BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF041L16

Length=639
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009777271.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    239   1e-72   Nicotiana sylvestris
ref|XP_006366999.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    238   3e-72   Solanum tuberosum [potatoes]
ref|XP_009610543.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    236   2e-71   Nicotiana tomentosiformis
ref|XP_011089044.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    236   2e-71   Sesamum indicum [beniseed]
ref|XP_004247041.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    236   2e-71   Solanum lycopersicum
ref|XP_008244679.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    228   3e-68   Prunus mume [ume]
gb|EYU39188.1|  hypothetical protein MIMGU_mgv1a006049mg                225   2e-67   Erythranthe guttata [common monkey flower]
emb|CDP03931.1|  unnamed protein product                                224   3e-67   Coffea canephora [robusta coffee]
gb|EPS58986.1|  hypothetical protein M569_15824                         221   5e-66   Genlisea aurea
ref|XP_008382581.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    221   6e-66   
ref|XP_008356234.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    222   1e-65   
ref|XP_009372203.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    219   4e-65   Pyrus x bretschneideri [bai li]
ref|XP_004144397.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    218   1e-64   Cucumis sativus [cucumbers]
gb|KDO46598.1|  hypothetical protein CISIN_1g038099mg                   212   1e-64   Citrus sinensis [apfelsine]
ref|XP_006386885.1|  3-glucanase family protein                         218   2e-64   Populus trichocarpa [western balsam poplar]
ref|XP_011024595.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    216   5e-64   Populus euphratica
ref|XP_004290162.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    216   5e-64   Fragaria vesca subsp. vesca
ref|XP_010100789.1|  putative glucan endo-1,3-beta-glucosidase A6       215   3e-63   Morus notabilis
ref|XP_007049651.1|  O-Glycosyl hydrolases family 17 protein isof...    214   3e-63   
ref|XP_010036769.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    214   5e-63   Eucalyptus grandis [rose gum]
ref|XP_003626949.1|  Beta-1 3-glucanase                                 213   9e-63   Medicago truncatula
ref|XP_011024596.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    211   8e-62   Populus euphratica
gb|KHG25787.1|  putative glucan endo-1,3-beta-glucosidase A6 -lik...    210   2e-61   Gossypium arboreum [tree cotton]
ref|XP_008460404.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    210   2e-61   Cucumis melo [Oriental melon]
gb|KJB10879.1|  hypothetical protein B456_001G230200                    209   4e-61   Gossypium raimondii
ref|XP_002303070.2|  3-glucanase family protein                         209   5e-61   
gb|KJB10878.1|  hypothetical protein B456_001G230200                    209   5e-61   Gossypium raimondii
ref|XP_004492271.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    208   6e-61   Cicer arietinum [garbanzo]
gb|KEH22559.1|  glucan endo-1,3-beta-glucosidase-like protein           207   1e-60   Medicago truncatula
dbj|BAA89481.1|  beta-1,3-glucanase                                     207   3e-60   Salix gilgiana
gb|KDP45279.1|  hypothetical protein JCGZ_15144                         207   3e-60   Jatropha curcas
ref|XP_003632052.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    204   3e-59   Vitis vinifera
gb|KFK38190.1|  hypothetical protein AALP_AA3G081000                    204   5e-59   Arabis alpina [alpine rockcress]
gb|KHN10950.1|  Putative glucan endo-1,3-beta-glucosidase A6            201   7e-59   Glycine soja [wild soybean]
ref|XP_002884642.1|  glycosyl hydrolase family 17 protein               203   8e-59   Arabidopsis lyrata subsp. lyrata
ref|XP_004510238.1|  PREDICTED: putative copper-transporting ATPa...    209   2e-58   
emb|CDY28063.1|  BnaC05g44650D                                          201   3e-58   Brassica napus [oilseed rape]
emb|CDY45466.1|  BnaC09g12840D                                          201   3e-58   Brassica napus [oilseed rape]
ref|XP_006407848.1|  hypothetical protein EUTSA_v10020660mg             201   7e-58   Eutrema salsugineum [saltwater cress]
ref|XP_006407849.1|  hypothetical protein EUTSA_v10020660mg             201   8e-58   
ref|XP_003530849.2|  PREDICTED: probable glucan endo-1,3-beta-glu...    200   9e-58   Glycine max [soybeans]
emb|CDY24629.1|  BnaA05g30280D                                          200   1e-57   Brassica napus [oilseed rape]
ref|XP_006297636.1|  hypothetical protein CARUB_v10013655mg             200   1e-57   Capsella rubella
ref|XP_009147086.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    201   1e-57   Brassica rapa
ref|XP_010486278.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    199   2e-57   Camelina sativa [gold-of-pleasure]
gb|AAF20214.1|AC012395_1  putative beta-1,3-glucanase precursor         198   4e-57   Arabidopsis thaliana [mouse-ear cress]
ref|NP_683538.1|  O-Glycosyl hydrolases family 17 protein               198   4e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010247391.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    198   8e-57   Nelumbo nucifera [Indian lotus]
ref|XP_006484802.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    197   1e-56   Citrus sinensis [apfelsine]
ref|XP_006437250.1|  hypothetical protein CICLE_v10031440mg             197   1e-56   Citrus clementina [clementine]
ref|XP_010464351.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    197   2e-56   Camelina sativa [gold-of-pleasure]
gb|KJB84083.1|  hypothetical protein B456_N004800                       197   2e-56   Gossypium raimondii
gb|AAM65039.1|  putative glucan endo-1-3-beta-glucosidase               196   4e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010451138.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    196   5e-56   Camelina sativa [gold-of-pleasure]
emb|CDO96794.1|  unnamed protein product                                195   7e-56   Coffea canephora [robusta coffee]
gb|KHG02504.1|  putative glucan endo-1,3-beta-glucosidase A6 -lik...    195   9e-56   Gossypium arboreum [tree cotton]
ref|XP_007140788.1|  hypothetical protein PHAVU_008G142200g             194   2e-55   Phaseolus vulgaris [French bean]
gb|ADE76604.1|  unknown                                                 192   7e-55   Picea sitchensis
ref|XP_010547131.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    191   2e-54   Tarenaya hassleriana [spider flower]
ref|XP_003552101.2|  PREDICTED: probable glucan endo-1,3-beta-glu...    191   2e-54   Glycine max [soybeans]
ref|XP_010552026.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    191   2e-54   Tarenaya hassleriana [spider flower]
ref|XP_010246533.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    191   5e-54   Nelumbo nucifera [Indian lotus]
ref|XP_010685101.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    190   5e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003541516.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    188   8e-54   Glycine max [soybeans]
ref|XP_006830555.1|  hypothetical protein AMTR_s00117p00104410          189   3e-53   
ref|XP_004505110.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    186   2e-52   
ref|XP_004298215.2|  PREDICTED: probable glucan endo-1,3-beta-glu...    184   2e-52   Fragaria vesca subsp. vesca
gb|KHN47213.1|  Putative glucan endo-1,3-beta-glucosidase A6            182   8e-52   Glycine soja [wild soybean]
gb|KEH30957.1|  glucan endo-1,3-beta-glucosidase-like protein           184   2e-51   Medicago truncatula
emb|CAN60692.1|  hypothetical protein VITISV_007558                     182   2e-51   Vitis vinifera
ref|XP_007199923.1|  hypothetical protein PRUPE_ppa006984mg             181   3e-51   
ref|XP_003632055.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    183   4e-51   Vitis vinifera
ref|XP_007153895.1|  hypothetical protein PHAVU_003G073900g             179   8e-51   Phaseolus vulgaris [French bean]
ref|XP_006299757.1|  hypothetical protein CARUB_v10015952mg             180   4e-50   Capsella rubella
ref|XP_010488453.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    179   8e-50   Camelina sativa [gold-of-pleasure]
ref|XP_002520622.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    179   8e-50   
ref|XP_006830552.1|  hypothetical protein AMTR_s00117p00097230          179   8e-50   
ref|XP_010466734.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    179   1e-49   Camelina sativa [gold-of-pleasure]
emb|CDY08004.1|  BnaC03g35190D                                          179   1e-49   Brassica napus [oilseed rape]
emb|CDX74052.1|  BnaA03g29950D                                          180   2e-49   
ref|XP_009373620.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    178   2e-49   
ref|XP_009134961.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    177   3e-49   Brassica rapa
ref|XP_007221306.1|  hypothetical protein PRUPE_ppa016789mg             177   4e-49   
ref|XP_010023613.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    176   6e-49   
ref|XP_006418839.1|  hypothetical protein EUTSA_v10002513mg             177   7e-49   Eutrema salsugineum [saltwater cress]
ref|XP_009411847.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    176   9e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008222761.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    176   1e-48   
ref|XP_009411846.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    176   1e-48   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP15106.1|  unnamed protein product                                176   1e-48   Coffea canephora [robusta coffee]
ref|XP_010512882.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    176   1e-48   Camelina sativa [gold-of-pleasure]
gb|AEN82021.1|  AT3G23770-like protein                                  167   1e-48   Capsella rubella
ref|XP_002444717.1|  hypothetical protein SORBIDRAFT_07g026540          176   2e-48   Sorghum bicolor [broomcorn]
ref|XP_002883459.1|  hypothetical protein ARALYDRAFT_479892             176   3e-48   
gb|AEN82027.1|  AT3G23770-like protein                                  167   3e-48   Capsella rubella
ref|XP_008380636.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    174   5e-48   
gb|KJB10880.1|  hypothetical protein B456_001G230200                    173   5e-48   Gossypium raimondii
gb|KFK39673.1|  a6 anther-specific protein                              174   5e-48   Arabis alpina [alpine rockcress]
ref|XP_009385472.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    174   6e-48   
ref|XP_002534357.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    172   7e-48   Ricinus communis
ref|NP_189019.1|  O-glycosyl hydrolases family 17 protein               174   7e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009102583.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    174   7e-48   Brassica rapa
gb|ABK28569.1|  unknown                                                 174   7e-48   Arabidopsis thaliana [mouse-ear cress]
emb|CDY59775.1|  BnaCnng35540D                                          174   8e-48   Brassica napus [oilseed rape]
ref|XP_006421038.1|  hypothetical protein CICLE_v10004917mg             174   8e-48   
ref|XP_010532729.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    174   8e-48   Tarenaya hassleriana [spider flower]
emb|CDY63754.1|  BnaAnng19080D                                          174   1e-47   Brassica napus [oilseed rape]
ref|XP_006349905.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    174   1e-47   Solanum tuberosum [potatoes]
ref|XP_008792940.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    173   1e-47   
ref|XP_008792939.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    173   1e-47   Phoenix dactylifera
ref|XP_010314851.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    173   1e-47   
gb|AEN82023.1|  AT3G23770-like protein                                  165   1e-47   Capsella rubella
ref|XP_009135862.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    173   2e-47   Brassica rapa
gb|KDO47456.1|  hypothetical protein CISIN_1g012660mg                   172   3e-47   Citrus sinensis [apfelsine]
gb|ADG38498.1|  AT3G23770-like protein                                  164   3e-47   Capsella grandiflora
gb|ADG38497.1|  AT3G23770-like protein                                  164   3e-47   Capsella grandiflora
gb|AAM64490.1|  beta-1,3-glucanase, putative                            172   4e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009625839.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    171   7e-47   Nicotiana tomentosiformis
gb|AEN82025.1|  AT3G23770-like protein                                  163   8e-47   Capsella rubella
ref|XP_009625838.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    171   1e-46   Nicotiana tomentosiformis
emb|CDY53213.1|  BnaC03g74070D                                          171   1e-46   Brassica napus [oilseed rape]
gb|ADG38499.1|  AT3G23770-like protein                                  163   1e-46   Capsella grandiflora
gb|ADG38503.1|  AT3G23770-like protein                                  163   1e-46   Neslia paniculata [ball mustard]
ref|XP_009777293.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    169   4e-46   Nicotiana sylvestris
ref|XP_010264204.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    167   4e-46   Nelumbo nucifera [Indian lotus]
gb|ADG38502.1|  AT3G23770-like protein                                  161   5e-46   Capsella grandiflora
emb|CDY50110.1|  BnaC01g43580D                                          168   1e-45   Brassica napus [oilseed rape]
gb|KEH22560.1|  glucan endo-1,3-beta-glucosidase-like protein           166   1e-45   Medicago truncatula
ref|XP_006373100.1|  hypothetical protein POPTR_0017s08720g             168   1e-45   Populus trichocarpa [western balsam poplar]
ref|XP_009106344.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    168   1e-45   Brassica rapa
ref|XP_011045808.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    168   1e-45   Populus euphratica
ref|NP_193144.1|  putative glucan endo-1,3-beta-glucosidase A6          168   1e-45   Arabidopsis thaliana [mouse-ear cress]
emb|CDY18092.1|  BnaA01g23530D                                          167   3e-45   Brassica napus [oilseed rape]
ref|XP_002462618.1|  hypothetical protein SORBIDRAFT_02g029080          167   4e-45   Sorghum bicolor [broomcorn]
ref|XP_002868315.1|  hypothetical protein ARALYDRAFT_493503             166   6e-45   
ref|XP_002298669.2|  glucan endo-1 family protein                       165   7e-45   
gb|KJB28087.1|  hypothetical protein B456_005G026800                    166   7e-45   Gossypium raimondii
gb|EYU31523.1|  hypothetical protein MIMGU_mgv1a005774mg                165   8e-45   Erythranthe guttata [common monkey flower]
gb|KDP32593.1|  hypothetical protein JCGZ_13143                         166   8e-45   Jatropha curcas
gb|EYU31522.1|  hypothetical protein MIMGU_mgv1a005774mg                166   1e-44   Erythranthe guttata [common monkey flower]
ref|XP_009383834.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    166   1e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009383833.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    166   1e-44   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH18116.1|  O-glycosyl hydrolase family 17 protein                  164   1e-44   Medicago truncatula
ref|XP_008439043.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    165   2e-44   Cucumis melo [Oriental melon]
ref|XP_011101604.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    164   5e-44   
ref|XP_011010072.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    164   6e-44   Populus euphratica
gb|KFK36299.1|  hypothetical protein AALP_AA4G104300                    164   7e-44   Arabis alpina [alpine rockcress]
ref|XP_002971665.1|  hypothetical protein SELMODRAFT_231791             163   9e-44   
ref|XP_006282877.1|  hypothetical protein CARUB_v10006945mg             163   1e-43   Capsella rubella
ref|XP_010450129.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    162   1e-43   
ref|XP_002976500.1|  hypothetical protein SELMODRAFT_105435             162   2e-43   
ref|XP_010450110.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    162   2e-43   Camelina sativa [gold-of-pleasure]
ref|XP_004957267.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    162   2e-43   Setaria italica
dbj|BAJ88052.1|  predicted protein                                      162   2e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003572424.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    164   2e-43   Brachypodium distachyon [annual false brome]
ref|XP_007034194.1|  O-Glycosyl hydrolases family 17 protein            162   4e-43   
dbj|BAK04571.1|  predicted protein                                      162   5e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010435194.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    160   1e-42   Camelina sativa [gold-of-pleasure]
gb|EEC84834.1|  hypothetical protein OsI_31928                          160   1e-42   Oryza sativa Indica Group [Indian rice]
ref|NP_001149815.1|  glucan endo-1,3-beta-glucosidase A6 precursor      160   2e-42   Zea mays [maize]
gb|KCW48409.1|  hypothetical protein EUGRSUZ_K02112                     158   2e-42   Eucalyptus grandis [rose gum]
dbj|BAK05423.1|  predicted protein                                      159   3e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002965673.1|  hypothetical protein SELMODRAFT_85067              158   4e-42   
ref|XP_002973407.1|  hypothetical protein SELMODRAFT_413735             159   4e-42   
ref|NP_001063586.1|  Os09g0502200                                       159   5e-42   
ref|XP_004147671.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    157   1e-41   
gb|KGN57233.1|  hypothetical protein Csa_3G172380                       158   1e-41   Cucumis sativus [cucumbers]
ref|XP_006414816.1|  hypothetical protein EUTSA_v10025081mg             157   1e-41   Eutrema salsugineum [saltwater cress]
ref|XP_010527440.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    157   1e-41   Tarenaya hassleriana [spider flower]
dbj|BAG16366.1|  tapetum-specific protein A6 family protein             153   2e-40   Brassica rapa var. perviridis [kabuna]
emb|CBI39414.3|  unnamed protein product                                152   3e-40   Vitis vinifera
ref|XP_010238330.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    154   3e-40   Brachypodium distachyon [annual false brome]
ref|XP_009144683.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    153   4e-40   Brassica rapa
emb|CDY08310.1|  BnaA05g13090D                                          153   4e-40   Brassica napus [oilseed rape]
gb|ABR16205.1|  unknown                                                 152   1e-39   Picea sitchensis
emb|CDY12371.1|  BnaC08g08340D                                          152   1e-39   Brassica napus [oilseed rape]
ref|XP_009108090.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    152   2e-39   Brassica rapa
emb|CDY27122.1|  BnaA08g07600D                                          152   2e-39   Brassica napus [oilseed rape]
ref|NP_001062294.2|  Os08g0525800                                       151   3e-39   
dbj|BAC75423.1|  putative beta-1,3-glucanase                            150   4e-39   Oryza sativa Japonica Group [Japonica rice]
dbj|BAG16359.1|  tapetum-specific protein A6 family protein             149   7e-39   Brassica oleracea var. italica [asparagus broccoli]
emb|CAB71021.1|  putative beta-1,3-glucanase                            148   8e-39   Hieracium piloselloides
emb|CAA49513.1|  beta-1,3-glucanase homologue                           149   1e-38   Brassica napus [oilseed rape]
ref|NP_001051879.1|  Os03g0845600                                       149   1e-38   
emb|CDY06469.1|  BnaC06g11750D                                          149   1e-38   
emb|CDY01191.1|  BnaA04g06280D                                          148   4e-38   
ref|XP_009139564.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    148   4e-38   Brassica rapa
emb|CDY12732.1|  BnaC04g29090D                                          146   1e-37   Brassica napus [oilseed rape]
gb|EEC76519.1|  hypothetical protein OsI_14305                          146   2e-37   Oryza sativa Indica Group [Indian rice]
ref|XP_010673323.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    145   3e-37   Beta vulgaris subsp. vulgaris [field beet]
gb|EAZ07710.1|  hypothetical protein OsI_29967                          149   3e-37   Oryza sativa Indica Group [Indian rice]
ref|XP_002964439.1|  hypothetical protein SELMODRAFT_230318             143   3e-37   
ref|XP_002975355.1|  hypothetical protein SELMODRAFT_103308             141   1e-36   Selaginella moellendorffii
ref|XP_008643986.1|  PREDICTED: uncharacterized protein LOC100382...    143   2e-36   Zea mays [maize]
ref|XP_002980798.1|  hypothetical protein SELMODRAFT_444643             143   2e-36   Selaginella moellendorffii
ref|XP_002972033.1|  hypothetical protein SELMODRAFT_96745              142   3e-36   
ref|XP_008364550.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 14     142   5e-36   
ref|XP_006661404.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    142   5e-36   
ref|XP_009348307.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    142   6e-36   Pyrus x bretschneideri [bai li]
ref|XP_009334153.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    141   7e-36   Pyrus x bretschneideri [bai li]
ref|XP_003581305.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    141   9e-36   Brachypodium distachyon [annual false brome]
ref|XP_006492526.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    140   9e-36   
ref|XP_004973968.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    140   9e-36   Setaria italica
ref|XP_007020717.1|  O-Glycosyl hydrolases family 17 protein            141   1e-35   
gb|ADG38397.1|  AT3G07320-like protein                                  135   1e-35   Capsella grandiflora
ref|XP_009361042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    141   1e-35   Pyrus x bretschneideri [bai li]
gb|ADG38393.1|  AT3G07320-like protein                                  135   1e-35   Capsella grandiflora
ref|XP_002972579.1|  hypothetical protein SELMODRAFT_97838              140   1e-35   
gb|ADG38398.1|  AT3G07320-like protein                                  135   1e-35   Capsella grandiflora
gb|EYU33669.1|  hypothetical protein MIMGU_mgv1a005896mg                140   1e-35   Erythranthe guttata [common monkey flower]
ref|XP_002961854.1|  hypothetical protein SELMODRAFT_437767             140   2e-35   Selaginella moellendorffii
ref|XP_008792941.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    139   2e-35   
ref|XP_002316783.2|  glycosyl hydrolase family 17 family protein        140   3e-35   Populus trichocarpa [western balsam poplar]
ref|XP_011044921.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   3e-35   Populus euphratica
ref|XP_008385844.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    138   1e-34   
gb|ADG38399.1|  AT3G07320-like protein                                  133   1e-34   Neslia paniculata [ball mustard]
ref|XP_010433433.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    138   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_002274828.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     137   2e-34   Vitis vinifera
ref|XP_010026682.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    135   2e-34   
gb|ADG38396.1|  AT3G07320-like protein                                  132   2e-34   Capsella grandiflora
ref|XP_002463526.1|  hypothetical protein SORBIDRAFT_01g001430          137   2e-34   Sorghum bicolor [broomcorn]
gb|KDP39185.1|  hypothetical protein JCGZ_00942                         137   3e-34   Jatropha curcas
ref|XP_010539314.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     137   3e-34   Tarenaya hassleriana [spider flower]
ref|XP_010448205.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    137   3e-34   
ref|XP_009771279.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    137   4e-34   Nicotiana sylvestris
gb|AEN81798.1|  AT3G07320-like protein                                  132   4e-34   Capsella rubella
gb|KDP30806.1|  hypothetical protein JCGZ_13749                         136   5e-34   Jatropha curcas
gb|KDO62116.1|  hypothetical protein CISIN_1g0115512mg                  136   5e-34   Citrus sinensis [apfelsine]
gb|KDO62115.1|  hypothetical protein CISIN_1g0115512mg                  136   5e-34   Citrus sinensis [apfelsine]
ref|XP_008230022.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     135   5e-34   
gb|AEN81800.1|  AT3G07320-like protein                                  131   6e-34   Capsella rubella
gb|KDO62114.1|  hypothetical protein CISIN_1g0115512mg                  136   6e-34   Citrus sinensis [apfelsine]
ref|XP_006452449.1|  hypothetical protein CICLE_v10008176mg             135   1e-33   Citrus clementina [clementine]
ref|XP_006475009.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   1e-33   Citrus sinensis [apfelsine]
ref|XP_003519593.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   1e-33   
ref|XP_006283767.1|  hypothetical protein CARUB_v10004853mg             135   2e-33   
gb|EEC82195.1|  hypothetical protein OsI_26335                          135   2e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_002278044.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     135   2e-33   Vitis vinifera
gb|KHN44765.1|  Glucan endo-1,3-beta-glucosidase 11                     134   2e-33   Glycine soja [wild soybean]
ref|XP_007215327.1|  hypothetical protein PRUPE_ppa005206mg             134   2e-33   
ref|XP_009628415.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     134   3e-33   Nicotiana tomentosiformis
emb|CDP14397.1|  unnamed protein product                                134   3e-33   Coffea canephora [robusta coffee]
ref|XP_010110627.1|  Glucan endo-1,3-beta-glucosidase 13                134   3e-33   
ref|XP_006344866.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    134   3e-33   Solanum tuberosum [potatoes]
ref|XP_006344865.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    134   4e-33   Solanum tuberosum [potatoes]
gb|KHG04965.1|  hypothetical protein F383_30444                         134   4e-33   Gossypium arboreum [tree cotton]
tpg|DAA63006.1|  TPA: putative O-glycosyl hydrolase family 17 pro...    135   5e-33   
gb|ADU15553.1|  GLU                                                     134   5e-33   Gossypium hirsutum [American cotton]
ref|XP_008653189.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   5e-33   Zea mays [maize]
gb|AFU52656.1|  beta-1,3-glucanase 23                                   133   5e-33   Solanum tuberosum [potatoes]
gb|KEH41871.1|  O-glycosyl hydrolase family 17 protein                  134   6e-33   Medicago truncatula
ref|XP_010545233.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     133   6e-33   Tarenaya hassleriana [spider flower]
ref|XP_007049174.1|  O-Glycosyl hydrolases family 17 protein isof...    134   6e-33   
ref|XP_006575581.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    133   6e-33   Glycine max [soybeans]
emb|CDP13790.1|  unnamed protein product                                134   6e-33   Coffea canephora [robusta coffee]
tpg|DAA63007.1|  TPA: putative O-glycosyl hydrolase family 17 pro...    135   7e-33   
gb|KFK29190.1|  hypothetical protein AALP_AA7G101400                    133   7e-33   Arabis alpina [alpine rockcress]
ref|XP_006595830.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    133   7e-33   Glycine max [soybeans]
ref|NP_001059878.1|  Os07g0538000                                       134   7e-33   
gb|KJB62900.1|  hypothetical protein B456_009G442700                    133   7e-33   Gossypium raimondii
ref|XP_003544773.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    133   8e-33   Glycine max [soybeans]
gb|KHN23902.1|  Glucan endo-1,3-beta-glucosidase 12                     133   8e-33   Glycine soja [wild soybean]
ref|XP_007049173.1|  O-Glycosyl hydrolases family 17 protein isof...    134   8e-33   
ref|XP_004140120.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    133   9e-33   
ref|XP_004140121.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    133   1e-32   Cucumis sativus [cucumbers]
ref|XP_010438690.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   1e-32   Camelina sativa [gold-of-pleasure]
ref|XP_004497650.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   1e-32   Cicer arietinum [garbanzo]
ref|XP_010467085.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   1e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010488778.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   1e-32   Camelina sativa [gold-of-pleasure]
ref|XP_011009684.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   1e-32   Populus euphratica
ref|XP_004294409.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   1e-32   Fragaria vesca subsp. vesca
ref|XP_004251911.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   1e-32   Solanum lycopersicum
gb|EPS73917.1|  hypothetical protein M569_00835                         132   1e-32   Genlisea aurea
ref|XP_006386788.1|  hypothetical protein POPTR_0002s21700g             132   2e-32   
ref|XP_006413135.1|  hypothetical protein EUTSA_v10026799mg             132   2e-32   Eutrema salsugineum [saltwater cress]
ref|XP_002302861.2|  glycosyl hydrolase family 17 family protein        132   2e-32   
ref|XP_008449478.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     132   2e-32   Cucumis melo [Oriental melon]
gb|EMS66645.1|  Glucan endo-1,3-beta-glucosidase 3                      133   2e-32   Triticum urartu
ref|XP_001759996.1|  predicted protein                                  130   2e-32   
dbj|BAC53928.1|  beta-1,3-glucanase-like protein                        130   2e-32   Nicotiana tabacum [American tobacco]
ref|XP_010412737.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   2e-32   
ref|XP_002462967.1|  hypothetical protein SORBIDRAFT_02g035480          132   2e-32   
ref|XP_010063042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    131   2e-32   
ref|XP_010557676.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     132   3e-32   
dbj|BAF01341.1|  putative beta-1,3-glucanase                            129   3e-32   
emb|CDX92794.1|  BnaC07g40520D                                          131   4e-32   
ref|XP_009794437.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    131   4e-32   
ref|XP_008226995.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    131   4e-32   
ref|XP_001779924.1|  predicted protein                                  130   5e-32   
gb|EMT12040.1|  Glucan endo-1,3-beta-glucosidase 13                     131   6e-32   
emb|CDY20780.1|  BnaA02g09200D                                          130   6e-32   
ref|XP_002462970.1|  hypothetical protein SORBIDRAFT_02g035520          132   6e-32   
emb|CDY06601.1|  BnaC02g13250D                                          130   7e-32   
ref|XP_009127019.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    130   7e-32   
ref|XP_001781801.1|  predicted protein                                  130   8e-32   
ref|XP_009127020.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    130   8e-32   
emb|CDP05678.1|  unnamed protein product                                130   1e-31   
gb|KCW70221.1|  hypothetical protein EUGRSUZ_F03494                     128   1e-31   
ref|XP_006396136.1|  hypothetical protein EUTSA_v10002515mg             129   1e-31   
gb|KHG05496.1|  hypothetical protein F383_30989                         129   1e-31   
ref|XP_010913393.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    129   2e-31   
ref|XP_004243515.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     129   2e-31   
ref|XP_006357966.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    129   2e-31   
dbj|BAB17320.1|  elicitor inducible beta-1,3-glucanase NtEIG-E76        129   2e-31   
ref|XP_008449141.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     129   2e-31   
ref|XP_009595038.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    129   2e-31   
ref|XP_007141644.1|  hypothetical protein PHAVU_008G213400g             129   3e-31   
gb|EPS59841.1|  hypothetical protein M569_14964                         129   3e-31   
ref|XP_002320484.1|  glycosyl hydrolase family 17 family protein        129   3e-31   
gb|KJB37880.1|  hypothetical protein B456_006G224700                    129   3e-31   
ref|XP_001777261.1|  predicted protein                                  128   3e-31   
gb|KJB10702.1|  hypothetical protein B456_001G216900                    129   3e-31   
ref|XP_006357965.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    129   3e-31   
ref|XP_002967643.1|  hypothetical protein SELMODRAFT_88150              127   3e-31   
gb|KJB10701.1|  hypothetical protein B456_001G216900                    128   3e-31   
ref|XP_004491103.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    128   4e-31   
ref|XP_004968988.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    130   4e-31   
ref|XP_010252551.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    128   4e-31   
tpg|DAA62996.1|  TPA: putative O-glycosyl hydrolase family 17 pro...    129   5e-31   
ref|XP_004491104.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    128   5e-31   
gb|AAD26909.1|  putative beta-1,3-glucanase                             128   5e-31   
ref|XP_004304086.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     128   5e-31   
ref|XP_002964390.1|  hypothetical protein SELMODRAFT_82448              127   5e-31   
ref|XP_006401482.1|  hypothetical protein EUTSA_v10013478mg             128   5e-31   
ref|NP_178637.2|  O-glycosyl hydrolases family 17 protein               128   6e-31   
ref|NP_001275111.1|  glucan endo-1,3-beta-glucosidase 12-like pre...    128   6e-31   
ref|XP_007212383.1|  hypothetical protein PRUPE_ppa005210mg             127   6e-31   
ref|XP_002883709.1|  hypothetical protein ARALYDRAFT_480193             127   6e-31   
ref|XP_001784285.1|  predicted protein                                  127   6e-31   
ref|XP_007142328.1|  hypothetical protein PHAVU_008G271000g             127   7e-31   
ref|XP_009365112.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    127   8e-31   
gb|AAZ40342.1|  beta-1,3-glucanase 2                                    127   9e-31   
ref|XP_006647977.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    127   9e-31   
ref|XP_010449211.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    127   9e-31   
ref|XP_009365111.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    127   9e-31   
ref|NP_001151472.1|  hydrolase, hydrolyzing O-glycosyl compounds ...    128   1e-30   
ref|XP_001775379.1|  predicted protein                                  126   1e-30   
ref|XP_006280442.1|  hypothetical protein CARUB_v10026374mg             127   1e-30   
emb|CDY46679.1|  BnaA03g48290D                                          127   1e-30   
emb|CDY19908.1|  BnaC09g31740D                                          127   1e-30   
ref|XP_001780045.1|  predicted protein                                  127   1e-30   
ref|XP_002529472.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    127   1e-30   
emb|CDY17308.1|  BnaA10g09420D                                          126   1e-30   
ref|XP_006297583.1|  hypothetical protein CARUB_v10013604mg             126   2e-30   
ref|XP_002864380.1|  glycosyl hydrolase family 17 protein               126   2e-30   
ref|XP_009414127.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    126   2e-30   
ref|XP_007204831.1|  hypothetical protein PRUPE_ppa1027206mg            126   2e-30   
ref|XP_002454630.1|  hypothetical protein SORBIDRAFT_04g034530          126   2e-30   
ref|XP_004167482.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    126   2e-30   
dbj|BAJ90025.1|  predicted protein                                      129   3e-30   
ref|XP_010482941.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    125   3e-30   
ref|NP_001154780.1|  O-Glycosyl hydrolases family 17 protein            125   3e-30   
ref|XP_004147695.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    125   3e-30   
ref|XP_009137621.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     125   3e-30   
ref|NP_568822.1|  O-Glycosyl hydrolases family 17 protein               125   3e-30   
ref|XP_009102359.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     125   3e-30   
emb|CDY56498.1|  BnaAnng14330D                                          125   3e-30   
dbj|BAB08587.1|  beta-1,3-glucanase-like protein                        125   3e-30   
ref|XP_002525335.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    125   3e-30   
gb|AAD10386.1|  beta-1,3-glucanase precursor                            125   3e-30   
ref|XP_002867539.1|  hydrolase, hydrolyzing O-glycosyl compounds        125   4e-30   
ref|XP_011097840.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     125   4e-30   
ref|XP_004149346.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    125   4e-30   
emb|CDY18049.1|  BnaC07g04210D                                          125   4e-30   
ref|XP_010689521.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     125   4e-30   
ref|NP_001136613.1|  uncharacterized protein LOC100216736 precursor     125   4e-30   
ref|XP_010270042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     125   4e-30   
tpg|DAA41054.1|  TPA: putative O-glycosyl hydrolase family 17 pro...    122   4e-30   
gb|ACF88240.1|  unknown                                                 125   4e-30   
ref|NP_001048260.1|  Os02g0771700                                       125   5e-30   
ref|XP_011085458.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      125   6e-30   
ref|XP_008379673.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    125   7e-30   
ref|XP_010443128.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    124   7e-30   
gb|AAL77689.1|  AT5g55180/MCO15_13                                      124   8e-30   
gb|KDO36784.1|  hypothetical protein CISIN_1g009301mg                   125   9e-30   
ref|XP_003616906.1|  Glucan endo-1,3-beta-glucosidase                   124   1e-29   
gb|KFK27118.1|  hypothetical protein AALP_AA8G337200                    124   1e-29   
ref|XP_010236896.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    124   1e-29   
dbj|BAE80092.1|  glycosyl hydrolase family 17                           124   1e-29   
gb|AAM66024.1|  beta-1,3-glucanase-like protein                         124   1e-29   
ref|XP_011047200.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     124   1e-29   
ref|XP_006447645.1|  hypothetical protein CICLE_v10015086mg             124   1e-29   
ref|XP_001764817.1|  predicted protein                                  122   2e-29   
gb|KHG21190.1|  hypothetical protein F383_01641                         124   2e-29   
ref|XP_008242470.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    124   2e-29   
ref|XP_004498531.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    122   2e-29   
ref|XP_004161885.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    123   2e-29   
gb|KHG21189.1|  hypothetical protein F383_01641                         123   2e-29   
ref|XP_006469612.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    124   2e-29   
dbj|BAJ87688.1|  predicted protein                                      123   2e-29   
dbj|BAJ92436.1|  predicted protein                                      123   2e-29   
ref|XP_009132400.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    123   2e-29   
ref|XP_009132399.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    123   2e-29   
gb|ACF79018.1|  unknown                                                 123   2e-29   
ref|XP_002971087.1|  hypothetical protein SELMODRAFT_95153              121   2e-29   
ref|XP_008242469.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    123   2e-29   
ref|XP_009120040.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    123   2e-29   
ref|XP_008670470.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    124   3e-29   
gb|EAZ04201.1|  hypothetical protein OsI_26344                          124   3e-29   
ref|XP_001775863.1|  predicted protein                                  122   3e-29   
gb|KJB13749.1|  hypothetical protein B456_002G092600                    123   3e-29   
ref|XP_002961999.1|  hypothetical protein SELMODRAFT_76182              120   3e-29   
gb|AAC04713.1|  beta-1,3-glucanase 7                                    120   3e-29   
ref|XP_004968973.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    123   3e-29   
gb|ADT64455.1|  beta-1,3-glucosidase                                    120   4e-29   
gb|EPS68573.1|  hypothetical protein M569_06194                         122   4e-29   
gb|EPS69142.1|  hypothetical protein M569_05624                         121   4e-29   
gb|ACR35980.1|  unknown                                                 122   4e-29   
gb|EYU27371.1|  hypothetical protein MIMGU_mgv1a005776mg                122   4e-29   
gb|EMT25818.1|  Glucan endo-1,3-beta-glucosidase 12                     123   4e-29   
ref|XP_003562973.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    123   5e-29   
ref|NP_001059886.2|  Os07g0539400                                       123   5e-29   
dbj|BAC84505.1|  putative beta-1,3-glucanase                            123   5e-29   
dbj|BAJ93567.1|  predicted protein                                      123   5e-29   
ref|XP_004968994.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    122   5e-29   
ref|XP_004968993.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    122   6e-29   
emb|CDY36734.1|  BnaA03g11520D                                          122   7e-29   
ref|XP_007160277.1|  hypothetical protein PHAVU_002G307800g             122   8e-29   
gb|AGV54422.1|  glucan endo-1,3-beta-glucosidase 13-like protein        122   8e-29   
gb|ACN39797.1|  unknown                                                 121   9e-29   
ref|XP_008669802.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    121   1e-28   
emb|CAB36529.1|  putative beta-1, 3-glucanase                           121   1e-28   
ref|NP_194413.2|  O-Glycosyl hydrolases family 17 protein               121   1e-28   
gb|EYU43154.1|  hypothetical protein MIMGU_mgv1a005917mg                121   1e-28   
ref|XP_008653186.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    123   1e-28   
ref|XP_006855691.1|  hypothetical protein AMTR_s00044p00136160          118   1e-28   
ref|XP_001752959.1|  predicted protein                                  120   1e-28   
ref|XP_011091523.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    121   1e-28   
ref|XP_004954064.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    121   1e-28   
ref|XP_004954063.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    121   2e-28   
ref|XP_008788767.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    121   2e-28   
ref|XP_004957929.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    120   2e-28   
gb|KHM99816.1|  Glucan endo-1,3-beta-glucosidase 13                     120   2e-28   
ref|XP_004954062.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    120   2e-28   
emb|CDY12009.1|  BnaC03g14350D                                          120   2e-28   
ref|XP_006580483.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     120   2e-28   
gb|EPS64814.1|  hypothetical protein M569_09966                         119   3e-28   
emb|CDP00093.1|  unnamed protein product                                120   3e-28   
ref|XP_001757144.1|  predicted protein                                  119   3e-28   
gb|EMS51674.1|  Glucan endo-1,3-beta-glucosidase 13                     120   4e-28   
ref|XP_004968992.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    120   5e-28   
gb|KHN16652.1|  Glucan endo-1,3-beta-glucosidase 13                     119   5e-28   
ref|XP_006584807.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    119   5e-28   
ref|XP_008653187.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    120   6e-28   
ref|XP_002987317.1|  hypothetical protein SELMODRAFT_125909             117   8e-28   
ref|XP_006853717.1|  hypothetical protein AMTR_s00056p00158530          119   8e-28   
ref|XP_001762206.1|  predicted protein                                  117   1e-27   
ref|XP_010675772.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    118   1e-27   
ref|XP_001780679.1|  predicted protein                                  117   1e-27   
gb|EPS68882.1|  hypothetical protein M569_05882                         117   1e-27   
ref|XP_010252096.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     118   1e-27   
ref|XP_008805608.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    118   1e-27   
ref|XP_004251202.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    117   1e-27   
gb|AES71661.2|  glycoside hydrolase family 17 protein                   117   1e-27   
ref|XP_007134154.1|  hypothetical protein PHAVU_010G0238000g            112   1e-27   
gb|EMT31770.1|  Glucan endo-1,3-beta-glucosidase 13                     119   2e-27   
ref|XP_009595793.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    117   2e-27   
gb|EMT01043.1|  Glucan endo-1,3-beta-glucosidase 13                     119   2e-27   
gb|KHN16491.1|  Glucan endo-1,3-beta-glucosidase                        117   2e-27   
ref|XP_010915632.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    117   2e-27   
ref|XP_002976327.1|  hypothetical protein SELMODRAFT_105037             116   3e-27   
ref|XP_010249473.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     117   3e-27   
ref|XP_003601410.1|  Glucan endo-1,3-beta-glucosidase                   117   3e-27   
ref|XP_004502047.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    116   4e-27   
ref|XP_009405069.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    117   4e-27   
gb|AIR93910.1|  glucanase                                               117   4e-27   
gb|EMS62685.1|  Glucan endo-1,3-beta-glucosidase 13                     118   4e-27   
ref|XP_010541008.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     117   4e-27   
ref|XP_009347789.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    115   4e-27   
ref|XP_010925705.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    116   4e-27   
gb|AHL24654.1|  Fra e 9.01 allergen                                     116   5e-27   
ref|XP_010109237.1|  Glucan endo-1,3-beta-glucosidase                   116   5e-27   
ref|XP_006837267.1|  hypothetical protein AMTR_s00112p00108890          116   5e-27   
ref|XP_008374135.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    116   5e-27   
gb|AFS50099.1|  glucan endo-1,3-beta-glucosidase                        116   6e-27   
ref|XP_010538537.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    116   6e-27   
gb|EPS63364.1|  glycoside hydrolase                                     116   6e-27   
ref|XP_008352157.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    116   6e-27   
ref|XP_010925707.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    115   6e-27   
ref|XP_009347788.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    114   6e-27   
ref|XP_010928243.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    116   6e-27   
ref|XP_002530863.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    116   7e-27   
ref|XP_010538536.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    115   7e-27   
ref|XP_010662898.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        116   7e-27   
ref|NP_001059883.1|  Os07g0539100                                       117   7e-27   
ref|XP_002864470.1|  glycosyl hydrolase family 17 protein               116   8e-27   
ref|XP_001766544.1|  predicted protein                                  115   8e-27   
ref|XP_007147908.1|  hypothetical protein PHAVU_006G165100g             115   9e-27   
ref|XP_009352572.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     116   9e-27   
ref|XP_010267530.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        115   9e-27   
ref|XP_009785958.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    115   1e-26   
ref|XP_002281025.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    115   1e-26   
emb|CAN72975.1|  hypothetical protein VITISV_019488                     115   1e-26   
ref|XP_009593199.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    115   1e-26   
emb|CBI16129.3|  unnamed protein product                                115   1e-26   
gb|KFK39880.1|  hypothetical protein AALP_AA3G300600                    115   1e-26   
ref|NP_001275363.1|  glucan endo-1,3-beta-glucosidase 13-like pre...    115   1e-26   
gb|EMS65653.1|  Glucan endo-1,3-beta-glucosidase 13                     115   1e-26   
ref|XP_006350772.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    115   1e-26   
ref|XP_006350517.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    115   1e-26   
ref|XP_010046172.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    115   1e-26   



