BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF041J13

Length=657
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007227719.1|  hypothetical protein PRUPE_ppa007047mg             215   3e-64   Prunus persica
ref|XP_011097188.1|  PREDICTED: ubiquitin receptor RAD23c-like          214   1e-63   Sesamum indicum [beniseed]
ref|XP_009607597.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    213   3e-63   Nicotiana tomentosiformis
ref|XP_009607598.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    210   2e-62   Nicotiana tomentosiformis
ref|XP_009781758.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    210   4e-62   Nicotiana sylvestris
ref|XP_002283656.1|  PREDICTED: ubiquitin receptor RAD23c               209   4e-62   Vitis vinifera
ref|XP_011099561.1|  PREDICTED: ubiquitin receptor RAD23c-like          209   6e-62   Sesamum indicum [beniseed]
ref|XP_006363121.1|  PREDICTED: ubiquitin receptor RAD23c-like          209   6e-62   Solanum tuberosum [potatoes]
ref|XP_007223090.1|  hypothetical protein PRUPE_ppa007032mg             209   7e-62   Prunus persica
ref|XP_007223091.1|  hypothetical protein PRUPE_ppa007032mg             207   1e-61   
ref|XP_009781759.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    207   2e-61   Nicotiana sylvestris
ref|XP_002516727.1|  uv excision repair protein rad23, putative         207   3e-61   Ricinus communis
ref|XP_008243218.1|  PREDICTED: ubiquitin receptor RAD23d-like          207   5e-61   
gb|KDP32945.1|  hypothetical protein JCGZ_12976                         206   7e-61   Jatropha curcas
gb|AII99835.1|  putative DNA repair protein RAD23-3-like protein        206   9e-61   Nicotiana tabacum [American tobacco]
ref|XP_009784661.1|  PREDICTED: ubiquitin receptor RAD23d               206   1e-60   Nicotiana sylvestris
gb|KJB80004.1|  hypothetical protein B456_013G076900                    206   1e-60   Gossypium raimondii
gb|KJB80005.1|  hypothetical protein B456_013G076900                    206   1e-60   Gossypium raimondii
ref|XP_007215515.1|  hypothetical protein PRUPE_ppa007020mg             206   2e-60   Prunus persica
ref|XP_008230399.1|  PREDICTED: ubiquitin receptor RAD23d               206   2e-60   Prunus mume [ume]
ref|XP_009356279.1|  PREDICTED: ubiquitin receptor RAD23d-like          205   3e-60   Pyrus x bretschneideri [bai li]
ref|XP_004232367.1|  PREDICTED: ubiquitin receptor RAD23d               204   4e-60   
ref|XP_010552226.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    200   2e-58   Tarenaya hassleriana [spider flower]
ref|XP_011021233.1|  PREDICTED: ubiquitin receptor RAD23c isoform X3    200   3e-58   Populus euphratica
ref|XP_008379541.1|  PREDICTED: ubiquitin receptor RAD23d-like          199   4e-58   
ref|XP_011035052.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    199   7e-58   Populus euphratica
ref|XP_006846642.1|  hypothetical protein AMTR_s00156p00078120          197   2e-57   Amborella trichopoda
ref|XP_002305813.1|  ubiquitin family protein                           194   3e-56   Populus trichocarpa [western balsam poplar]
ref|XP_011021236.1|  PREDICTED: ubiquitin receptor RAD23c isoform X4    194   3e-56   Populus euphratica
ref|XP_006383464.1|  ubiquitin family protein                           194   5e-56   
ref|XP_008368214.1|  PREDICTED: ubiquitin receptor RAD23c-like          193   6e-56   
ref|XP_011035051.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    192   3e-55   Populus euphratica
ref|XP_009356676.1|  PREDICTED: ubiquitin receptor RAD23c-like          191   5e-55   Pyrus x bretschneideri [bai li]
ref|XP_009357056.1|  PREDICTED: ubiquitin receptor RAD23d               188   8e-54   Pyrus x bretschneideri [bai li]
ref|XP_010440953.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    188   8e-54   Camelina sativa [gold-of-pleasure]
ref|NP_001078680.1|  ubiquitin receptor RAD23d                          183   1e-52   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001130219.1|  uncharacterized protein LOC100191313               179   4e-52   
emb|CDY58121.1|  BnaCnng32650D                                          183   5e-52   Brassica napus [oilseed rape]
ref|XP_010103794.1|  Putative DNA repair protein RAD23-4                187   5e-52   
tpg|DAA61375.1|  TPA: hypothetical protein ZEAMMB73_350633              180   3e-51   
ref|XP_006283908.1|  hypothetical protein CARUB_v10005026mg             179   2e-50   Capsella rubella
ref|XP_008650775.1|  PREDICTED: uncharacterized protein LOC100191...    179   3e-50   
ref|XP_004956778.1|  PREDICTED: probable DNA repair protein RAD23...    178   7e-50   Setaria italica
gb|KDO46130.1|  hypothetical protein CISIN_1g0198171mg                  174   1e-49   Citrus sinensis [apfelsine]
gb|KDO46129.1|  hypothetical protein CISIN_1g0198171mg                  174   2e-49   Citrus sinensis [apfelsine]
ref|XP_004956777.1|  PREDICTED: probable DNA repair protein RAD23...    178   4e-49   
gb|KJB69953.1|  hypothetical protein B456_011G053200                    174   6e-49   Gossypium raimondii
gb|KJB69954.1|  hypothetical protein B456_011G053200                    172   1e-48   Gossypium raimondii
gb|KJB69952.1|  hypothetical protein B456_011G053200                    173   2e-48   Gossypium raimondii