>ref|XP_009777271.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nicotiana 
sylvestris]
Length=466

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            + LI+GLKA RVKIYDANP+IL+A   + +QVSVMVPNE+I NIS++Q LAD+WV+TNVV
Sbjct  47   VDLINGLKANRVKIYDANPEILKAFKGTKIQVSVMVPNELINNISTNQDLADQWVKTNVV  106

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  527
            PFY +T IRYLLVGNEILSNPPNTTWF LVPA+RKIR SVKKFGL KIKVGTPLA+DMLE
Sbjct  107  PFYPDTMIRYLLVGNEILSNPPNTTWFNLVPAIRKIRYSVKKFGLGKIKVGTPLAIDMLE  166

Query  528  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            +S+PPS+G FRSD++  V  PLL FL+RT SFFF DV
Sbjct  167  SSFPPSNGTFRSDISEKVMIPLLHFLNRTKSFFFIDV  203



>ref|XP_006366999.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Solanum tuberosum]
Length=464

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = +3

Query  162  HDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETN  341
            + + LI GLKAKRVKIYD NP+IL AL  + +QVSVMVPNE+I NIS++Q LAD+WV+ N
Sbjct  43   NSVDLIKGLKAKRVKIYDTNPQILEALKGTNLQVSVMVPNELINNISTNQTLADQWVKNN  102

Query  342  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  521
            VVPFY  T IRYLLVGNEILS+PPNTTWF LVPA+RKIR SVKKFGL KIK+GTPLA+DM
Sbjct  103  VVPFYPHTMIRYLLVGNEILSSPPNTTWFNLVPAIRKIRFSVKKFGLGKIKIGTPLAIDM  162

Query  522  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            LE+S+PPS+G FRSD++  V KPLL FL+RT SFFF DV
Sbjct  163  LESSFPPSNGTFRSDISEKVMKPLLHFLNRTKSFFFIDV  201



>ref|XP_009610543.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nicotiana 
tomentosiformis]
Length=465

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            + LI+GLKA RVKIYDANP+IL+A   + +Q+SVMVPNE+I NIS++Q LAD+WV+TNVV
Sbjct  46   VDLINGLKANRVKIYDANPEILKAFKGTKLQLSVMVPNELINNISTNQDLADQWVKTNVV  105

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  527
            PFY +T IRY+LVGNEILS+PPNTTWF LVPA+RKIR +VKKFGL KIKVGTPLA+DMLE
Sbjct  106  PFYPDTMIRYVLVGNEILSSPPNTTWFNLVPAIRKIRYAVKKFGLGKIKVGTPLAIDMLE  165

Query  528  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            +S+PPS+G FRSD++  V KPLL FL+RT SFFF DV
Sbjct  166  SSFPPSNGTFRSDISEKVMKPLLHFLNRTKSFFFIDV  202



>ref|XP_011089044.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Sesamum 
indicum]
Length=461

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            +QLI  L  KR+KIY  NPKIL+++  + +Q+S+MVPN +IP+IS++Q LAD+WV+TNVV
Sbjct  46   IQLIQKLNGKRIKIYGTNPKILKSIQGTDLQISIMVPNNLIPDISTNQTLADQWVQTNVV  105

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  527
            PFY E+KIRYLLVGNEILSNPPNTTWF+LVPAMRKIR SVKK+GL KIKVGTPLAMD LE
Sbjct  106  PFYPESKIRYLLVGNEILSNPPNTTWFKLVPAMRKIRSSVKKYGLHKIKVGTPLAMDALE  165

Query  528  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            +S+PPS+G FRSD+   V +P+L FL+RT SFFF DV
Sbjct  166  SSFPPSNGTFRSDVREKVIRPMLHFLNRTKSFFFVDV  202



>ref|XP_004247041.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Solanum 
lycopersicum]
Length=464

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = +3

Query  162  HDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETN  341
            + + LI GLKAKRVKIYD NP+IL AL  + +QVSVMVPNE+I NIS++Q LAD+WV+ N
Sbjct  43   NSVDLIKGLKAKRVKIYDTNPQILDALKGTNLQVSVMVPNELINNISTNQTLADQWVKNN  102

Query  342  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  521
            +VPFY  T IRYLLVGNEILS+PPNTTWF LVP +RKIR SVKKFGL KIKVGTPLA+DM
Sbjct  103  IVPFYPHTMIRYLLVGNEILSSPPNTTWFNLVPTIRKIRFSVKKFGLGKIKVGTPLAIDM  162

Query  522  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            LE+S+PPS+G FRSD++  V KPLL FL+RT SFFF DV
Sbjct  163  LESSFPPSNGTFRSDISEKVMKPLLHFLNRTKSFFFIDV  201



>ref|XP_008244679.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Prunus 
mume]
Length=462

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 131/159 (82%), Gaps = 0/159 (0%)
 Frame = +3

Query  162  HDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETN  341
              ++LI  LKAKRVKIYDANPKIL AL N+ +QVS+MVPNE+I NISS+Q LAD+WV  N
Sbjct  42   ESVKLIQSLKAKRVKIYDANPKILEALRNTDLQVSMMVPNELINNISSNQTLADQWVHAN  101

Query  342  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  521
            VVPFY ET IRYLLVGNEILS P  T WF LVPAMRKI+ ++K  G+ K+KVGTPLAMD+
Sbjct  102  VVPFYPETLIRYLLVGNEILSQPDKTIWFNLVPAMRKIKAALKTHGIAKVKVGTPLAMDV  161

Query  522  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            LE+S+PPS+G FRSD + SV KPLLQF+++T SFFF DV
Sbjct  162  LESSFPPSNGTFRSDFSASVIKPLLQFVNKTKSFFFVDV  200



>gb|EYU39188.1| hypothetical protein MIMGU_mgv1a006049mg [Erythranthe guttata]
Length=459

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 136/160 (85%), Gaps = 0/160 (0%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
               +QLI  L AKR+KIY ANPKIL+++  + +Q+S+MVPN++I  I ++Q LAD WV+T
Sbjct  43   EKSIQLIQKLNAKRIKIYGANPKILKSIQGTDLQISIMVPNQLISAIYNNQTLADDWVKT  102

Query  339  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  518
            NVVPFY ++KIRYLLVGNEILS+ PN+TWFQLVPA+R+IR +VKK+GL+K+KVGTPLAMD
Sbjct  103  NVVPFYPQSKIRYLLVGNEILSSQPNSTWFQLVPAIRRIRNAVKKYGLKKVKVGTPLAMD  162

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            +LE+SYPPS+G FRSD++ +V +PLL FL+RT SFFF DV
Sbjct  163  VLESSYPPSNGTFRSDVSETVVEPLLHFLNRTKSFFFVDV  202



>emb|CDP03931.1| unnamed protein product [Coffea canephora]
Length=418

 Score =   224 bits (570),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            ++LI GLKAK VKIYDANPKIL ALG + +QVSVMVPNEII NISS+Q LAD+WV+TNVV
Sbjct  47   VELIQGLKAKGVKIYDANPKILAALGGTPLQVSVMVPNEIITNISSNQTLADQWVKTNVV  106

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  527
            PFY +T+IRYLLVGNEILS P  TTWF LVPAMR+IR SVK FGL K+KVGTPLAMD+L 
Sbjct  107  PFYRKTRIRYLLVGNEILSGPDKTTWFNLVPAMRRIRYSVKTFGLNKVKVGTPLAMDVLG  166

Query  528  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            +S+PPSSG+FRSD++  V KPLLQFLDRT SFFF DV
Sbjct  167  SSFPPSSGSFRSDVSDKVLKPLLQFLDRTKSFFFIDV  203


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 2/47 (4%)
 Frame = +2

Query  95   GADISATVGICYGQLGNNLPTPSRSAAHPWLKGEAGQDLRCQPENPQ  235
            GA++SA VGICYGQLGNNLPTPS+S     ++G   + ++    NP+
Sbjct  22   GAEMSAKVGICYGQLGNNLPTPSKSVE--LIQGLKAKGVKIYDANPK  66



>gb|EPS58986.1| hypothetical protein M569_15824, partial [Genlisea aurea]
Length=453

 Score =   221 bits (564),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 131/163 (80%), Gaps = 1/163 (1%)
 Frame = +3

Query  153  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWV  332
            P    ++LI  LKA RVKIYDANP+IL+AL    + VSVM+PN++IP +++DQ  +D WV
Sbjct  31   PPSESVRLIEKLKAGRVKIYDANPEILKALKGKNLLVSVMLPNQLIPAVAADQKFSDEWV  90

Query  333  ETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLA  512
              NV PFY  TKIRY+LVGNEILSNPPNTTWF+LVPAM++IR SV K G++KIK+GTPLA
Sbjct  91   RKNVAPFYPATKIRYILVGNEILSNPPNTTWFELVPAMKRIRISVVKLGMKKIKIGTPLA  150

Query  513  MDMLEASYPPSSGAFRSD-LTGSVFKPLLQFLDRTNSFFFFDV  638
            MD+LE+SYPPS+GAFRS  +   V KPLL+FL+RT SFFF DV
Sbjct  151  MDVLESSYPPSAGAFRSGVIADDVIKPLLRFLNRTKSFFFVDV  193



>ref|XP_008382581.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Malus 
domestica]
Length=463

 Score =   221 bits (564),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 131/162 (81%), Gaps = 0/162 (0%)
 Frame = +3

Query  153  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWV  332
            P    ++LI  LKAKRVK+YDANPKIL AL N+ +QVS+MVPNE+I NISS+Q LAD WV
Sbjct  39   PPSQSVKLIQSLKAKRVKLYDANPKILTALRNTDLQVSIMVPNELINNISSNQTLADHWV  98

Query  333  ETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLA  512
             TNVVPFY ET IRYLLVGNEILS P    W+ LVPAMRKI+ ++K   + K+KVGTPLA
Sbjct  99   HTNVVPFYPETLIRYLLVGNEILSQPDKQIWYNLVPAMRKIKAALKTHRITKVKVGTPLA  158

Query  513  MDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            MD+LE+S+PPS+G FRSD++G V KPLL+F+++T SFFF DV
Sbjct  159  MDVLESSFPPSNGTFRSDVSGLVLKPLLKFINKTKSFFFVDV  200



>ref|XP_008356234.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Malus 
domestica]
Length=524

 Score =   222 bits (566),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = +3

Query  153  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWV  332
            P    ++LI  L AKRVK+YDANPKIL AL N+ +QVS+MVPNE+I NISS+Q LAD+WV
Sbjct  91   PPSQSVKLIQSLNAKRVKLYDANPKILAALRNTDLQVSIMVPNELISNISSNQTLADQWV  150

Query  333  ETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLA  512
             TNVVPFY +T IRYLLVGNEILS P    WF LVPAMRKI+ ++K   + K+KVGTPLA
Sbjct  151  RTNVVPFYPDTLIRYLLVGNEILSQPNKQIWFNLVPAMRKIKAALKTHRITKVKVGTPLA  210

Query  513  MDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            MD+LE+S+PPS+G FRSD++GSV KP+L+F+++T SFFF D+
Sbjct  211  MDVLESSFPPSNGTFRSDISGSVIKPMLKFINKTKSFFFVDL  252



>ref|XP_009372203.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Pyrus 
x bretschneideri]
Length=463

 Score =   219 bits (558),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 131/162 (81%), Gaps = 0/162 (0%)
 Frame = +3

Query  153  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWV  332
            P    ++LI  LKAKRVK+YDANPKIL AL N+ +QVS+MVPNE+I NISS+Q LAD WV
Sbjct  39   PPSQSVKLIQSLKAKRVKLYDANPKILTALRNTDLQVSIMVPNELINNISSNQTLADHWV  98

Query  333  ETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLA  512
             TN+VPFY ET IRYLLVGNEILS P    W+ LVPAMRKI+ ++K   + K+KVGTPLA
Sbjct  99   YTNLVPFYPETLIRYLLVGNEILSQPDKQVWYNLVPAMRKIKAALKTHRITKVKVGTPLA  158

Query  513  MDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            MD+LE+S+PPS+G FRSD++G V KP+L+F+++T SFFF DV
Sbjct  159  MDVLESSFPPSNGTFRSDVSGLVLKPMLKFINKTKSFFFVDV  200



>ref|XP_004144397.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cucumis sativus]
 ref|XP_004167264.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cucumis sativus]
 gb|KGN58384.1| hypothetical protein Csa_3G634360 [Cucumis sativus]
Length=466

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = +3

Query  153  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWV  332
            P  H + LI  L A+ VKIYDANP+IL+AL N+ ++VSVMVPNE+I NISS Q LAD+WV
Sbjct  39   PPSHSVNLIKSLNAQIVKIYDANPQILKALKNTDLRVSVMVPNELIINISSSQNLADQWV  98

Query  333  ETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLA  512
             TN++PFY +TKIRYLLVGNEI+S+  N TWF LVPAMR+I+ S+K +G+ K+KVGTP A
Sbjct  99   RTNILPFYPQTKIRYLLVGNEIISSTGNQTWFSLVPAMRRIKHSLKTYGIHKVKVGTPSA  158

Query  513  MDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            MD+L++S+PPS+G FR+D+   V +P+LQFL+RT SFFF DV
Sbjct  159  MDVLQSSFPPSNGTFRADIADRVMRPMLQFLNRTKSFFFLDV  200



>gb|KDO46598.1| hypothetical protein CISIN_1g038099mg, partial [Citrus sinensis]
Length=250

 Score =   212 bits (539),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 126/162 (78%), Gaps = 1/162 (1%)
 Frame = +3

Query  153  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNIS-SDQALADRW  329
            P      +I  LKA RVKIYDANPKIL+AL N  +QVS+MVPNEII NIS S Q L+D+W
Sbjct  41   PQESVELMIKSLKATRVKIYDANPKILKALKNIDIQVSIMVPNEIINNISLSSQTLSDQW  100

Query  330  VETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
            V TNV+P+   TKIRYLLVGNEILS P  + W  LVPAMRKIR+S+K  G RKIKVGTP 
Sbjct  101  VRTNVLPYLPGTKIRYLLVGNEILSLPDKSIWPNLVPAMRKIRKSLKTLGARKIKVGTPS  160

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFD  635
            AMD+L++S+PPS+G FRSD++ SV +P+L FL+RT SFFF D
Sbjct  161  AMDVLQSSFPPSNGTFRSDISESVMRPMLHFLNRTKSFFFVD  202



>ref|XP_006386885.1| 3-glucanase family protein [Populus trichocarpa]
 gb|ERP64682.1| 3-glucanase family protein [Populus trichocarpa]
Length=465

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 131/159 (82%), Gaps = 0/159 (0%)
 Frame = +3

Query  162  HDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETN  341
              ++L+  LKAKRVKIYDANP IL++L ++ +QVS+M+PNE+I NIS  Q+L+D WV+TN
Sbjct  43   ESVELLKSLKAKRVKIYDANPDILKSLKDTDIQVSIMIPNELIQNISKSQSLSDHWVKTN  102

Query  342  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  521
            VVP+Y + KIRYLLVGNEIL+NP   TWF LVPAMR+I+ S+K   + KIKVGTP A+++
Sbjct  103  VVPYYSDVKIRYLLVGNEILTNPDTGTWFNLVPAMRRIKASLKTHKITKIKVGTPSALNV  162

Query  522  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            LE+S+PPS+G FRSD++G + KP+L+FLDRT SFFF DV
Sbjct  163  LESSFPPSNGTFRSDISGPIIKPMLRFLDRTKSFFFIDV  201



>ref|XP_011024595.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Populus 
euphratica]
Length=465

 Score =   216 bits (551),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 131/159 (82%), Gaps = 0/159 (0%)
 Frame = +3

Query  162  HDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETN  341
              ++LI  LKAKRVKIYDANP IL++L ++ +QVS+M+PNE+I NIS  Q+L+D WV+TN
Sbjct  43   ESVELIKSLKAKRVKIYDANPDILKSLKDTDIQVSIMIPNELIQNISKSQSLSDHWVKTN  102

Query  342  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  521
            VVP+Y + KIRYLLVGNEIL+NP   TWF LVPAMR+I+ S+K   ++KIKVGT  A+++
Sbjct  103  VVPYYSDVKIRYLLVGNEILTNPDTGTWFNLVPAMRRIKASLKSHKIKKIKVGTTSAINV  162

Query  522  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            LE+S+PPS+G FRSD++G + KP+L+FLDRT SFFF DV
Sbjct  163  LESSFPPSNGTFRSDISGPIIKPMLRFLDRTKSFFFIDV  201



>ref|XP_004290162.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Fragaria 
vesca subsp. vesca]
Length=463

 Score =   216 bits (551),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 130/159 (82%), Gaps = 0/159 (0%)
 Frame = +3

Query  162  HDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETN  341
              ++LI  LKAKRVKIYDANPKIL AL N+ +QVS+MVPNE+I NISS+Q LA++WV  N
Sbjct  42   ESVKLIQNLKAKRVKIYDANPKILEALRNTDLQVSMMVPNELINNISSNQTLANQWVHAN  101

Query  342  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  521
            VVPFY  T IRYLLVGNEILS P  + WF LVPAMRKI++++K  G+ K+KVGTP AMD+
Sbjct  102  VVPFYPHTLIRYLLVGNEILSAPDKSIWFNLVPAMRKIKKALKIHGITKVKVGTPSAMDV  161

Query  522  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            LE+S+PPS+G FRSD++ SV KP+L+FL +T SFFF DV
Sbjct  162  LESSFPPSNGTFRSDISSSVIKPMLKFLFKTKSFFFVDV  200



>ref|XP_010100789.1| putative glucan endo-1,3-beta-glucosidase A6 [Morus notabilis]
 gb|EXB84487.1| putative glucan endo-1,3-beta-glucosidase A6 [Morus notabilis]
Length=470

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 132/159 (83%), Gaps = 0/159 (0%)
 Frame = +3

Query  162  HDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETN  341
              ++LI  LKAKRVKIY+A+P+IL AL N+ +QVS+MVPNEI+ NIS++Q LAD WV TN
Sbjct  46   RSVELIKTLKAKRVKIYNADPEILTALRNTNIQVSIMVPNEILINISTNQTLADEWVHTN  105

Query  342  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  521
            +VPFY +T IRYLLVGNEI+S+     W+ LVPAMRKI+ +++  G+RK+KVGTP AMD+
Sbjct  106  LVPFYHDTMIRYLLVGNEIISSTAKPVWYALVPAMRKIKSALRTHGIRKVKVGTPSAMDV  165

Query  522  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            L++S+PPS+G+FRSD++G + KP+LQFL+RT SFFF DV
Sbjct  166  LQSSFPPSNGSFRSDISGPIIKPMLQFLNRTKSFFFVDV  204



>ref|XP_007049651.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOX93808.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
Length=461

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 129/159 (81%), Gaps = 0/159 (0%)
 Frame = +3

Query  162  HDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETN  341
              ++LI  L AKRVKIYDANP IL AL ++ +QVS+MVPN+++ NIS++Q LAD WVE+N
Sbjct  40   QSVKLIQSLGAKRVKIYDANPDILNALKDTNLQVSIMVPNQLLTNISTNQKLADSWVESN  99

Query  342  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  521
            VVPFY +TKIRYLLVGNE++S+ P  TW+ +VPAMRK++ S+K   L KIKVGT +AMD+
Sbjct  100  VVPFYPKTKIRYLLVGNEVISSSPKETWYSIVPAMRKLKNSLKIHSLNKIKVGTSMAMDV  159

Query  522  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            LE+S+PPS+G FRSD+ G + KP+LQFL RT SF+F DV
Sbjct  160  LESSFPPSNGTFRSDIAGPIVKPMLQFLSRTKSFYFLDV  198



>ref|XP_010036769.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Eucalyptus 
grandis]
 gb|KCW48410.1| hypothetical protein EUGRSUZ_K02113 [Eucalyptus grandis]
 gb|KCW48411.1| hypothetical protein EUGRSUZ_K02113 [Eucalyptus grandis]
Length=466

 Score =   214 bits (545),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 128/154 (83%), Gaps = 1/154 (1%)
 Frame = +3

Query  180  HGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYG  359
            H LKA+RVKIYDANP ILRAL ++G+QVSVMVPNE+I  I+ +Q LAD WV +NVVPF+ 
Sbjct  50   HQLKAQRVKIYDANPSILRALEHTGIQVSVMVPNELINAIAVNQTLADSWVGSNVVPFHP  109

Query  360  ETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPLAMDMLEASY  536
             TKIRYLLVGNEILS+  NTTWF LVPAMRK+++++K+  +  K+KVGTPLAMD+L  SY
Sbjct  110  ATKIRYLLVGNEILSSADNTTWFNLVPAMRKVKKALKRHKVHHKVKVGTPLAMDVLATSY  169

Query  537  PPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            PPSSG+FR D++  V KP+LQFL+RT SFFF DV
Sbjct  170  PPSSGSFRPDVSDRVMKPMLQFLNRTKSFFFIDV  203



>ref|XP_003626949.1| Beta-1 3-glucanase [Medicago truncatula]
 gb|AET01425.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=463

 Score =   213 bits (543),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            + LI  LKAKRVKIYDANP+IL+AL N+G+QVS+M+PNE++ N+SS+Q LA++WV+TN+V
Sbjct  47   VSLIKNLKAKRVKIYDANPQILKALENTGIQVSIMLPNELVTNVSSNQTLANQWVQTNLV  106

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  527
            PFY +T IRYLLVGNE++S+  N TW  +VPAM +++ S+  FGL K+KVGTPLAMD+L+
Sbjct  107  PFYSKTLIRYLLVGNELISSTTNQTWPHIVPAMYRMKHSLTIFGLHKVKVGTPLAMDVLQ  166

Query  528  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             S+PPS+G FR+D+  SV KP+L+FL  TNSFFF DV
Sbjct  167  TSFPPSNGTFRNDIALSVMKPMLEFLHVTNSFFFLDV  203



>ref|XP_011024596.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Populus 
euphratica]
Length=465

 Score =   211 bits (536),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = +3

Query  162  HDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETN  341
              ++LI  LKAKRVKIYDANP IL++L N+ +QVS+MVPN +IPNIS  Q  +D+WV+TN
Sbjct  43   RSVELIKSLKAKRVKIYDANPDILKSLKNTDIQVSIMVPNALIPNISKSQYFSDQWVKTN  102

Query  342  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  521
            VVP+Y + KIRYLLVGNEIL+NP   TWF LVPAMR+I+ S+ +  +RKIKVGTP A+++
Sbjct  103  VVPYYSDVKIRYLLVGNEILTNPDTGTWFNLVPAMRRIKISLTRHNIRKIKVGTPSAINV  162

Query  522  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNS  620
            LE+S+PPS+G FRSD++G+V KP+LQFL+RT S
Sbjct  163  LESSFPPSNGTFRSDISGTVIKPMLQFLNRTKS  195



>gb|KHG25787.1| putative glucan endo-1,3-beta-glucosidase A6 -like protein [Gossypium 
arboreum]
Length=461

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 123/159 (77%), Gaps = 0/159 (0%)
 Frame = +3

Query  162  HDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETN  341
              ++LI  L+AKRVKIYDAN  IL AL  + +QV +MVPNEII NIS+ Q LAD WVETN
Sbjct  40   QSVKLIQSLRAKRVKIYDANHDILNALKGTNLQVCIMVPNEIINNISTSQKLADSWVETN  99

Query  342  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  521
            VVPFY  TKIRYLLVGNE++S  P   W  +VPAMRKI++S+K  GL KIKV T +AMD+
Sbjct  100  VVPFYSTTKIRYLLVGNEVISGSPKDIWPNIVPAMRKIKKSLKAHGLDKIKVSTSMAMDV  159

Query  522  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            LE+S+PPS+G FRSD+  S+ +PLLQFL RT SF+F DV
Sbjct  160  LESSFPPSNGTFRSDIADSIVRPLLQFLHRTKSFYFLDV  198



>ref|XP_008460404.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Cucumis 
melo]
Length=465

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = +3

Query  162  HDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETN  341
            H + LI  L A+ VKIYDANP+IL AL N+ ++VSVMVPNE+I NISS+Q LAD+WV TN
Sbjct  42   HSVNLIKSLNAQIVKIYDANPQILNALKNTDLRVSVMVPNELIINISSNQNLADQWVRTN  101

Query  342  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  521
            ++PFY + KIRYLLVGNEI+S+  N TWF LVPAMR+I+ S+K +G+ K+KVGT  AMD+
Sbjct  102  ILPFYPQIKIRYLLVGNEIISSTGNQTWFSLVPAMRRIKHSLKTYGIHKVKVGTSSAMDV  161

Query  522  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            L++S+PPS+G FR D+   V +P+LQFL+RT SF+F DV
Sbjct  162  LQSSFPPSNGTFREDIADRVMRPMLQFLNRTKSFYFLDV  200



>gb|KJB10879.1| hypothetical protein B456_001G230200 [Gossypium raimondii]
Length=460

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 122/159 (77%), Gaps = 0/159 (0%)
 Frame = +3

Query  162  HDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETN  341
              ++LI  L AKRVKIYDAN  IL AL  + +QV +MVPNEII NIS+ Q LAD WVETN
Sbjct  40   QSVKLIQSLGAKRVKIYDANHDILNALKGTNLQVCIMVPNEIINNISTSQKLADSWVETN  99

Query  342  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  521
            VVPFY  TKIRYLLVGNE++S  P   W  +VPAMRKI++S+K  GL KIKV T +AMD+
Sbjct  100  VVPFYSTTKIRYLLVGNEVISGSPKDIWPNIVPAMRKIKKSLKTHGLDKIKVSTSMAMDV  159

Query  522  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            LE+S+PPS+G FRSD+  S+ +PLLQFL RT SF+F DV
Sbjct  160  LESSFPPSNGTFRSDIADSIVRPLLQFLHRTKSFYFLDV  198



>ref|XP_002303070.2| 3-glucanase family protein [Populus trichocarpa]
 gb|EEE82343.2| 3-glucanase family protein [Populus trichocarpa]
Length=465

 Score =   209 bits (531),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 126/153 (82%), Gaps = 0/153 (0%)
 Frame = +3

Query  162  HDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETN  341
              ++LI  LKAKRVKIYDANP IL++L N+ +QVS+MVPN +IPNIS  Q  +D+WV+TN
Sbjct  43   RSVELIKSLKAKRVKIYDANPDILKSLKNTDIQVSIMVPNALIPNISKSQYFSDQWVKTN  102

Query  342  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  521
            VVP+Y + KIRYLLVGNEIL+NP   TWF LVPAMR+I+ S+ +  +RKIKVGTP A+++
Sbjct  103  VVPYYSDVKIRYLLVGNEILTNPDTGTWFNLVPAMRRIKISLTRHNIRKIKVGTPSAINV  162

Query  522  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNS  620
            LE+S+PPS+G FR D++G+V KP+LQFL+RT S
Sbjct  163  LESSFPPSNGTFRPDISGTVIKPMLQFLNRTKS  195



>gb|KJB10878.1| hypothetical protein B456_001G230200 [Gossypium raimondii]
Length=461

 Score =   209 bits (531),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 122/159 (77%), Gaps = 0/159 (0%)
 Frame = +3

Query  162  HDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETN  341
              ++LI  L AKRVKIYDAN  IL AL  + +QV +MVPNEII NIS+ Q LAD WVETN
Sbjct  40   QSVKLIQSLGAKRVKIYDANHDILNALKGTNLQVCIMVPNEIINNISTSQKLADSWVETN  99

Query  342  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  521
            VVPFY  TKIRYLLVGNE++S  P   W  +VPAMRKI++S+K  GL KIKV T +AMD+
Sbjct  100  VVPFYSTTKIRYLLVGNEVISGSPKDIWPNIVPAMRKIKKSLKTHGLDKIKVSTSMAMDV  159

Query  522  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            LE+S+PPS+G FRSD+  S+ +PLLQFL RT SF+F DV
Sbjct  160  LESSFPPSNGTFRSDIADSIVRPLLQFLHRTKSFYFLDV  198



>ref|XP_004492271.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cicer arietinum]
Length=463

 Score =   208 bits (530),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 130/160 (81%), Gaps = 0/160 (0%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
             + + LI  L +KR+KIYD NP+IL +L N+ +QVS+M+PNE+I NIS++Q L+D+W+++
Sbjct  41   QNSISLIKSLNSKRIKIYDTNPQILTSLKNTNIQVSIMLPNELITNISTNQTLSDQWIKS  100

Query  339  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  518
            NVVPFY +T IRYLL+GNEI+S+ PN+TW  LVPAMR+I+ S+KKF ++KIKVGT  AMD
Sbjct  101  NVVPFYPQTLIRYLLIGNEIISSTPNSTWPHLVPAMRRIKHSLKKFRIKKIKVGTSSAMD  160

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            +LE S+PPS+ AFR D+   V KP+L+FL+RT SFFF DV
Sbjct  161  VLETSFPPSNAAFRKDIAVQVIKPMLRFLNRTKSFFFLDV  200



>gb|KEH22559.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=463

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            L LI  L AKR+KIYD NP+IL  L N+ +QVS+M+PNE+I NISS+Q L+D+W+++N++
Sbjct  44   LSLIKSLNAKRIKIYDTNPQILTTLKNTNIQVSIMLPNELITNISSNQTLSDQWIKSNIL  103

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  527
            P+Y +T IRYLLVGNEI+S+ PN+TW  LVPAMR+I+ S+KKF +++IKVGT  AMD+LE
Sbjct  104  PYYPQTLIRYLLVGNEIISSTPNSTWLHLVPAMRRIKHSLKKFRVKRIKVGTSSAMDVLE  163

Query  528  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             S+PPS+ AFR D+   V KP+L+FL+RT SFFF DV
Sbjct  164  TSFPPSNAAFRKDIAVQVIKPMLRFLNRTKSFFFLDV  200



>dbj|BAA89481.1| beta-1,3-glucanase [Salix gilgiana]
Length=478

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 125/151 (83%), Gaps = 0/151 (0%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            ++LI  LKAKRVKIYDANP IL++L N+ +QVS+MVPN +IPN+S+ Q  +D+WVETNVV
Sbjct  58   VELIKSLKAKRVKIYDANPDILKSLKNTDIQVSIMVPNALIPNMSTSQHFSDQWVETNVV  117

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  527
            P+Y + KIRYLLVGNEIL+NP   TWF LVPAMR+I+ S+ +   RKIKVGTP A+++LE
Sbjct  118  PYYPDVKIRYLLVGNEILTNPDTGTWFNLVPAMRRIKISLTRRNFRKIKVGTPSAINVLE  177

Query  528  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNS  620
            +S PPS+G FRSD++G V KP+LQFL+RT S
Sbjct  178  SSSPPSNGTFRSDVSGPVIKPMLQFLNRTKS  208



>gb|KDP45279.1| hypothetical protein JCGZ_15144 [Jatropha curcas]
Length=464

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 139/196 (71%), Gaps = 7/196 (4%)
 Frame = +3

Query  72   YWPCHLFPAQISQLRSEYAT---VNWATTF----PHHHDLQLIHGLKAKRVKIYDANPKI  230
            ++P  +F    S   SE +    +NW T      P  H ++LI  LKAKRVKIY A+ +I
Sbjct  5    FFPLFVFALLFSTCSSEISNKIGINWGTLGNNLPPPPHTVELIKSLKAKRVKIYSADQEI  64

Query  231  LRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNP  410
            L AL N+ +QVS+M+PNE+IPN+S  Q  +D WV+ NVV F  + KIRYLLVGNEIL+NP
Sbjct  65   LTALKNTDIQVSIMLPNELIPNVSKSQHFSDHWVKNNVVRFLPDVKIRYLLVGNEILTNP  124

Query  411  PNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKP  590
               TWF LVPAMR+I+ S++ + + K+KVGTP A+++LE+S+PPS+G FRSD+   + +P
Sbjct  125  DVGTWFNLVPAMRRIKCSLRAYKIHKVKVGTPSALNVLESSFPPSNGTFRSDIADPIMRP  184

Query  591  LLQFLDRTNSFFFFDV  638
            +LQFL+RT SFFF DV
Sbjct  185  MLQFLNRTKSFFFLDV  200



>ref|XP_003632052.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Vitis 
vinifera]
 emb|CBI39470.3| unnamed protein product [Vitis vinifera]
Length=467

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 127/160 (79%), Gaps = 1/160 (1%)
 Frame = +3

Query  162  HDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETN  341
              +QLI GLKA RVK+YD NP+IL AL  + +QVS+MVPN+ I NIS  Q L+D+WV+TN
Sbjct  45   RSVQLIKGLKAGRVKLYDPNPEILEALSGTELQVSIMVPNQQISNISRSQKLSDQWVKTN  104

Query  342  VVPFYGETKIRYLLVGNEILS-NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  518
            VVP+Y ET IRY+LVGNE+LS       W  LVPAMR+I+ S++KF + K+KVGTPLAMD
Sbjct  105  VVPYYPETMIRYVLVGNEVLSLYDQKQGWPDLVPAMRRIKGSLRKFHIHKVKVGTPLAMD  164

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            +LE+S+PPS+G FRSD++ SV KPLLQFL+RT SFFF DV
Sbjct  165  VLESSFPPSNGTFRSDISVSVVKPLLQFLNRTKSFFFLDV  204



>gb|KFK38190.1| hypothetical protein AALP_AA3G081000 [Arabis alpina]
Length=462

 Score =   204 bits (518),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            ++LI  L AKRVK+YDANPKIL AL ++ + VSVMVPNE+I NIS    L+D WV++ ++
Sbjct  44   IKLIQSLNAKRVKLYDANPKILTALNSTDISVSVMVPNELIINISKSNTLSDEWVKSKIL  103

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  527
            PFY  TKIRYLLVGNEILS+  +     LVPAMRKI+RS+K  G++KIKVGT LA+D+L+
Sbjct  104  PFYPTTKIRYLLVGNEILSSQNSQLKSSLVPAMRKIQRSLKTLGVKKIKVGTTLAVDVLQ  163

Query  528  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             S+PPSSG FRSD++GSV KP+LQFL+RT SF F DV
Sbjct  164  TSFPPSSGEFRSDISGSVMKPMLQFLNRTKSFLFVDV  200



>gb|KHN10950.1| Putative glucan endo-1,3-beta-glucosidase A6 [Glycine soja]
Length=397

 Score =   201 bits (512),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 127/163 (78%), Gaps = 1/163 (1%)
 Frame = +3

Query  153  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWV  332
            P    + LI  L AKRVK+YDANP IL AL ++ +QVS+MVPN++I NIS +Q+L+D+WV
Sbjct  42   PPQKSVSLITSLHAKRVKLYDANPAILHALRDTSLQVSIMVPNDLIVNISRNQSLSDKWV  101

Query  333  ETNVVPFYGETKIRYLLVGNEILSN-PPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
              NVVP++  T IRYLLVGNE+ S+  PN TW  LVPAMR+I+ S+K  G+RK+KVGT  
Sbjct  102  SDNVVPYHPRTLIRYLLVGNEVTSSTAPNGTWPYLVPAMRRIKHSLKSLGIRKVKVGTSS  161

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            A+D+LEAS+PPS+GAFR DL+  V KP+L+FL+RT SFFF DV
Sbjct  162  AIDVLEASFPPSNGAFRKDLSAPVMKPMLKFLNRTKSFFFLDV  204



>ref|XP_002884642.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60901.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=460

 Score =   203 bits (516),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            + LI  L AKRVK+YDANPKIL AL  + + VSVMVPNE+I NIS  ++L+D W+ +N++
Sbjct  42   VNLIKSLNAKRVKLYDANPKILTALNGTDITVSVMVPNELIVNISKSESLSDDWIRSNIL  101

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  527
            PFY  TKIRYLLVGNEILS P +     LVPAMRKI+RS+K  G++K+KVGT LA+D+L+
Sbjct  102  PFYPTTKIRYLLVGNEILSFPDSELKSSLVPAMRKIQRSLKSLGVKKVKVGTTLAVDVLQ  161

Query  528  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            +S+PPSSG FRSD++G V KP+LQFL+RT SF F DV
Sbjct  162  SSFPPSSGEFRSDISGLVMKPMLQFLNRTKSFLFVDV  198



>ref|XP_004510238.1| PREDICTED: putative copper-transporting ATPase HMA5-like [Cicer 
arietinum]
Length=1239

 Score =   209 bits (533),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            + LI  LKAKRVKIYDANP+IL+AL N+G+QVS+M+PN++I +IS +Q L+++WV++N+V
Sbjct  823  ISLIKNLKAKRVKIYDANPQILKALENTGLQVSIMIPNQLITDISLNQTLSNQWVQSNLV  882

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  527
            PFY +T IRYLLVGNE++S+  N TW  +VPAM +I+ S+  FGL K+KVGTPLAMD+L+
Sbjct  883  PFYPKTLIRYLLVGNELISSTTNQTWPHIVPAMHRIKNSLTNFGLHKVKVGTPLAMDILQ  942

Query  528  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             S+PPS+G FR+D+  +V KP+L+FL+ TNSFFF DV
Sbjct  943  TSFPPSNGIFRNDIAFTVIKPMLEFLNITNSFFFLDV  979



>emb|CDY28063.1| BnaC05g44650D [Brassica napus]
Length=460

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 124/157 (79%), Gaps = 0/157 (0%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            + LI  L AK VK+YDANP IL AL  + + VSVMVPNE+I NI+  + L+D WV++NV+
Sbjct  42   VSLIKSLNAKSVKLYDANPSILAALKATDIVVSVMVPNELIVNITKSKTLSDDWVKSNVL  101

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  527
            PFY  TKIRYLLVGNEILS+P +     LVPAMRKI+RS+K  G++K+KVGT LA+D+L 
Sbjct  102  PFYPSTKIRYLLVGNEILSSPDSELKSALVPAMRKIQRSLKTLGVKKVKVGTTLAVDVLN  161

Query  528  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            +SYPPSSG FRSD++GSV KP+LQFL+RT SF F DV
Sbjct  162  SSYPPSSGEFRSDISGSVMKPMLQFLNRTKSFLFVDV  198



>emb|CDY45466.1| BnaC09g12840D [Brassica napus]
Length=460

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 124/157 (79%), Gaps = 0/157 (0%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            + LI  L AK VK+YDANP IL AL  + + VSVMVPNE+I NI+  + L+D W+++NV+
Sbjct  42   VSLIKSLNAKSVKLYDANPSILAALNATDIVVSVMVPNELIVNITKSKTLSDDWIKSNVL  101

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  527
            PFY  TKIRYLLVGNEILS+P +     LVPAMRKI+RS+K  G++K+KVGT LA+D+L 
Sbjct  102  PFYPSTKIRYLLVGNEILSSPDSELKSALVPAMRKIQRSLKTLGVKKVKVGTTLAVDVLN  161

Query  528  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            +SYPPSSG FRSD++GSV KP+LQFL+RT SF F DV
Sbjct  162  SSYPPSSGEFRSDISGSVMKPMLQFLNRTKSFLFVDV  198



>ref|XP_006407848.1| hypothetical protein EUTSA_v10020660mg [Eutrema salsugineum]
 gb|ESQ49301.1| hypothetical protein EUTSA_v10020660mg [Eutrema salsugineum]
Length=469

 Score =   201 bits (510),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            ++LI  L AKRVK+YDANP IL AL  + + VSVMVPN++I NIS   +L+D W+ +N++
Sbjct  51   VKLIKSLNAKRVKLYDANPTILAALNATDIAVSVMVPNQLIVNISKSDSLSDDWIRSNIL  110

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  527
            PFY +TKIRYLLVGNEILS+  +     LVPAMRKI+RS+K  G++K+KVGT LA+D+L+
Sbjct  111  PFYPDTKIRYLLVGNEILSSTDSELKSALVPAMRKIQRSLKTLGVKKVKVGTSLAVDVLQ  170

Query  528  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            +S+PPSSG FRSD++GSV KP+LQFL+RT SF F DV
Sbjct  171  SSFPPSSGEFRSDISGSVMKPMLQFLNRTKSFLFVDV  207



>ref|XP_006407849.1| hypothetical protein EUTSA_v10020660mg [Eutrema salsugineum]
 gb|ESQ49302.1| hypothetical protein EUTSA_v10020660mg [Eutrema salsugineum]
Length=470

 Score =   201 bits (510),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            ++LI  L AKRVK+YDANP IL AL  + + VSVMVPN++I NIS   +L+D W+ +N++
Sbjct  51   VKLIKSLNAKRVKLYDANPTILAALNATDIAVSVMVPNQLIVNISKSDSLSDDWIRSNIL  110

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  527
            PFY +TKIRYLLVGNEILS+  +     LVPAMRKI+RS+K  G++K+KVGT LA+D+L+
Sbjct  111  PFYPDTKIRYLLVGNEILSSTDSELKSALVPAMRKIQRSLKTLGVKKVKVGTSLAVDVLQ  170

Query  528  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            +S+PPSSG FRSD++GSV KP+LQFL+RT SF F DV
Sbjct  171  SSFPPSSGEFRSDISGSVMKPMLQFLNRTKSFLFVDV  207



>ref|XP_003530849.2| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Glycine max]
Length=467

 Score =   200 bits (509),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 127/163 (78%), Gaps = 1/163 (1%)
 Frame = +3

Query  153  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWV  332
            P    + LI  L AKRVK+YDANP IL AL ++ +QVS+MVPN++I NIS +Q+L+D+WV
Sbjct  42   PPQKSVSLITSLHAKRVKLYDANPAILHALRDTSLQVSIMVPNDLIVNISRNQSLSDKWV  101

Query  333  ETNVVPFYGETKIRYLLVGNEILSN-PPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
              NVVP++  T IRYLLVGNE+ S+  PN TW  LVPAMR+I+ S+K  G+RK+KVGT  
Sbjct  102  SDNVVPYHPRTLIRYLLVGNEVTSSTAPNGTWPYLVPAMRRIKHSLKSLGIRKVKVGTSS  161

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            A+D+LEAS+PPS+GAFR DL+  V KP+L+FL+RT SFFF DV
Sbjct  162  AIDVLEASFPPSNGAFRKDLSAPVMKPMLKFLNRTKSFFFLDV  204



>emb|CDY24629.1| BnaA05g30280D [Brassica napus]
Length=460

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 123/157 (78%), Gaps = 0/157 (0%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            + LI  L AK VK+YDANP IL AL  + + VSVMVPNE+I NI+  + L+D W+++NV+
Sbjct  42   VTLIKSLNAKSVKLYDANPSILAALNATDIVVSVMVPNELIVNITKSKTLSDDWIKSNVL  101

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  527
            PFY  TKIRYLLVGNEILS+  +     LVPAMRKI+RS+K  G++K+KVGT LAMD+L 
Sbjct  102  PFYPSTKIRYLLVGNEILSSQDSELKSALVPAMRKIQRSLKTLGVKKVKVGTTLAMDVLN  161

Query  528  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            +SYPPSSG FRSD++GSV KP+LQFL+RT SF F DV
Sbjct  162  SSYPPSSGEFRSDISGSVMKPMLQFLNRTKSFLFVDV  198



>ref|XP_006297636.1| hypothetical protein CARUB_v10013655mg [Capsella rubella]
 gb|EOA30534.1| hypothetical protein CARUB_v10013655mg [Capsella rubella]
Length=460

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 123/157 (78%), Gaps = 0/157 (0%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            + LI  L AKRVK+YDANPKIL AL  + + VSVMVPNE++ NIS  ++L+D W+ +N++
Sbjct  42   VNLIKSLNAKRVKLYDANPKILAALNATDITVSVMVPNELLVNISKSESLSDDWIRSNIL  101

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  527
            PFY  TKIRYLLVGNEILS+P +     LVPAMRKI+RS+K  G++K+KVGT LA+D+L+
Sbjct  102  PFYPTTKIRYLLVGNEILSSPDSELKASLVPAMRKIQRSLKSLGVKKVKVGTSLAVDVLQ  161

Query  528  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             S+PPS G FR D++G V KP+LQFL+RT SF F DV
Sbjct  162  TSFPPSKGEFREDISGLVMKPMLQFLNRTKSFLFVDV  198



>ref|XP_009147086.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=501

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 123/157 (78%), Gaps = 0/157 (0%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            + LI  L AK VK+YDANP IL AL  + + VSVMVPNE+I NI+  + L+D W+++NV+
Sbjct  83   VTLIKSLNAKSVKLYDANPSILAALNATDIVVSVMVPNELIVNITKSKTLSDDWIKSNVL  142

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  527
            PFY  TKIRYLLVGNEILS+  +     LVPAMRKI+RS+K  G++K+KVGT LAMD+L 
Sbjct  143  PFYPSTKIRYLLVGNEILSSQDSELKSALVPAMRKIQRSLKTLGVKKVKVGTTLAMDVLN  202

Query  528  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            +SYPPSSG FRSD++GSV KP+LQFL+RT SF F DV
Sbjct  203  SSYPPSSGEFRSDISGSVMKPMLQFLNRTKSFLFVDV  239



>ref|XP_010486278.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=461

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 123/157 (78%), Gaps = 0/157 (0%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            + LI  L AKRVK+YDANPKIL AL  + + VSVMVPNE++ NIS  + L+D W+ +N++
Sbjct  43   VNLIKSLNAKRVKLYDANPKILSALNATDITVSVMVPNELLVNISKSETLSDDWIRSNIL  102

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  527
            PFY  TKIRYLLVGNEILS+  +     LVPAMRKI+RS+K  G++K+KVGT LA+D+L+
Sbjct  103  PFYPTTKIRYLLVGNEILSSTDSELKASLVPAMRKIQRSLKSLGVKKVKVGTSLAVDVLK  162

Query  528  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             S+PPSSG F+ D++GSV KP+LQFL+RT SF F DV
Sbjct  163  TSFPPSSGEFKEDISGSVMKPMLQFLNRTKSFLFIDV  199



>gb|AAF20214.1|AC012395_1 putative beta-1,3-glucanase precursor [Arabidopsis thaliana]
Length=440

 Score =   198 bits (503),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            + LI  L AKRVK+YDANPKIL AL  + + VSVMVPNE++ NIS   +L+D W+ +N++
Sbjct  43   VNLIKSLNAKRVKLYDANPKILAALNGTDITVSVMVPNELLVNISKSASLSDDWIRSNIL  102

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  527
            PFY  TKIRYLLVGNEILS P +     LVPAMRKI+RS+K  G++K+KVGT LA D+L+
Sbjct  103  PFYPTTKIRYLLVGNEILSLPDSELKSSLVPAMRKIQRSLKSLGVKKVKVGTTLATDVLQ  162

Query  528  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            +S+PPSSG FR D++G + KP+LQFL+RT SF F DV
Sbjct  163  SSFPPSSGEFREDISGLIMKPMLQFLNRTKSFLFVDV  199



>ref|NP_683538.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|AAF02143.1|AC009853_3 putative glucan endo-1-3-beta-glucosidase [Arabidopsis thaliana]
 dbj|BAC42699.1| putative beta-1,3-glucanase precursor [Arabidopsis thaliana]
 gb|AAO64098.1| putative glycosyl hydrolase [Arabidopsis thaliana]
 gb|AEE74528.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=460

 Score =   198 bits (504),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            + LI  L AKRVK+YDANPKIL AL  + + VSVMVPNE++ NIS   +L+D W+ +N++
Sbjct  43   VNLIKSLNAKRVKLYDANPKILAALNGTDITVSVMVPNELLVNISKSASLSDDWIRSNIL  102

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  527
            PFY  TKIRYLLVGNEILS P +     LVPAMRKI+RS+K  G++K+KVGT LA D+L+
Sbjct  103  PFYPTTKIRYLLVGNEILSLPDSELKSSLVPAMRKIQRSLKSLGVKKVKVGTTLATDVLQ  162

Query  528  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            +S+PPSSG FR D++G + KP+LQFL+RT SF F DV
Sbjct  163  SSFPPSSGEFREDISGLIMKPMLQFLNRTKSFLFVDV  199



>ref|XP_010247391.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nelumbo 
nucifera]
Length=466

 Score =   198 bits (503),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 124/160 (78%), Gaps = 3/160 (2%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            ++ I  L+A R+K+YDANP+IL AL  + +QVS+MVPN++I NISS QA+AD WV TNV+
Sbjct  43   IEFIKTLEAGRIKLYDANPEILNALAWTNIQVSIMVPNQLISNISSSQAVADEWVRTNVI  102

Query  348  PFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  518
            PFY +T IR+LLVGNEI    S+    TW+ LV AMR+I+ S+  + +R IKVGTP+AMD
Sbjct  103  PFYSKTLIRHLLVGNEIFNFYSDEDRQTWYNLVLAMRRIKHSLSTYNIRNIKVGTPVAMD  162

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            +LE ++PPS+GAFRSD+   V KPLLQFL+RT SFFF DV
Sbjct  163  ILETAFPPSNGAFRSDIAVPVMKPLLQFLNRTRSFFFLDV  202



>ref|XP_006484802.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Citrus sinensis]
Length=466

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 121/163 (74%), Gaps = 1/163 (1%)
 Frame = +3

Query  153  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADR-W  329
            P      +I  LKA RVKIYDANPKIL+AL N+ +QVS+MVPNEII NIS         W
Sbjct  41   PQESVELMIKSLKATRVKIYDANPKILKALKNTDIQVSIMVPNEIINNISLSSQSLSDQW  100

Query  330  VETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
            V TNV+P+   TKIRYLLVGNEILS P  + W  LVPAMRKIR+S+K  G RKIKVGTP 
Sbjct  101  VRTNVLPYLPGTKIRYLLVGNEILSLPDKSIWPNLVPAMRKIRKSLKTLGARKIKVGTPS  160

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            AMD+L++S+PPS+G FRSD++ SV +P+L FL+RT SFFF D 
Sbjct  161  AMDVLQSSFPPSNGTFRSDISESVMRPMLHFLNRTKSFFFVDA  203



>ref|XP_006437250.1| hypothetical protein CICLE_v10031440mg [Citrus clementina]
 gb|ESR50490.1| hypothetical protein CICLE_v10031440mg [Citrus clementina]
Length=466

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 121/163 (74%), Gaps = 1/163 (1%)
 Frame = +3

Query  153  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADR-W  329
            P      +I  LKA RVKIYDANPKIL+AL N+ +QVS+MVPNEII NIS         W
Sbjct  41   PQESVELMIKSLKATRVKIYDANPKILKALKNTDIQVSIMVPNEIINNISLSSQSLSDQW  100

Query  330  VETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
            V TNV+P+   TKIRYLLVGNEILS P  + W  LVPAMRKIR+S+K  G RKIKVGTP 
Sbjct  101  VRTNVLPYLPGTKIRYLLVGNEILSLPDKSIWPNLVPAMRKIRKSLKTLGARKIKVGTPS  160

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            AMD+L++S+PPS+G FRSD++ SV +P+L FL+RT SFFF D 
Sbjct  161  AMDVLQSSFPPSNGTFRSDISESVMRPMLHFLNRTKSFFFVDA  203



>ref|XP_010464351.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=461

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 123/157 (78%), Gaps = 0/157 (0%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            + LI  L AKRVK+YDANPKIL AL ++ + VSVMVPNE++ NIS  + L+D W+ +N++
Sbjct  43   VNLIKSLNAKRVKLYDANPKILTALNSTDITVSVMVPNELLVNISKSETLSDDWIRSNIL  102

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  527
            PFY  TKIRYLLVGNEILS+  +     LVPAMRKI+RS+K  G++K+KVGT LA+D+L+
Sbjct  103  PFYPTTKIRYLLVGNEILSSTDSELKASLVPAMRKIQRSLKSLGVKKVKVGTSLAVDVLK  162

Query  528  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             S+PPSSG F+ D++G V KP+LQFL+RT SF F DV
Sbjct  163  TSFPPSSGEFKEDISGLVMKPMLQFLNRTKSFLFVDV  199



>gb|KJB84083.1| hypothetical protein B456_N004800 [Gossypium raimondii]
Length=464

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 122/160 (76%), Gaps = 0/160 (0%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
               ++LI  + A RVKIYDANP IL AL  + +QVS+MVPN+ + NIS++Q LAD W+++
Sbjct  42   EKSVKLIQSIGANRVKIYDANPDILNALRGTDLQVSIMVPNQHLTNISTNQKLADSWIQS  101

Query  339  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  518
            NV+PFY + KIRYLLVGNE++S+ P   W+ +VPAMRKI+ ++    L KIKVGT +AMD
Sbjct  102  NVLPFYPKVKIRYLLVGNEVISSSPKEIWYSIVPAMRKIKNALNTHRLNKIKVGTSMAMD  161

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            +LE+S+PPS+G FRSD+   + KP+LQFL RT SF+F DV
Sbjct  162  VLESSFPPSNGTFRSDIADPIVKPMLQFLSRTKSFYFLDV  201



>gb|AAM65039.1| putative glucan endo-1-3-beta-glucosidase [Arabidopsis thaliana]
Length=460

 Score =   196 bits (498),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 121/157 (77%), Gaps = 0/157 (0%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            + LI  L AKRVK+YDANPKIL AL  + + VSVMVPNE++ NIS   +L+D W+ +N++
Sbjct  43   VNLIKSLNAKRVKLYDANPKILAALNGTDITVSVMVPNELLVNISKSASLSDDWIRSNIL  102

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  527
            PFY  TKIRYLLVGNEILS P +     LVPAMRKI+ S+K  G++K+KVGT LA D+L+
Sbjct  103  PFYPTTKIRYLLVGNEILSLPDSELKSSLVPAMRKIQHSLKSLGVKKVKVGTTLATDVLQ  162

Query  528  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            +S+PPSSG FR D++G + KP+LQFL+RT SF F DV
Sbjct  163  SSFPPSSGEFREDISGLIMKPMLQFLNRTKSFLFVDV  199



>ref|XP_010451138.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=461

 Score =   196 bits (497),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 121/157 (77%), Gaps = 0/157 (0%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            + LI  L AKRVK+YDANPKIL AL  + + VSVMVPNE++ NIS  + L+D W+ +N++
Sbjct  43   VNLIKSLNAKRVKLYDANPKILAALNATDITVSVMVPNELLVNISKSETLSDDWIRSNIL  102

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  527
            PFY  TKIRYLLVGNEILS   +     LVPAMRKI+RS+K  G++K+KVGT LA+D+L+
Sbjct  103  PFYPTTKIRYLLVGNEILSFTDSELKASLVPAMRKIQRSLKSLGVKKVKVGTSLAVDVLK  162

Query  528  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             S+PPSSG FR D++G V KP+LQFL+RT SF F DV
Sbjct  163  TSFPPSSGEFREDISGLVMKPMLQFLNRTKSFLFVDV  199



>emb|CDO96794.1| unnamed protein product [Coffea canephora]
Length=446

 Score =   195 bits (495),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 132/182 (73%), Gaps = 2/182 (1%)
 Frame = +3

Query  96   AQISQLRSEYATVNWATTFPHHHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMV  275
            AQI+Q+   Y  +      P    +QL+  L A +VK+YDANPKIL AL  S + ++VMV
Sbjct  23   AQINQVGVCYGQLGNNLPAPSQ-SVQLLQKLNATQVKLYDANPKILNALIGSKLYITVMV  81

Query  276  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKI  455
            PNE+I NISS+Q LA++WV+ NV+P+Y    IRY+LVGNE+LS      WF LVPA+++I
Sbjct  82   PNELIINISSNQTLANQWVQNNVIPYYPRAMIRYILVGNEVLSYYFKPLWFYLVPAVKRI  141

Query  456  RRSVKKFGLRKIKVGTPLAMDMLEAS-YPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  632
             +SVK FGL  +KVGTPLA+DMLE+S   PS+G FRSD+ G V KPLLQFL++TNSFFF 
Sbjct  142  HQSVKTFGLSNVKVGTPLAIDMLESSVLLPSNGTFRSDIAGKVVKPLLQFLNQTNSFFFV  201

Query  633  DV  638
            D+
Sbjct  202  DL  203



>gb|KHG02504.1| putative glucan endo-1,3-beta-glucosidase A6 -like protein [Gossypium 
arboreum]
Length=464

 Score =   195 bits (495),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 122/160 (76%), Gaps = 0/160 (0%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
               ++LI  + AKRVKIYDANP IL AL  + +QVS+MVPN+ + NIS++Q LAD W+++
Sbjct  42   EKSVKLIQSIGAKRVKIYDANPDILNALRGTDLQVSIMVPNQHLTNISTNQKLADSWIQS  101

Query  339  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  518
            NV+PFY + KIRYLLVGNE++S+ P   W+ +VPAMRKI+ ++    L KIKVGT +AM 
Sbjct  102  NVLPFYPKVKIRYLLVGNEVISSSPKEIWYSIVPAMRKIKNALNTHRLNKIKVGTSMAMG  161

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            +LE+S+PPS+G FRSD+   + KP+LQFL RT SF+F DV
Sbjct  162  VLESSFPPSNGTFRSDIAYPIVKPMLQFLSRTKSFYFLDV  201



>ref|XP_007140788.1| hypothetical protein PHAVU_008G142200g [Phaseolus vulgaris]
 gb|ESW12782.1| hypothetical protein PHAVU_008G142200g [Phaseolus vulgaris]
Length=465

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 122/162 (75%), Gaps = 0/162 (0%)
 Frame = +3

Query  153  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWV  332
            P    +  +  L AKRVK+YDANP IL AL ++ +QVSVMVPN++I NISS+Q LAD+WV
Sbjct  41   PARQSVSHLTSLHAKRVKLYDANPAILHALQHTRLQVSVMVPNDLIMNISSNQTLADKWV  100

Query  333  ETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLA  512
             +NV  F   T+IRY+LVGNEI+S+  N TW  +VPAMR+I+ ++K  G+RK+KVGT  A
Sbjct  101  SSNVAAFLPNTRIRYILVGNEIISSTTNATWRHVVPAMRRIKHALKSLGIRKVKVGTSSA  160

Query  513  MDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            MD+L+ S+PPS+ AFR D+   V KP+L+FL+RT SFFF DV
Sbjct  161  MDVLQTSFPPSNAAFREDIAVPVMKPMLKFLNRTKSFFFLDV  202



>gb|ADE76604.1| unknown [Picea sitchensis]
Length=462

 Score =   192 bits (489),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 123/158 (78%), Gaps = 1/158 (1%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            + LI  +KA RVKIYD NP+IL+AL ++G++VSVMV NE I N+SS+Q+ A++WV+ NVV
Sbjct  47   IHLIQRMKAGRVKIYDTNPEILKALSHTGIKVSVMVKNEDIANVSSNQSFANKWVKNNVV  106

Query  348  PFYGETKIRYLLVGNEILSN-PPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDML  524
             FY  T+I  +LVGNEILS+   N TW+QLVPAM +IRR++ ++ L  IKVGTPLAMD+L
Sbjct  107  YFYPATRINIILVGNEILSDYSNNQTWYQLVPAMLRIRRALLRYKLHHIKVGTPLAMDVL  166

Query  525  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
              S+PPSSG FR D+  +V KP+L+FL RT S+FF DV
Sbjct  167  NTSFPPSSGIFRDDVAETVMKPMLEFLSRTRSYFFIDV  204



>ref|XP_010547131.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Tarenaya 
hassleriana]
Length=460

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = +3

Query  162  HDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETN  341
              ++LI  L A RVKIYDAN  IL+AL  + + VSVMVPNEII N+S  QA +D WV   
Sbjct  40   ESVKLIKSLNATRVKIYDANHSILKALNGTDIAVSVMVPNEIIVNVSKSQAQSDDWVRNK  99

Query  342  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  521
            ++PFY  TKIRYLLVGNE+LSNP       LV AM KI+ S+K+FG+ K+KVGT LAMD+
Sbjct  100  ILPFYPTTKIRYLLVGNEVLSNPDPALRSGLVSAMCKIKHSLKRFGVHKVKVGTTLAMDV  159

Query  522  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            L+ SYPPSSG FR D+ G V KP+LQFL++T SF F DV
Sbjct  160  LQTSYPPSSGEFRPDIAGRVMKPMLQFLNKTKSFLFVDV  198



>ref|XP_003552101.2| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Glycine max]
Length=467

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 124/163 (76%), Gaps = 1/163 (1%)
 Frame = +3

Query  153  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWV  332
            P    + LI  + AKRVK+YDANP IL AL ++ +QVS+MVPN++I NIS++Q L+D+WV
Sbjct  42   PPRESVSLITSVHAKRVKLYDANPSILHALQDTRLQVSIMVPNDLILNISTNQTLSDQWV  101

Query  333  ETNVVPFYGETKIRYLLVGNEILSNPPNTT-WFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
              NVVP++  T IRYLLVGNE+ S    T  W  LVPAMR+I+RS+K  G+RKIKVGT  
Sbjct  102  SDNVVPYHPRTLIRYLLVGNEVTSTTAATATWPHLVPAMRRIKRSLKSHGIRKIKVGTSS  161

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            AMD+L+ S+PPS+GAFR DLT  V KP+L+FL+RT SFFF DV
Sbjct  162  AMDVLQTSFPPSNGAFRKDLTAPVMKPMLKFLNRTKSFFFLDV  204



>ref|XP_010552026.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Tarenaya 
hassleriana]
Length=460

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 119/159 (75%), Gaps = 0/159 (0%)
 Frame = +3

Query  162  HDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETN  341
              ++LI  L A RVKIYDA+  IL AL  + + VSVMVPNE+I NIS  +  +D WV TN
Sbjct  40   ESVKLIRSLNATRVKIYDADHSILEALNGTDIAVSVMVPNEMIVNISKSRTQSDNWVLTN  99

Query  342  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  521
            V+PFY  TKI YLLVGNE+LSNP       LVPAMRKI++S+K+ G+ K+KVGT LAMD+
Sbjct  100  VLPFYPTTKILYLLVGNEVLSNPHPELRSGLVPAMRKIKQSLKRLGVHKVKVGTTLAMDV  159

Query  522  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            L+ SYPPSSG FRSD++G V KP+LQFL++T SF F DV
Sbjct  160  LQTSYPPSSGEFRSDISGLVMKPMLQFLNKTKSFLFVDV  198



>ref|XP_010246533.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nelumbo 
nucifera]
Length=466

 Score =   191 bits (484),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 122/160 (76%), Gaps = 3/160 (2%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            ++LI  LKA RVK+YDANP IL+AL  + + VS+MVPN++I NISS Q+LA+ WV TNVV
Sbjct  43   IELIKSLKAGRVKLYDANPDILKALEGTNIHVSIMVPNQLISNISSSQSLANEWVRTNVV  102

Query  348  PFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  518
            PFY +T IRYLLVGNEI    S+    TW+ LV AMR+++ S+K   +R IK+GT  AMD
Sbjct  103  PFYPKTLIRYLLVGNEIFSFYSDQDRQTWYDLVQAMRRLKYSLKIHSIRNIKIGTTAAMD  162

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            +L++S+PPS+G FRSD++  V KPLLQFL+RT S+FF D 
Sbjct  163  VLQSSFPPSNGTFRSDISIPVMKPLLQFLNRTKSYFFLDA  202



>ref|XP_010685101.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Beta 
vulgaris subsp. vulgaris]
Length=467

 Score =   190 bits (483),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 122/160 (76%), Gaps = 3/160 (2%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            ++LI  LKA RVK+Y+ +P+IL+AL  + +QVS+MVPNEII NIS++Q +A+ WV  N+V
Sbjct  43   VELIKSLKAGRVKLYNPDPEILKALNGTNIQVSIMVPNEIISNISTNQTMANEWVHKNLV  102

Query  348  PFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  518
             +Y  T IRYLLVGNEILS        TW  LVPAMRK++ ++K  G+RK+KVGT +AMD
Sbjct  103  AYYPHTLIRYLLVGNEILSLMGEADKKTWHDLVPAMRKLQYALKIHGIRKVKVGTTMAMD  162

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            +LE+S+PPS+G FRSD+  SV +PLLQFL+ T SFFF D 
Sbjct  163  VLESSFPPSNGTFRSDIAVSVMRPLLQFLNNTKSFFFIDC  202



>ref|XP_003541516.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Glycine max]
Length=391

 Score =   188 bits (477),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 122/163 (75%), Gaps = 3/163 (2%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            H  ++L+  +KA RVKIYDANP+ILR L N+ ++VS+M+PN  I  I+++Q++AD WV  
Sbjct  38   HRSIELLTTMKAGRVKIYDANPEILRLLSNTKLKVSIMIPNNEISGIAANQSIADEWVRN  97

Query  339  NVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
            NV+P+Y  T IRYLL+GNE+L   S   +  W  LVPAMR I RS++   +R IK+GTPL
Sbjct  98   NVLPYYPNTMIRYLLMGNEVLSYNSEQGHQMWRDLVPAMRSIERSLRAQNIRDIKIGTPL  157

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            AMD+L++++PPSS AFRSD+  SV  P+L+FLD+T SFFF DV
Sbjct  158  AMDVLQSTFPPSSSAFRSDIRDSVMVPMLKFLDQTKSFFFIDV  200



>ref|XP_006830555.1| hypothetical protein AMTR_s00117p00104410 [Amborella trichopoda]
 gb|ERM97971.1| hypothetical protein AMTR_s00117p00104410 [Amborella trichopoda]
Length=482

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 117/152 (77%), Gaps = 1/152 (1%)
 Frame = +3

Query  186  LKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGET  365
            +K  R+KIYD NP+IL AL N+ +QVSVM+PN+ I NIS+ Q  +D WV+TN++PFY  T
Sbjct  58   IKVSRIKIYDTNPQILHALTNTKIQVSVMLPNQAIQNISATQEASDSWVKTNILPFYPLT  117

Query  366  KIRYLLVGNEILSNPP-NTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPP  542
            +IR +LVGNE+LS+     TW  LVPAM+ I+RS++  G+  IKVGTPLAMD+L+AS+PP
Sbjct  118  RIRTILVGNEVLSDSSIEPTWTMLVPAMQNIKRSLRALGIHNIKVGTPLAMDVLKASFPP  177

Query  543  SSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            SSGAFR D+  +V +PLLQFL +T SFFF D 
Sbjct  178  SSGAFRDDIAETVMRPLLQFLKKTKSFFFLDA  209



>ref|XP_004505110.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cicer arietinum]
Length=462

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 120/163 (74%), Gaps = 3/163 (2%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  ++L+  +KA RVK+YDANP ILR L  + ++VS+M+PN  I  I+++Q++AD WV  
Sbjct  38   YRSIELLTIMKAARVKLYDANPDILRLLSTTKLKVSIMIPNHEISGIAANQSIADEWVRN  97

Query  339  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
            NVVPFY +T IR+LLVGNE+LS      +  W  LVPAMR I+RS+K   +R IK+GTPL
Sbjct  98   NVVPFYPKTMIRFLLVGNEVLSYNSEQGHKMWHDLVPAMRSIKRSLKSLNIRDIKIGTPL  157

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            AMD+L++++PPS G FRSD+  SV  P+L+FLDRT SFFF D 
Sbjct  158  AMDVLQSTFPPSRGTFRSDIRDSVIVPMLKFLDRTKSFFFIDA  200



>ref|XP_004298215.2| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Fragaria 
vesca subsp. vesca]
Length=380

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 119/163 (73%), Gaps = 3/163 (2%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  ++LI  +K  RVK+YDANP+ILR L  + + VS+MVPN  I  I+SDQ+ AD W+  
Sbjct  39   NRSVELIKSMKIGRVKLYDANPEILRLLSGTNISVSIMVPNNEITGIASDQSKADEWIRN  98

Query  339  NVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
            NV+P+Y ET IRYLLVGNEIL   S+     W  +VPAM KI+ S++   +  IK+GTPL
Sbjct  99   NVLPYYPETMIRYLLVGNEILSYFSDQDRRLWHDVVPAMTKIKHSLRAKNITNIKIGTPL  158

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            AMD+L+ S+PPSSGAFRSD++ +V  PLL+FL+RT SFFF DV
Sbjct  159  AMDVLQTSFPPSSGAFRSDVSETVIVPLLRFLNRTKSFFFIDV  201



>gb|KHN47213.1| Putative glucan endo-1,3-beta-glucosidase A6 [Glycine soja]
Length=345

 Score =   182 bits (461),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 117/154 (76%), Gaps = 3/154 (2%)
 Frame = +3

Query  186  LKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGET  365
            +KA RVKIYDANP+ILR L N+ ++VS+M+PN  I  I+++Q++AD WV  NV+P+Y  T
Sbjct  1    MKAGRVKIYDANPEILRLLSNTKLKVSIMIPNNEISGIAANQSIADEWVRNNVLPYYPNT  60

Query  366  KIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASY  536
             IRYLL+GNE+LS      +  W  LVPAMR I RS++   +R IK+GTPLAMD+L++++
Sbjct  61   MIRYLLMGNEVLSYNSEQGHQMWRDLVPAMRSIERSLRAQNIRDIKIGTPLAMDVLQSTF  120

Query  537  PPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            PPSS AFRSD+  SV  P+L+FLD+T SFFF DV
Sbjct  121  PPSSSAFRSDIRDSVMVPMLKFLDQTKSFFFIDV  154



>gb|KEH30957.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=462

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 119/163 (73%), Gaps = 3/163 (2%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  ++L+  +KA RVK+YDANP ILR L  + ++VS+M+PN  I  I+++Q++AD WV  
Sbjct  38   YRSIELLTTMKAGRVKLYDANPDILRLLSTTKLKVSIMIPNHEISGIAANQSIADEWVRN  97

Query  339  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
            N++P+Y  T  RYLLVGNE+LS      +  W  LVPAMR I+R++    +R IK+GTPL
Sbjct  98   NILPYYPNTLFRYLLVGNEVLSYNSEQGHKMWHDLVPAMRSIKRALNSQNIRGIKIGTPL  157