ref|XP_007135849.1|  hypothetical protein PHAVU_010G163300g             172   5e-48   Phaseolus vulgaris [French bean]
gb|KHG09850.1|  Putative DNA repair RAD23-1 -like protein               171   1e-47   Gossypium arboreum [tree cotton]
gb|ACU20959.1|  unknown                                                 171   2e-47   Glycine max [soybeans]
ref|NP_001240038.1|  uncharacterized protein LOC100819019               171   2e-47   Glycine max [soybeans]
gb|KJB34920.1|  hypothetical protein B456_006G091100                    171   2e-47   Gossypium raimondii
ref|XP_008462953.1|  PREDICTED: ubiquitin receptor RAD23b isoform X1    171   2e-47   Cucumis melo [Oriental melon]
ref|XP_003529480.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    171   3e-47   Glycine max [soybeans]
gb|KHG13236.1|  Putative DNA repair RAD23-1 -like protein               171   3e-47   Gossypium arboreum [tree cotton]
ref|XP_010435749.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    169   8e-47   Camelina sativa [gold-of-pleasure]
ref|NP_001149553.1|  LOC100283179                                       169   1e-46   Zea mays [maize]
ref|XP_009365249.1|  PREDICTED: ubiquitin receptor RAD23b-like          168   2e-46   Pyrus x bretschneideri [bai li]
gb|EMT27109.1|  Putative DNA repair protein RAD23                       169   3e-46   
gb|ACH72675.1|  RAD23                                                   166   2e-45   Pinus sylvestris var. mongolica
ref|NP_001063134.1|  Os09g0407200                                       166   3e-45   
gb|AAB65841.1|  osRAD23                                                 166   3e-45   Oryza sativa Japonica Group [Japonica rice]
gb|ABK24371.1|  unknown                                                 164   8e-45   Picea sitchensis
ref|XP_010532056.1|  PREDICTED: ubiquitin receptor RAD23b               164   9e-45   Tarenaya hassleriana [spider flower]
gb|KJB67005.1|  hypothetical protein B456_010G170000                    163   3e-44   Gossypium raimondii
ref|XP_002889262.1|  hypothetical protein ARALYDRAFT_316857             161   1e-43   Arabidopsis lyrata subsp. lyrata
ref|NP_974181.1|  ubiquitin receptor RAD23b                             160   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850982.1|  ubiquitin receptor RAD23b                             160   3e-43   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC76389.1|  RAD23-like protein                                     160   3e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565216.2|  ubiquitin receptor RAD23b                             159   5e-43   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC76390.1|  RAD23-like protein                                     159   6e-43   Arabidopsis thaliana [mouse-ear cress]
gb|ABG89119.1|  Rad23-3Ai                                               159   7e-43   synthetic construct
gb|KHN38092.1|  Putative DNA repair protein RAD23-1                     160   1e-42   Glycine soja [wild soybean]
ref|XP_010429866.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    158   1e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010429867.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    158   1e-42   Camelina sativa [gold-of-pleasure]
ref|XP_009117771.1|  PREDICTED: probable ubiquitin receptor RAD23a      152   1e-40   Brassica rapa
ref|XP_008462954.1|  PREDICTED: ubiquitin receptor RAD23b isoform X2    142   2e-36   Cucumis melo [Oriental melon]
ref|XP_009791274.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    142   3e-36   Nicotiana sylvestris
ref|XP_009631150.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    142   3e-36   Nicotiana tomentosiformis
ref|XP_009631151.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    141   3e-36   
ref|XP_009791275.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    141   4e-36   Nicotiana sylvestris
ref|XP_009597821.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    134   1e-35   Nicotiana tomentosiformis
ref|XP_004233496.1|  PREDICTED: ubiquitin receptor RAD23c isoform X3    140   1e-35   Solanum lycopersicum
ref|XP_004233495.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    140   1e-35   Solanum lycopersicum
ref|XP_010317192.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    140   1e-35   Solanum lycopersicum
ref|XP_004236965.1|  PREDICTED: ubiquitin receptor RAD23c               140   1e-35   Solanum lycopersicum
ref|XP_006367045.1|  PREDICTED: ubiquitin receptor RAD23c-like          140   1e-35   
gb|KDO58999.1|  hypothetical protein CISIN_1g014118mg                   137   4e-35   Citrus sinensis [apfelsine]
emb|CDP19777.1|  unnamed protein product                                138   7e-35   Coffea canephora [robusta coffee]
ref|XP_010498530.1|  PREDICTED: ubiquitin receptor RAD23c-like          138   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010463666.1|  PREDICTED: ubiquitin receptor RAD23c               138   1e-34   Camelina sativa [gold-of-pleasure]
gb|KDO59000.1|  hypothetical protein CISIN_1g014118mg                   137   1e-34   Citrus sinensis [apfelsine]
ref|XP_010647738.1|  PREDICTED: ubiquitin receptor RAD23c isoform X1    137   1e-34   Vitis vinifera