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            AMD+LE+++PPSSG FRSD+  SV  P+L+FL+RTNSFFF D 
Sbjct  158  AMDVLESTFPPSSGTFRSDIRDSVMAPMLKFLNRTNSFFFIDA  200



>emb|CAN60692.1| hypothetical protein VITISV_007558 [Vitis vinifera]
Length=404

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 121/162 (75%), Gaps = 3/162 (2%)
 Frame = +3

Query  162  HDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETN  341
              ++LI  +KA RVK+YDANP+IL  L  + +QVS+MVPN+ I NISS+Q LAD+WV  N
Sbjct  39   QSIELIKSMKAGRVKLYDANPEILNLLSGTKIQVSIMVPNQEISNISSNQTLADQWVRDN  98

Query  342  VVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLA  512
            V+ +Y +T IR+++VGNE+L   S+    TW  LVPAMR+I++S++   +  IKVGT +A
Sbjct  99   VLSYYPQTMIRFIVVGNEVLSYYSDRDRETWSNLVPAMRRIKKSLQANNIPNIKVGTSVA  158

Query  513  MDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            MD++E+S+PPSSG FRSD+  +V  PLL+FL  TNSFFF DV
Sbjct  159  MDVMESSFPPSSGMFRSDILDTVMVPLLEFLSGTNSFFFLDV  200



>ref|XP_007199923.1| hypothetical protein PRUPE_ppa006984mg [Prunus persica]
 gb|EMJ01122.1| hypothetical protein PRUPE_ppa006984mg [Prunus persica]
Length=387

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +3

Query  267  VMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAM  446
            +MVPNE+I NISS+Q LAD+WV  NVVPFY ET IRYLLVGNEILS P  T WF LVPAM
Sbjct  1    MMVPNELINNISSNQTLADQWVHANVVPFYPETLIRYLLVGNEILSQPDKTIWFNLVPAM  60

Query  447  RKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFF  626
            RKI+ ++K  G+ K+KVGTPLAMD+LE+S+PPS+G FRSD++ SV KPLLQF+++T SFF
Sbjct  61   RKIKAALKTHGITKVKVGTPLAMDVLESSFPPSNGTFRSDISTSVIKPLLQFVNKTKSFF  120

Query  627  FFDV  638
            F DV
Sbjct  121  FVDV  124



>ref|XP_003632055.1| PREDICTED: LOW QUALITY PROTEIN: probable glucan endo-1,3-beta-glucosidase 
A6 [Vitis vinifera]
Length=474

 Score =   183 bits (464),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 121/162 (75%), Gaps = 3/162 (2%)
 Frame = +3

Query  162  HDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETN  341
              ++LI  +KA RVK+YDANP+IL  L  + +QVS+MVPN+ I NISS+Q LAD+WV  N
Sbjct  51   QSIELIKSMKAGRVKLYDANPEILNLLSGTKIQVSIMVPNQEISNISSNQTLADQWVRDN  110

Query  342  VVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLA  512
            V+ +Y +T IR+++VGNE+L   S+    TW  LVPAMR+I++S++   +  IKVGT +A
Sbjct  111  VLSYYPQTMIRFIVVGNEVLSYYSDRDRETWSNLVPAMRRIKKSLQANNIPNIKVGTSVA  170

Query  513  MDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            MD++E+S+PPSSG FRSD+  +V  PLL+FL  TNSFFF DV
Sbjct  171  MDVMESSFPPSSGMFRSDILDTVMVPLLEFLSGTNSFFFLDV  212



>ref|XP_007153895.1| hypothetical protein PHAVU_003G073900g [Phaseolus vulgaris]
 gb|ESW25889.1| hypothetical protein PHAVU_003G073900g [Phaseolus vulgaris]
Length=368

 Score =   179 bits (455),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 119/163 (73%), Gaps = 3/163 (2%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
               ++L+  +KA  VK+YDANP+ILR L  + ++VS+M+PN  I  I+++Q++AD WV  
Sbjct  38   QRSIELLTSMKAGLVKLYDANPEILRLLSTTKLKVSIMIPNNEIAGIATNQSMADEWVRN  97

Query  339  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
            NV+P+Y +T IRYLLVGNE+LS      +  W  LVPAMR I RS+K   +R IK+GTPL
Sbjct  98   NVLPYYPKTLIRYLLVGNEVLSYNSEQGHQMWNDLVPAMRNIERSLKGQNIRDIKIGTPL  157

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            AMD+L++++PPSSG FR D+  SV  P+L+FL+RT SFFF D+
Sbjct  158  AMDVLQSTFPPSSGTFRPDVRDSVMAPMLKFLNRTKSFFFIDI  200



>ref|XP_006299757.1| hypothetical protein CARUB_v10015952mg [Capsella rubella]
 gb|EOA32655.1| hypothetical protein CARUB_v10015952mg [Capsella rubella]
Length=476

 Score =   180 bits (457),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 118/163 (72%), Gaps = 3/163 (2%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  + LI  +KA  VK+YDA+P+ L+ L  + + V++MVPN+ I ++ SDQA AD+WV T
Sbjct  52   YQSINLIKTIKAGHVKLYDADPETLKLLSKTNLYVTIMVPNDQIISVGSDQAAADKWVAT  111

Query  339  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
            NV+PFY +T+IR++LVGNE+LS   +     W  LVPAMRK+  S++  G+  IKVGTPL
Sbjct  112  NVLPFYPQTRIRFVLVGNEVLSYSSDQDKQIWANLVPAMRKVVNSLRARGIHNIKVGTPL  171

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            AMD L +S+PPSSGAFR DL   V  PLL+FL+ TNSFFF DV
Sbjct  172  AMDALRSSFPPSSGAFREDLAVPVMLPLLKFLNGTNSFFFLDV  214



>ref|XP_010488453.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=476

 Score =   179 bits (455),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 117/163 (72%), Gaps = 3/163 (2%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  + LI  LKA  VK+YDA+P+ L+ L  + + V++MVPN+ I +I +DQA AD W+ T
Sbjct  52   YQSINLIKSLKAGHVKLYDADPETLKLLSKTNLYVTIMVPNDQIISIGADQATADNWIAT  111

Query  339  NVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
            NV+PFY +T+IR++LVGNEIL   S+     W  LVPAMRK+  S++  G+  IKVGTPL
Sbjct  112  NVLPFYPQTRIRFVLVGNEILSYSSDQDKQIWANLVPAMRKVVNSLRARGIHNIKVGTPL  171

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            AMD L +S+PPSSGAFR D+   V  PLL+FL+ TNSFFF DV
Sbjct  172  AMDALRSSFPPSSGAFREDIAVPVMLPLLKFLNGTNSFFFLDV  214



>ref|XP_002520622.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF41758.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=463

 Score =   179 bits (454),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 117/163 (72%), Gaps = 3/163 (2%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  +Q++  +   RVK+YDANP+ILR L  + +QVSVMVPN  I NI+S+Q +A  WV  
Sbjct  43   YRSIQILQSMNTGRVKLYDANPEILRLLAGTKIQVSVMVPNNEINNIASNQTIAHNWVRE  102

Query  339  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
            NV+ +Y  T IR++LVGNEILS   +     W  LVPAMRKI+ S++   ++ IKVGTPL
Sbjct  103  NVLQYYPNTMIRFILVGNEILSYSSDQDKKIWSNLVPAMRKIKNSLRSHNIQNIKVGTPL  162

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            AMD+L+ + PPS+G FRSD++G+V  PLL+FL+ T SFFF DV
Sbjct  163  AMDVLQTTSPPSNGTFRSDISGTVILPLLKFLNGTKSFFFIDV  205



>ref|XP_006830552.1| hypothetical protein AMTR_s00117p00097230 [Amborella trichopoda]
 gb|ERM97968.1| hypothetical protein AMTR_s00117p00097230 [Amborella trichopoda]
Length=464

 Score =   179 bits (454),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 116/152 (76%), Gaps = 1/152 (1%)
 Frame = +3

Query  186  LKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGET  365
            LK  RVK+Y+  P IL+AL N+ +QV++MVPN+ IPNIS  Q ++D WV+ N++PFY +T
Sbjct  51   LKVPRVKLYEPRPDILQALSNTNIQVTIMVPNQAIPNISLSQNVSDSWVKINLLPFYPKT  110

Query  366  KIRYLLVGNEILSNPP-NTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPP  542
            +I+ LLVGNE+LS+P   TTW  LVPAMR ++ S++   +  IKVGT LAMD LE+S+PP
Sbjct  111  RIQTLLVGNEVLSDPSIKTTWSMLVPAMRNLKYSLRALDVGSIKVGTTLAMDTLESSFPP  170

Query  543  SSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            S+G FRSD+   V KPLLQFL++T SF+F DV
Sbjct  171  SNGTFRSDIAVPVIKPLLQFLNKTKSFYFVDV  202



>ref|XP_010466734.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=474

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 117/163 (72%), Gaps = 3/163 (2%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  + LI  LKA  VK+YDA+P+ L+ L  + + V++MVPN+ I +I +DQA AD WV T
Sbjct  52   YQSINLIKSLKAGHVKLYDADPETLKLLSKTNLYVTIMVPNDQIISIGADQATADNWVAT  111

Query  339  NVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
            NV+PFY +T+IR++LVGNEIL   S+     W  LVPAMRK+  S++  G+  IKVGTPL
Sbjct  112  NVLPFYPQTRIRFVLVGNEILSYSSDQDKQIWANLVPAMRKVVNSLRVRGIHNIKVGTPL  171

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            AMD L +S+PPSSGAFR D+   V  PLL+FL+ TNSFFF DV
Sbjct  172  AMDALRSSFPPSSGAFREDIAVPVMLPLLKFLNGTNSFFFLDV  214



>emb|CDY08004.1| BnaC03g35190D [Brassica napus]
Length=460

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            ++LI  L AKRVK+YDANP IL AL  + + VSVMVPNE+I NIS   +L+D W+ +N++
Sbjct  42   VKLIQSLNAKRVKLYDANPAILAALNATDITVSVMVPNELIVNISKSSSLSDEWIRSNIL  101

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  527
            PF+  TKIRYLLVGNEIL++  +     LVPAMRKI+RS+KK G++K+KVGT LA+D+L+
Sbjct  102  PFHPSTKIRYLLVGNEILTSADSELKSALVPAMRKIQRSLKKLGVKKVKVGTTLAVDVLK  161

Query  528  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             S+PPSSG FRSD++GSV KP+LQFL+RT SF F DV
Sbjct  162  TSFPPSSGEFRSDISGSVMKPMLQFLNRTKSFLFVDV  198



>emb|CDX74052.1| BnaA03g29950D [Brassica napus]
Length=567

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 123/157 (78%), Gaps = 0/157 (0%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            ++LI  L AKRVK+YDANP IL AL  + + VSVMVPNE+I NIS    L+D W+ +N++
Sbjct  42   VKLIQSLNAKRVKLYDANPAILAALNATDITVSVMVPNELIVNISKSSTLSDEWIRSNIL  101

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  527
            PF+  TKIRYLLVGNEILS+  +     LVPAMRKI+RS+KK  ++K+KVGT LA+D+L+
Sbjct  102  PFHPTTKIRYLLVGNEILSSADSELKSALVPAMRKIQRSLKKLSVKKVKVGTTLAVDVLK  161

Query  528  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             S+PPSSG FRSD++GSV KP+LQFL+RT SF F DV
Sbjct  162  TSFPPSSGEFRSDISGSVMKPMLQFLNRTKSFLFVDV  198



>ref|XP_009373620.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Pyrus 
x bretschneideri]
Length=469

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 117/164 (71%), Gaps = 4/164 (2%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  ++L+  + A RVK+YDA+P+IL+ L  + +QVS+MVPN  I  I+SDQ  AD WV  
Sbjct  38   NRSIELLMAMNAGRVKLYDADPEILKLLSGTNLQVSIMVPNNEISTIASDQIKADEWVRN  97

Query  339  NVVPFYGETKIRYLLVGNEIL----SNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTP  506
            NV+P+Y ET IRYLL+GNE+L    S+     W+ LVPAM KI+ S+K   +  IKVGTP
Sbjct  98   NVLPYYPETMIRYLLIGNEVLSYNSSDQDRQMWYDLVPAMSKIKSSLKSQNITNIKVGTP  157

Query  507  LAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            LAMD L++++PPS   FR+D++ +V  P+L+FL+RT SFFF DV
Sbjct  158  LAMDALQSTFPPSKATFRADISDTVMAPMLRFLNRTKSFFFIDV  201



>ref|XP_009134961.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=460

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 124/157 (79%), Gaps = 0/157 (0%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            ++LI  L AKRVK+YDANP IL AL  + + VSVM PNE++ NIS   +L+D W+ +N++
Sbjct  42   VKLIQSLNAKRVKLYDANPAILAALNATDITVSVMDPNELLVNISKSSSLSDEWITSNIL  101

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  527
            PF+  TKIRYLLVGNEILS+  +     LVPAMRKI+RS+KK G++K+KVGT LA+D+LE
Sbjct  102  PFHPTTKIRYLLVGNEILSSTDSELKSALVPAMRKIQRSLKKLGVKKVKVGTTLAVDVLE  161

Query  528  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             S+PPSSG FRSD++GSV KP+LQFL+RT SF F DV
Sbjct  162  TSFPPSSGEFRSDISGSVMKPMLQFLNRTKSFLFVDV  198



>ref|XP_007221306.1| hypothetical protein PRUPE_ppa016789mg, partial [Prunus persica]
 gb|EMJ22505.1| hypothetical protein PRUPE_ppa016789mg, partial [Prunus persica]
Length=452

 Score =   177 bits (449),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 115/164 (70%), Gaps = 4/164 (2%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  ++ I  + A RVK+YDANP+IL  L  + +QVS+MVPN  I  I+S+QA AD WV  
Sbjct  22   NSSVEFIKSMNAGRVKLYDANPEILNLLSGTNLQVSIMVPNNEISTIASNQAKADEWVRN  81

Query  339  NVVPFYGETKIRYLLVGNEIL----SNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTP  506
            NV+P+Y +T IRYLLVGNE+L    S+     W  LVPAM K + S+K   +  IKVGTP
Sbjct  82   NVLPYYPQTMIRYLLVGNEVLSYNSSDQDRQMWLDLVPAMTKFKSSLKAQNITNIKVGTP  141

Query  507  LAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            LAMD+LE+++PPS+  FR D++ SV  P+L+FL+RTNSF F DV
Sbjct  142  LAMDVLESTFPPSNSMFRPDISNSVMAPMLRFLNRTNSFMFIDV  185



>ref|XP_010023613.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Eucalyptus 
grandis]
 gb|KCW59922.1| hypothetical protein EUGRSUZ_H02646 [Eucalyptus grandis]
Length=440

 Score =   176 bits (447),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 123/165 (75%), Gaps = 8/165 (5%)
 Frame = +3

Query  162  HDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETN  341
              ++ I  ++A+RVK+YDA+P+IL+ L  + VQVS+MV N+ IP ++S QALAD+WV  N
Sbjct  17   QSVERIQLMRARRVKLYDADPEILKLLSRTQVQVSIMVQNQEIPGVASSQALADKWVRNN  76

Query  342  VVPFYGETKIRYLLVGNEILSNPPNTT------WFQLVPAMRKIRRSVKKFGLRKIKVGT  503
            V+P+Y  T IR++LVGNE+LS   N+T      W  LVPAMR+I+ S++   +R IKVGT
Sbjct  77   VLPYYPRTMIRFILVGNEVLSY--NSTDRDRQLWGDLVPAMRRIKSSLRSNRIRNIKVGT  134

Query  504  PLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            P+AMD++E+++PPSSG FRSD+  SV  PL++FL+ T S+FF DV
Sbjct  135  PMAMDVVESTFPPSSGRFRSDVAESVIMPLVRFLNSTRSYFFLDV  179



>ref|XP_006418839.1| hypothetical protein EUTSA_v10002513mg [Eutrema salsugineum]
 gb|ESQ37275.1| hypothetical protein EUTSA_v10002513mg [Eutrema salsugineum]
Length=474

 Score =   177 bits (448),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 117/163 (72%), Gaps = 3/163 (2%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  + LI  LKA  VK+YDA+P+ L+ L  + + V++MVPN  I ++ SD+A AD WV T
Sbjct  50   YQSINLIKSLKAGHVKLYDADPETLKLLSQTNLYVTIMVPNNQIISVGSDKAAADNWVNT  109

Query  339  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
            NV+P++ +T+IR++LVGNEILS   +     W  LVPAMRKI  S++  G+  IKVGTPL
Sbjct  110  NVLPYHPQTRIRFVLVGNEILSYSSDQDKQIWSNLVPAMRKIVNSLRARGIHNIKVGTPL  169

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            AMD+L +S+PPSSG FR ++T  V  PLL+FL+ TNSFFF DV
Sbjct  170  AMDVLRSSFPPSSGTFREEITAPVISPLLKFLNGTNSFFFLDV  212



>ref|XP_009411847.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=455

 Score =   176 bits (447),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 114/159 (72%), Gaps = 2/159 (1%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            + L+  L A  VKIYDANP IL AL  +G++VS+MVPNEI+P++ ++ +LAD WV  N+ 
Sbjct  29   VALLQSLGAGAVKIYDANPAILCALAGTGLRVSIMVPNEIVPSLGANASLADAWVADNLA  88

Query  348  PFYGETKIRYLLVGNEILSNP--PNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  521
            PFY   ++RY+LVGNEILS+    N+TW  LVPAM  I R+++   +  +KVGT LAMD 
Sbjct  89   PFYPAVRVRYVLVGNEILSDASLANSTWPFLVPAMANIHRALRARSVCDVKVGTTLAMDA  148

Query  522  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            L  ++PPS+GAFR+D+ G V +PLL FL RT S++F D 
Sbjct  149  LATAFPPSAGAFRADIAGPVMRPLLDFLSRTRSYYFVDA  187



>ref|XP_008222761.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Prunus 
mume]
Length=477

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 116/161 (72%), Gaps = 4/161 (2%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            ++LI  + A RVK+YDANP+IL  L  + +QVS+MVPN  I  I+S+QA AD WV  NV+
Sbjct  50   IELIKSMNAGRVKLYDANPEILNLLSGTNLQVSIMVPNSEISIIASNQAKADEWVRNNVL  109

Query  348  PFYGETKIRYLLVGNEIL----SNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAM  515
            P+Y +T IRYLLVGNE+L    S+     W  LVPAM KI+ S+K   +  IKVGTPLA+
Sbjct  110  PYYPQTMIRYLLVGNEVLSYNSSDQDRQMWLDLVPAMTKIKSSLKAQNITNIKVGTPLAI  169

Query  516  DMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            D+L++++PPS+  FR D++ SV  P+L+FL+RTNSF F DV
Sbjct  170  DVLQSTFPPSNSMFRPDISNSVMAPMLRFLNRTNSFMFIDV  210



>ref|XP_009411846.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=469

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 114/159 (72%), Gaps = 2/159 (1%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            + L+  L A  VKIYDANP IL AL  +G++VS+MVPNEI+P++ ++ +LAD WV  N+ 
Sbjct  43   VALLQSLGAGAVKIYDANPAILCALAGTGLRVSIMVPNEIVPSLGANASLADAWVADNLA  102

Query  348  PFYGETKIRYLLVGNEILSNP--PNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  521
            PFY   ++RY+LVGNEILS+    N+TW  LVPAM  I R+++   +  +KVGT LAMD 
Sbjct  103  PFYPAVRVRYVLVGNEILSDASLANSTWPFLVPAMANIHRALRARSVCDVKVGTTLAMDA  162

Query  522  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            L  ++PPS+GAFR+D+ G V +PLL FL RT S++F D 
Sbjct  163  LATAFPPSAGAFRADIAGPVMRPLLDFLSRTRSYYFVDA  201



>emb|CDP15106.1| unnamed protein product [Coffea canephora]
Length=470

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 119/161 (74%), Gaps = 1/161 (1%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            HH + L+  + A RVKIYDANP++L+ L  + +Q S+M+ + +IP+I+SDQ++AD+WV  
Sbjct  46   HHSINLLQSMNASRVKIYDANPEVLKLLSGTKLQASIMIQDGLIPDIASDQSIADQWVRD  105

Query  339  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  518
            NV+ +Y +T IR++LVGNEILS+     W+ LVPAM +I  S+K   ++ IKVGTP+AMD
Sbjct  106  NVLAYYPQTMIRFVLVGNEILSSNNTLLWYNLVPAMVRIHNSIKAQNIQNIKVGTPVAMD  165

Query  519  MLEASYPPSSGAFRSD-LTGSVFKPLLQFLDRTNSFFFFDV  638
            +LE+++PPSSG FR + L   V  PLL FL++T SFFF +V
Sbjct  166  ILESTFPPSSGKFRPEILNHQVTVPLLSFLNKTRSFFFVNV  206



>ref|XP_010512882.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=476

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 116/163 (71%), Gaps = 3/163 (2%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  + LI  LKA  VK+YDA+P+ L+ L  + + V++MVPN+ I +I +DQA AD W+ T
Sbjct  52   YQSINLIKSLKAGHVKLYDADPETLKLLSKTNLYVTIMVPNDQIISIGADQATADNWIAT  111

Query  339  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
            NV+PF  +T+IR++LVGNEILS   +     W  LVPAMRK+  S++  G+  IKVGTPL
Sbjct  112  NVLPFSPQTRIRFVLVGNEILSYSSDQDKQIWANLVPAMRKVVNSLRARGIHNIKVGTPL  171

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            AMD L +S+PPSSGAFR D+   V  PLL+FL+ TNSFFF DV
Sbjct  172  AMDALRSSFPPSSGAFREDIAVPVMLPLLKFLNGTNSFFFLDV  214



>gb|AEN82021.1| AT3G23770-like protein, partial [Capsella rubella]
 gb|AEN82022.1| AT3G23770-like protein, partial [Capsella rubella]
 gb|AEN82024.1| AT3G23770-like protein, partial [Capsella rubella]
 gb|AEN82028.1| AT3G23770-like protein, partial [Capsella rubella]
Length=165

 Score =   167 bits (424),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 108/147 (73%), Gaps = 3/147 (2%)
 Frame = +3

Query  207  IYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLV  386
            +YDA+P+ L+ L  + + V++MVPN+ I ++ SDQA AD WV TNV+PFY +T+IR++LV
Sbjct  1    LYDADPETLKLLSKTNLYVTIMVPNDQIISVGSDQAAADNWVATNVLPFYPQTRIRFVLV  60

Query  387  GNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAF  557
            GNE+LS   +     W  LVPAMRK+  S++  G+  IKVGTPLAMD L +S+PPSSGAF
Sbjct  61   GNEVLSYSSDQDKQIWANLVPAMRKVVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGAF  120

Query  558  RSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            R DL   V  PLL+FL+ TNSFFF DV
Sbjct  121  REDLAVPVMLPLLKFLNGTNSFFFLDV  147



>ref|XP_002444717.1| hypothetical protein SORBIDRAFT_07g026540 [Sorghum bicolor]
 gb|EES14212.1| hypothetical protein SORBIDRAFT_07g026540 [Sorghum bicolor]
Length=484

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 121/192 (63%), Gaps = 8/192 (4%)
 Frame = +3

Query  81   CHLFPAQISQLRS---EYATVNWATTFPH-HHDLQLIHGLKAKRVKIYDANPKILRALGN  248
            CH   A  +  R     Y TV  A   P     +QL+    A  VKIYDAN  ILRAL  
Sbjct  35   CHCHGANGNGCRGLGINYGTV--ADDLPSASRSVQLLRATGAGAVKIYDANADILRALAG  92

Query  249  SGVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPP--NTT  422
            +G+ VS+MVPN  IP+++S +A A+ WV  N+ P    T++ YLLVGNE+LSN     +T
Sbjct  93   TGMPVSIMVPNSAIPSLASSRAAAEDWVAANLAPHIPATRVAYLLVGNEVLSNRAIAGST  152

Query  423  WFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQF  602
            W  +VPAM  + R+++  G+RK+K+GT LAMD L ASYPPS+GAFR D+   V +PLL+F
Sbjct  153  WRSVVPAMANLHRALRAHGIRKVKIGTTLAMDALSASYPPSAGAFRDDIAEDVVRPLLRF  212

Query  603  LDRTNSFFFFDV  638
            L+ T S++F D 
Sbjct  213  LNATGSYYFVDA  224



>ref|XP_002883459.1| hypothetical protein ARALYDRAFT_479892 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59718.1| hypothetical protein ARALYDRAFT_479892 [Arabidopsis lyrata subsp. 
lyrata]
Length=476

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 115/163 (71%), Gaps = 3/163 (2%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  + LI  LKA  VK+YDA+P+ L+ L  + + V++MVPN  I +I +DQA AD WV T
Sbjct  52   YQSINLIKTLKAGHVKLYDADPETLKLLSKTNLYVTIMVPNNQIISIGADQAAADNWVAT  111

Query  339  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
            NV+P+Y +T+IR++LVGNEILS   +     W  LVPAMRK+  S++  G+  IKVGTPL
Sbjct  112  NVLPYYPQTRIRFVLVGNEILSYNTDQDKQIWANLVPAMRKVVNSLRARGIHNIKVGTPL  171

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            AMD L +S+PPSSG FR D+   V  PLL+FL+ TNSFFF DV
Sbjct  172  AMDALRSSFPPSSGTFREDIAVPVMLPLLKFLNGTNSFFFLDV  214



>gb|AEN82027.1| AT3G23770-like protein, partial [Capsella rubella]
Length=165

 Score =   167 bits (422),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 108/147 (73%), Gaps = 3/147 (2%)
 Frame = +3

Query  207  IYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLV  386
            +YDA+P+ L+ L  + + V++MVPN+ I ++ +DQA AD WV TNV+PFY +T+IR++LV
Sbjct  1    LYDADPETLKLLSKTNLYVTIMVPNDQIISVGTDQAAADNWVATNVLPFYPQTRIRFVLV  60

Query  387  GNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAF  557
            GNE+LS   +     W  LVPAMRK+  S++  G+  IKVGTPLAMD L +S+PPSSGAF
Sbjct  61   GNEVLSYSSDQDKQIWANLVPAMRKVVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGAF  120

Query  558  RSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            R DL   V  PLL+FL+ TNSFFF DV
Sbjct  121  REDLAVPVMLPLLKFLNGTNSFFFLDV  147



>ref|XP_008380636.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Malus 
domestica]
Length=469

 Score =   174 bits (442),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 115/164 (70%), Gaps = 4/164 (2%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  ++L+  + A RVK+YDA+ +IL+ L  + +QVS+MVPN  I  I SDQ  AD WV  
Sbjct  38   NRSIELLKAMNAGRVKLYDADLEILKLLSGTNLQVSIMVPNNEISTIXSDQTKADEWVRN  97

Query  339  NVVPFYGETKIRYLLVGNEIL----SNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTP  506
            NV+P+Y ET IRYLL+GNE+L    S+     W+ LVPAM KI+ S+K   +  IKVGTP
Sbjct  98   NVLPYYPETMIRYLLIGNEVLSYNSSDQDRQMWYDLVPAMSKIKSSLKSQNITNIKVGTP  157

Query  507  LAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            LAMD L++++PPS   FR+D++ +V  P+L+FL+RT SFFF DV
Sbjct  158  LAMDALQSTFPPSKATFRADISDTVMAPMLRFLNRTRSFFFIDV  201



>gb|KJB10880.1| hypothetical protein B456_001G230200 [Gossypium raimondii]
Length=386

 Score =   173 bits (438),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = +3

Query  270  MVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMR  449
            MVPNEII NIS+ Q LAD WVETNVVPFY  TKIRYLLVGNE++S  P   W  +VPAMR
Sbjct  1    MVPNEIINNISTSQKLADSWVETNVVPFYSTTKIRYLLVGNEVISGSPKDIWPNIVPAMR  60

Query  450  KIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFF  629
            KI++S+K  GL KIKV T +AMD+LE+S+PPS+G FRSD+  S+ +PLLQFL RT SF+F
Sbjct  61   KIKKSLKTHGLDKIKVSTSMAMDVLESSFPPSNGTFRSDIADSIVRPLLQFLHRTKSFYF  120

Query  630  FDV  638
             DV
Sbjct  121  LDV  123



>gb|KFK39673.1| a6 anther-specific protein [Arabis alpina]
Length=474

 Score =   174 bits (442),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 115/163 (71%), Gaps = 3/163 (2%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  + LI  +KA  VK+YDA+P+ L  L  + + V++MVPN+ I +I SDQ+ AD WV T
Sbjct  50   YQSINLIKSIKAGHVKLYDADPETLMLLAQTNLYVTIMVPNDHIISIGSDQSAADNWVAT  109

Query  339  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
            +V+P+Y  T+IR++LVGNEILS   +     W  LVPAMRKI  S++  G+  IKVGTPL
Sbjct  110  SVIPYYPATRIRFVLVGNEILSYSSDQDKQIWTNLVPAMRKIVNSLRARGIHNIKVGTPL  169

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            AMD+L +S+PPSSG FR D+   V  PLL+FL+ TNSFFF DV
Sbjct  170  AMDVLRSSFPPSSGTFREDVAAPVMLPLLKFLNGTNSFFFLDV  212



>ref|XP_009385472.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009385473.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Musa 
acuminata subsp. malaccensis]
Length=474

 Score =   174 bits (442),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 113/159 (71%), Gaps = 2/159 (1%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            + L+H + A  VKIYDANP ILRAL  +  +VS+MVPNEIIP++  + + AD WV TN+ 
Sbjct  48   VHLLHSIGAGAVKIYDANPAILRALAGTRFRVSIMVPNEIIPSLGVNASAADAWVGTNLG  107

Query  348  PFYGETKIRYLLVGNEILS--NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  521
            PFY   ++RYLLVGNEILS  +  N+TW  LVPAM  I R++    +R +KVGT LAMD 
Sbjct  108  PFYPAVRVRYLLVGNEILSYTSLANSTWPFLVPAMVNIHRALSARSIRDVKVGTTLAMDA  167

Query  522  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            L  S+PPS+GAFRSD+   V +PLL+FL RT S++F D 
Sbjct  168  LVTSFPPSAGAFRSDIAEPVMRPLLRFLHRTRSYYFVDA  206



>ref|XP_002534357.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF28022.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=388

 Score =   172 bits (437),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = +3

Query  270  MVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMR  449
            MVPNE+I NIS  Q+L+D+WV +NVVPFY + KIRYLL+GNEIL+NP   TWF LVPAMR
Sbjct  1    MVPNELIANISKSQSLSDQWVNSNVVPFYPDVKIRYLLIGNEILTNPDTGTWFNLVPAMR  60

Query  450  KIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFF  629
            +I+ S++   + KIKV TP AM++LE+S+PPS+G FRSD++G + KP+LQFL+RT SFFF
Sbjct  61   RIKSSLRTHKIHKIKVSTPHAMNVLESSFPPSNGTFRSDISGPIIKPMLQFLNRTKSFFF  120

Query  630  FDV  638
             DV
Sbjct  121  LDV  123



>ref|NP_189019.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 dbj|BAB01853.1| beta-1,3-glucanase [Arabidopsis thaliana]
 gb|ABE65959.1| glycosyl hydrolase family 17 protein [Arabidopsis thaliana]
 gb|AEE76811.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=476

 Score =   174 bits (442),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 123/184 (67%), Gaps = 4/184 (2%)
 Frame = +3

Query  96   AQISQLRSEYATVNWATTFPHHHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMV  275
            A  S++   Y  +     FP+   + LI  +KA  VK+YDA+P+ L+ L  + + V++MV
Sbjct  32   ALASRIGINYGKLGNNLPFPYQ-SINLIKTIKAGHVKLYDADPETLKLLSTTNLYVTIMV  90

Query  276  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAM  446
            PN  I +I +DQA AD WV TNV+PF+ +T+IR++LVGNE+LS   +     W  LVPAM
Sbjct  91   PNNQIISIGADQAAADNWVATNVLPFHPQTRIRFVLVGNEVLSYSSDQDKQIWANLVPAM  150

Query  447  RKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFF  626
            RK+  S++  G+  IKVGTPLAMD L +S+PPSSG FR D+   V  PLL+FL+ TNSFF
Sbjct  151  RKVVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGTFREDIAVPVMLPLLKFLNGTNSFF  210

Query  627  FFDV  638
            F DV
Sbjct  211  FLDV  214



>ref|XP_009102583.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=478

 Score =   174 bits (442),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 113/163 (69%), Gaps = 3/163 (2%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  + LI  LKA  VK+YDA+ + L  L  + + V++MVPN  I  I +DQ  AD WV T
Sbjct  54   YQSINLIKTLKAGHVKLYDADQETLTLLSKTNLYVTIMVPNNQIITIGADQTAADNWVNT  113

Query  339  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
            NV+P Y +T+IR++LVGNEILS   +    TW  LVPAMRKI  S++  G+  IKVGTPL
Sbjct  114  NVLPHYPQTRIRFVLVGNEILSYNSDQDKQTWANLVPAMRKIVNSLRARGIHNIKVGTPL  173

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            AMD+L +SYPPSSGAFR ++   V  PLL+FL+ TNSFFF DV
Sbjct  174  AMDVLRSSYPPSSGAFREEVAAPVMLPLLKFLNGTNSFFFLDV  216



>gb|ABK28569.1| unknown [Arabidopsis thaliana]
Length=477

 Score =   174 bits (441),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 123/184 (67%), Gaps = 4/184 (2%)
 Frame = +3

Query  96   AQISQLRSEYATVNWATTFPHHHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMV  275
            A  S++   Y  +     FP+   + LI  +KA  VK+YDA+P+ L+ L  + + V++MV
Sbjct  32   ALASRIGINYGKLGNNLPFPYQ-SINLIKTIKAGHVKLYDADPETLKLLSTTNLYVTIMV  90

Query  276  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAM  446
            PN  I +I +DQA AD WV TNV+PF+ +T+IR++LVGNE+LS   +     W  LVPAM
Sbjct  91   PNNQIISIGADQAAADNWVATNVLPFHPQTRIRFVLVGNEVLSYSSDQDKQIWANLVPAM  150

Query  447  RKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFF  626
            RK+  S++  G+  IKVGTPLAMD L +S+PPSSG FR D+   V  PLL+FL+ TNSFF
Sbjct  151  RKVVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGTFREDIAVPVMLPLLKFLNGTNSFF  210

Query  627  FFDV  638
            F DV
Sbjct  211  FLDV  214



>emb|CDY59775.1| BnaCnng35540D [Brassica napus]
Length=474

 Score =   174 bits (441),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 113/163 (69%), Gaps = 3/163 (2%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  + LI  LKA  VK+YDA+ + L  L  + + V++MVPN  I  I +DQ  AD WV T
Sbjct  50   YQSINLIKTLKAGHVKLYDADQETLTLLSKTNLYVTIMVPNNQIITIGADQTAADNWVNT  109

Query  339  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
            NV+P Y +T+IR++LVGNEILS   +    TW  LVPAMRKI  S++  G+  IKVGTPL
Sbjct  110  NVLPHYPQTRIRFVLVGNEILSYNSDQDKQTWANLVPAMRKIVNSLRARGIHNIKVGTPL  169

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            AMD+L +SYPPSSGAFR ++   V  PLL+FL+ TNSFFF DV
Sbjct  170  AMDVLRSSYPPSSGAFREEVAAPVMLPLLKFLNGTNSFFFLDV  212



>ref|XP_006421038.1| hypothetical protein CICLE_v10004917mg [Citrus clementina]
 gb|ESR34278.1| hypothetical protein CICLE_v10004917mg [Citrus clementina]
Length=466

 Score =   174 bits (440),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 115/163 (71%), Gaps = 3/163 (2%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  ++ I  LKA  VKIYDANP+IL+ L  + ++VS+MV N  I +I+S Q +AD+WV  
Sbjct  43   YQSIESIKFLKAGSVKIYDANPEILKLLSGTDLKVSIMVQNHEIIDIASKQKVADQWVHD  102

Query  339  NVVPFYGETKIRYLLVGNEILSNPPNT---TWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
            NV+ FY ET IR++LVGNEILS         W  LVPAM +I++ +    +  IKVGTPL
Sbjct  103  NVLSFYPETMIRFILVGNEILSQSSEEYKQIWKNLVPAMHRIKKCLNAHNIHNIKVGTPL  162

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            AMD+ + ++PPS+G FRSD++ SV +PLLQFL+RT SFFF DV
Sbjct  163  AMDIFQTTFPPSNGTFRSDISASVMEPLLQFLNRTKSFFFLDV  205



>ref|XP_010532729.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Tarenaya 
hassleriana]
Length=480

 Score =   174 bits (441),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 116/163 (71%), Gaps = 3/163 (2%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  + LI  +KA  VK+YDA+P+ L  L  + + V++MVPN  + +I SDQ  AD WV+T
Sbjct  56   YQSINLIKSVKAGHVKLYDADPETLTLLSQTNLYVTIMVPNHQVISIGSDQTAADNWVKT  115

Query  339  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
            NV+P+Y +T IR++LVGNE+LS   +     W  LVPAMRK+  S++  G+R IKVGTPL
Sbjct  116  NVLPYYPQTLIRFVLVGNEVLSYSTDQDREVWRNLVPAMRKLVNSLRAQGIRNIKVGTPL  175

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            AMD+L++++PPSSG FR D+ G V  PLL+FL+ TNSFFF D 
Sbjct  176  AMDVLQSTFPPSSGTFREDIAGPVMLPLLKFLNGTNSFFFIDA  218



>emb|CDY63754.1| BnaAnng19080D [Brassica napus]
Length=478

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 113/163 (69%), Gaps = 3/163 (2%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  + LI  LKA  VK+YDA+ + L  L  + + V++MVPN  I  I +DQ  AD WV T
Sbjct  54   YQSINLIKTLKAGHVKLYDADQETLTLLSKTNLYVTIMVPNNQIITIGADQTAADNWVNT  113

Query  339  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
            NV+P Y +T+IR++LVGNEILS   +    TW  LVPAMRKI  S++  G+  IKVGTPL
Sbjct  114  NVLPHYPQTRIRFVLVGNEILSYNSDQDKQTWANLVPAMRKIVNSLRARGIHNIKVGTPL  173

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            AMD+L +SYPPSSGAFR ++   V  PLL+FL+ TNSFFF DV
Sbjct  174  AMDVLRSSYPPSSGAFREEVAALVMLPLLKFLNGTNSFFFLDV  216



>ref|XP_006349905.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Solanum tuberosum]
Length=470

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 120/169 (71%), Gaps = 3/169 (2%)
 Frame = +3

Query  141  ATTFPHHHD-LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQAL  317
            A   P  +D ++L+  +KA RVKIYDANP+ILR L  + +QVS+MVPN  I  ++++Q+ 
Sbjct  39   ANNLPSPYDSIELLKNMKAGRVKIYDANPEILRLLSGTNLQVSIMVPNNQISIVAANQSA  98

Query  318  ADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTT-WFQLVPAMRKIRRSVKKFGLRKIK  494
            A++WV  NV+P+Y  T IRY+LVGNE+LSN  +   W+ L+PAM  IR S+ +  +  IK
Sbjct  99   ANQWVRDNVLPYYPNTMIRYILVGNEVLSNKDDQGLWYDLIPAMNNIRNSIDQHNIHNIK  158

Query  495  VGTPLAMDMLEASYPPSSGAFRSDLT-GSVFKPLLQFLDRTNSFFFFDV  638
            +GTP AMD+LE S+PPSSG FR D++  ++  PLL+FL+ T S+FF D 
Sbjct  159  IGTPFAMDILETSFPPSSGEFRLDISRNNLLMPLLRFLNWTKSYFFLDA  207



>ref|XP_008792940.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Phoenix dactylifera]
Length=467

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 119/160 (74%), Gaps = 1/160 (1%)
 Frame = +3

Query  162  HDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETN  341
              +  +  L+A  VKIYDANP ILRAL  + ++VS+MVPN++ P+++++++LAD W+  N
Sbjct  43   RSIGFLQSLRAGAVKIYDANPAILRALAGTRLRVSIMVPNQVFPSLAANRSLADAWLAAN  102

Query  342  VVPFYGETKIRYLLVGNEILSN-PPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  518
            ++PFY + +IR+LLVGNE+LS+    ++W  LVPAM  + R+++   +R +KVGT LAMD
Sbjct  103  LLPFYPQARIRFLLVGNEVLSDYSVKSSWPSLVPAMANLHRALRARSIRDVKVGTTLAMD  162

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             L+ S+PPS+G FR D+ G+V +PLL+F +RT SF+F DV
Sbjct  163  SLKTSFPPSAGEFRDDIAGTVIRPLLRFANRTRSFYFVDV  202



>ref|XP_008792939.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Phoenix dactylifera]
Length=470

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 119/160 (74%), Gaps = 1/160 (1%)
 Frame = +3

Query  162  HDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETN  341
              +  +  L+A  VKIYDANP ILRAL  + ++VS+MVPN++ P+++++++LAD W+  N
Sbjct  46   RSIGFLQSLRAGAVKIYDANPAILRALAGTRLRVSIMVPNQVFPSLAANRSLADAWLAAN  105

Query  342  VVPFYGETKIRYLLVGNEILSN-PPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  518
            ++PFY + +IR+LLVGNE+LS+    ++W  LVPAM  + R+++   +R +KVGT LAMD
Sbjct  106  LLPFYPQARIRFLLVGNEVLSDYSVKSSWPSLVPAMANLHRALRARSIRDVKVGTTLAMD  165

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             L+ S+PPS+G FR D+ G+V +PLL+F +RT SF+F DV
Sbjct  166  SLKTSFPPSAGEFRDDIAGTVIRPLLRFANRTRSFYFVDV  205



>ref|XP_010314851.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Solanum 
lycopersicum]
Length=463

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 119/169 (70%), Gaps = 3/169 (2%)
 Frame = +3

Query  141  ATTFPHHHD-LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQAL  317
            A   P  +D ++L+  +KA RVKIYDANP+ILR L  + +QVS+MVPN  I  ++++Q  
Sbjct  33   ANNLPSPYDSIELLKNMKAGRVKIYDANPEILRLLSGTNLQVSIMVPNNQISVVAANQTA  92

Query  318  ADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTT-WFQLVPAMRKIRRSVKKFGLRKIK  494
            A++WV  NV+P+Y  T IRY+LVGNE+LSN  +   W+ L+PAM  IR S+ +  +  IK
Sbjct  93   ANQWVRDNVLPYYPNTMIRYILVGNEVLSNKDDQGLWYDLIPAMNNIRNSIDQHNIHNIK  152

Query  495  VGTPLAMDMLEASYPPSSGAFRSDLT-GSVFKPLLQFLDRTNSFFFFDV  638
            +GTP AMD+LE ++PPSSG FR D++  ++  PLL+FL+ T S+FF D 
Sbjct  153  IGTPFAMDLLETTFPPSSGEFRLDISRNNILMPLLRFLNWTRSYFFLDA  201



>gb|AEN82023.1| AT3G23770-like protein, partial [Capsella rubella]
 gb|AEN82026.1| AT3G23770-like protein, partial [Capsella rubella]
Length=165

 Score =   165 bits (418),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 107/147 (73%), Gaps = 3/147 (2%)
 Frame = +3

Query  207  IYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLV  386
            +YDA+P+ L+ L  + + V++MVPN+ I +I +DQA AD WV TNV+PFY +T+IR++LV
Sbjct  1    LYDADPETLKLLSKTNLYVTIMVPNDQIISIGADQAAADNWVATNVLPFYPQTRIRFVLV  60

Query  387  GNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAF  557
            GNE+LS   +     W  LVPAM K+  S++  G+  IKVGTPLAMD L +S+PPSSGAF
Sbjct  61   GNEVLSYSSDQDKQIWANLVPAMHKVVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGAF  120

Query  558  RSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            R DL   V  PLL+FL+ TNSFFF DV
Sbjct  121  REDLAVPVMLPLLKFLNGTNSFFFLDV  147



>ref|XP_009135862.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=480

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 113/163 (69%), Gaps = 3/163 (2%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  + LI  + A  VK+YDA+P+ L  L  + + V++MVPN  I  I +DQA AD WV T
Sbjct  56   YQSINLIKSINAGHVKLYDADPETLMVLSQTNLYVTIMVPNNHIIPIGADQAAADNWVNT  115

Query  339  NVVPFYGETKIRYLLVGNEILSNPPNT---TWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
            NV+  Y +TKIR++LVGNEILSN  +    TW  LVPAMRKI  S++  G+  IKVGTPL
Sbjct  116  NVLAHYPQTKIRFVLVGNEILSNNSDQDKQTWSSLVPAMRKIVTSLRARGIHNIKVGTPL  175

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            AMD+L  S+PPSSGAFR ++   V  PLL+FL+ TNSFFF DV
Sbjct  176  AMDVLRTSFPPSSGAFREEVAALVMLPLLKFLNGTNSFFFLDV  218



>gb|KDO47456.1| hypothetical protein CISIN_1g012660mg [Citrus sinensis]
Length=459

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 115/163 (71%), Gaps = 3/163 (2%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  ++ I  L+A  VKIYDANP+IL+ L  + ++VS+MV N  I +I+S Q +AD+WV  
Sbjct  43   YQSIESIKFLQAGSVKIYDANPEILKLLSGTDLKVSIMVQNHEIIDIASKQKVADQWVHD  102

Query  339  NVVPFYGETKIRYLLVGNEILSNPPNT---TWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
            NV+ FY ET IR++LVGNEILS         W  LVPAM +I++ +    +  IKVGTPL
Sbjct  103  NVLSFYPETMIRFILVGNEILSQSSEEYKQIWKNLVPAMHRIKKCLNAHNIHNIKVGTPL  162

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            AMD+ + ++PPS+G FRSD++ SV +PLLQFL+RT SFFF DV
Sbjct  163  AMDIFQTTFPPSNGTFRSDISASVMEPLLQFLNRTKSFFFLDV  205



>gb|ADG38498.1| AT3G23770-like protein [Capsella grandiflora]
 gb|ADG38500.1| AT3G23770-like protein [Capsella grandiflora]
 gb|ADG38501.1| AT3G23770-like protein [Capsella grandiflora]
Length=169

 Score =   164 bits (416),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 106/145 (73%), Gaps = 3/145 (2%)
 Frame = +3

Query  213  DANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGN  392
            DA+P+ L+ L  + + V++MVPN+ I ++ SDQA AD WV TNV+PFY +T+IR++LVGN
Sbjct  1    DADPETLKLLSKTNLYVTIMVPNDQIISVGSDQAAADNWVATNVLPFYPQTRIRFVLVGN  60

Query  393  EILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRS  563
            E+LS   +     W  LVPAMRK+  S++  G+  IKVGTPLAMD L +S+PPSSGAFR 
Sbjct  61   EVLSYSSDQDKQIWANLVPAMRKVVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGAFRE  120

Query  564  DLTGSVFKPLLQFLDRTNSFFFFDV  638
            DL   V  PLL+FL+ TNSFFF DV
Sbjct  121  DLAVPVMLPLLKFLNGTNSFFFLDV  145



>gb|ADG38497.1| AT3G23770-like protein [Capsella grandiflora]
Length=169

 Score =   164 bits (416),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 106/145 (73%), Gaps = 3/145 (2%)
 Frame = +3

Query  213  DANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGN  392
            DA+P+ L+ L  + + V++MVPN+ I ++ SDQA AD WV TNV+PFY +T+IR++LVGN
Sbjct  1    DADPETLKLLSKTNLYVTIMVPNDQIISVGSDQAAADNWVATNVLPFYPQTRIRFVLVGN  60

Query  393  EILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRS  563
            E+LS   +     W  LVPAMRK+  S++  G+  IKVGTPLAMD L +S+PPSSGAFR 
Sbjct  61   EVLSYSSDQDKQIWANLVPAMRKVVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGAFRE  120

Query  564  DLTGSVFKPLLQFLDRTNSFFFFDV  638
            DL   V  PLL+FL+ TNSFFF DV
Sbjct  121  DLAVPVMLPLLKFLNGTNSFFFLDV  145



>gb|AAM64490.1| beta-1,3-glucanase, putative [Arabidopsis thaliana]
Length=476

 Score =   172 bits (436),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 115/163 (71%), Gaps = 3/163 (2%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  + LI  +KA  VK+YDA+P+ L+ L  + + V++MVPN  I +I +DQA AD WV T
Sbjct  52   YQSINLIKTIKAGHVKLYDADPETLKLLSTTNLYVTIMVPNNQIISIGADQAAADNWVAT  111

Query  339  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
            NV+PF+ +T+IR++LVGNE+LS   +     W  LVPAMRK+  S++  G+  IKVGTPL
Sbjct  112  NVLPFHPQTRIRFVLVGNEVLSYSSDQDKQIWANLVPAMRKVVNSLRARGIHNIKVGTPL  171

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            AMD L +S+PPSSG FR D+   +  PLL+FL+ TNSFFF DV
Sbjct  172  AMDALRSSFPPSSGTFREDIAVPMMLPLLKFLNGTNSFFFLDV  214



>ref|XP_009625839.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Nicotiana tomentosiformis]
Length=440

 Score =   171 bits (433),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 120/162 (74%), Gaps = 2/162 (1%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  ++LI  +KA +VK+YDANP+ILR L  + + VS+MVPN+ I  ++++Q++A++WV  
Sbjct  17   YESIELIKTMKAGKVKLYDANPEILRLLSGTNLHVSIMVPNDQISIVAANQSVANQWVRD  76

Query  339  NVVPFYGETKIRYLLVGNEILSNPPNTT-WFQLVPAMRKIRRSVKKFGLRKIKVGTPLAM  515
            NV+ +Y  T IRY+LVGNE+LSN  + + W+ LVPAMR I++S+    +  IK+GTPLAM
Sbjct  77   NVLSYYPNTMIRYILVGNEVLSNKDDQSLWYDLVPAMRNIKKSIDGHRIHNIKIGTPLAM  136

Query  516  DMLEASYPPSSGAFRSDL-TGSVFKPLLQFLDRTNSFFFFDV  638
            DML+ S+PPSSG FR D+   S+  PLL+FL+ T S+FF DV
Sbjct  137  DMLQTSFPPSSGEFRLDIPRNSLLIPLLRFLNWTKSYFFIDV  178



>gb|AEN82025.1| AT3G23770-like protein, partial [Capsella rubella]
Length=165

 Score =   163 bits (413),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 107/147 (73%), Gaps = 3/147 (2%)
 Frame = +3

Query  207  IYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLV  386
            +YDA+P+ L+ L  + + V++MVPN+ I +I +DQA AD WV TNV+PFY +T+IR++LV
Sbjct  1    LYDADPETLKLLSKTNLYVTIMVPNDQIISIGADQAAADNWVATNVLPFYPQTRIRFVLV  60

Query  387  GNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAF  557
            GNE+LS   +     W  LVPAM K+  S++  G+  IKVGTPLAMD L +S+PPSSGAF
Sbjct  61   GNEVLSYSSDQDKQIWANLVPAMHKVVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGAF  120

Query  558  RSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            R DL   V  PLL+FL+ T+SFFF DV
Sbjct  121  REDLAVPVMLPLLKFLNGTSSFFFLDV  147



>ref|XP_009625838.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Nicotiana tomentosiformis]
Length=470

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 120/162 (74%), Gaps = 2/162 (1%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  ++LI  +KA +VK+YDANP+ILR L  + + VS+MVPN+ I  ++++Q++A++WV  
Sbjct  47   YESIELIKTMKAGKVKLYDANPEILRLLSGTNLHVSIMVPNDQISIVAANQSVANQWVRD  106

Query  339  NVVPFYGETKIRYLLVGNEILSNPPNTT-WFQLVPAMRKIRRSVKKFGLRKIKVGTPLAM  515
            NV+ +Y  T IRY+LVGNE+LSN  + + W+ LVPAMR I++S+    +  IK+GTPLAM
Sbjct  107  NVLSYYPNTMIRYILVGNEVLSNKDDQSLWYDLVPAMRNIKKSIDGHRIHNIKIGTPLAM  166

Query  516  DMLEASYPPSSGAFRSDL-TGSVFKPLLQFLDRTNSFFFFDV  638
            DML+ S+PPSSG FR D+   S+  PLL+FL+ T S+FF DV
Sbjct  167  DMLQTSFPPSSGEFRLDIPRNSLLIPLLRFLNWTKSYFFIDV  208



>emb|CDY53213.1| BnaC03g74070D [Brassica napus]
Length=480

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 112/162 (69%), Gaps = 3/162 (2%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  + LI  + A  VK+YDA+P+ L  L  + + V++MVPN  I  I +DQA AD WV T
Sbjct  56   YQSINLIKSINAGHVKLYDADPETLMVLSQTNLYVTIMVPNNQIIPIGADQAAADNWVNT  115

Query  339  NVVPFYGETKIRYLLVGNEILSNPPNT---TWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
            NV+  Y +T+IR++LVGNEILSN  +    TW  LVPAMRKI  S++  G+  IKVGTPL
Sbjct  116  NVLAHYPQTRIRFVLVGNEILSNNSDQDKQTWSSLVPAMRKIITSLRARGIHNIKVGTPL  175

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFD  635
            AMD+L  S+PPSSGAFR ++   V  PLL+FL+ TNSFFF D
Sbjct  176  AMDVLRTSFPPSSGAFREEVAAPVMLPLLKFLNGTNSFFFLD  217



>gb|ADG38499.1| AT3G23770-like protein [Capsella grandiflora]
Length=169

 Score =   163 bits (412),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 105/145 (72%), Gaps = 3/145 (2%)
 Frame = +3

Query  213  DANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGN  392
            DA+P+ L+ L  + + V++MVPN  I ++ SDQA AD WV TNV+PFY +T+IR++LVGN
Sbjct  1    DADPETLKLLSKTNLYVTIMVPNXQIISVGSDQAAADXWVATNVLPFYPQTRIRFVLVGN  60

Query  393  EILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRS  563
            E+LS   +     W  LVPAMRK+  S++  G+  IKVGTPLAMD L +S+PPSSGAFR 
Sbjct  61   EVLSYSSDQDKQIWANLVPAMRKVVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGAFRE  120

Query  564  DLTGSVFKPLLQFLDRTNSFFFFDV  638
            DL   V  PLL+FL+ TNSFFF DV
Sbjct  121  DLAVPVMLPLLKFLNGTNSFFFLDV  145



>gb|ADG38503.1| AT3G23770-like protein [Neslia paniculata]
Length=169

 Score =   163 bits (412),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 105/145 (72%), Gaps = 3/145 (2%)
 Frame = +3

Query  213  DANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGN  392
            DA+P+ L+ L  + + V++MVPN+ I  I SDQA AD WV T V+PFY +T+IR++LVGN
Sbjct  1    DADPETLKLLSKTNLYVTIMVPNDQIITIGSDQAAADNWVATKVIPFYPQTRIRFVLVGN  60

Query  393  EILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRS  563
            EILS   +     W  LVPAMRK+  S++  G+  IKVGTPLAMD L++S+PPSSGAFR 
Sbjct  61   EILSYSSDQDKQIWANLVPAMRKVVNSLRARGIHNIKVGTPLAMDALQSSFPPSSGAFRE  120

Query  564  DLTGSVFKPLLQFLDRTNSFFFFDV  638
            D+   V  PLL+FL+ TN+FFF DV
Sbjct  121  DIAVPVMLPLLKFLNGTNTFFFLDV  145



>ref|XP_009777293.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nicotiana 
sylvestris]
Length=470

 Score =   169 bits (429),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 119/163 (73%), Gaps = 2/163 (1%)
 Frame = +3

Query  156  HHHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVE  335
             +  ++ +  +KA RVK+YDANP+ILR L  + + VS+MVPN+ I  ++++Q+ A++WV 
Sbjct  46   QYESIEHMKNMKAGRVKLYDANPEILRLLSGTNLHVSIMVPNDQISIVAANQSAANQWVR  105

Query  336  TNVVPFYGETKIRYLLVGNEILSNPPNTT-WFQLVPAMRKIRRSVKKFGLRKIKVGTPLA  512
             NV+ +Y  T IRY+LVGNE+LSN  + + W+ LVPAMR I++S+ +  +  IK+GTPLA
Sbjct  106  DNVLSYYPNTMIRYILVGNEVLSNKDDQSLWYDLVPAMRNIKKSIDEHRIHNIKIGTPLA  165

Query  513  MDMLEASYPPSSGAFRSDL-TGSVFKPLLQFLDRTNSFFFFDV  638
            MDML+ S+PPSSG FR D+   S+  PLL+FL+ T S+FF DV
Sbjct  166  MDMLQTSFPPSSGEFRLDIPRNSLLIPLLRFLNWTKSYFFIDV  208



>ref|XP_010264204.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nelumbo 
nucifera]
Length=339

 Score =   167 bits (422),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 112/158 (71%), Gaps = 5/158 (3%)
 Frame = +3

Query  174  LIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVVPF  353
            LI  LKA  VK   ANP IL AL  + +QVS+MVPN++I NISS Q+LA+ WV TN VPF
Sbjct  38   LIKSLKAGHVK--HANPDILNALEGTNIQVSIMVPNQLISNISSSQSLANEWVRTNNVPF  95

Query  354  YGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDML  524
            Y +T   YLLVGNEI S   N    TW+ LV AM +++ S+K   +R IK+GT +AMD+L
Sbjct  96   YPKTLTHYLLVGNEIFSFSSNQDRQTWYGLVQAMSRLKYSLKIHNIRNIKIGTTIAMDVL  155

Query  525  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            ++S+PPS+G FRSD++  V KPLLQFL+RT S+ F D 
Sbjct  156  QSSFPPSNGMFRSDISIPVMKPLLQFLNRTKSYSFLDA  193



>gb|ADG38502.1| AT3G23770-like protein [Capsella grandiflora]
Length=169

 Score =   161 bits (408),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 105/145 (72%), Gaps = 3/145 (2%)
 Frame = +3

Query  213  DANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGN  392
            DA+P+ L+ L  + + V++MVPN+ I ++ SDQA AD WV TNV+PFY +T+IR++LVGN
Sbjct  1    DADPETLKLLSKTNLYVTIMVPNDQIISVGSDQAAADNWVATNVLPFYPQTRIRFVLVGN  60

Query  393  EILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRS  563
            E+LS   +     W  LVPAMRK+  S++  G+  IKVGTPLAMD L +S+PPSSGAFR 
Sbjct  61   EVLSYSSDQDKQIWANLVPAMRKVVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGAFRE  120

Query  564  DLTGSVFKPLLQFLDRTNSFFFFDV  638
            DL   V   LL+FL+ TNSFFF DV
Sbjct  121  DLAVPVMLXLLKFLNGTNSFFFLDV  145



>emb|CDY50110.1| BnaC01g43580D [Brassica napus]
Length=476

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 113/163 (69%), Gaps = 3/163 (2%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  + L+  +KA  VK+YDA+ + L  L  + + V++MVPN  I +I +DQA AD WV T
Sbjct  52   YQSINLVKSIKAGHVKLYDADQETLMLLSQTNLYVTIMVPNNQIISIGADQAAADNWVNT  111

Query  339  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
            NV+P Y +T+IR++LVGNEILS   +     W  LVPAMRKI  S++  G+  IKVGTPL
Sbjct  112  NVLPHYPQTRIRFVLVGNEILSYNSDQDKQIWANLVPAMRKIVNSLRARGIHNIKVGTPL  171

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            AMD+L +S+PPS+G FR ++   V  PLL+FL+ TNSFFF DV
Sbjct  172  AMDVLRSSFPPSNGTFREEVAAPVMLPLLKFLNGTNSFFFLDV  214



>gb|KEH22560.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=386

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +3

Query  270  MVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMR  449
            M+PNE+I NISS+Q L+D+W+++N++P+Y +T IRYLLVGNEI+S+ PN+TW  LVPAMR
Sbjct  1    MLPNELITNISSNQTLSDQWIKSNILPYYPQTLIRYLLVGNEIISSTPNSTWLHLVPAMR  60

Query  450  KIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFF  629
            +I+ S+KKF +++IKVGT  AMD+LE S+PPS+ AFR D+   V KP+L+FL+RT SFFF
Sbjct  61   RIKHSLKKFRVKRIKVGTSSAMDVLETSFPPSNAAFRKDIAVQVIKPMLRFLNRTKSFFF  120

Query  630  FDV  638
             DV
Sbjct  121  LDV  123



>ref|XP_006373100.1| hypothetical protein POPTR_0017s08720g [Populus trichocarpa]
 gb|ERP50897.1| hypothetical protein POPTR_0017s08720g [Populus trichocarpa]
Length=466

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 117/162 (72%), Gaps = 3/162 (2%)
 Frame = +3

Query  162  HDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETN  341
              ++ +  +KA  VK+YDANP+ILR L  + ++VS+MVPN  I NI+++Q  A++WVE N
Sbjct  43   QSIESLRAMKAGSVKLYDANPEILRLLAGTDIRVSIMVPNYEIINIATNQTSANKWVEDN  102

Query  342  VVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLA  512
            V+ ++ ET IR +LVGNE+LS   +     W  LVPAMR+I+ S++   +R IKVGTPLA
Sbjct  103  VLAYHPETMIRTILVGNEVLSYCSDEGKRIWNHLVPAMRRIKISLRAQDIRNIKVGTPLA  162

Query  513  MDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            MD+L+ ++PPS+G FR D++ +V  PLL+FL+ T SFFF DV
Sbjct  163  MDVLQTTFPPSTGTFRPDISTTVMVPLLKFLNSTKSFFFIDV  204



>ref|XP_009106344.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=476

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 113/163 (69%), Gaps = 3/163 (2%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  + L+  +KA  VK+YDA+ + L  L  + + V++MVPN  I +I +DQA AD WV T
Sbjct  52   YQSINLVKSIKAGHVKLYDADQETLMLLSQTNLYVTIMVPNNQIISIGADQAAADNWVNT  111

Query  339  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
            NV+P Y +T+IR++LVGNEILS   +     W  LVPAMRKI  S++  G+  IKVGTPL
Sbjct  112  NVLPHYPQTRIRFVLVGNEILSYNSDQDKQIWANLVPAMRKIVNSLRARGIHNIKVGTPL  171

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            AMD+L +S+PPS+G FR ++   V  PLL+FL+ TNSFFF DV
Sbjct  172  AMDVLRSSFPPSNGTFREEVAAPVMLPLLKFLNGTNSFFFLDV  214



>ref|XP_011045808.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Populus 
euphratica]
Length=475

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 116/163 (71%), Gaps = 3/163 (2%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  ++++  +KA  VK+YDANP+ILR L  + + VS+MV N+ I NI+++Q  A++WVE 
Sbjct  51   YESIEILRSMKAGSVKLYDANPEILRLLARTNIHVSIMVSNDEIINIAANQTTANKWVED  110

Query  339  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
            NV+ +Y +T IR +LVGNE+LS   +     W  LVPAMR+I  S++   +R IKVGTPL
Sbjct  111  NVLRYYPDTIIRIILVGNEVLSYSSDAGKQIWNNLVPAMRRINISLRAQDIRNIKVGTPL  170

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            AMD+L+ ++PPS+G FRSD++ SV  PLL FL+ T SFFF D 
Sbjct  171  AMDVLQTAFPPSNGIFRSDISTSVMVPLLNFLNSTKSFFFIDA  213



>ref|NP_193144.1| putative glucan endo-1,3-beta-glucosidase A6 [Arabidopsis thaliana]
 sp|Q06915.1|EA6_ARATH RecName: Full=Probable glucan endo-1,3-beta-glucosidase A6; AltName: 
Full=(1->3)-beta-glucan endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Anther-specific protein A6; AltName: 
Full=Beta-1,3-endoglucanase; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAA49853.1| A6 [Arabidopsis thaliana]
 emb|CAB10187.1| A6 anther-specific protein [Arabidopsis thaliana]
 emb|CAB78450.1| A6 anther-specific protein [Arabidopsis thaliana]
 gb|AAM20432.1| A6 anther-specific protein [Arabidopsis thaliana]
 gb|AAN72161.1| A6 anther-specific protein [Arabidopsis thaliana]
 gb|AEE83368.1| putative glucan endo-1,3-beta-glucosidase A6 [Arabidopsis thaliana]
Length=478

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 112/160 (70%), Gaps = 0/160 (0%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  +  I  +KA  VK+YDA+P+ L  L  + + V++ VPN  I  +SS+Q +AD WV T
Sbjct  57   YQSINFIKSIKAGHVKLYDADPESLTLLSQTNLYVTITVPNHQITALSSNQTIADEWVRT  116

Query  339  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  518
            N++P+Y +T+IR++LVGNEILS         LVPAMRKI  S++  G+  IKVGTPLAMD
Sbjct  117  NILPYYPQTQIRFVLVGNEILSYNSGNVSVNLVPAMRKIVNSLRLHGIHNIKVGTPLAMD  176

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             L +S+PPS+G FR ++TG V  PLL+FL+ TNS+FF +V
Sbjct  177  SLRSSFPPSNGTFREEITGPVMLPLLKFLNGTNSYFFLNV  216



>emb|CDY18092.1| BnaA01g23530D [Brassica napus]
Length=476

 Score =   167 bits (423),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 113/163 (69%), Gaps = 3/163 (2%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  + L+  +KA  VK+YDA+ + L  L  + + V++MVPN  I +I +DQA AD WV T
Sbjct  52   YQSINLVKSIKAGHVKLYDADQETLMLLSQTNLYVTIMVPNNQIISIGADQAAADNWVNT  111

Query  339  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
            NV+P Y +T+IR++LVGNEILS   +     W  LVPAMRK+  S++  G+  IKVGTPL
Sbjct  112  NVLPHYPQTRIRFVLVGNEILSYNSDQDKQIWANLVPAMRKMVNSLRARGIHNIKVGTPL  171

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            AMD+L +S+PPS+G FR ++   V  PLL+FL+ TNSFFF DV
Sbjct  172  AMDVLRSSFPPSNGTFREEVAAPVMLPLLKFLNGTNSFFFLDV  214



>ref|XP_002462618.1| hypothetical protein SORBIDRAFT_02g029080 [Sorghum bicolor]
 gb|EER99139.1| hypothetical protein SORBIDRAFT_02g029080 [Sorghum bicolor]
Length=483

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 114/162 (70%), Gaps = 5/162 (3%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            ++L+    A  VKIYDANP +LRAL  +   VS+MVPNEIIP++++  A ADRWV  N+V
Sbjct  55   VELLRAAGAGSVKIYDANPGVLRALAGTRWPVSIMVPNEIIPDLAASVAAADRWVAKNLV  114

Query  348  PFYGETKIRYLLVGNEILSNP--PNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  521
            P+Y  T++++LLVGNEILS+    N+TW +LVPAM  I RS++K G+  +K+GT LAMD 
Sbjct  115  PYYPATRVKFLLVGNEILSDHSIANSTWPRLVPAMENIHRSLRKRGISSVKIGTTLAMDA  174

Query  522  LEASY---PPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            L       PPS+  FR+D+  +V +PLL FL+ TNS++F D 
Sbjct  175  LADGAFPRPPSAATFRADIAEAVVRPLLHFLNGTNSYYFVDA  216



>ref|XP_002868315.1| hypothetical protein ARALYDRAFT_493503 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44574.1| hypothetical protein ARALYDRAFT_493503 [Arabidopsis lyrata subsp. 
lyrata]
Length=478

 Score =   166 bits (421),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 112/160 (70%), Gaps = 0/160 (0%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  +  I  +KA  VK+YDA+P+ L  L  + + V++ VPN  I ++SS+Q  AD WV T
Sbjct  57   YQSINFIKSIKAGHVKLYDADPESLTLLSQTNLYVTITVPNHQITSLSSNQTTADEWVRT  116

Query  339  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  518
            N++P+Y +T+IR++LVGNEILS         LVPAMRKI  S++  G+  IKVGTPLAMD
Sbjct  117  NILPYYPQTQIRFVLVGNEILSYNYGNVSANLVPAMRKIVNSLRLHGIHNIKVGTPLAMD  176

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             L +S+PPS+G FR ++TG V  PLL+FL+ TNS+FF +V
Sbjct  177  SLRSSFPPSNGTFREEITGPVMLPLLKFLNGTNSYFFLNV  216



>ref|XP_002298669.2| glucan endo-1 family protein [Populus trichocarpa]
 gb|EEE83474.2| glucan endo-1 family protein [Populus trichocarpa]
Length=416

 Score =   165 bits (418),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 112/154 (73%), Gaps = 3/154 (2%)
 Frame = +3

Query  186  LKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGET  365
            +KA  VK+YDANP+ILR L  + + VS+MV N+ I NI+++Q  A++WVE NV+ +Y +T
Sbjct  1    MKAGSVKLYDANPEILRLLARTNIHVSIMVRNDEIINIAANQTTANKWVEDNVLRYYPDT  60

Query  366  KIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASY  536
             IR +LVGNE+LS   +     W  LVPAMR+I+ S++   +R IKVGTPLAMD+L+ ++
Sbjct  61   IIRTILVGNEVLSYSSDAGKQIWNHLVPAMRRIKISLRAQDIRNIKVGTPLAMDVLQTAF  120

Query  537  PPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            PPS+G FRSD++ SV  PLL FL+ T SFFF D 
Sbjct  121  PPSNGTFRSDISTSVMVPLLNFLNSTKSFFFIDA  154



>gb|KJB28087.1| hypothetical protein B456_005G026800 [Gossypium raimondii]
Length=462

 Score =   166 bits (420),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 115/160 (72%), Gaps = 0/160 (0%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  ++ +  + A R+K+YD++P+IL+ L  + + VSVMV N  I  I+S QA+A++WV+ 
Sbjct  41   YQTIETVKSMNAGRIKLYDSDPEILKLLSGTNIHVSVMVQNNDIIRIASSQAVAEQWVQD  100

Query  339  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  518
            NV+ +Y +T IR++LVGNE+LS+     W  LV AMR+I+ S+    ++ IKVGTPLAMD
Sbjct  101  NVLAYYPDTMIRFVLVGNEVLSHQDRRIWLSLVSAMRRIKNSLNTHDIKNIKVGTPLAMD  160

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            ++++++PPSS  FR D+T +V  PLL+FL+ T SFFF DV
Sbjct  161  VMQSTFPPSSSRFRPDITDTVMAPLLRFLNGTKSFFFIDV  200



>gb|EYU31523.1| hypothetical protein MIMGU_mgv1a005774mg [Erythranthe guttata]
Length=426

 Score =   165 bits (418),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 112/157 (71%), Gaps = 0/157 (0%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            +QL+  +KA  VK+YDA+P++L+ L ++ + V++MV N+ I  I+S+++ AD W++ NV+
Sbjct  52   IQLLLSMKAGHVKLYDADPEVLKLLSDTDLHVTIMVTNQEISMIASNESHADAWIDDNVL  111

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  527
              Y  TKIR++LVGNE+ S      W  LVPAMR+I+RS+ K  +  IKVGTPLAMD LE
Sbjct  112  AHYPSTKIRFILVGNEVFSYNDRQLWLDLVPAMRRIKRSLNKHQIHNIKVGTPLAMDALE  171

Query  528  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            +++PPSS  FRS +   V  PL++FL+ T SFFF DV
Sbjct  172  STFPPSSARFRSSIPAEVIVPLMRFLNSTKSFFFVDV  208



>gb|KDP32593.1| hypothetical protein JCGZ_13143 [Jatropha curcas]
Length=479

 Score =   166 bits (420),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 118/164 (72%), Gaps = 6/164 (4%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  +Q++  + A RVK+Y+A+P+ILR L  S +QVS+MVPN+ I  I+SDQ LA++WV  
Sbjct  56   YQSIQILKSINASRVKLYNADPEILRLLAGSKIQVSIMVPNQEIIRIASDQTLANQWVRQ  115

Query  339  NVVPFYGETKIRYLLVGNEILSN----PPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTP  506
            NV+ +Y  T IR++LVGNEI S+      N  W  LVPAMR I+ S+K   ++ IKVGTP
Sbjct  116  NVLQYYPNTMIRFILVGNEIFSSVSVQEQNYVWPNLVPAMRNIKNSLKIHNIKNIKVGTP  175

Query  507  LAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            L+MD+L+ ++PPS+G FR+++  S+  PLL+FL+ T S+FF DV
Sbjct  176  LSMDILQTTFPPSNGTFRTNV--SILPPLLKFLNGTKSYFFIDV  217



>gb|EYU31522.1| hypothetical protein MIMGU_mgv1a005774mg [Erythranthe guttata]
Length=471

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 112/157 (71%), Gaps = 0/157 (0%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            +QL+  +KA  VK+YDA+P++L+ L ++ + V++MV N+ I  I+S+++ AD W++ NV+
Sbjct  52   IQLLLSMKAGHVKLYDADPEVLKLLSDTDLHVTIMVTNQEISMIASNESHADAWIDDNVL  111

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  527
              Y  TKIR++LVGNE+ S      W  LVPAMR+I+RS+ K  +  IKVGTPLAMD LE
Sbjct  112  AHYPSTKIRFILVGNEVFSYNDRQLWLDLVPAMRRIKRSLNKHQIHNIKVGTPLAMDALE  171

Query  528  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            +++PPSS  FRS +   V  PL++FL+ T SFFF DV
Sbjct  172  STFPPSSARFRSSIPAEVIVPLMRFLNSTKSFFFVDV  208



>ref|XP_009383834.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=475

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 111/159 (70%), Gaps = 2/159 (1%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            + L+  + A  VKIYDANP ILRAL  + ++VS+MVPNEIIP++ ++ +LAD WV   + 
Sbjct  49   VALLRSIGAGAVKIYDANPAILRALAGTRLRVSIMVPNEIIPSLGTNASLADAWVAAYLT  108

Query  348  PFYGETKIRYLLVGNEILS--NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  521
            PFY   ++RYLLVGNEILS  +  N+TW  LVPAM  I RS+    +R +KV T  AMD 
Sbjct  109  PFYPAVRVRYLLVGNEILSYTSLANSTWPFLVPAMVNIHRSLIARSIRDVKVSTTFAMDA  168

Query  522  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            L  S+PPS+GAFRSD+   V +PLL+FL +T S++F D 
Sbjct  169  LGISFPPSAGAFRSDIAEPVIRPLLRFLHKTRSYYFVDA  207



>ref|XP_009383833.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=476

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 111/159 (70%), Gaps = 2/159 (1%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            + L+  + A  VKIYDANP ILRAL  + ++VS+MVPNEIIP++ ++ +LAD WV   + 
Sbjct  50   VALLRSIGAGAVKIYDANPAILRALAGTRLRVSIMVPNEIIPSLGTNASLADAWVAAYLT  109