ref|XP_002282352.1|  PREDICTED: ubiquitin receptor RAD23c isoform X2    137   2e-34   Vitis vinifera
emb|CDX74251.1|  BnaA03g27960D                                          137   2e-34   
gb|ACJ83348.1|  unknown                                                 131   2e-34   Medicago truncatula
ref|XP_009134681.1|  PREDICTED: ubiquitin receptor RAD23c               137   2e-34   Brassica rapa
ref|XP_006482260.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    136   3e-34   Citrus sinensis [apfelsine]
gb|KDO58997.1|  hypothetical protein CISIN_1g014118mg                   136   3e-34   Citrus sinensis [apfelsine]
gb|KDO58996.1|  hypothetical protein CISIN_1g014118mg                   136   3e-34   Citrus sinensis [apfelsine]
gb|KDO58993.1|  hypothetical protein CISIN_1g014118mg                   136   3e-34   Citrus sinensis [apfelsine]
ref|XP_006482261.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    136   3e-34   Citrus sinensis [apfelsine]
gb|KFK37714.1|  hypothetical protein AALP_AA3G019400                    137   3e-34   Arabis alpina [alpine rockcress]
ref|XP_011070815.1|  PREDICTED: ubiquitin receptor RAD23c-like          137   4e-34   
gb|KFK37713.1|  hypothetical protein AALP_AA3G019400                    136   4e-34   Arabis alpina [alpine rockcress]
gb|KDO58994.1|  hypothetical protein CISIN_1g014118mg                   136   4e-34   Citrus sinensis [apfelsine]
emb|CDX91998.1|  BnaC03g33000D                                          136   4e-34   
ref|XP_006430789.1|  hypothetical protein CICLE_v10011886mg             136   5e-34   Citrus clementina [clementine]
ref|XP_006430787.1|  hypothetical protein CICLE_v10011886mg             136   5e-34   
ref|XP_006430788.1|  hypothetical protein CICLE_v10011886mg             136   5e-34   Citrus clementina [clementine]
gb|EYU44643.1|  hypothetical protein MIMGU_mgv1a006427mg                136   5e-34   Erythranthe guttata [common monkey flower]
ref|XP_008361862.1|  PREDICTED: ubiquitin receptor RAD23c-like          127   6e-34   
ref|XP_009597820.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    133   6e-34   Nicotiana tomentosiformis
gb|KDO58995.1|  hypothetical protein CISIN_1g014118mg                   136   7e-34   Citrus sinensis [apfelsine]
ref|XP_010485565.1|  PREDICTED: ubiquitin receptor RAD23c-like          135   8e-34   Camelina sativa [gold-of-pleasure]
ref|NP_974211.1|  UV excision repair protein RAD23C                     133   8e-34   Arabidopsis thaliana [mouse-ear cress]
gb|ABB02636.1|  RAD23-like                                              135   1e-33   Solanum tuberosum [potatoes]
gb|KDO58998.1|  hypothetical protein CISIN_1g014118mg                   135   1e-33   Citrus sinensis [apfelsine]
ref|NP_001274760.1|  uncharacterized protein LOC102577665               134   1e-33   Solanum tuberosum [potatoes]
ref|XP_006408409.1|  hypothetical protein EUTSA_v10020817mg             134   2e-33   Eutrema salsugineum [saltwater cress]
gb|ACU18469.1|  unknown                                                 128   3e-33   Glycine max [soybeans]
ref|XP_010525156.1|  PREDICTED: ubiquitin receptor RAD23c-like          133   4e-33   Tarenaya hassleriana [spider flower]
ref|XP_006299986.1|  hypothetical protein CARUB_v10016200mg             134   5e-33   Capsella rubella
gb|ABD96960.1|  hypothetical protein                                    134   5e-33   Tarenaya spinosa
ref|XP_004172134.1|  PREDICTED: putative DNA repair protein RAD23...    133   6e-33   
ref|XP_004135098.1|  PREDICTED: putative DNA repair protein RAD23...    133   7e-33   
ref|XP_007033285.1|  Rad23 UV excision repair protein family isof...    132   9e-33   
gb|EYU34397.1|  hypothetical protein MIMGU_mgv1a008220mg                132   9e-33   Erythranthe guttata [common monkey flower]
ref|XP_008446578.1|  PREDICTED: ubiquitin receptor RAD23c-like          132   1e-32   Cucumis melo [Oriental melon]
gb|KGN52072.1|  hypothetical protein Csa_5G608600                       132   1e-32   Cucumis sativus [cucumbers]
ref|NP_186903.1|  UV excision repair protein RAD23C                     132   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010549930.1|  PREDICTED: ubiquitin receptor RAD23c-like          132   1e-32   Tarenaya hassleriana [spider flower]
ref|NP_001189793.1|  UV excision repair protein RAD23C                  132   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001240201.1|  uncharacterized protein LOC100809066               132   1e-32   Glycine max [soybeans]
gb|EYU29968.1|  hypothetical protein MIMGU_mgv1a008352mg                131   2e-32   Erythranthe guttata [common monkey flower]
gb|EYU29967.1|  hypothetical protein MIMGU_mgv1a008352mg                131   2e-32   Erythranthe guttata [common monkey flower]
ref|XP_010263555.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    131   3e-32   Nelumbo nucifera [Indian lotus]
ref|XP_010263550.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    131   3e-32   Nelumbo nucifera [Indian lotus]
ref|XP_010103792.1|  Putative DNA repair protein RAD23-3                131   3e-32   Morus notabilis
ref|XP_006584607.1|  PREDICTED: uncharacterized protein LOC100813...    130   4e-32   
ref|XP_006584608.1|  PREDICTED: uncharacterized protein LOC100813...    130   4e-32   
gb|ACU18529.1|  unknown                                                 130   4e-32   Glycine max [soybeans]
ref|XP_004497101.1|  PREDICTED: putative DNA repair protein RAD23...    130   5e-32   Cicer arietinum [garbanzo]
ref|XP_006584606.1|  PREDICTED: uncharacterized protein LOC100813...    130   5e-32   
ref|XP_006584604.1|  PREDICTED: uncharacterized protein LOC100813...    131   5e-32   
gb|KEH44233.1|  RAD23 UV excision repair family protein                 130   5e-32   Medicago truncatula
ref|NP_001242098.1|  uncharacterized protein LOC100813881               130   5e-32   
ref|XP_003555895.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    130   5e-32   Glycine max [soybeans]
ref|XP_006584605.1|  PREDICTED: uncharacterized protein LOC100813...    131   5e-32   Glycine max [soybeans]
ref|XP_008781252.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    130   5e-32   Phoenix dactylifera
ref|XP_008781229.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    130   5e-32   
ref|XP_008781237.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    130   5e-32   Phoenix dactylifera
ref|XP_008781245.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    130   6e-32   
ref|XP_007033284.1|  Rad23 UV excision repair protein family isof...    130   7e-32   
gb|KHN15504.1|  Putative DNA repair protein RAD23-3                     130   8e-32   Glycine soja [wild soybean]
ref|XP_008390012.1|  PREDICTED: ubiquitin receptor RAD23c-like          129   1e-31   
ref|XP_002884326.1|  hypothetical protein ARALYDRAFT_477488             129   1e-31   
ref|XP_006437672.1|  hypothetical protein CICLE_v10031777mg             125   2e-31   
ref|XP_011464118.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    129   2e-31   Fragaria vesca subsp. vesca
emb|CDP02781.1|  unnamed protein product                                128   2e-31   Coffea canephora [robusta coffee]
ref|XP_004299088.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    128   2e-31   Fragaria vesca subsp. vesca
ref|XP_010265160.1|  PREDICTED: ubiquitin receptor RAD23c-like          128   3e-31   Nelumbo nucifera [Indian lotus]
ref|XP_006437673.1|  hypothetical protein CICLE_v10031777mg             126   4e-31   
ref|XP_010926134.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    127   5e-31   Elaeis guineensis
ref|XP_010926135.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    127   5e-31   Elaeis guineensis
ref|XP_008775144.1|  PREDICTED: ubiquitin receptor RAD23d-like          127   5e-31   Phoenix dactylifera
ref|XP_003536688.1|  PREDICTED: ubiquitin receptor RAD23c               127   5e-31   Glycine max [soybeans]
gb|KHN05574.1|  Putative DNA repair protein RAD23-3                     127   6e-31   Glycine soja [wild soybean]
ref|XP_007142903.1|  hypothetical protein PHAVU_007G026600g             127   7e-31   Phaseolus vulgaris [French bean]
ref|XP_010926133.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    127   7e-31   Elaeis guineensis
ref|XP_010926132.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    127   7e-31   Elaeis guineensis
ref|XP_006437674.1|  hypothetical protein CICLE_v10031777mg             126   8e-31   
ref|XP_010552232.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    126   1e-30   Tarenaya hassleriana [spider flower]
ref|XP_006484457.1|  PREDICTED: ubiquitin receptor RAD23c-like          125   2e-30   Citrus sinensis [apfelsine]
ref|XP_006437675.1|  hypothetical protein CICLE_v10031777mg             125   2e-30   Citrus clementina [clementine]
ref|XP_002529115.1|  uv excision repair protein rad23, putative         125   3e-30   Ricinus communis
ref|XP_010916168.1|  PREDICTED: ubiquitin receptor RAD23c-like          125   3e-30   Elaeis guineensis
ref|XP_011035053.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    125   4e-30   Populus euphratica
ref|XP_011035049.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    124   6e-30   Populus euphratica
ref|XP_011035048.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    124   6e-30   Populus euphratica
ref|XP_009417654.1|  PREDICTED: ubiquitin receptor RAD23d-like          124   9e-30   
ref|XP_007142901.1|  hypothetical protein PHAVU_007G026400g             124   1e-29   Phaseolus vulgaris [French bean]
ref|XP_008801157.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    123   1e-29   
ref|XP_008801156.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    123   2e-29   
ref|XP_006383465.1|  hypothetical protein POPTR_0005s15740g             123   2e-29   Populus trichocarpa [western balsam poplar]
ref|XP_008801153.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    123   2e-29   Phoenix dactylifera
ref|XP_008801154.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    123   2e-29   Phoenix dactylifera
gb|KJB80001.1|  hypothetical protein B456_013G076800                    121   4e-29   Gossypium raimondii
ref|XP_010907325.1|  PREDICTED: ubiquitin receptor RAD23d-like          122   6e-29   Elaeis guineensis
ref|XP_011021231.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    122   7e-29   Populus euphratica
ref|XP_010553920.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    121   7e-29   Tarenaya hassleriana [spider flower]