Query  348  PFYGETKIRYLLVGNEILS--NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  521
            PFY   ++RYLLVGNEILS  +  N+TW  LVPAM  I RS+    +R +KV T  AMD 
Sbjct  110  PFYPAVRVRYLLVGNEILSYTSLANSTWPFLVPAMVNIHRSLIARSIRDVKVSTTFAMDA  169

Query  522  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            L  S+PPS+GAFRSD+   V +PLL+FL +T S++F D 
Sbjct  170  LGISFPPSAGAFRSDIAEPVIRPLLRFLHKTRSYYFVDA  208



>gb|KEH18116.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=383

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = +3

Query  270  MVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMR  449
            M+PNE++ N+SS+Q LA++WV+TN+VPFY +T IRYLLVGNE++S+  N TW  +VPAM 
Sbjct  1    MLPNELVTNVSSNQTLANQWVQTNLVPFYSKTLIRYLLVGNELISSTTNQTWPHIVPAMY  60

Query  450  KIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFF  629
            +++ S+  FGL K+KVGTPLAMD+L+ S+PPS+G FR+D+  SV KP+L+FL  TNSFFF
Sbjct  61   RMKHSLTIFGLHKVKVGTPLAMDVLQTSFPPSNGTFRNDIALSVMKPMLEFLHVTNSFFF  120

Query  630  FDV  638
             DV
Sbjct  121  LDV  123



>ref|XP_008439043.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Cucumis 
melo]
Length=467

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 116/165 (70%), Gaps = 3/165 (2%)
 Frame = +3

Query  153  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWV  332
            P +  +++++ +K  RVK+YDAN +IL  L  +  QVS+M+PN  I +I+++Q  AD+W+
Sbjct  41   PPNLAIEMMNSMKVGRVKLYDANHEILGNLSKTKFQVSIMIPNNEISDIANNQTRADQWI  100

Query  333  ETNVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGT  503
              NV+PFY +T IR++LVGNE+L   S+     W  LVPAMR+I  S+K   L+ IKVGT
Sbjct  101  SNNVLPFYPQTMIRFILVGNEVLSFDSDKDRQVWNDLVPAMRRIWSSLKANNLQTIKVGT  160

Query  504  PLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            P+AMD+LE ++PPS G FRSD+  +V  P+L FL+ T SFFF +V
Sbjct  161  PVAMDILETTFPPSRGTFRSDIQQTVVAPMLNFLNETRSFFFANV  205



>ref|XP_011101604.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Sesamum 
indicum]
Length=468

 Score =   164 bits (414),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 118/180 (66%), Gaps = 4/180 (2%)
 Frame = +3

Query  111  LRSEYATVNWA---TTFPH-HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVP  278
            L SE   +N+       P  +  + L++ ++A  VK+YDANP++L+ L  + + VS+MV 
Sbjct  26   LSSEKIGINYGRLGNNLPSPYQTITLLNSMEAGHVKLYDANPEVLKLLSGTDLHVSIMVT  85

Query  279  NEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIR  458
            NE I  I+++Q+ AD WV+ NVV +Y  TKIR++LVGNE+ S      W  LVPAMR I+
Sbjct  86   NEQISGIAANQSKADLWVQENVVAYYPSTKIRFVLVGNEVFSYNDLKMWHDLVPAMRNIK  145

Query  459  RSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            RS+    +  +KV T +AM+ LE+S+PPSSG FRSD+ G V  PLL+FL+ T SF F DV
Sbjct  146  RSLSIRDIHNVKVSTAIAMETLESSFPPSSGKFRSDIPGEVILPLLKFLNGTKSFLFLDV  205



>ref|XP_011010072.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Populus 
euphratica]
Length=466

 Score =   164 bits (414),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 117/162 (72%), Gaps = 3/162 (2%)
 Frame = +3

Query  162  HDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETN  341
              ++ +  +KA  VK+YDANP+ILR L  + ++VS+MVPN  I +I+++Q  A++WVE N
Sbjct  43   QSIESLRAMKAGSVKLYDANPEILRLLAGTDIRVSIMVPNYEIISIATNQTSANKWVEDN  102

Query  342  VVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLA  512
            V+ ++ ET IR +LVGNE+LS   +     W  LV AMR+I+ S++   +R IKVGTPLA
Sbjct  103  VLAYHPETMIRTILVGNEVLSYCSDEGKRIWNHLVLAMRRIKISLRAQDIRNIKVGTPLA  162

Query  513  MDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            MD+L+ ++PPS+G FRSD++ +V  PLL+FL+ T SFFF DV
Sbjct  163  MDVLQTAFPPSTGIFRSDISTTVMVPLLKFLNSTKSFFFIDV  204



>gb|KFK36299.1| hypothetical protein AALP_AA4G104300 [Arabis alpina]
Length=479

 Score =   164 bits (414),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 113/160 (71%), Gaps = 0/160 (0%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  +  I  +KA  VK+YDA+P+ L  L  + + V++ VPN  I ++SS+Q++A+ WV+T
Sbjct  58   YQSINFIKSIKAGHVKLYDADPETLTLLSQTNLYVTITVPNHQITSLSSNQSIAEDWVKT  117

Query  339  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  518
            N++P+Y +T+IR++LVGNEILS         LVPAMRKI  S++  G+  IKVGTPLAMD
Sbjct  118  NILPYYPQTQIRFVLVGNEILSAQDTNVTANLVPAMRKIVNSLRTHGIHNIKVGTPLAMD  177

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             L +++PPS+  FR D+ G +  PLL+FL+ TNS+FF +V
Sbjct  178  SLRSTFPPSNSTFREDIAGPLVLPLLKFLNGTNSYFFINV  217



>ref|XP_002971665.1| hypothetical protein SELMODRAFT_231791 [Selaginella moellendorffii]
 gb|EFJ27414.1| hypothetical protein SELMODRAFT_231791 [Selaginella moellendorffii]
Length=449

 Score =   163 bits (412),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 112/160 (70%), Gaps = 3/160 (2%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            + LI  L   R KI+ A+  I+RA  NSGV++SVMV N+ IP I+S Q+ AD WVE NV 
Sbjct  19   VGLIKDLGFDRAKIFSADSSIIRAFANSGVKLSVMVANQQIPEIASSQSSADAWVEKNVA  78

Query  348  PFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRRSVKKFGLR-KIKVGTPLAMD  518
             +Y +T I  +LVGNEILS+     +TW +LVPAM KI+ +V+KF L   IKV TPLA D
Sbjct  79   AYYPKTAIESVLVGNEILSDSSIRESTWPKLVPAMEKIQSAVEKFELAGSIKVSTPLASD  138

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             L  SYPPS+G+F+SD+  S+ +PLL+FL RTNSF+  +V
Sbjct  139  ALGNSYPPSAGSFKSDIAESIIQPLLEFLSRTNSFYCGNV  178



>ref|XP_006282877.1| hypothetical protein CARUB_v10006945mg [Capsella rubella]
 gb|EOA15775.1| hypothetical protein CARUB_v10006945mg [Capsella rubella]
Length=478

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 112/160 (70%), Gaps = 0/160 (0%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  +  I  +KA  VK+YDA+P+ L  L  + + V++ VPN  I ++SS+Q +AD WV T
Sbjct  57   YQSINFIKSIKAGHVKLYDADPESLTLLSQTNLYVTITVPNHQITSLSSNQTIADEWVRT  116

Query  339  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  518
            N++P+Y +T+IR++LVG+EILS         LVPAMRKI  S++  G+  IKVGTPLAMD
Sbjct  117  NIIPYYPQTQIRFVLVGHEILSYNYGNVSANLVPAMRKIVNSLRFHGIHNIKVGTPLAMD  176

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             L +S+PPS+G FR ++ G V  PLL+FL+ TNS+FF +V
Sbjct  177  SLRSSFPPSNGTFREEVAGPVILPLLKFLNGTNSYFFINV  216



>ref|XP_010450129.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=479

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 111/160 (69%), Gaps = 0/160 (0%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  +  I  +KA  VK+YDA+P+ L  L  + + V++ VPN  I ++SS+Q  AD WV T
Sbjct  58   YQSINFIKSIKAGHVKLYDADPECLTLLSQTNLYVTITVPNHQITSLSSNQTTADEWVRT  117

Query  339  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  518
            N++P+Y +T+IR++LVGNE+LS         LVPAMRKI  S++  G+  IKVGTPLAMD
Sbjct  118  NILPYYPQTQIRFVLVGNEVLSYNYGNISANLVPAMRKIVNSLRFRGIHNIKVGTPLAMD  177

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             L +S+PPS+G FR ++ G V  PLL+FL+ TNS+FF +V
Sbjct  178  ALRSSFPPSNGTFREEIAGPVVLPLLKFLNGTNSYFFINV  217



>ref|XP_002976500.1| hypothetical protein SELMODRAFT_105435, partial [Selaginella 
moellendorffii]
 gb|EFJ22169.1| hypothetical protein SELMODRAFT_105435, partial [Selaginella 
moellendorffii]
Length=461

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 116/161 (72%), Gaps = 4/161 (2%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            ++LI  LK  RVKIYDANP IL AL N+ V+V+VMVPN+ IP+++S Q+ AD WV++NV 
Sbjct  19   VELIRQLKLGRVKIYDANPSILSALANTSVKVTVMVPNQQIPSVASSQSFADEWVKSNVT  78

Query  348  PFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPLAMD  518
             +Y  T+IR +L+GNEILS+     +TW +LVPAM+ I RS+ K GL RKIKV TP A+ 
Sbjct  79   AYYPFTRIRTVLIGNEILSDFSIRQSTWPKLVPAMKNIHRSLAKLGLHRKIKVSTPHALL  138

Query  519  MLEA-SYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            +L+   +PPS+G FR D+   + +P+L+FL  TNS FF D 
Sbjct  139  VLQGYVFPPSNGTFRDDIAEPIIRPMLEFLHSTNSPFFVDA  179



>ref|XP_010450110.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=479

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 111/160 (69%), Gaps = 0/160 (0%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  +  I  +KA  VK+YDA+P+ L  L  + + V++ VPN  I +ISS+Q  AD WV T
Sbjct  58   YQSINFIKSIKAGHVKLYDADPESLTLLSRTNLYVTITVPNHQITSISSNQTTADEWVRT  117

Query  339  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  518
            N++PFY +T+IR++LVGNE+L+         LVPAMRKI  S++  G+  IKVGTPLAMD
Sbjct  118  NILPFYPQTQIRFVLVGNEVLNYNYGNISANLVPAMRKIVNSLRFRGIHNIKVGTPLAMD  177

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             L +S+PPS+G FR ++ G V  PLL+FL+ TNS+FF +V
Sbjct  178  SLRSSFPPSNGTFREEIAGPVILPLLKFLNGTNSYFFINV  217



>ref|XP_004957267.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Setaria italica]
Length=483

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 113/162 (70%), Gaps = 5/162 (3%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            ++L+    A  VKIYDANP +LRAL  +   VS+MVPN+IIP+I++  A ADRWV  N+V
Sbjct  56   VELLRAAGAGSVKIYDANPGVLRALAGTRWPVSIMVPNQIIPDIAASAAAADRWVAENLV  115

Query  348  PFYGETKIRYLLVGNEILSN--PPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  521
            P+Y  T++++LLVGNEILS+    N+TW +LVPAM  I  S++K G+  +K+GT LAMD 
Sbjct  116  PYYPATRVKFLLVGNEILSDYSIANSTWLRLVPAMENIHLSLRKRGISSVKIGTTLAMDA  175

Query  522  LEAS---YPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            L       PPS+ AFR D+  SV +PLL FL+ TNS++F D 
Sbjct  176  LADGDFPRPPSAAAFRPDIAASVVRPLLHFLNGTNSYYFVDA  217



>dbj|BAJ88052.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=488

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 115/165 (70%), Gaps = 5/165 (3%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
               +QL+    A  VKIYDANP +LRAL  +G+ VS+MVPN++IP++++  A ADRWV  
Sbjct  58   RRSVQLLRAAGAGSVKIYDANPAVLRALAGTGMAVSIMVPNQVIPDLAASYAAADRWVAA  117

Query  339  NVVPFYGETKIRYLLVGNEILSNP--PNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLA  512
            N++P+   T++++LLVGNE+LS+     +TW ++VPAM  + RS++   + ++K+GT LA
Sbjct  118  NLLPYLPRTRVKFLLVGNEVLSDGSIAASTWPRIVPAMENLHRSLRARRVSRVKLGTTLA  177

Query  513  MDMLEASY---PPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            MD L A     PPS+ AFR D+  SV +PLL+FL+ TNS++F D 
Sbjct  178  MDALVAGAFPRPPSAAAFRPDIAESVLRPLLRFLEGTNSYYFVDA  222



>ref|XP_003572424.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brachypodium 
distachyon]
Length=590

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 112/160 (70%), Gaps = 3/160 (2%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNV-  344
            ++L+    A  VKIYDANP+IL A   +G+ VS MVPNEIIP+I++ +A A +WV  N+ 
Sbjct  62   VRLLRDAGAGAVKIYDANPEILSAFAGTGIPVSAMVPNEIIPSIAASRAAAHKWVVNNLP  121

Query  345  VPFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  518
             P     KI YLLVGNE+LSN    ++TW  +VPAMR +R +++K G+ ++K+GTPLAMD
Sbjct  122  KPSSHGPKIVYLLVGNELLSNQAIKDSTWGAIVPAMRNLRHALRKHGMGRVKLGTPLAMD  181

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             L ASYPPSS  FR D+   V +PLL+FL+ T S++F D 
Sbjct  182  ALSASYPPSSSLFRDDIELKVMRPLLRFLNLTKSYYFVDA  221



>ref|XP_007034194.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY05120.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=552

 Score =   162 bits (410),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 117/163 (72%), Gaps = 4/163 (2%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  ++++  +KA+RVK+YD++P+IL+    + + +++MVPN+ I  ISS Q  A++WV  
Sbjct  129  YQSIEIMKSMKARRVKLYDSDPEILKLFSGTNIDMAIMVPNKDIVLISSSQTAAEQWVRN  188

Query  339  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
            NV+  Y  T IR++LVGNE+LS       T W  LVPAMR+I+ S+    ++ IK+GTPL
Sbjct  189  NVLA-YPNTNIRFVLVGNEVLSYVSKQDQTIWAHLVPAMRRIKNSLSANDIKNIKIGTPL  247

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            AMD+L++++PPSSG FRSD++ +V  PLL+FL+ + SFFF DV
Sbjct  248  AMDILQSTFPPSSGTFRSDISNTVMAPLLKFLNGSKSFFFLDV  290



>dbj|BAK04571.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=551

 Score =   162 bits (410),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 115/162 (71%), Gaps = 5/162 (3%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            +QL+    A  VKIYDANP +LRAL  +G+ VS+MVPN++IP++++  A ADRWV  N++
Sbjct  109  VQLLRAAGAGSVKIYDANPAVLRALAGTGMAVSIMVPNQVIPDLAASYAAADRWVAANLL  168

Query  348  PFYGETKIRYLLVGNEILSNP--PNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  521
            P+   T++++LLVGNE+LS+     +TW ++VPAM  + RS++   + ++K+GT LAMD 
Sbjct  169  PYLPRTRVKFLLVGNEVLSDGSIAASTWPRIVPAMENLHRSLRARRVSRVKLGTTLAMDA  228

Query  522  LEASY---PPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            L A     PPS+ AFR D+  SV +PLL+FL+ TNS++F D 
Sbjct  229  LVAGAFPRPPSAAAFRPDIAESVLRPLLRFLEGTNSYYFVDA  270



>ref|XP_010435194.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=479

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 111/160 (69%), Gaps = 0/160 (0%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  +  I  +KA  VK+YDA+P+ L  L  + + V++ VPN  I ++SS+Q  AD WV T
Sbjct  58   YQSINFIKSIKAGHVKLYDADPESLTLLSRTNLYVTITVPNHQITSLSSNQTTADEWVRT  117

Query  339  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  518
            N++P+Y +T+IR++LVGNE+L+         LVPAMRKI  S++  G+  IKVGTPLAMD
Sbjct  118  NILPYYPQTQIRFVLVGNEVLNYNYGNISANLVPAMRKIVNSLRFRGIHNIKVGTPLAMD  177

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             L +S+PPS+G FR ++ G V  PLL+FL+ TNS+FF +V
Sbjct  178  SLRSSFPPSNGTFREEIAGPVILPLLKFLNGTNSYFFINV  217



>gb|EEC84834.1| hypothetical protein OsI_31928 [Oryza sativa Indica Group]
Length=477

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 124/195 (64%), Gaps = 9/195 (5%)
 Frame = +3

Query  81   CHLFPAQISQLRSEYATVNWATTF----PHHHDLQLIHGLKAKRVKIYDANPKILRALGN  248
            CH+     S   +    VN+        P    ++L+  + A  VKIYDAN  +LRAL  
Sbjct  16   CHVVAQGRSTAAAHGIGVNYGRVADDIPPPARSVELLRAVGAGSVKIYDANSSVLRALAG  75

Query  249  SGVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSN--PPNTT  422
            + ++VS+MVPNEIIP +++  A ADRWV  N+VP+Y ET+++YLLVGNE+LS+    N+T
Sbjct  76   TRMRVSIMVPNEIIPGLAASAAAADRWVAENLVPYYPETRVKYLLVGNELLSDYSIANST  135

Query  423  WFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASY---PPSSGAFRSDLTGSVFKPL  593
            W ++VPAM  +  S+++  +  +K+ T LAMD L +     PPS+ AFR D+ G V +PL
Sbjct  136  WPRIVPAMENLHVSLRRRRISSVKISTTLAMDALTSGSFPRPPSAAAFRPDIAGDVVRPL  195

Query  594  LQFLDRTNSFFFFDV  638
            L+FL+ TNS++F D 
Sbjct  196  LRFLNGTNSYYFVDA  210



>ref|NP_001149815.1| glucan endo-1,3-beta-glucosidase A6 precursor [Zea mays]
 gb|ACG36890.1| glucan endo-1,3-beta-glucosidase A6 precursor [Zea mays]
 tpg|DAA62204.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=479

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 113/162 (70%), Gaps = 5/162 (3%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            ++L+    A  VKIYDANP +LRAL  +   VS+MVPN+IIP++++  A ADRWV  N+V
Sbjct  51   VELLRAAGAGSVKIYDANPGVLRALAGTRWPVSIMVPNQIIPDLAASAAAADRWVAENLV  110

Query  348  PFYGETKIRYLLVGNEILSN--PPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  521
            P+Y  T++++LLVGNEILS+    N+TW  LVPAM  I RS++K  +  +K+GT LAMD 
Sbjct  111  PYYPATRVKFLLVGNEILSDLSIANSTWPHLVPAMENIHRSLRKRSISSVKIGTTLAMDA  170

Query  522  LEASY---PPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            L       PPS+ AFR+D+  +V +PLL FL+ TNS++F D 
Sbjct  171  LADGAFPRPPSAAAFRADIAEAVVRPLLHFLNGTNSYYFVDA  212



>gb|KCW48409.1| hypothetical protein EUGRSUZ_K02112 [Eucalyptus grandis]
Length=418

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 105/147 (71%), Gaps = 20/147 (14%)
 Frame = +3

Query  186  LKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGET  365
            L +K VK+YDANP+IL AL N+G++V  MVPNE+I NIS+DQAL+D WV +N++PFY +T
Sbjct  49   LSSKSVKLYDANPQILLALRNTGLEVCAMVPNELIANISADQALSDHWVGSNIIPFYPDT  108

Query  366  KIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEAS--YP  539
            KIR+LLVGNEILS+P N                  +  +R +KVG  +AM+ LE S  YP
Sbjct  109  KIRHLLVGNEILSDPGN------------------RHRIRNVKVGISMAMETLEGSSVYP  150

Query  540  PSSGAFRSDLTGSVFKPLLQFLDRTNS  620
            PS+G+FRSD++GSV KP+LQFL  T S
Sbjct  151  PSNGSFRSDISGSVMKPMLQFLSETKS  177



>dbj|BAK05423.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=470

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 114/159 (72%), Gaps = 3/159 (2%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            ++L+    A  VK+Y+A+ +IL AL  +G+ VSVMVPN++IP+++  +A A +WV  N+ 
Sbjct  52   VKLLRKANAGAVKLYNADQRILHALAGTGIPVSVMVPNDLIPSLADSRAAARKWVANNL-  110

Query  348  PFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  521
              +   ++ YLLVGNE+LS P    +TW ++VPAM+ +R +++  GL ++K+GTPLAMD 
Sbjct  111  KRHPRVRVMYLLVGNELLSYPAIAASTWGKIVPAMKNLRYALRAIGLGRVKLGTPLAMDA  170

Query  522  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            L ASYPPS+GAFR D+ G+V +PLL FL+ T S++F D 
Sbjct  171  LAASYPPSAGAFREDIAGTVMRPLLHFLNYTRSYYFVDA  209



>ref|XP_002965673.1| hypothetical protein SELMODRAFT_85067 [Selaginella moellendorffii]
 gb|EFJ33093.1| hypothetical protein SELMODRAFT_85067 [Selaginella moellendorffii]
Length=449

 Score =   158 bits (400),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 112/160 (70%), Gaps = 3/160 (2%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            + LI  L   R KI+ A+  I+RA  NSGV++SVMV N+ IP I+S Q+ AD WV+ NV 
Sbjct  19   VGLIKDLGFDRAKIFSADSSIIRAFANSGVKLSVMVANQQIPEIASSQSSADAWVKKNVA  78

Query  348  PFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRRSVKKFGLR-KIKVGTPLAMD  518
             +Y +T I  +LVGNEILS+     +TW +LVPAM KI+ +++KF L   IKV TPLA D
Sbjct  79   AYYPKTAIDSVLVGNEILSDSSIRESTWPKLVPAMEKIQSALEKFELAGSIKVSTPLASD  138

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             L  SYPPS+G+F+SD+  S+ +PLL+FL RTNSF+  +V
Sbjct  139  ALGNSYPPSAGSFKSDIAESIIQPLLEFLSRTNSFYCGNV  178



>ref|XP_002973407.1| hypothetical protein SELMODRAFT_413735 [Selaginella moellendorffii]
 gb|EFJ25781.1| hypothetical protein SELMODRAFT_413735 [Selaginella moellendorffii]
Length=541

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 117/162 (72%), Gaps = 5/162 (3%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            ++LI  LK  RVKIYDANP IL AL N+ V+V+VMVPN+ IP+++S Q+ AD WV++NV 
Sbjct  111  VELIRQLKLGRVKIYDANPSILSALANTSVKVTVMVPNQQIPSVASSQSFADEWVKSNVT  170

Query  348  PFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPLA-M  515
             +Y  T+IR +L+GNEILS+     +TW +LVPAM+ I RS+ K GL RKIKV TP A +
Sbjct  171  AYYPFTRIRTVLIGNEILSDFSIRQSTWPKLVPAMKNIHRSLAKLGLHRKIKVSTPHALL  230

Query  516  DMLEA-SYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            ++L+   +PPS+G FR D+   + +P+L+FL  TNS FF D 
Sbjct  231  NVLQGYVFPPSNGTFRDDIAEPIIRPMLEFLHSTNSPFFVDA  272



>ref|NP_001063586.1| Os09g0502200 [Oryza sativa Japonica Group]
 dbj|BAF25500.1| Os09g0502200 [Oryza sativa Japonica Group]
 gb|EEE69998.1| hypothetical protein OsJ_29910 [Oryza sativa Japonica Group]
Length=480

 Score =   159 bits (401),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 128/199 (64%), Gaps = 14/199 (7%)
 Frame = +3

Query  81   CHLFPAQISQLRSEYAT----VNWATTF----PHHHDLQLIHGLKAKRVKIYDANPKILR  236
            CH+    ++Q RS  A     VN+        P    ++L+  + A  VKIYDAN  +LR
Sbjct  16   CHVG-VVVAQGRSTAAAHGIGVNYGRVADDIPPPARSVELLRAVGAGSVKIYDANSSVLR  74

Query  237  ALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSN--P  410
            AL  + ++VS+MVPNEIIP +++  A ADRWV  N+VP+Y ET+++YLLVGNE+LS+   
Sbjct  75   ALAGTRMRVSIMVPNEIIPGLAASAAAADRWVAENLVPYYPETRVKYLLVGNELLSDYSI  134

Query  411  PNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASY---PPSSGAFRSDLTGSV  581
             N+TW ++VPAM  +  S+++  +  +K+ T LAMD L +     PPS+ AFR D+ G V
Sbjct  135  ANSTWPRIVPAMENLHVSLRRRRISSVKISTTLAMDALTSGSFPRPPSAAAFRPDIAGDV  194

Query  582  FKPLLQFLDRTNSFFFFDV  638
             +PLL+FL+ TNS++F D 
Sbjct  195  VRPLLRFLNGTNSYYFVDA  213



>ref|XP_004147671.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cucumis sativus]
Length=461

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 113/160 (71%), Gaps = 3/160 (2%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            +++++ ++  RVK+YDAN +IL  L  +  QVS+M+PN  I  I+++Q  AD+W+  N++
Sbjct  40   IEMMNSMRVGRVKLYDANHEILSNLSKTKFQVSIMIPNNEISGIANNQTRADQWILNNLL  99

Query  348  PFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  518
            PFY +T IR++LVGNE+L   S+     W  LVPAMR+I  S+K   L+ I+VGTP+AMD
Sbjct  100  PFYPQTMIRFILVGNEVLSLDSDIDRQVWNDLVPAMRRIWSSLKANNLQIIRVGTPVAMD  159

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            +LE ++PPS G FRSD+  +V  P+L FL+ T SFFF +V
Sbjct  160  VLETTFPPSRGTFRSDIQRTVVAPMLDFLNETRSFFFANV  199



>gb|KGN57233.1| hypothetical protein Csa_3G172380 [Cucumis sativus]
Length=487

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 113/160 (71%), Gaps = 3/160 (2%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            +++++ ++  RVK+YDAN +IL  L  +  QVS+M+PN  I  I+++Q  AD+W+  N++
Sbjct  46   IEMMNSMRVGRVKLYDANHEILSNLSKTKFQVSIMIPNNEISGIANNQTRADQWILNNLL  105

Query  348  PFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  518
            PFY +T IR++LVGNE+L   S+     W  LVPAMR+I  S+K   L+ I+VGTP+AMD
Sbjct  106  PFYPQTMIRFILVGNEVLSLDSDIDRQVWNDLVPAMRRIWSSLKANNLQIIRVGTPVAMD  165

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            +LE ++PPS G FRSD+  +V  P+L FL+ T SFFF +V
Sbjct  166  VLETTFPPSRGTFRSDIQRTVVAPMLDFLNETRSFFFANV  205



>ref|XP_006414816.1| hypothetical protein EUTSA_v10025081mg [Eutrema salsugineum]
 gb|ESQ56269.1| hypothetical protein EUTSA_v10025081mg [Eutrema salsugineum]
Length=479

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 111/160 (69%), Gaps = 0/160 (0%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  +  I  +KA  VK+YDA+P+ L  L ++ + V++ VPN  I ++ S+Q  A+ WV+T
Sbjct  58   YQSINFIKSIKAGHVKLYDADPESLTLLSHTNLYVTITVPNHQIISLGSNQTTAEDWVKT  117

Query  339  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  518
            N++P+Y +T+IR++LVGNEILS         LVPAMRKI  S++  G+  IKVGTPLAMD
Sbjct  118  NILPYYPQTQIRFVLVGNEILSAENRNITANLVPAMRKIVTSLRAHGIHNIKVGTPLAMD  177

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             L +++PPS+  FR D+ G +  PL++FL+ TNS+FF ++
Sbjct  178  SLRSTFPPSNSTFREDIAGELMLPLMKFLNGTNSYFFINL  217



>ref|XP_010527440.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Tarenaya 
hassleriana]
Length=489

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 113/166 (68%), Gaps = 6/166 (4%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  + LI  + A  VK+YDA+P+ L  L  + ++V++MV N  I +I SDQ  AD WV T
Sbjct  57   YKSINLIKSVNAGHVKLYDADPETLILLSQTNLRVTIMVQNHDIVSIGSDQRAADDWVRT  116

Query  339  NVVPFYGETKIRYLLVGNEILS----NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTP  506
            NV+P+Y  T IR++LVGNE+LS    +     W  LVPAMRKI +S++  G+  +KVGTP
Sbjct  117  NVLPYYPRTLIRFVLVGNEVLSYYNTDQDRDIWRNLVPAMRKIVKSLRAQGIHNVKVGTP  176

Query  507  LAMDMLEA--SYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            LAMD+L++  ++PPSSG FR D+   V  PLL+FL+ TNSFFF DV
Sbjct  177  LAMDVLQSATTFPPSSGTFRDDIAFPVMLPLLKFLNGTNSFFFIDV  222



>dbj|BAG16366.1| tapetum-specific protein A6 family protein [Brassica rapa var. 
perviridis]
Length=399

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 110/160 (69%), Gaps = 0/160 (0%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  +  I  +KA  VK+YDA+P+ L  L  + + V++ VPN  I ++S++Q  AD WV+T
Sbjct  5    YQSINFIKLIKAGHVKLYDADPESLTLLSQTNLYVTIAVPNHQITSLSANQTTADDWVKT  64

Query  339  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  518
            N++P+Y +T+IR++LVGNEILS         +VPAMRKI  S++  G+  IKVGTPLAMD
Sbjct  65   NILPYYPQTQIRFVLVGNEILSVQDRNITANVVPAMRKIVNSLRAHGIHNIKVGTPLAMD  124

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             L +++PPS+  FR D+   +  PLL+FL+ TNS+FF ++
Sbjct  125  SLRSTFPPSNSTFREDIALPLMLPLLKFLNGTNSYFFINL  164



>emb|CBI39414.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 102/137 (74%), Gaps = 3/137 (2%)
 Frame = +3

Query  237  ALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILS---N  407
            A   + +QVS+MVPN+ I NISS+Q LAD+WV  NV+ +Y +T IR+++VGNE+LS   +
Sbjct  25   AFTRTKIQVSIMVPNQEISNISSNQTLADQWVRDNVLSYYPQTMIRFIVVGNEVLSYYSD  84

Query  408  PPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFK  587
                TW  LVPAMR+I++S++   +  IKVGT +AMD++E+S+PPSSG FRSD+  +V  
Sbjct  85   RDRETWSNLVPAMRRIKKSLQANNIPNIKVGTSVAMDVMESSFPPSSGMFRSDILDTVMV  144

Query  588  PLLQFLDRTNSFFFFDV  638
            PLL+FL  TNSFFF DV
Sbjct  145  PLLEFLSGTNSFFFLDV  161



>ref|XP_010238330.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brachypodium 
distachyon]
Length=477

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 113/162 (70%), Gaps = 5/162 (3%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            +QL+    A  VKIYDANP +LRAL  + + VS+MVPNEIIP++++  A AD WV  N++
Sbjct  53   VQLLRAAGAGSVKIYDANPAVLRALAGTRIPVSIMVPNEIIPDLAASAAKADEWVVQNLL  112

Query  348  PFYGETKIRYLLVGNEILSNP--PNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  521
            P+  +T++++LLVGNE+LS+     +TW ++VPAM  + RS++   +  +K+GT LAMD 
Sbjct  113  PYLAKTRVKFLLVGNEVLSDRSIATSTWPRIVPAMENLHRSLRARRVSSVKLGTTLAMDA  172

Query  522  LEASY---PPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            L +     PPS+  FR+D+  +V +PLL+FL+ TNS++F D 
Sbjct  173  LVSGAFPRPPSAAVFRADIAEAVVRPLLRFLNGTNSYYFVDA  214



>ref|XP_009144683.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=479

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 110/160 (69%), Gaps = 0/160 (0%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  +  I  +KA  VK+YDA+P+ L  L  + + V++ VPN  I ++S++Q  AD WV+T
Sbjct  58   YQSINFIKLIKAGHVKLYDADPESLTLLSQTNLYVTIAVPNHQITSLSANQTTADDWVKT  117

Query  339  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  518
            N++P+Y +T+IR++LVGNEILS         +VPAMRKI  S++  G+  IKVGTPLAMD
Sbjct  118  NILPYYPQTQIRFVLVGNEILSVKDRNITANVVPAMRKIVNSLRAHGIHNIKVGTPLAMD  177

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             L +++PPS+  FR D+   +  PLL+FL+ TNS+FF ++
Sbjct  178  SLRSTFPPSNSTFREDIALPLMLPLLKFLNGTNSYFFINL  217



>emb|CDY08310.1| BnaA05g13090D [Brassica napus]
Length=479

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 110/160 (69%), Gaps = 0/160 (0%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  +  I  +KA  VK+YDA+P+ L  L  + + V++ VPN  I ++S++Q  AD WV+T
Sbjct  58   YQSINFIKLIKAGHVKLYDADPESLTLLSQTNLYVTIAVPNHQITSLSANQTTADDWVKT  117

Query  339  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  518
            N++P+Y +T+IR++LVGNEILS         +VPAMRKI  S++  G+  IKVGTPLAMD
Sbjct  118  NILPYYPQTQIRFVLVGNEILSVQDRNITANVVPAMRKIVNSLRAHGIHNIKVGTPLAMD  177

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             L +++PPS+  FR D+   +  PLL+FL+ TNS+FF ++
Sbjct  178  SLRSTFPPSNSTFREDIALPLMLPLLKFLNGTNSYFFINL  217



>gb|ABR16205.1| unknown [Picea sitchensis]
Length=494

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 108/159 (68%), Gaps = 2/159 (1%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            + LI  L+A  VKIYDA+P++L AL N+ +QV++ V N+ I NISS   +A++WV+ NV+
Sbjct  66   VALIKNLQAGYVKIYDADPQVLSALSNTALQVTITVRNQDISNISSSPTVAEQWVQANVL  125

Query  348  PFYGETKIRYLLVGNEILSNPPN-TTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPLAMDM  521
            P Y  T I  ++VGNE+LS+  N  TW  ++PAM  I  S+   GL   IKV T LAMD+
Sbjct  126  PHYPSTLITAIMVGNEVLSDYQNQATWLLMLPAMPNIHASLLNHGLADSIKVTTSLAMDV  185

Query  522  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            L +SYPPS G FR+D+   V +PLL F++RT SF F D+
Sbjct  186  LSSSYPPSEGTFRNDVASPVLQPLLDFVNRTGSFVFLDI  224



>emb|CDY12371.1| BnaC08g08340D [Brassica napus]
Length=479

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 109/160 (68%), Gaps = 0/160 (0%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  +  I  +KA  VK+YDA+P+ L  L ++ + VS+ V N  I ++ ++Q  A+ WV+T
Sbjct  58   YQSINFIKSIKAGHVKLYDADPETLTLLSHTNLYVSITVHNHQITSLGTNQTTAEDWVKT  117

Query  339  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  518
            N++P+Y +T+IR++LVGNEILS         LVPAMRKI  +++  G+  IKVGTPL MD
Sbjct  118  NILPYYPQTQIRFVLVGNEILSVQDRNITANLVPAMRKIVNALRAHGIHNIKVGTPLPMD  177

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             L +++PPS+  FR D+ G +  PLL+FL+ TNS+FF ++
Sbjct  178  SLRSTFPPSNSTFREDIAGPLMLPLLKFLNGTNSYFFINL  217



>ref|XP_009108090.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=479

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 109/160 (68%), Gaps = 0/160 (0%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  +  I  +KA  VK+YDA+P+ L  L ++ + VS+ V N  I ++ ++Q  A+ WV+T
Sbjct  58   YQSINFIKSIKAGHVKLYDADPETLTLLSHTNLYVSITVHNHQITSLGTNQTTAEDWVKT  117

Query  339  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  518
            N++P+Y +T+IR++LVGNEILS         LVPAMRKI  +++  G+  IKVGTPL MD
Sbjct  118  NILPYYPQTQIRFVLVGNEILSVQDRNITSNLVPAMRKIVNALRAHGIHNIKVGTPLPMD  177

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             L +++PPS+  FR D+ G +  PLL+FL+ TNS+FF ++
Sbjct  178  SLRSTFPPSNSTFREDIAGPLMLPLLKFLNGTNSYFFINL  217



>emb|CDY27122.1| BnaA08g07600D [Brassica napus]
Length=479

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 109/160 (68%), Gaps = 0/160 (0%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  +  I  +KA  VK+YDA+P+ L  L ++ + VS+ V N  I ++ ++Q  A+ WV+T
Sbjct  58   YQSINFIKSIKAGHVKLYDADPETLTLLSHTNLYVSITVHNHQITSLGTNQTTAEDWVKT  117

Query  339  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  518
            N++P+Y +T+IR++LVGNEILS         LVPAMRKI  +++  G+  IKVGTPL MD
Sbjct  118  NILPYYPQTQIRFVLVGNEILSVQDRNITSNLVPAMRKIVNALRAHGIHNIKVGTPLPMD  177

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             L +++PPS+  FR D+ G +  PLL+FL+ TNS+FF ++
Sbjct  178  SLRSTFPPSNSTFREDIAGPLMLPLLKFLNGTNSYFFINL  217



>ref|NP_001062294.2| Os08g0525800 [Oryza sativa Japonica Group]
 dbj|BAF24208.2| Os08g0525800 [Oryza sativa Japonica Group]
Length=471

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 117/192 (61%), Gaps = 8/192 (4%)
 Frame = +3