ref|XP_010553921.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    121   7e-29   Tarenaya hassleriana [spider flower]
ref|XP_011021232.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    121   8e-29   Populus euphratica
ref|XP_011021237.1|  PREDICTED: ubiquitin receptor RAD23c isoform X5    121   9e-29   Populus euphratica
gb|KJB80000.1|  hypothetical protein B456_013G076800                    121   9e-29   Gossypium raimondii
ref|XP_009399729.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    121   1e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009399730.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    121   1e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002315945.2|  hypothetical protein POPTR_0010s13610g             121   1e-28   
gb|KJB79998.1|  hypothetical protein B456_013G076800                    121   1e-28   Gossypium raimondii
ref|XP_011007998.1|  PREDICTED: ubiquitin receptor RAD23d-like          121   1e-28   Populus euphratica
ref|XP_007046250.1|  Rad23 UV excision repair protein family isof...    120   2e-28   
ref|XP_002312393.1|  hypothetical protein POPTR_0008s11840g             119   2e-28   
gb|EPS71284.1|  hypothetical protein M569_03474                         120   2e-28   Genlisea aurea
ref|XP_008341883.1|  PREDICTED: ubiquitin receptor RAD23d-like          120   3e-28   
ref|XP_007046249.1|  Rad23 UV excision repair protein family isof...    119   4e-28   
emb|CAA72741.1|  RAD23, isoform I                                       119   5e-28   Daucus carota [carrots]
ref|XP_009391405.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    119   6e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391404.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    119   6e-28   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB79994.1|  hypothetical protein B456_013G076500                    119   8e-28   Gossypium raimondii
ref|XP_003551850.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    118   9e-28   Glycine max [soybeans]
gb|KJB79995.1|  hypothetical protein B456_013G076600                    118   9e-28   Gossypium raimondii
ref|XP_011022053.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    117   1e-27   Populus euphratica
ref|XP_010681568.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    118   1e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681566.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    118   1e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681565.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    118   1e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681567.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    118   1e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681564.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    118   1e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004304134.1|  PREDICTED: ubiquitin receptor RAD23d-like          118   1e-27   Fragaria vesca subsp. vesca
ref|XP_010681563.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    118   1e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004489115.1|  PREDICTED: putative DNA repair protein RAD23...    118   1e-27   Cicer arietinum [garbanzo]
ref|XP_006655985.1|  PREDICTED: ubiquitin receptor RAD23c-like          118   2e-27   Oryza brachyantha
ref|XP_011022044.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    117   2e-27   Populus euphratica
gb|AFK37901.1|  unknown                                                 114   2e-27   Medicago truncatula
ref|NP_001057334.1|  Os06g0264300                                       116   5e-27   
gb|EAZ00429.1|  hypothetical protein OsI_22453                          116   5e-27   Oryza sativa Indica Group [Indian rice]
gb|KFK33251.1|  hypothetical protein AALP_AA6G350300                    115   1e-26   Arabis alpina [alpine rockcress]
ref|XP_010435751.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    115   1e-26   Camelina sativa [gold-of-pleasure]
gb|KEH21499.1|  RAD23 UV excision repair family protein                 114   2e-26   Medicago truncatula
ref|XP_010450905.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    114   2e-26   Camelina sativa [gold-of-pleasure]
gb|AFK37577.1|  unknown                                                 114   2e-26   Lotus japonicus
ref|XP_010450906.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    114   3e-26   Camelina sativa [gold-of-pleasure]
ref|XP_003563980.1|  PREDICTED: ubiquitin receptor RAD23d-like          114   5e-26   Brachypodium distachyon [annual false brome]
ref|XP_002870839.1|  hypothetical protein ARALYDRAFT_494129             113   6e-26   
emb|CDY01661.1|  BnaC04g30910D                                          112   1e-25   
ref|XP_009139789.1|  PREDICTED: ubiquitin receptor RAD23d               112   1e-25   Brassica rapa
ref|XP_003578094.1|  PREDICTED: probable ubiquitin receptor RAD23       111   2e-25   Brachypodium distachyon [annual false brome]
gb|KCW86330.1|  hypothetical protein EUGRSUZ_B03019                     110   3e-25   Eucalyptus grandis [rose gum]
emb|CDX74522.1|  BnaA04g08670D                                          111   4e-25   
ref|XP_010692904.1|  PREDICTED: ubiquitin receptor RAD23d               111   4e-25   Beta vulgaris subsp. vulgaris [field beet]
gb|EMS50196.1|  putative DNA repair protein RAD23                       112   6e-25   Triticum urartu
ref|XP_010044267.1|  PREDICTED: ubiquitin receptor RAD23d-like          110   7e-25   Eucalyptus grandis [rose gum]
dbj|BAC76395.1|  RAD23-like protein                                     110   8e-25   Arabidopsis thaliana [mouse-ear cress]
gb|EMS61794.1|  putative DNA repair protein RAD23                       110   8e-25   Triticum urartu
gb|KDO69966.1|  hypothetical protein CISIN_1g0163871mg                  108   1e-24   Citrus sinensis [apfelsine]
emb|CDX67404.1|  BnaA07g14440D                                          109   1e-24   
dbj|BAJ97496.1|  predicted protein                                      109   1e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ98767.1|  predicted protein                                      109   1e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009125074.1|  PREDICTED: ubiquitin receptor RAD23d               109   1e-24   Brassica rapa
ref|NP_198663.1|  ubiquitin receptor RAD23d                             109   1e-24   Arabidopsis thaliana [mouse-ear cress]
gb|AAK59766.1|  unknown protein                                         109   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001061854.1|  Os08g0430200                                       109   2e-24   
gb|EAZ07072.1|  hypothetical protein OsI_29318                          109   2e-24   Oryza sativa Indica Group [Indian rice]
ref|XP_006378490.1|  hypothetical protein POPTR_0010s13610g             108   2e-24   
gb|KDO69965.1|  hypothetical protein CISIN_1g0163871mg                  108   3e-24   Citrus sinensis [apfelsine]
gb|ACN40029.1|  unknown                                                 107   5e-24   Picea sitchensis
ref|XP_006408408.1|  hypothetical protein EUTSA_v10020817mg             107   5e-24   
ref|XP_006405766.1|  hypothetical protein EUTSA_v10027790mg             107   6e-24   Eutrema salsugineum [saltwater cress]
ref|XP_010235145.1|  PREDICTED: probable ubiquitin receptor RAD23...    107   6e-24   Brachypodium distachyon [annual false brome]
gb|KJB79996.1|  hypothetical protein B456_013G076600                    107   7e-24   Gossypium raimondii
ref|XP_003574508.1|  PREDICTED: probable ubiquitin receptor RAD23...    107   7e-24   Brachypodium distachyon [annual false brome]
ref|XP_001763027.1|  predicted protein                                  107   8e-24   
ref|XP_004965183.1|  PREDICTED: putative DNA repair protein RAD23...    106   2e-23   Setaria italica
dbj|BAC76393.1|  RAD23-like protein                                     106   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006427691.1|  hypothetical protein CICLE_v100258681mg            100   2e-23   
ref|XP_010246571.1|  PREDICTED: ubiquitin receptor RAD23b-like          105   3e-23   Nelumbo nucifera [Indian lotus]
tpg|DAA61379.1|  TPA: hypothetical protein ZEAMMB73_350633              105   3e-23   
ref|XP_010268454.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    105   4e-23   Nelumbo nucifera [Indian lotus]
ref|XP_004147454.1|  PREDICTED: putative DNA repair protein RAD23...    105   4e-23   Cucumis sativus [cucumbers]
ref|XP_010268452.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    105   5e-23   Nelumbo nucifera [Indian lotus]
gb|KDO46132.1|  hypothetical protein CISIN_1g0198171mg                  102   5e-23   Citrus sinensis [apfelsine]
ref|XP_009605626.1|  PREDICTED: probable ubiquitin receptor RAD23a    99.8    7e-23   Nicotiana tomentosiformis
ref|XP_002444556.1|  hypothetical protein SORBIDRAFT_07g023746          101   7e-23   
ref|XP_006646967.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    104   9e-23   Oryza brachyantha
ref|XP_006646966.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    104   9e-23   Oryza brachyantha
ref|XP_009408042.1|  PREDICTED: ubiquitin receptor RAD23b-like          103   1e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002961618.1|  hypothetical protein SELMODRAFT_77427              103   1e-22   
gb|ACG32894.1|  DNA repair protein RAD23                                103   2e-22   Zea mays [maize]
ref|XP_006646969.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    103   2e-22   
ref|XP_006646968.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    103   2e-22   
ref|NP_001149140.1|  LOC100282762                                       103   2e-22   
ref|XP_010695313.1|  PREDICTED: probable ubiquitin receptor RAD23a      103   2e-22   
ref|XP_002964690.1|  hypothetical protein SELMODRAFT_82644              103   2e-22   
ref|XP_004161413.1|  PREDICTED: putative DNA repair protein RAD23...    103   2e-22   
ref|XP_008443453.1|  PREDICTED: ubiquitin receptor RAD23b-like          103   2e-22   
gb|KGN58646.1|  hypothetical protein Csa_3G710740                       103   2e-22   
gb|ACN26781.1|  unknown                                                 102   2e-22   
gb|ACJ84340.1|  unknown                                               98.2    2e-22   
ref|XP_004137651.1|  PREDICTED: putative DNA repair protein RAD23...    102   3e-22   
gb|EYU24565.1|  hypothetical protein MIMGU_mgv1a008731mg                102   4e-22   