Query  81   CHLFPAQI-SQLRSEYATVNWATTFP-HHHDLQLIHGLKAKRVKIYDANPKILRALGNSG  254
            CH   A+    L   Y TV  A   P     ++L+    A  V+IYDAN  ILRAL  +G
Sbjct  22   CHCHVARGWGGLGVNYGTV--ADDLPTAARSVELLRAAGAGAVRIYDANADILRALAGTG  79

Query  255  VQVSVMVPNEIIPNISSDQALA--DRWVETNVVPFYGETKIRYLLVGNEILSN--PPNTT  422
            V VSV VPN+ IP++++  + A  D WV  N+ P     ++  LLVGNE+LS+     T 
Sbjct  80   VPVSVTVPNDAIPSLAAAASPAAVDEWVARNLAPHIPAARVLCLLVGNEVLSDRATAGTA  139

Query  423  WFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQF  602
            W  LVPAM  +RR++   GL ++KVGT LAMD L  SYPPS+GAFR D+ G+V +PLL+F
Sbjct  140  WPSLVPAMANLRRALSARGLGRVKVGTTLAMDALGTSYPPSAGAFRDDIAGAVVRPLLEF  199

Query  603  LDRTNSFFFFDV  638
            L+ T S++F D 
Sbjct  200  LNATGSYYFVDA  211



>dbj|BAC75423.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
Length=482

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 117/192 (61%), Gaps = 8/192 (4%)
 Frame = +3

Query  81   CHLFPAQI-SQLRSEYATVNWATTFP-HHHDLQLIHGLKAKRVKIYDANPKILRALGNSG  254
            CH   A+    L   Y TV  A   P     ++L+    A  V+IYDAN  ILRAL  +G
Sbjct  22   CHCHVARGWGGLGVNYGTV--ADDLPTAARSVELLRAAGAGAVRIYDANADILRALAGTG  79

Query  255  VQVSVMVPNEIIPNISSDQALA--DRWVETNVVPFYGETKIRYLLVGNEILSN--PPNTT  422
            V VSV VPN+ IP++++  + A  D WV  N+ P     ++  LLVGNE+LS+     T 
Sbjct  80   VPVSVTVPNDAIPSLAAAASPAAVDEWVARNLAPHIPAARVLCLLVGNEVLSDRATAGTA  139

Query  423  WFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQF  602
            W  LVPAM  +RR++   GL ++KVGT LAMD L  SYPPS+GAFR D+ G+V +PLL+F
Sbjct  140  WPSLVPAMANLRRALSARGLGRVKVGTTLAMDALGTSYPPSAGAFRDDIAGAVVRPLLEF  199

Query  603  LDRTNSFFFFDV  638
            L+ T S++F D 
Sbjct  200  LNATGSYYFVDA  211



>dbj|BAG16359.1| tapetum-specific protein A6 family protein [Brassica oleracea 
var. italica]
Length=399

 Score =   149 bits (375),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 109/160 (68%), Gaps = 0/160 (0%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  +  I  +KA  VK+YDA+P+ L  L  + + V++ VP   I ++S++Q  A+ WV+T
Sbjct  5    YQSINFIKLIKAGHVKLYDADPESLTLLSQTNLYVTIAVPTHQITSLSANQTTAEDWVKT  64

Query  339  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  518
            N++P+Y +T+IR++LVGNEILS         +VPAMRKI  S++  G+  IKVGTPLAMD
Sbjct  65   NILPYYPQTQIRFVLVGNEILSVKDRNITGNVVPAMRKIVNSLRAHGIHNIKVGTPLAMD  124

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             L +++PPS+  FR D+   +  PLL+FL+ TNS+FF ++
Sbjct  125  SLRSTFPPSNSTFRGDIALPLMLPLLKFLNGTNSYFFINL  164



>emb|CAB71021.1| putative beta-1,3-glucanase [Hieracium piloselloides]
Length=379

 Score =   148 bits (374),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 111/161 (69%), Gaps = 5/161 (3%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            ++L+  + A RVK+YDA+ +IL  L    ++V++ V N+ I  I+++Q LAD+WV  +V+
Sbjct  58   IELLESMNAGRVKLYDADHEILHLLSGKDIEVAITVANDEISAIAANQHLADQWVYEHVL  117

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQ----LVPAMRKIRRSVKKFGLRKIKVGTPLAM  515
              Y  TKIR++LVGNE+ S+  N    Q    LVPAMR+I+ ++K  G+R IKVGTPLAM
Sbjct  118  AHYPNTKIRFILVGNEVFSSTNNVQDMQIARDLVPAMRRIKNTIKAQGIRNIKVGTPLAM  177

Query  516  DMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            DM+E ++PPS+G+F+ D+   +  PLL++L+ T SF   DV
Sbjct  178  DMMETTFPPSNGSFKPDIR-ELMIPLLKYLNGTRSFVLVDV  217



>emb|CAA49513.1| beta-1,3-glucanase homologue [Brassica napus]
Length=474

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 109/160 (68%), Gaps = 0/160 (0%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  +  I  +KA  VK+YDA+P+ L  L  + + V++ VP   I ++S++Q  A+ WV+T
Sbjct  53   YQSINFIKLIKAGHVKLYDADPESLTLLSQTNLYVTIAVPTHQITSLSANQTTAEDWVKT  112

Query  339  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  518
            N++P+Y +T+IR++LVGNEILS         +VPAMRKI  S++  G+  IKVGTPLAMD
Sbjct  113  NILPYYPQTQIRFVLVGNEILSVKDRNITGNVVPAMRKIVNSLRAHGIHNIKVGTPLAMD  172

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             L +++PPS+  FR D+   +  PLL+FL+ TNS+FF ++
Sbjct  173  SLRSTFPPSNSTFRGDIALPLMLPLLKFLNGTNSYFFINL  212



>ref|NP_001051879.1| Os03g0845600 [Oryza sativa Japonica Group]
 gb|AAO73280.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 gb|AAS07356.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 gb|ABF99870.1| Glycosyl hydrolases family 17 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13793.1| Os03g0845600 [Oryza sativa Japonica Group]
 gb|EAZ29287.1| hypothetical protein OsJ_13350 [Oryza sativa Japonica Group]
 dbj|BAG98908.1| unnamed protein product [Oryza sativa Japonica Group]
Length=474

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 104/165 (63%), Gaps = 3/165 (2%)
 Frame = +3

Query  153  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWV  332
            P H  L+L     A  V+ YD+N   L     SG+     VPNE+IP++++ +  AD WV
Sbjct  40   PPHRALELARSAGAAAVRFYDSNATFLSPAAASGLVFVPGVPNELIPSLAASRRAADEWV  99

Query  333  ETNVVPFYGETKIRYLLVGNEILSNPPNTT-WFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
               ++PF    ++RYL VGNE+LS+P   + WFQLVPAM  + R++++ G+R++KV T L
Sbjct  100  AATLLPFRRNRRLRYLFVGNEVLSDPTTKSRWFQLVPAMANLERALRRHGMRRVKVSTTL  159

Query  510  AMDMLEAS--YPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             MD L+    +PPS+G FR D+  +V +PLL FL+RT+S+ F D 
Sbjct  160  GMDALDGQNVFPPSAGVFRPDIADAVVRPLLAFLERTDSYLFVDA  204



>emb|CDY06469.1| BnaC06g11750D [Brassica napus]
Length=479

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 109/160 (68%), Gaps = 0/160 (0%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  +  I  +KA  VK+YDA+P+ L  L  + + V++ VP   I ++S++Q  A+ WV+T
Sbjct  58   YQSINFIKLIKAGHVKLYDADPESLTLLSQTNLYVTIAVPTHQITSLSANQTTAEDWVKT  117

Query  339  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  518
            N++P+Y +T+IR++LVGNEILS         +VPAMRKI  S++  G+  IKVGTPLAMD
Sbjct  118  NILPYYPQTQIRFVLVGNEILSVKDRNITGNVVPAMRKIVNSLRAHGIHNIKVGTPLAMD  177

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             L +++PPS+  FR D+   +  PLL+FL+ TNS+FF ++
Sbjct  178  SLRSTFPPSNSTFRGDIALPLMLPLLKFLNGTNSYFFINL  217



>emb|CDY01191.1| BnaA04g06280D [Brassica napus]
Length=480

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 108/161 (67%), Gaps = 1/161 (1%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  +  I  +KA  VK+YDA+P+ L  L  + + V++ VPN +I ++S++Q  A+ WV+T
Sbjct  58   YQSINFIKSIKAGHVKLYDADPESLTLLSQTNLYVTITVPNHLITSLSTNQTTAEDWVQT  117

Query  339  NVVPFYGETKIRYLLVGNEILS-NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAM  515
            N++P+Y +T IR++LVGNEILS          +VPAMRKI  S++  G+  IKVGT L M
Sbjct  118  NIIPYYPQTHIRFVLVGNEILSVEERRNITANVVPAMRKIVTSLRAHGIHNIKVGTALDM  177

Query  516  DMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            D L +S+PPS+  FR D+   +  PLL+FL+ TNS+FF ++
Sbjct  178  DSLRSSFPPSNSTFREDIAEPLMLPLLKFLNGTNSYFFINL  218



>ref|XP_009139564.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=480

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 108/161 (67%), Gaps = 1/161 (1%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  +  I  +KA  VK+YDA+P+ L  L  + + V++ VPN +I ++S++Q  A+ WV+T
Sbjct  58   YQSINFIKSIKAGHVKLYDADPESLTLLSQTNLYVTITVPNHLITSLSTNQTTAEDWVQT  117

Query  339  NVVPFYGETKIRYLLVGNEILS-NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAM  515
            N++P+Y +T IR++LVGNEILS          +VPAMRKI  S++  G+  IKVGT L M
Sbjct  118  NIIPYYPQTHIRFVLVGNEILSVEERRNITANVVPAMRKIVTSLRAHGIHNIKVGTALDM  177

Query  516  DMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            D L +S+PPS+  FR D+   +  PLL+FL+ TNS+FF ++
Sbjct  178  DSLRSSFPPSNSTFREDIAEPLMLPLLKFLNGTNSYFFINL  218



>emb|CDY12732.1| BnaC04g29090D [Brassica napus]
Length=480

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 108/161 (67%), Gaps = 1/161 (1%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  +  I  +KA  VK+YDA+P+ L  L  + + V++ VPN +I ++S++Q  A+ WV+T
Sbjct  58   YQSINFIKSIKAGHVKLYDADPESLTLLSQTNLYVTITVPNHLITSLSTNQTSAEDWVQT  117

Query  339  NVVPFYGETKIRYLLVGNEILS-NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAM  515
            N+ P+Y +T IR++LVGNEILS          +VPAMRKI  S++  G+  IKVGT L M
Sbjct  118  NITPYYPQTHIRFVLVGNEILSVEERRNITANVVPAMRKIVTSLRAHGIHNIKVGTALDM  177

Query  516  DMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            D L +++PPS+  FR D+  ++  PLL+FL+ TNS+FF ++
Sbjct  178  DSLRSTFPPSNSTFREDIAETLMLPLLKFLNGTNSYFFINL  218



>gb|EEC76519.1| hypothetical protein OsI_14305 [Oryza sativa Indica Group]
Length=474

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/165 (42%), Positives = 103/165 (62%), Gaps = 3/165 (2%)
 Frame = +3

Query  153  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWV  332
            P H  L+L     A  V+ YD+N   L     SG+     VPNE+IP++++ +  AD WV
Sbjct  40   PPHRALELARSAGAAAVRFYDSNATFLSPAAASGLVFVPGVPNELIPSLAASRRAADEWV  99

Query  333  ETNVVPFYGETKIRYLLVGNEILSNPPNTT-WFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
               ++PF    ++RYL VGNE+LS+P   + WFQLV AM  + R++++ G+R++KV T L
Sbjct  100  AATLLPFRRNRRLRYLFVGNEVLSDPTTKSRWFQLVSAMANLERALRRHGMRRVKVSTTL  159

Query  510  AMDMLEAS--YPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             MD L+    +PPS+G FR D+  +V +PLL FL+RT+S+ F D 
Sbjct  160  GMDALDGQNVFPPSAGVFRPDIADAVVRPLLAFLERTDSYLFVDA  204



>ref|XP_010673323.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Beta 
vulgaris subsp. vulgaris]
Length=473

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 106/160 (66%), Gaps = 1/160 (1%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  ++LI  + A  VK+YDA+P+ ++ L  + + VS+MV N+ I  ++++  LA++WV  
Sbjct  54   YKSIELIKSMNASMVKLYDADPETMKLLAGTDLHVSIMVRNDEIVELATNDTLANQWVHE  113

Query  339  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  518
            NV  +Y  T IR ++VGNE+ SN     W  LV AM+ IR ++    +  IKVGTPLAMD
Sbjct  114  NVFAYYPTTMIRSIMVGNEVYSNHNLEQWDNLVLAMQHIRNTLHTHDIHNIKVGTPLAMD  173

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            +L +++PPS+G FR D T +   PLLQFL+RT SFFF D+
Sbjct  174  ILGSTFPPSNGTFRVD-TLTTIVPLLQFLNRTGSFFFLDI  212



>gb|EAZ07710.1| hypothetical protein OsI_29967 [Oryza sativa Indica Group]
Length=1020

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 117/192 (61%), Gaps = 8/192 (4%)
 Frame = +3

Query  81   CHLFPAQI-SQLRSEYATVNWATTFP-HHHDLQLIHGLKAKRVKIYDANPKILRALGNSG  254
            CH   A+    L   Y TV  A   P     ++L+    A  V+IYDAN  ILRAL  +G
Sbjct  22   CHCHVARGWGGLGVNYGTV--ADDLPTAARSVELLRAAGAGAVRIYDANADILRALAGTG  79

Query  255  VQVSVMVPNEIIPNISSDQALA--DRWVETNVVPFYGETKIRYLLVGNEILSN--PPNTT  422
            V VSV VPN+ IP++++  + A  D WV  N+ P     ++  LLVGNE+LS+     T 
Sbjct  80   VPVSVTVPNDAIPSLAAAASPAAVDEWVARNLAPHIPAARVLCLLVGNEVLSDRATAGTA  139

Query  423  WFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQF  602
            W  LVPAM  +RR++   GL ++KVGT LAMD L  SYPPS+GAFR D+ G+V +PLL+F
Sbjct  140  WPSLVPAMANLRRALSARGLGRVKVGTTLAMDALGTSYPPSAGAFRDDIAGAVVRPLLEF  199

Query  603  LDRTNSFFFFDV  638
            L+ T S++F D 
Sbjct  200  LNATGSYYFVDA  211



>ref|XP_002964439.1| hypothetical protein SELMODRAFT_230318 [Selaginella moellendorffii]
 gb|EFJ34772.1| hypothetical protein SELMODRAFT_230318 [Selaginella moellendorffii]
Length=339

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 105/160 (66%), Gaps = 3/160 (2%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            + LI  L   RVKI+DA+ ++L AL N+ ++VS+MV N+ IP I+S+ + AD WV  NVV
Sbjct  32   VSLIKSLGIDRVKIFDADSQVLAALANTSIKVSIMVRNQDIPGIASNASHADSWVAQNVV  91

Query  348  PFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRRSVKKFGLR-KIKVGTPLAMD  518
              Y  T I  +LVGNEILS+    ++TW  LVPAM  I  S++   L  KIKV TPLA D
Sbjct  92   HHYPATHIATILVGNEILSDTSIKSSTWPALVPAMENIFASLQARNLTAKIKVSTPLASD  151

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             L  SYPPS+GAF S++  SV +PLL FL +T S +  +V
Sbjct  152  ALSTSYPPSAGAFHSEIATSVIQPLLAFLAKTGSSYHANV  191



>ref|XP_002975355.1| hypothetical protein SELMODRAFT_103308, partial [Selaginella 
moellendorffii]
 gb|EFJ23556.1| hypothetical protein SELMODRAFT_103308, partial [Selaginella 
moellendorffii]
Length=320

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 104/160 (65%), Gaps = 3/160 (2%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            + LI  L   RVKI+DA+ ++L AL N+ ++VS+MV N+ IP I+S+ + AD WV  NVV
Sbjct  13   VSLIKSLGIDRVKIFDADSQVLAALANTSIKVSIMVRNQDIPGIASNASHADSWVAQNVV  72

Query  348  PFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRRSVKKFGLR-KIKVGTPLAMD  518
              Y  T I  +LVGNEILS+    ++TW  LVPAM  I  S++   L  KIKV TPLA D
Sbjct  73   HHYPATHIATILVGNEILSDTSIKSSTWPALVPAMENIFASLQARNLTAKIKVSTPLASD  132

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             L  SYPPS+G F S++  SV +PLL FL +T S +  +V
Sbjct  133  ALSTSYPPSAGTFHSEIATSVIQPLLAFLAKTGSSYHANV  172



>ref|XP_008643986.1| PREDICTED: uncharacterized protein LOC100382447 isoform X1 [Zea 
mays]
 tpg|DAA48156.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=482

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 121/190 (64%), Gaps = 6/190 (3%)
 Frame = +3

Query  81   CHLFPAQISQ-LRSEYATVNWATTFPH-HHDLQLIHGLKAKRVKIYDANPKILRALGNSG  254
            CH   A+  + L   Y TV  A   P     +QL+    A  VKIYDAN  ILRAL  +G
Sbjct  36   CHCHGAKGCRGLGINYGTV--ADDLPSASRSVQLLRAAGASAVKIYDANADILRALAGTG  93

Query  255  VQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNP--PNTTWF  428
            V VS+MVPN  IP+++S +A A+ WV  N+ P    T++ +LLVGNE+LSN     +TW 
Sbjct  94   VPVSIMVPNSAIPSLASSRAAAEAWVAANLAPHIPATRVAHLLVGNEVLSNRAIAASTWR  153

Query  429  QLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLD  608
             +VPAM  +RR+++  GLR +K+GT LAMD L ASYPPS+GAFR D+   V  PLL+FL+
Sbjct  154  GVVPAMANLRRALRARGLRGVKLGTTLAMDALSASYPPSAGAFRGDIAEDVVLPLLRFLN  213

Query  609  RTNSFFFFDV  638
             T S++F D 
Sbjct  214  ATRSYYFVDA  223



>ref|XP_002980798.1| hypothetical protein SELMODRAFT_444643 [Selaginella moellendorffii]
 gb|EFJ17983.1| hypothetical protein SELMODRAFT_444643 [Selaginella moellendorffii]
Length=464

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 117/181 (65%), Gaps = 3/181 (2%)
 Frame = +3

Query  102  ISQLRSEYATVNWATTFPHHHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPN  281
            + Q+   Y  V+     P+   ++L+  +  + VK++DANP++L AL NS ++V++MVPN
Sbjct  27   LDQIGVNYGRVSDNIPSPNQT-VELLKSMNVRLVKLFDANPQVLTALSNSSIRVTIMVPN  85

Query  282  EIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPP-NTTWFQLVPAMRKIR  458
            EII  ++S Q+ AD W+  +V+P+Y  T+I  ++VGNEI S P    TW QL+PA+  + 
Sbjct  86   EIIGAVASSQSSADDWIAQSVLPYYPSTQIIVIVVGNEIFSYPALAQTWQQLMPAIENLH  145

Query  459  RSVKKFGL-RKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFD  635
            RS++   L  +IK+ T +A D+L ASYPPS G FR D+  +V KPLL FL  T + F+ +
Sbjct  146  RSLQSHNLDDRIKITTSVAGDVLAASYPPSVGRFRPDIRDTVLKPLLGFLRTTRAPFYIN  205

Query  636  V  638
            +
Sbjct  206  L  206



>ref|XP_002972033.1| hypothetical protein SELMODRAFT_96745, partial [Selaginella moellendorffii]
 gb|EFJ26950.1| hypothetical protein SELMODRAFT_96745, partial [Selaginella moellendorffii]
Length=459

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 110/164 (67%), Gaps = 3/164 (2%)
 Frame = +3

Query  153  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWV  332
            P    ++L+  LK + VKIYDANP +L+AL ++ ++V++MV N+ I  +++    +D+WV
Sbjct  14   PPARVVELLQSLKIRSVKIYDANPDVLKALQSTNLRVAIMVTNQEIEQMAASSNFSDQWV  73

Query  333  ETNVVPFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRRSVKKFGLRKIKVGTP  506
            + NV   Y  TKI   +VGNEILS+     T W +LVPAM  +  S+++ G  KIKV T 
Sbjct  74   QQNVAA-YPATKIETAIVGNEILSDLSLRQTVWSKLVPAMENLHSSLQRLGHGKIKVTTS  132

Query  507  LAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            LA+D L+ S+PPS GAFR D++ ++ +P+L+FL+ T S FF +V
Sbjct  133  LAIDCLKVSFPPSEGAFRDDVSDTIIQPMLKFLETTQSPFFINV  176



>ref|XP_008364550.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14 [Malus domestica]
 ref|XP_008364558.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14 [Malus domestica]
Length=465

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 106/162 (65%), Gaps = 1/162 (1%)
 Frame = +3

Query  153  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWV  332
            P    + L+      +VK+YD +  +L AL NSG+ V V +PNE++ + +SD + AD+WV
Sbjct  41   PPEKVVALLKSQGINKVKLYDTDATVLTALANSGISVVVALPNELLSSAASDPSFADKWV  100

Query  333  ETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLA  512
            ++N+  ++ +T+I  + VGNE+  +P NTT F LVPAM+ I+ S+ K+ L  IK+ +P+A
Sbjct  101  QSNISHYHPKTQIEAIAVGNEVFVDPNNTTQF-LVPAMKNIQSSLVKYNLSSIKLSSPIA  159

Query  513  MDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            +  L +SYPPS+GAF  DL   V KP L+FL +T+S+   + 
Sbjct  160  LSALNSSYPPSAGAFNPDLIEPVIKPFLEFLTQTSSYLMINA  201



>ref|XP_006661404.1| PREDICTED: LOW QUALITY PROTEIN: probable glucan endo-1,3-beta-glucosidase 
A6-like [Oryza brachyantha]
Length=521

 Score =   142 bits (358),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 110/164 (67%), Gaps = 2/164 (1%)
 Frame = +3

Query  153  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWV  332
            P    ++L+  + A  VKIYD N  +LRAL  +G++VS+MVPNEIIP +++  A ADRWV
Sbjct  95   PPRRSVELLRAVGAGSVKIYDGNSSVLRALAGTGMRVSIMVPNEIIPGLAASAAAADRWV  154

Query  333  ETNVVPFYGETKIRYLLVGNEILSN--PPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTP  506
              N+VP+Y ET+++YLLVGNE+LS+    N+TW ++VPAM  +  S+++  +  +K+ T 
Sbjct  155  AENLVPYYPETRVKYLLVGNELLSDYSIANSTWPRIVPAMENLHASLRRRRISSVKISTT  214

Query  507  LAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            LAMD L +   P   +      G+V +PLL+FL+ TNS++F D 
Sbjct  215  LAMDALSSGSFPRPPSAAGVXAGAVVRPLLRFLNGTNSYYFVDA  258



>ref|XP_009348307.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Pyrus x bretschneideri]
Length=463

 Score =   142 bits (357),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 106/162 (65%), Gaps = 1/162 (1%)
 Frame = +3

Query  153  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWV  332
            P    + L       +VK+YD +  +L AL NSG+ V V +PNE++ + +SD + AD+WV
Sbjct  39   PPEKVVALFKSQGINKVKLYDTDAAVLTALANSGIGVVVAIPNELLSSAASDPSFADKWV  98

Query  333  ETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLA  512
            ++N+  ++ +T+I  + VGNE+ ++P NTT F LVPA++ I+ S+ K+ L  IK+ +P A
Sbjct  99   QSNISQYHPKTQIEAIAVGNEVFADPNNTTQF-LVPAIKNIQSSLVKYNLSSIKLSSPFA  157

Query  513  MDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            +  L +SYPPS+GAF+ DL   V KP L+FL +T+S+   + 
Sbjct  158  LSALNSSYPPSAGAFKPDLIEPVIKPFLEFLTQTSSYLMINA  199



>ref|XP_009334153.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Pyrus x bretschneideri]
Length=463

 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 106/162 (65%), Gaps = 1/162 (1%)
 Frame = +3

Query  153  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWV  332
            P    + L       +VK+YD +  +L AL NSG+ V V +PNE++ + +SD + AD+WV
Sbjct  39   PPEKVVALFKSQGINKVKLYDTDAAVLTALANSGIGVVVAIPNELLSSAASDPSFADKWV  98

Query  333  ETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLA  512
            ++N+  ++ +T+I  + VGNE+ ++P NTT F LVPA++ I+ S+ K+ L  IK+ +P A
Sbjct  99   QSNISQYHPKTQIEAIAVGNEVFADPNNTTQF-LVPAIKNIQSSLVKYNLSSIKLSSPFA  157

Query  513  MDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            +  L +SYPPS+GAF+ DL   V KP L+FL +T+S+   + 
Sbjct  158  LSALNSSYPPSAGAFKPDLIEPVIKPFLEFLTQTSSYLMINA  199



>ref|XP_003581305.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brachypodium 
distachyon]
Length=473

 Score =   141 bits (356),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 103/165 (62%), Gaps = 3/165 (2%)
 Frame = +3

Query  153  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWV  332
            P H  L+L     A  V+ YD+N  +L A  +SG+     VPNE+IP++S+ +  AD WV
Sbjct  44   PPHVALELARSAGAAAVRFYDSNATLLAAASSSGLGFVPGVPNELIPSLSASRRAADAWV  103

Query  333  ETNVVPFYGETKIRYLLVGNEILSNPPNTT-WFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
             + ++PF    ++RYL VGNE+LS+P   + W QLVPAM  + R++++ GL ++KV T L
Sbjct  104  ASTLLPFRRNPRLRYLFVGNEVLSDPTTKSRWSQLVPAMANLHRALRRHGLGRVKVSTTL  163

Query  510  AMDML--EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             MD L  +  +PPS+G FR D+     +PLL FL+RT S+ F D 
Sbjct  164  GMDALVGQNVFPPSAGVFRPDIVDVAVRPLLAFLERTESYLFVDT  208



>ref|XP_006492526.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Citrus sinensis]
Length=389

 Score =   140 bits (353),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 89/126 (71%), Gaps = 3/126 (2%)
 Frame = +3

Query  270  MVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNT---TWFQLVP  440
            MV N  I +I+S Q +AD+WV  NV+ FY ET IR++LVGNEILS         W  LVP
Sbjct  1    MVQNHEIIDIASKQKVADQWVHDNVLSFYPETMIRFILVGNEILSQSSEEYKQIWKNLVP  60

Query  441  AMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNS  620
            AM +I++ +    +  IKVGTPLAMD+ + ++PPS+G FRSD++ SV +PLLQFL+RT S
Sbjct  61   AMHRIKKCLNAHNIHNIKVGTPLAMDIFQTTFPPSNGTFRSDISASVMEPLLQFLNRTKS  120

Query  621  FFFFDV  638
            FFF DV
Sbjct  121  FFFLDV  126



>ref|XP_004973968.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Setaria italica]
Length=389

 Score =   140 bits (353),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 89/125 (71%), Gaps = 2/125 (2%)
 Frame = +3

Query  270  MVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSN--PPNTTWFQLVPA  443
            MVPNE IP+++S +A A+ WV  N+ P     ++ YLLVGNE+LSN     +TW  +VPA
Sbjct  1    MVPNEAIPSLASSRAAAEGWVAANLAPHVPAARVMYLLVGNEVLSNRAAAGSTWRAIVPA  60

Query  444  MRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSF  623
            M  + R+++  G+RK+K+GT LAMD L ASYPPS+GAFR D+  +V +PLL+FL+ T SF
Sbjct  61   MANLHRALRAHGIRKVKLGTTLAMDALSASYPPSAGAFRGDVAEAVIRPLLRFLNATRSF  120

Query  624  FFFDV  638
            +F D 
Sbjct  121  YFVDA  125



>ref|XP_007020717.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY12242.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=475

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 106/158 (67%), Gaps = 2/158 (1%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            ++L+  +  ++VK+YD +  +L AL NSG+ V V +PNE++ + ++DQ+ AD WV++N+ 
Sbjct  51   VELLKSIGVEKVKLYDTDATVLTALANSGISVMVALPNELLASAAADQSFADNWVQSNIS  110

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPLAMDML  524
             FY  TKI  + VGNE+  +P NTT + +VPAM+ +  S+ KF L   IK+ +P+A+  L
Sbjct  111  KFYPATKIEAIAVGNEVFVDPKNTTSY-VVPAMKNVHASLVKFNLDSNIKISSPIALSAL  169

Query  525  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            + SYP S+G+F+ DL   V KP+L FL +T+S+   + 
Sbjct  170  QNSYPSSAGSFKPDLVEPVIKPMLDFLKQTDSYLMVNA  207



>gb|ADG38397.1| AT3G07320-like protein [Capsella grandiflora]
Length=202

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +3

Query  330  VETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
            + +N++PFY  TKIRYLLVGNEILS+P +     LVPAMRKI+RS+K  G++K+KVGT L
Sbjct  1    IRSNILPFYPTTKIRYLLVGNEILSSPDSELKASLVPAMRKIQRSLKSLGVKKVKVGTSL  60

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            A+D+L+ S+PPS G FR D++G V KP+LQFL+RT SF F DV
Sbjct  61   AVDVLQTSFPPSKGEFREDISGLVMKPMLQFLNRTKSFLFVDV  103



>ref|XP_009361042.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14-like [Pyrus x 
bretschneideri]
Length=465

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 108/162 (67%), Gaps = 1/162 (1%)
 Frame = +3

Query  153  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWV  332
            P    + L+      +VK+YD +  +L AL NSG+ V V +PN+++ + +SD + AD+WV
Sbjct  41   PPEKVVALLKSQGINKVKLYDTDATVLTALANSGISVVVALPNDLLSSAASDPSFADKWV  100

Query  333  ETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLA  512
            ++N+  ++ +T+I  + VGNE+  +P NTT F LVPA++ I+ S+ K+ L  IK+ +P+A
Sbjct  101  QSNISHYHPKTQIEAIAVGNEVFVDPNNTTQF-LVPAIKNIQSSLVKYNLSSIKLSSPIA  159

Query  513  MDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            +  L +SYPPS+GAF+ DL   V KPLL+FL +T+S+   + 
Sbjct  160  LSSLNSSYPPSAGAFKPDLIEPVIKPLLEFLTQTSSYLMINA  201



>gb|ADG38393.1| AT3G07320-like protein [Capsella grandiflora]
 gb|ADG38394.1| AT3G07320-like protein [Capsella grandiflora]
 gb|ADG38395.1| AT3G07320-like protein [Capsella grandiflora]
Length=202

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +3

Query  330  VETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
            + +N++PFY  TKIRYLLVGNEILS+P +     LVPAMRKI+RS+K  G++K+KVGT L
Sbjct  1    IRSNILPFYPTTKIRYLLVGNEILSSPDSELKASLVPAMRKIQRSLKSLGVKKVKVGTSL  60

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            A+D+L+ S+PPS G FR D++G V KP+LQFL+RT SF F DV
Sbjct  61   AVDVLQTSFPPSKGEFREDISGLVMKPMLQFLNRTKSFLFVDV  103



>ref|XP_002972579.1| hypothetical protein SELMODRAFT_97838, partial [Selaginella moellendorffii]
 gb|EFJ26665.1| hypothetical protein SELMODRAFT_97838, partial [Selaginella moellendorffii]
Length=460

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 109/164 (66%), Gaps = 3/164 (2%)
 Frame = +3

Query  153  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWV  332
            P    ++L+  LK + VKIYDANP +L+AL ++ ++V++MV N+ I  +++    +D+WV
Sbjct  14   PPARVVELLQSLKIRSVKIYDANPDVLKALQSTNLRVAIMVTNQEIEQMAASSNFSDQWV  73

Query  333  ETNVVPFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRRSVKKFGLRKIKVGTP  506
            + NV   Y  TKI   +VGNEILS+     T W +LVPAM  +  S+++ G  KIKV T 
Sbjct  74   QQNVAA-YPATKIETAIVGNEILSDLSLRQTVWSKLVPAMENLHSSLQRLGHGKIKVTTS  132

Query  507  LAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            LA+D L+ S+PPS G FR D++ ++ +P+L+FL+ T S FF +V
Sbjct  133  LAIDCLKVSFPPSDGVFRDDISDAIIQPMLKFLETTQSPFFINV  176



>gb|ADG38398.1| AT3G07320-like protein [Capsella grandiflora]
Length=202

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +3

Query  330  VETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
            + +N++PFY  TKIRYLLVGNEILS+P +     LVPAMRKI+RS+K  G++K+KVGT L
Sbjct  1    IRSNILPFYPTTKIRYLLVGNEILSSPDSELKASLVPAMRKIQRSLKSLGVKKVKVGTSL  60

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            A+D+L+ S+PPS G FR D++G V KP+LQFL+RT SF F DV
Sbjct  61   AVDVLQTSFPPSXGEFREDISGLVMKPMLQFLNRTKSFLFVDV  103



>gb|EYU33669.1| hypothetical protein MIMGU_mgv1a005896mg [Erythranthe guttata]
Length=466

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 103/148 (70%), Gaps = 3/148 (2%)
 Frame = +3

Query  198  RVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRY  377
            RVKI+D +  +L ALG SG+ V+V +PNE + + ++DQ+  D WV++N++P++  T +  
Sbjct  58   RVKIFDTDAAVLSALGGSGISVTVAMPNEQLSSAAADQSFTDTWVQSNILPYHPNTIVDA  117

Query  378  LLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRK-IKVGTPLAMDMLEASYPPSSGA  554
            + VGNE+ ++P NT +  LVPAM+ +  S+ K+ +   IKV +P+AM  L++SYPPSSG+
Sbjct  118  IAVGNEVFADPANTAF--LVPAMKNVYASLVKYDVASTIKVSSPVAMGALQSSYPPSSGS  175

Query  555  FRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            F  DL   V KP+L+FL +T SFF  +V
Sbjct  176  FEPDLVEPVMKPMLEFLQQTGSFFMANV  203



>ref|XP_002961854.1| hypothetical protein SELMODRAFT_437767 [Selaginella moellendorffii]
 gb|EFJ37114.1| hypothetical protein SELMODRAFT_437767 [Selaginella moellendorffii]
Length=464

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 109/162 (67%), Gaps = 2/162 (1%)
 Frame = +3

Query  159  HHDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVET  338
            +  + L+  +  + VK++DANP++L AL NS ++V++MVPNEII  ++S Q+ AD W+  
Sbjct  45   NQTVALLKSMNVRLVKLFDANPQVLTALSNSSIRVTIMVPNEIIGAVASSQSSADDWIAQ  104

Query  339  NVVPFYGETKIRYLLVGNEILSNPP-NTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPLA  512
            +V+P+Y  T+I  ++VGNEI S P    TW QL+PA+  + R+++   L  +IK+ T +A
Sbjct  105  SVLPYYPSTQIIVIVVGNEIFSYPALAQTWQQLMPAIENLHRALQSHNLDDRIKITTSVA  164

Query  513  MDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             D+L ASYPPS G FR D+  +V KPLL FL  T + F+ ++
Sbjct  165  GDVLAASYPPSVGRFRPDIRDTVLKPLLGFLRTTRAPFYINL  206



>ref|XP_008792941.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X3 [Phoenix dactylifera]
Length=389

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 95/124 (77%), Gaps = 1/124 (1%)
 Frame = +3

Query  270  MVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSN-PPNTTWFQLVPAM  446
            MVPN++ P+++++++LAD W+  N++PFY + +IR+LLVGNE+LS+    ++W  LVPAM
Sbjct  1    MVPNQVFPSLAANRSLADAWLAANLLPFYPQARIRFLLVGNEVLSDYSVKSSWPSLVPAM  60

Query  447  RKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFF  626
              + R+++   +R +KVGT LAMD L+ S+PPS+G FR D+ G+V +PLL+F +RT SF+
Sbjct  61   ANLHRALRARSIRDVKVGTTLAMDSLKTSFPPSAGEFRDDIAGTVIRPLLRFANRTRSFY  120

Query  627  FFDV  638
            F DV
Sbjct  121  FVDV  124



>ref|XP_002316783.2| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|EEE97395.2| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
Length=476

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 103/153 (67%), Gaps = 3/153 (2%)
 Frame = +3

Query  180  HGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYG  359
            HG+   R+K+YD +  +L AL  S + V V +PNE++ ++++DQ+ AD WV+ N+   + 
Sbjct  55   HGIN--RIKLYDTDSDVLTALAGSSINVVVALPNELLSSVAADQSFADSWVKGNISQHFP  112

Query  360  ETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYP  539
            +TKI  + VGNE+  +P NTT F LVPAM+ +  S+ KF L  IK+ +P+A+  L++SYP
Sbjct  113  QTKIEAIAVGNEVFVDPKNTTPF-LVPAMKNVHNSLVKFNLSSIKISSPIALSALQSSYP  171

Query  540  PSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             S+G+F+++L G V KP+L FL +T S+   + 
Sbjct  172  SSAGSFKTELIGPVIKPMLDFLRQTGSYLMINA  204



>ref|XP_011044921.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Populus 
euphratica]
Length=476

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 103/157 (66%), Gaps = 1/157 (1%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            + L+      R+K+YD +  +L AL  S + V V +PNE++ ++++DQ+ AD WV+ N+ 
Sbjct  49   VSLLKSQGINRIKLYDTDSDVLTALAGSSINVVVALPNELLSSVAADQSFADSWVKANIS  108