gb|KDO46131.1|  hypothetical protein CISIN_1g0198171mg                  101   4e-22   
ref|XP_006493449.1|  PREDICTED: ubiquitin receptor RAD23b-like          102   5e-22   
gb|EYU24564.1|  hypothetical protein MIMGU_mgv1a008731mg                102   5e-22   
ref|XP_003543713.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    102   5e-22   
gb|KHN31866.1|  Putative DNA repair protein RAD23-1                     102   5e-22   
gb|AFW87601.1|  hypothetical protein ZEAMMB73_681598                    102   5e-22   
ref|XP_010107189.1|  Putative DNA repair protein RAD23-1                102   7e-22   
ref|XP_011082656.1|  PREDICTED: ubiquitin receptor RAD23b-like          101   7e-22   
ref|XP_009418051.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    101   8e-22   
ref|XP_007150827.1|  hypothetical protein PHAVU_005G184000g             101   8e-22   
ref|XP_009418030.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    101   8e-22   
ref|NP_001142065.1|  uncharacterized protein LOC100274222               101   8e-22   
ref|NP_001266655.1|  DNA repair protein RAD23                           101   8e-22   
ref|XP_010655132.1|  PREDICTED: ubiquitin receptor RAD23b               101   9e-22   
emb|CBI25247.3|  unnamed protein product                                101   9e-22   
ref|XP_008794386.1|  PREDICTED: ubiquitin receptor RAD23b-like          101   9e-22   
ref|XP_007215553.1|  hypothetical protein PRUPE_ppa007284mg             101   1e-21   
ref|XP_008228865.1|  PREDICTED: ubiquitin receptor RAD23b-like          101   1e-21   
ref|XP_007024819.1|  Rad23 UV excision repair protein family isof...    100   1e-21   
ref|XP_006385947.1|  hypothetical protein POPTR_0003s18540g             100   1e-21   
gb|ACF83232.1|  unknown                                               98.6    1e-21   
ref|XP_002303970.1|  DNA repair protein RAD23                           100   1e-21   
ref|XP_002512770.1|  uv excision repair protein rad23, putative         100   1e-21   
ref|XP_007024818.1|  Rad23 UV excision repair protein family isof...    100   2e-21   
ref|XP_006368664.1|  hypothetical protein POPTR_0001s07510g             100   2e-21   
ref|XP_011035054.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    100   2e-21   
ref|XP_011034604.1|  PREDICTED: ubiquitin receptor RAD23b-like          100   2e-21   
ref|XP_009615678.1|  PREDICTED: ubiquitin receptor RAD23b               100   2e-21   
ref|XP_002299163.1|  DNA repair protein RAD23                           100   2e-21   
ref|XP_010929196.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    100   2e-21   
ref|XP_010929195.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    100   2e-21   
ref|XP_010929193.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    100   2e-21   
ref|XP_006427690.1|  hypothetical protein CICLE_v100258682mg          99.8    2e-21   
ref|XP_004486596.1|  PREDICTED: putative DNA repair protein RAD23...    100   3e-21   
ref|XP_004486595.1|  PREDICTED: putative DNA repair protein RAD23...    100   3e-21   
gb|KHG13156.1|  Putative DNA repair RAD23-1 -like protein               100   3e-21   
ref|XP_004303217.1|  PREDICTED: ubiquitin receptor RAD23b             99.8    3e-21   
ref|XP_004164899.1|  PREDICTED: putative DNA repair protein RAD23...  99.8    3e-21   
ref|XP_006845449.1|  hypothetical protein AMTR_s00019p00116110        99.8    3e-21   
emb|CDO98260.1|  unnamed protein product                              99.8    3e-21   
ref|XP_010034056.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  99.4    4e-21   
ref|XP_010034057.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  99.4    4e-21   
ref|XP_010034058.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  99.4    5e-21   
ref|XP_010034055.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  99.4    5e-21   
ref|XP_003637291.1|  RAD23 protein                                    99.4    5e-21   
ref|XP_001752113.1|  predicted protein                                94.0    5e-21   
ref|XP_011020549.1|  PREDICTED: ubiquitin receptor RAD23b-like        99.0    6e-21   
ref|XP_008381163.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  99.0    7e-21   
ref|XP_004235877.1|  PREDICTED: ubiquitin receptor RAD23b             99.0    7e-21   
ref|XP_006341431.1|  PREDICTED: ubiquitin receptor RAD23b-like        99.0    7e-21   
ref|XP_009759118.1|  PREDICTED: ubiquitin receptor RAD23b isoform X2  98.6    8e-21   
ref|XP_008342756.1|  PREDICTED: ubiquitin receptor RAD23b-like        98.6    8e-21   
ref|XP_009759117.1|  PREDICTED: ubiquitin receptor RAD23b isoform X1  98.6    8e-21   
dbj|BAD19842.1|  RAD23 protein-like                                   94.4    8e-21   
ref|XP_009354240.1|  PREDICTED: ubiquitin receptor RAD23b-like        98.6    9e-21   
ref|NP_001172955.1|  Os02g0465112                                     93.6    9e-21   
gb|ACF79443.1|  unknown                                               98.6    9e-21   
ref|XP_008668010.1|  PREDICTED: LOC100283179 isoform X1               99.0    9e-21   
ref|XP_008677244.1|  PREDICTED: LOC100282427 isoform X2               98.2    1e-20   
gb|EEC73129.1|  hypothetical protein OsI_07141                        97.1    1e-20   