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  527
              + +TKI  + VGNE+  +P NTT F LVPAM+ +  S+ KF L  IK+ +P+A+  L+
Sbjct  109  QHFPQTKIEAIAVGNEVFVDPKNTTPF-LVPAMKNVHNSLVKFNLSSIKISSPIALSALQ  167

Query  528  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            +SYP S+G+F+++L G V KP+L FL +T S+   + 
Sbjct  168  SSYPSSAGSFKTELIGPVIKPMLDFLRQTGSYLMINA  204



>ref|XP_008385844.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Malus domestica]
Length=454

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 105/154 (68%), Gaps = 3/154 (2%)
 Frame = +3

Query  177  IHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVVPFY  356
            I G+   +VK+YD +  +L AL NSG+ V V +PNE++ + +SD + AD+WV++N+  ++
Sbjct  49   IQGIN--KVKLYDTDAAVLTALANSGIGVVVALPNELLSSAASDPSFADKWVQSNISQYH  106

Query  357  GETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASY  536
             +T+I  + VGNE+ ++P NTT F LVPA++ I+ S+ K+ L  IK+ +P A+  L +SY
Sbjct  107  PKTQIEAIAVGNEVFADPNNTTQF-LVPAIKNIQSSLVKYNLSSIKLSSPFALSALNSSY  165

Query  537  PPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            PPS+G F+ DL   V KPLL+ L +T+S+   + 
Sbjct  166  PPSAGVFKPDLIEPVIKPLLEXLTQTSSYLMINA  199



>gb|ADG38399.1| AT3G07320-like protein [Neslia paniculata]
Length=202

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +3

Query  330  VETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
            + +N++PFY  TKIRYLLVGNEILS+  +     LVPAMR+I+RS+K  G++K+KVGT L
Sbjct  1    IRSNILPFYPTTKIRYLLVGNEILSSTDSELKSSLVPAMRRIQRSLKSLGVKKVKVGTSL  60

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            A+D+L+ S+PPSSG FR D++G V KP+LQFL+RT SF F DV
Sbjct  61   AVDVLKTSFPPSSGEFREDISGLVMKPMLQFLNRTKSFLFVDV  103



>ref|XP_010433433.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Camelina 
sativa]
Length=455

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/199 (40%), Positives = 116/199 (58%), Gaps = 11/199 (6%)
 Frame = +3

Query  72   YWPCHL----FPA-QISQLRSEYATVNW---ATTFPHHHDL-QLIHGLKAKRVKIYDANP  224
            + PC L    FP    +   S    VN+   A   P   ++  L+      R+KIYD + 
Sbjct  5    FLPCFLILCLFPTISFTHAESGMIGVNYGRIANNLPSPKNVVSLLKSQGISRIKIYDTDK  64

Query  225  KILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILS  404
             +L AL NSG++V V +PNE++ + SS+Q+ ADRW++TNV   +  T+I  + VGNE+  
Sbjct  65   NVLAALANSGIKVIVALPNELLSSASSNQSFADRWIQTNVASHFPATEIEAIAVGNEVFV  124

Query  405  NPPNTTWFQLVPAMRKIRRSVKKFGLRK-IKVGTPLAMDMLEASYPPSSGAFRSDLTGSV  581
            +P NTT + L PAM+ I  S+ K  L K IK+ +P+A+  L  SYPPSSG+F+ DL   V
Sbjct  125  DPKNTTPY-LDPAMKNIHTSLVKHNLDKAIKISSPVALSALANSYPPSSGSFKPDLIEPV  183

Query  582  FKPLLQFLDRTNSFFFFDV  638
             KP+L  L RT+S+   + 
Sbjct  184  IKPMLDLLQRTSSYLMVNA  202



>ref|XP_002274828.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Vitis vinifera]
Length=471

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 108/158 (68%), Gaps = 2/158 (1%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            +QL+     +RVK++D +P +L+ALG SG++V+V +PNE++ + +  Q+ A+ WV+ NV 
Sbjct  42   VQLLKSQGIERVKVFDTDPAVLKALGESGIKVTVDLPNELLISAAKRQSFANTWVQKNVA  101

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRK-IKVGTPLAMDML  524
             ++  TKI  + VGNE+  +P NTT   LVPA++ I +++ K+ L   IKV +P+A+  L
Sbjct  102  DYFPATKIEAIAVGNEVFVDPHNTT-LSLVPALKNIHKALVKYNLHSHIKVSSPVALSAL  160

Query  525  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            ++SYP S+G+FR +L   VFKP+L+FL +T S+   + 
Sbjct  161  QSSYPSSAGSFRQELIEPVFKPMLEFLRQTGSYLMVNA  198



>ref|XP_010026682.1| PREDICTED: LOW QUALITY PROTEIN: probable glucan endo-1,3-beta-glucosidase 
A6 [Eucalyptus grandis]
Length=337

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 101/155 (65%), Gaps = 5/155 (3%)
 Frame = +3

Query  186  LKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGET  365
            ++A  VK+Y+A+P+IL+ L  + VQVS+MV N  IP ++S QALAD+WV  NV+ +Y  T
Sbjct  1    MRAGHVKLYNADPEILKLLSGTKVQVSIMVQNHEIPGVASSQALADKWVRNNVLLYYHGT  60

Query  366  KIRYLLVGNEILS----NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEAS  533
             IR++LVGNE  S    +  +  W  LVPAM +I+ S++  G+  IK GTPLA+      
Sbjct  61   MIRFVLVGNEFSSYNSTDRDHQLWRDLVPAMCRIKSSLRSNGIHNIKGGTPLAIRG-RIH  119

Query  534  YPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             P  SG FRSD+  SV  PL++FL+ T S FF DV
Sbjct  120  IPSLSGRFRSDVAESVIMPLVRFLNSTRSHFFLDV  154



>gb|ADG38396.1| AT3G07320-like protein [Capsella grandiflora]
Length=202

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +3

Query  330  VETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  509
            + +N++PFY  TKIRYLLVGNEILS+P +     LVPAMRKI+RS+K  G++K+KVGT L
Sbjct  1    IRSNILPFYPTTKIRYLLVGNEILSSPDSELKASLVPAMRKIQRSLKSLGVKKVKVGTSL  60

Query  510  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            A+D+L+ S+PPS G FR D++  V KP+LQFL+RT SF F DV
Sbjct  61   AVDVLQTSFPPSKGEFREDISXLVMKPMLQFLNRTKSFLFVDV  103



>ref|XP_002463526.1| hypothetical protein SORBIDRAFT_01g001430 [Sorghum bicolor]
 gb|EER90524.1| hypothetical protein SORBIDRAFT_01g001430 [Sorghum bicolor]
Length=483

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 102/160 (64%), Gaps = 3/160 (2%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            L+L     A  V+ YDAN  +L A   SG++    VPNE+IP++++ Q  AD WV T ++
Sbjct  56   LELARSAGASAVRFYDANATMLAAAAASGLEFVPSVPNELIPSLAASQRAADAWVATTLL  115

Query  348  PFYGETKIRYLLVGNEILSNP-PNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDML  524
            PF G  ++RYL VGNE+LS+P   + W +LVPAM  + R++ + GL  +KV T  +M  L
Sbjct  116  PFRGNPRLRYLFVGNEVLSDPTARSRWPRLVPAMANVHRALHRHGLGSVKVSTTFSMHEL  175

Query  525  EAS--YPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            E    +PPS+GAFR D+ G+V +PLL FLDRT S  F D 
Sbjct  176  EGQNVFPPSAGAFRPDIAGAVVRPLLAFLDRTGSPLFVDA  215



>gb|KDP39185.1| hypothetical protein JCGZ_00942 [Jatropha curcas]
Length=463

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 104/157 (66%), Gaps = 2/157 (1%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            ++L+      R K+YD +  +L AL NSG+ V V +PNE++ + ++DQ+ AD+WV+ N+ 
Sbjct  41   VELLKSQGINRAKLYDTDSTVLTALANSGISVVVALPNELLASTAADQSFADKWVQANIS  100

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  527
             +Y +T+I  + VGNE+  +P NTT F LVPAM+ +  S+ KF    IK+ +P+A+  L+
Sbjct  101  QYYPQTQIEAIAVGNEVFVDPNNTTKF-LVPAMKNVYNSLVKFNHSSIKISSPIALSALQ  159

Query  528  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            +SYP S+G+F+ DL   V KP+L+FL ++ S+   + 
Sbjct  160  SSYPSSAGSFKPDLV-PVMKPMLEFLRQSGSYLMINA  195



>ref|XP_010539314.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Tarenaya hassleriana]
Length=462

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 104/158 (66%), Gaps = 2/158 (1%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            ++L+      RVK+YD +  +L AL NS ++V V +PNE++ + ++DQ+ AD+WVE N+ 
Sbjct  44   VELLKTQGIHRVKLYDTDKTVLTALANSSIKVVVALPNELLSSAAADQSFADKWVEANIT  103

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPLAMDML  524
             +Y  T+I  + VGNE+  +P NTT F LV AM+ +  S+ K+ L R IKV +P+A+  L
Sbjct  104  KYYPSTEIEAIAVGNEVFVDPNNTTEF-LVQAMKNVHSSLVKYDLDRSIKVSSPIALSSL  162

Query  525  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             +SYPPS+G+F+SDL   V KP+L    +T+S+   + 
Sbjct  163  ASSYPPSAGSFKSDLVEPVIKPMLDLFRQTSSYLMVNA  200



>ref|XP_010448205.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Camelina 
sativa]
Length=457

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 78/199 (39%), Positives = 117/199 (59%), Gaps = 11/199 (6%)
 Frame = +3

Query  72   YWPCHL----FPA-QISQLRSEYATVNW---ATTFPHHHDL-QLIHGLKAKRVKIYDANP  224
            + PC L    FP    +   S    VN+   A   P   ++  L+      R+KIYD + 
Sbjct  5    FLPCFLILCLFPTISFTHTESGMIGVNYGRIANNLPSPKNVVSLLKSQGINRIKIYDTDK  64

Query  225  KILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILS  404
            K+L AL N+G++V V +PNE++ + SS+Q+ AD W++TNV   +  T+I  + VGNE+  
Sbjct  65   KVLTALANTGIKVIVALPNELLSSASSNQSFADHWIQTNVASHFPATEIEAIAVGNEVFV  124

Query  405  NPPNTTWFQLVPAMRKIRRSVKKFGLRK-IKVGTPLAMDMLEASYPPSSGAFRSDLTGSV  581
            +P NTT + LVPAM+ I  S+ K  L K IK+ +P+A+  L  SYPPSSG+F+ +L   V
Sbjct  125  DPKNTTPY-LVPAMKNIHTSLVKRNLDKAIKISSPVALSALANSYPPSSGSFKPELIEPV  183

Query  582  FKPLLQFLDRTNSFFFFDV  638
             KP+L  L RT+S+   + 
Sbjct  184  IKPMLDLLQRTSSYLMVNA  202



>ref|XP_009771279.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like, partial 
[Nicotiana sylvestris]
Length=455

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 101/149 (68%), Gaps = 2/149 (1%)
 Frame = +3

Query  195  KRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIR  374
            +RVK+YD +P +L+AL  SG+ V+V +PNE++ N +  Q+ A  WV+ NVV +Y  T+I 
Sbjct  37   ERVKVYDTDPAVLKALSGSGIMVTVNLPNELLYNAAKRQSFAYSWVQRNVVAYYPSTQIE  96

Query  375  YLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR-KIKVGTPLAMDMLEASYPPSSG  551
             + VGNE+  +P NTT F LVPAM+ I  ++ K+ +  KIKV +P+A+  L+ SYP S+G
Sbjct  97   SIAVGNEVFVDPHNTTRF-LVPAMKNIHEALLKYNIHDKIKVSSPVALSALQNSYPSSAG  155

Query  552  AFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            +FRS+L   V KP+L FL +T SF   + 
Sbjct  156  SFRSELVEPVIKPMLDFLRQTGSFLMVNC  184



>gb|AEN81798.1| AT3G07320-like protein, partial [Capsella rubella]
 gb|AEN81799.1| AT3G07320-like protein, partial [Capsella rubella]
 gb|AEN81801.1| AT3G07320-like protein, partial [Capsella rubella]
 gb|AEN81802.1| AT3G07320-like protein, partial [Capsella rubella]
 gb|AEN81804.1| AT3G07320-like protein, partial [Capsella rubella]
 gb|AEN81805.1| AT3G07320-like protein, partial [Capsella rubella]
Length=209

 Score =   132 bits (331),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +3

Query  342  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  521
            ++PFY  TKIRYLLVGNEILS+P +     LVPAMRKI+RS+K  G++K+KVGT LA+D+
Sbjct  1    ILPFYPTTKIRYLLVGNEILSSPDSELKASLVPAMRKIQRSLKSLGVKKVKVGTSLAVDV  60

Query  522  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            L+ S+PPS G FR D++G V KP+LQFL+RT SF F DV
Sbjct  61   LQTSFPPSKGEFREDISGLVMKPMLQFLNRTKSFLFVDV  99



>gb|KDP30806.1| hypothetical protein JCGZ_13749 [Jatropha curcas]
Length=469

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 107/158 (68%), Gaps = 2/158 (1%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            +QL+     +RVK++DA+P +L+AL  S ++V+V +PNE++ + +  Q+ A  WV+ N+ 
Sbjct  42   VQLLKSQGLQRVKVFDADPAVLKALSGSSIKVTVDLPNELLYSAAKRQSFALSWVQRNIA  101

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRK-IKVGTPLAMDML  524
             +Y  T+I  + VGNE+  +P NTT F L+PAM+ I ++++K  L   IK+ +P+A+  L
Sbjct  102  AYYPSTQIEAIAVGNEVFVDPHNTTKF-LIPAMKNIHQALEKLNLHSDIKISSPIALSAL  160

Query  525  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            ++SYP S+GAFRS+L   VFKPLL FL +T S+   + 
Sbjct  161  QSSYPSSAGAFRSELIEPVFKPLLDFLRQTGSYLMVNA  198



>gb|KDO62116.1| hypothetical protein CISIN_1g0115512mg [Citrus sinensis]
Length=475

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 101/158 (64%), Gaps = 2/158 (1%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            ++L+   +  RVK YD +  +L AL NS + V V  PNE +   ++DQ+  D WV+ N+ 
Sbjct  44   VELLKSQRIDRVKTYDTDSAVLAALANSDISVVVAFPNEELSKAAADQSFTDNWVQANIS  103

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPLAMDML  524
             +Y  TKI  + VGNE+ ++P NTT F LVPAM+ +  S+ K+ L   +KV +P+A+  L
Sbjct  104  KYYPATKIEAVAVGNEVFADPKNTTPF-LVPAMKNVYNSLVKYKLDSNVKVSSPIALGAL  162

Query  525  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            + SYPPSSG+F+SDL     KP+L+FL +T+S+   + 
Sbjct  163  QNSYPPSSGSFKSDLIEPALKPMLEFLRKTSSYLMVNA  200



>gb|KDO62115.1| hypothetical protein CISIN_1g0115512mg [Citrus sinensis]
Length=472

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 101/158 (64%), Gaps = 2/158 (1%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            ++L+   +  RVK YD +  +L AL NS + V V  PNE +   ++DQ+  D WV+ N+ 
Sbjct  44   VELLKSQRIDRVKTYDTDSAVLAALANSDISVVVAFPNEELSKAAADQSFTDNWVQANIS  103

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPLAMDML  524
             +Y  TKI  + VGNE+ ++P NTT F LVPAM+ +  S+ K+ L   +KV +P+A+  L
Sbjct  104  KYYPATKIEAVAVGNEVFADPKNTTPF-LVPAMKNVYNSLVKYKLDSNVKVSSPIALGAL  162

Query  525  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            + SYPPSSG+F+SDL     KP+L+FL +T+S+   + 
Sbjct  163  QNSYPPSSGSFKSDLIEPALKPMLEFLRKTSSYLMVNA  200



>ref|XP_008230022.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11 [Prunus mume]
Length=344

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 105/157 (67%), Gaps = 2/157 (1%)
 Frame = +3

Query  171  QLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVVP  350
            QL+     +RVK++D++P +LRAL  S ++V+V VPNE++ +++  Q+ A  WV+ NVV 
Sbjct  53   QLLKSQGLERVKVFDSDPAVLRALAGSNIKVTVDVPNELLSSVAKSQSFATNWVQRNVVA  112

Query  351  FYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRK-IKVGTPLAMDMLE  527
            ++  T+I  + VGNE+  +  NTT F L+PAM+ I  ++  F +   IKV +P+A+  L+
Sbjct  113  YHPNTEIEAIAVGNEVFVDTHNTTKF-LIPAMKNIHTALIHFDIHSAIKVSSPIALSALQ  171

Query  528  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             SYP S+G+FR +L  +VFKP+L+FL +T S+   + 
Sbjct  172  NSYPASAGSFRPELVETVFKPMLEFLRQTGSYLMVNA  208



>gb|AEN81800.1| AT3G07320-like protein, partial [Capsella rubella]
 gb|AEN81803.1| AT3G07320-like protein, partial [Capsella rubella]
Length=209

 Score =   131 bits (330),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +3

Query  342  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  521
            ++PFY  TKIRYLLVGNEILS+P +     LVPAMRKI+RS+K  G++K+KVGT LA+D+
Sbjct  1    ILPFYPTTKIRYLLVGNEILSSPDSELKASLVPAMRKIQRSLKSLGVKKVKVGTSLAVDV  60

Query  522  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            L+ S+PPS G FR D++G V KP+LQFL+RT SF F DV
Sbjct  61   LQTSFPPSKGEFREDISGLVMKPMLQFLNRTKSFLFVDV  99



>gb|KDO62114.1| hypothetical protein CISIN_1g0115512mg [Citrus sinensis]
Length=483

 Score =   136 bits (343),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 101/158 (64%), Gaps = 2/158 (1%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            ++L+   +  RVK YD +  +L AL NS + V V  PNE +   ++DQ+  D WV+ N+ 
Sbjct  44   VELLKSQRIDRVKTYDTDSAVLAALANSDISVVVAFPNEELSKAAADQSFTDNWVQANIS  103

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPLAMDML  524
             +Y  TKI  + VGNE+ ++P NTT F LVPAM+ +  S+ K+ L   +KV +P+A+  L
Sbjct  104  KYYPATKIEAVAVGNEVFADPKNTTPF-LVPAMKNVYNSLVKYKLDSNVKVSSPIALGAL  162

Query  525  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            + SYPPSSG+F+SDL     KP+L+FL +T+S+   + 
Sbjct  163  QNSYPPSSGSFKSDLIEPALKPMLEFLRKTSSYLMVNA  200



>ref|XP_006452449.1| hypothetical protein CICLE_v10008176mg [Citrus clementina]
 gb|ESR65689.1| hypothetical protein CICLE_v10008176mg [Citrus clementina]
Length=473

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 100/158 (63%), Gaps = 2/158 (1%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            ++L+      RVK YD +  +L AL NS + V V  PNE +   ++DQ+  D WV+ N+ 
Sbjct  45   VELLKSQGIGRVKTYDTDSAVLAALANSDISVVVAFPNEELSKAAADQSFTDNWVQANIS  104

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPLAMDML  524
             +Y  TKI  + VGNE+ ++P NTT F LVPAM+ +  S+ K+ L   +KV +P+A+  L
Sbjct  105  KYYPATKIEAVAVGNEVFADPKNTTPF-LVPAMKNVYNSLVKYKLDSNVKVSSPIALGAL  163

Query  525  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            + SYPPSSG+F+SDL     KP+L+FL +T+S+   + 
Sbjct  164  QNSYPPSSGSFKSDLIEPALKPMLEFLRKTSSYLMVNA  201



>ref|XP_006475009.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Citrus sinensis]
Length=472

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 100/158 (63%), Gaps = 2/158 (1%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            ++L+      RVK YD +  +L AL NS + V V  PNE +   ++DQ+  D WV+ N+ 
Sbjct  44   VELLKSQGIGRVKTYDTDSAVLAALANSDISVVVAFPNEELSKAAADQSFTDNWVQANIS  103

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPLAMDML  524
             +Y  TKI  + VGNE+ ++P NTT F LVPAM+ +  S+ K+ L   +KV +P+A+  L
Sbjct  104  KYYPATKIEAVAVGNEVFADPKNTTPF-LVPAMKNVYNSLVKYKLDSNVKVSSPIALGAL  162

Query  525  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            + SYPPSSG+F+SDL     KP+L+FL +T+S+   + 
Sbjct  163  QNSYPPSSGSFKSDLIEPALKPMLEFLRKTSSYLMVNA  200



>ref|XP_003519593.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Glycine 
max]
Length=471

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 102/158 (65%), Gaps = 2/158 (1%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            ++L+      RVK+YD +  +L A  NSG++V V +PNE++ N ++DQ+  D WV+ N+ 
Sbjct  49   VELLKAQGLNRVKLYDTDATVLTAFANSGIKVVVAMPNELLANAAADQSFTDAWVQANIS  108

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRK-IKVGTPLAMDML  524
             +Y  T+I  + VGNE+  +P NTT F LVPAM+ +  S+ K+ L K IK+ +P+A+  L
Sbjct  109  TYYPATQIEAIAVGNEVFVDPNNTTKF-LVPAMKNVHASLTKYNLDKNIKISSPIALSAL  167

Query  525  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            + S+P SSG+F+++L   V KP+L  L +T S+   + 
Sbjct  168  QNSFPASSGSFKTELVEPVIKPMLDLLRQTGSYLMVNA  205



>ref|XP_006283767.1| hypothetical protein CARUB_v10004853mg [Capsella rubella]
 gb|EOA16665.1| hypothetical protein CARUB_v10004853mg [Capsella rubella]
Length=432

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 103/158 (65%), Gaps = 2/158 (1%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            + L+      R+KIYD +  +L AL NSG++V V +PNE++ + +S+Q+ AD WV+TNV 
Sbjct  20   VNLVKSQGISRIKIYDTDKNVLTALANSGIKVIVALPNELLFSAASNQSFADYWVQTNVT  79

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRK-IKVGTPLAMDML  524
             ++  T+I  + VGNE+  +P NTT + LVPAM+ I  S+ K+ L K IK+ +P+A+  L
Sbjct  80   SYFPATEIEAIAVGNEVFVDPKNTTPY-LVPAMKNIHTSLVKYNLDKAIKISSPVALSAL  138

Query  525  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
              SYPPSSG+F+ DL   V +P+L  L  T+S+   + 
Sbjct  139  ANSYPPSSGSFKPDLIEPVIRPMLDLLQHTSSYLMVNA  176



>gb|EEC82195.1| hypothetical protein OsI_26335 [Oryza sativa Indica Group]
Length=569

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 99/147 (67%), Gaps = 2/147 (1%)
 Frame = +3

Query  201  VKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYL  380
            V+I+DA+P +LRAL N+G++V V +PN  + +   D + A RWVE++VVP+Y  T I  +
Sbjct  58   VRIFDADPAVLRALANTGIKVMVALPNTDLGSAGWDPSYAQRWVESSVVPYYPATLINGV  117

Query  381  LVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRK-IKVGTPLAMDMLEASYPPSSGAF  557
             VGNE+    P+ T  QLVPAMR +  ++ + GL   I+V TP+A   +E S+PPS+GAF
Sbjct  118  AVGNEVFDQAPHLTQ-QLVPAMRNVHAALARLGLADAIRVSTPIAFSSVEVSFPPSAGAF  176

Query  558  RSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            R D+  SV  P++ FL +T+S+F  ++
Sbjct  177  RDDIAQSVMSPMIDFLQQTDSYFMVNL  203



>ref|XP_002278044.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Vitis vinifera]
 emb|CBI26687.3| unnamed protein product [Vitis vinifera]
Length=471

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 109/160 (68%), Gaps = 5/160 (3%)
 Frame = +3

Query  171  QLIHGLKAK---RVKIYDANPKILRALGNSGVQVSVMVPNEIIPNIS-SDQALADRWVET  338
            Q++  LKA+   +VK++DA+  +L AL NSGV V V +PNE++ + + +D + +++WV+T
Sbjct  40   QVVELLKAQGINKVKLFDADSTVLTALANSGVSVVVALPNELLSSAAATDGSFSEKWVQT  99

Query  339  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  518
            N+  ++  T+I  + VGNE+  +P NTT F LVPAM  + +S+ K  L  IK+ +P+A+ 
Sbjct  100  NIAQYHPSTQIEAIAVGNEVFVDPNNTTQF-LVPAMNNVYKSLVKHNLSSIKISSPVALS  158

Query  519  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
             L +SYPPS+G F+ +L  +V KP+L+FL +T+S+   + 
Sbjct  159  ALNSSYPPSAGVFKPELIETVMKPMLEFLRKTSSYLMVNA  198



>gb|KHN44765.1| Glucan endo-1,3-beta-glucosidase 11 [Glycine soja]
Length=400

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 101/158 (64%), Gaps = 2/158 (1%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            +QL+      RVK+YD +P +LRAL  SG++V+V +PN+ +   +   + A  WVE NV 
Sbjct  72   VQLLKSQGLTRVKVYDTDPAVLRALSGSGIKVTVDLPNQQLFAAAKAPSFASSWVERNVA  131

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRK-IKVGTPLAMDML  524
             +Y  T+I  + VGNE+  +P NTT F LVPAM+ I++++ K  L K IKV +P+A+  L
Sbjct  132  AYYPHTQIESIAVGNEVFVDPHNTTKF-LVPAMKNIQKALTKHNLDKDIKVSSPIALSAL  190

Query  525  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
              SYP S+G+FR +L   VFKP+L FL  T S+   +V
Sbjct  191  ANSYPSSAGSFRPELVDPVFKPMLDFLRETGSYLMVNV  228



>ref|XP_007215327.1| hypothetical protein PRUPE_ppa005206mg [Prunus persica]
 gb|EMJ16526.1| hypothetical protein PRUPE_ppa005206mg [Prunus persica]
Length=472

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 106/158 (67%), Gaps = 2/158 (1%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            +QL+     +RVK++D++P +LRAL  S ++V+V VPNE++ +++  Q+ A  WV+ NVV
Sbjct  43   MQLLKSQGLERVKVFDSDPAVLRALAGSNIKVTVDVPNELLSSVAKSQSFATNWVQRNVV  102

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRK-IKVGTPLAMDML  524
             ++  T+I  + VGNE+  +  NTT F L+PAM+ I  ++  F +   IKV +P+A+  L
Sbjct  103  AYHPNTQIEAIAVGNEVFVDTHNTTKF-LIPAMKNIHTALIHFDIHSAIKVSSPIALSAL  161

Query  525  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            + SYP S+G+FR +L  +VFKP+L+FL +T S+   + 
Sbjct  162  QNSYPASAGSFRPELVETVFKPMLEFLRQTGSYLMVNA  199



>ref|XP_009628415.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Nicotiana tomentosiformis]
Length=471

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 103/158 (65%), Gaps = 2/158 (1%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            + L+     +RVK+YD +P +L+AL  SG++V+V +PNE++ N +  Q+ A  WV+ NV 
Sbjct  44   VALLKSQGVERVKVYDTDPAVLKALSGSGIKVTVNLPNELLYNAAKRQSFAYSWVQRNVA  103

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR-KIKVGTPLAMDML  524
             +Y  T+I  + VGNE+  +P NTT F LVPAM+ I  ++ K+    KIKV +P+A+  L
Sbjct  104  AYYPSTQIESIAVGNEVFVDPHNTTRF-LVPAMKNIHEALLKYNFHDKIKVSSPVALSAL  162

Query  525  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            + SYP S+G+FRS+L   V KP++ FL +T S+   + 
Sbjct  163  QNSYPSSAGSFRSELIEPVIKPMMDFLRQTGSYLMVNC  200



>emb|CDP14397.1| unnamed protein product [Coffea canephora]
Length=490

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 102/159 (64%), Gaps = 1/159 (1%)
 Frame = +3

Query  162  HDLQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETN  341
            H +QL+      +VK+YD +  +L AL  SG+ V+V +PNE++ + ++ Q+  D WV++N
Sbjct  59   HVVQLLKAQGLTKVKLYDTDSTVLSALSGSGISVTVALPNELLSSAAAGQSYTDSWVQSN  118

Query  342  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  521
            +  +Y +T I  + VGNE+  +P NTT F LVPAM+ +  S+ K+ +  IK+ +P+A+  
Sbjct  119  IFAYYPKTLIEAIAVGNEVFVDPKNTTPF-LVPAMKNVYSSLVKYNVSSIKISSPIALSA  177

Query  522  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            L+ SYP SSG+F+ +L   V KP+L FL +T S+   + 
Sbjct  178  LQTSYPSSSGSFQPELVEPVIKPMLNFLKQTGSYVMVNA  216



>ref|XP_010110627.1| Glucan endo-1,3-beta-glucosidase 13 [Morus notabilis]
 gb|EXC27249.1| Glucan endo-1,3-beta-glucosidase 13 [Morus notabilis]
Length=479

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 105/158 (66%), Gaps = 2/158 (1%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            +QL+     +RVK+YD +P +L++L  SG++V+V +PNE++ + +  Q+ A+ WV+ NVV
Sbjct  40   VQLLRSQGLERVKVYDTDPAVLKSLSGSGIKVTVDLPNELLSSAARHQSFANSWVQRNVV  99

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPLAMDML  524
             ++  T+I  + VGNE+  +P NTT F LVPAM+ I  ++ K  L   IK+ +P+A+  L
Sbjct  100  AYHPATQIEAIAVGNEVFVDPHNTTTF-LVPAMKNIHAALVKNNLDSSIKISSPIALSAL  158

Query  525  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            + SYP S+G+FR +L   VFKPLL FL +T SF   + 
Sbjct  159  QNSYPASAGSFRPELVELVFKPLLDFLRQTGSFLMVNA  196



>ref|XP_006344866.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Solanum 
tuberosum]
Length=518

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 103/158 (65%), Gaps = 2/158 (1%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            +QL+      RVK+YD +  +L AL  S + V+V +PNE + + +S Q+  D WV++N++
Sbjct  87   VQLLKSQGINRVKLYDTDSAVLTALSGSNISVTVALPNEQLSDAASKQSFTDSWVQSNII  146

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPLAMDML  524
             +Y +T I  + VGNE+  +P NTT F LVPAM+ +  S+ K+G+   IKV +P+A+  L
Sbjct  147  RYYPKTNIESIAVGNEVFVDPKNTTKF-LVPAMKNVYASLVKYGVASSIKVSSPVALSAL  205

Query  525  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            + SYP SSG+F++DL   V KP+L FL ++ SF   ++
Sbjct  206  QNSYPSSSGSFKTDLIEPVIKPMLSFLKQSGSFLAVNI  243



>ref|XP_006344865.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Solanum 
tuberosum]
Length=480

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 103/158 (65%), Gaps = 2/158 (1%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            +QL+      RVK+YD +  +L AL  S + V+V +PNE + + +S Q+  D WV++N++
Sbjct  43   VQLLKSQGINRVKLYDTDSAVLTALSGSNISVTVALPNEQLSDAASKQSFTDSWVQSNII  102

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPLAMDML  524
             +Y +T I  + VGNE+  +P NTT F LVPAM+ +  S+ K+G+   IKV +P+A+  L
Sbjct  103  RYYPKTNIESIAVGNEVFVDPNNTTKF-LVPAMKNVYASLVKYGVASSIKVSSPVALSAL  161

Query  525  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            + SYP SSG+F++DL   V KP+L FL ++ SF   ++
Sbjct  162  QNSYPSSSGSFKTDLIEPVIKPMLSFLKQSGSFLAVNI  199



>gb|KHG04965.1| hypothetical protein F383_30444 [Gossypium arboreum]
 gb|KHG22638.1| hypothetical protein F383_01203 [Gossypium arboreum]
Length=469

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 101/158 (64%), Gaps = 2/158 (1%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            ++L+      +VK+YD +  +L AL +SG+ V V +PNE++ + ++DQ+ AD WVE N+ 
Sbjct  45   VELLKSQGINKVKLYDTDATVLTALADSGITVVVALPNELLSSTAADQSFADNWVEANIT  104

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPLAMDML  524
             FY +TKI  + VGNE+  +P NTT + LVPAM+ I  S+ K  L   IK+ +P+A   L
Sbjct  105  KFYPKTKIEAIAVGNEVFVDPANTTKY-LVPAMKNIHASLVKSKLDSAIKISSPIAFSAL  163

Query  525  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            + SYP S+G+F+ +L   V KP+L FL +T S+   + 
Sbjct  164  KTSYPSSAGSFKPELIEPVIKPMLDFLKQTGSYLMVNA  201



>tpg|DAA63006.1| TPA: putative O-glycosyl hydrolase family 17 protein, partial 
[Zea mays]
Length=649

 Score =   135 bits (340),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 66/158 (42%), Positives = 98/158 (62%), Gaps = 2/158 (1%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            +QL+       V++YDANPK+L +L N+G++V VM+PNE +   +SD + A +W   NV 
Sbjct  48   VQLLKQSGITMVRLYDANPKVLTSLANTGIKVMVMLPNEELAAAASDPSYALQWARANVA  107

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRK-IKVGTPLAMDML  524
             FY  T I  + VGNE+  + P+     LVPAM  +  ++ + GL   +KV TP+A   +
Sbjct  108  AFYPATHIHCVAVGNEVFDSRPDLN-SNLVPAMANVHDALAQLGLADAVKVSTPVAFSAV  166

Query  525  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            + SYPPS+G FR D+  SV KP+L FLDRT S+   ++
Sbjct  167  QDSYPPSAGRFRDDIAQSVMKPMLGFLDRTGSYLTINI  204



>gb|ADU15553.1| GLU [Gossypium hirsutum]
Length=469

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 101/158 (64%), Gaps = 2/158 (1%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            ++L+      +VK+YD +  +L AL +SG+ V V +PNE++ + ++DQ+ AD WVE N+ 
Sbjct  45   VELLKSQGINKVKLYDTDATVLTALADSGITVVVALPNELLSSTAADQSFADNWVEANIT  104

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPLAMDML  524
             FY +TKI  + VGNE+  +P NTT + LVPAM+ I  S+ K  L   IK+ +P+A   L
Sbjct  105  KFYPKTKIEAIAVGNEVFVDPANTTKY-LVPAMKNIHASLVKSKLDSAIKISSPIAFSAL  163

Query  525  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            + SYP S+G+F+ +L   V KP+L FL +T S+   + 
Sbjct  164  KTSYPSSAGSFKPELIEPVIKPMLDFLKQTGSYLMVNA  201



>ref|XP_008653189.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Zea mays]
Length=660

 Score =   135 bits (340),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 66/158 (42%), Positives = 98/158 (62%), Gaps = 2/158 (1%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            +QL+       V++YDANPK+L +L N+G++V VM+PNE +   +SD + A +W   NV 
Sbjct  48   VQLLKQSGITMVRLYDANPKVLTSLANTGIKVMVMLPNEELAAAASDPSYALQWARANVA  107

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRK-IKVGTPLAMDML  524
             FY  T I  + VGNE+  + P+     LVPAM  +  ++ + GL   +KV TP+A   +
Sbjct  108  AFYPATHIHCVAVGNEVFDSRPDLN-SNLVPAMANVHDALAQLGLADAVKVSTPVAFSAV  166

Query  525  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            + SYPPS+G FR D+  SV KP+L FLDRT S+   ++
Sbjct  167  QDSYPPSAGRFRDDIAQSVMKPMLGFLDRTGSYLTINI  204



>gb|AFU52656.1| beta-1,3-glucanase 23 [Solanum tuberosum]
Length=473

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 103/158 (65%), Gaps = 2/158 (1%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            +QL+      RVK+YD +  +L AL  S + V+V +PNE + + +S Q+  D WV++N++
Sbjct  43   VQLLKSQGINRVKLYDTDSAVLTALSGSNISVTVALPNEQLSDAASKQSFTDSWVQSNIL  102

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPLAMDML  524
             +Y +T I  + VGNE+  +P NTT F LVPAM+ +  S+ K+G+   IKV +P+A+  L
Sbjct  103  RYYPKTNIESIAVGNEVFVDPKNTTKF-LVPAMKNVYASLVKYGVASSIKVSSPVALSAL  161

Query  525  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            + SYP SSG+F++DL   V KP+L FL ++ SF   ++
Sbjct  162  QNSYPSSSGSFKTDLIEPVIKPMLSFLKQSGSFLAVNI  199



>gb|KEH41871.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=494

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 108/158 (68%), Gaps = 2/158 (1%)
 Frame = +3

Query  168  LQLIHGLKAKRVKIYDANPKILRALGNSGVQVSVMVPNEIIPNISSDQALADRWVETNVV  347
            ++L+      RVK+YD +  +L AL NSG++V+V +PNE++ + ++DQ+  D W+++N++
Sbjct  56   VELLKAQGFNRVKLYDTDATVLTALANSGIKVTVAMPNELLSSAAADQSYTDTWIQSNIL  115

Query  348  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPLAMDML  524
              Y  T+I  + VGNE+  +P NTT + LVPAM+ +  S++K  L ++I + +P+A+  L
Sbjct  116  NHYPATEIEAIAVGNEVFVDPKNTTNY-LVPAMKNVHASLQKQNLDKQILISSPIALSAL  174

Query  525  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  638
            ++SYP S+G+F+++L   V KP+L+FL +T S+   + 
Sbjct  175  QSSYPTSTGSFKTELVEPVIKPMLEFLSQTGSYLMVNA  212



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 947301083750