ref|NP_001148810.1|  LOC100282427                                     98.2    1e-20   
gb|AFW66284.1|  hypothetical protein ZEAMMB73_839350                  97.4    1e-20   
ref|XP_009398645.1|  PREDICTED: ubiquitin receptor RAD23b-like        98.2    1e-20   
ref|XP_009797065.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  98.2    1e-20   
ref|XP_009598520.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  98.2    1e-20   
ref|XP_009598522.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  97.8    1e-20   
ref|XP_009797063.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  97.8    1e-20   
gb|EEC72612.1|  hypothetical protein OsI_06092                        97.4    2e-20   
ref|NP_001046083.1|  Os02g0179300                                     97.4    2e-20   
ref|XP_002451657.1|  hypothetical protein SORBIDRAFT_04g005370        97.1    2e-20   
emb|CDX69473.1|  BnaA10g18220D                                        99.4    3e-20   
gb|KFK42374.1|  hypothetical protein AALP_AA2G247700                  96.7    3e-20   
ref|XP_001780766.1|  predicted protein                                97.1    3e-20   
emb|CDX69474.1|  BnaA10g18230D                                        96.7    4e-20   
emb|CDY33351.1|  BnaC05g12320D                                        96.7    4e-20   
gb|KJB34921.1|  hypothetical protein B456_006G091100                  96.3    4e-20   
ref|XP_001775909.1|  predicted protein                                94.0    5e-20   
gb|EMS58233.1|  Putative DNA repair protein RAD23-1                   96.7    6e-20   
gb|AAF68123.1|AC010793_18  F20B17.8                                   95.9    7e-20   
emb|CAA72742.1|  RAD23 protein, isoform II                            95.9    7e-20   
ref|XP_002890153.1|  hypothetical protein ARALYDRAFT_312599           95.9    7e-20   
ref|NP_001185439.1|  ubiquitin receptor RAD23b                        95.9    7e-20   
gb|AAF18513.1|AC010924_26  Contains similarity to gb|Y12014 RAD23...  94.4    1e-19   
gb|EEE56950.1|  hypothetical protein OsJ_06656                        94.0    1e-19   
ref|XP_010417634.1|  PREDICTED: ubiquitin receptor RAD23b             95.1    1e-19   
ref|XP_006302422.1|  hypothetical protein CARUB_v10020503mg           95.1    1e-19   
emb|CDX81753.1|  BnaC08g38480D                                        94.7    2e-19   
ref|XP_009797066.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  94.4    2e-19   
gb|EPS72838.1|  hypothetical protein M569_01918                       94.4    2e-19   
ref|XP_009121517.1|  PREDICTED: ubiquitin receptor RAD23c-like        94.4    2e-19   
gb|KDP41924.1|  hypothetical protein JCGZ_26942                       94.4    2e-19   
dbj|BAK04690.1|  predicted protein                                    94.7    2e-19   
ref|XP_003622299.1|  hypothetical protein MTR_7g032690                94.7    2e-19   
ref|XP_006598286.1|  PREDICTED: ubiquitin receptor RAD23b-like        94.4    2e-19   
ref|XP_003622298.1|  hypothetical protein MTR_7g032690                95.1    2e-19   
ref|XP_006416841.1|  hypothetical protein EUTSA_v10007982mg           94.7    2e-19   
ref|XP_006306209.1|  hypothetical protein CARUB_v10011879mg           94.4    2e-19   
ref|XP_010459157.1|  PREDICTED: probable ubiquitin receptor RAD23a    94.4    2e-19   
ref|XP_010497716.1|  PREDICTED: probable ubiquitin receptor RAD23a    94.4    3e-19   
ref|NP_173070.1|  DNA repair protein RAD23A                           94.0    3e-19   
ref|XP_009104513.1|  PREDICTED: ubiquitin receptor RAD23b             93.6    4e-19   
emb|CDY35071.1|  BnaA06g10810D                                        93.6    4e-19   
ref|XP_009149056.1|  PREDICTED: probable ubiquitin receptor RAD23a    93.6    4e-19   
gb|ABY66298.1|  RAD23-like protein                                    93.2    6e-19   
ref|XP_009121516.1|  PREDICTED: ubiquitin receptor RAD23c-like        93.2    7e-19   
ref|XP_010472832.1|  PREDICTED: ubiquitin receptor RAD23b-like        93.2    7e-19   
ref|XP_008381164.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  92.8    7e-19   
ref|XP_003570619.1|  PREDICTED: ubiquitin receptor RAD23b-like        92.8    8e-19   
gb|EMT30328.1|  Putative DNA repair protein RAD23                     93.6    1e-18   
gb|ABN05900.1|  Ubiquitin                                             94.7    1e-18   
gb|KFK25846.1|  hypothetical protein AALP_AA8G169700                  92.8    1e-18   
emb|CDX67983.1|  BnaA07g20230D                                        92.8    1e-18   
ref|XP_006281616.1|  hypothetical protein CARUB_v10027742mg           87.4    1e-18   
emb|CAN62701.1|  hypothetical protein VITISV_007064                   92.0    1e-18   
emb|CAC01850.1|  putative protein                                     89.0    1e-18   
ref|NP_197113.4|  uncharacterized protein                             89.0    2e-18   
emb|CDX79333.1|  BnaC06g19700D                                        91.7    3e-18   
dbj|BAC76391.1|  RAD23-like protein                                   91.3    3e-18   
ref|XP_010476726.1|  PREDICTED: LOW QUALITY PROTEIN: probable ubi...  90.5    5e-18   
ref|XP_006389863.1|  hypothetical protein EUTSA_v10018655mg           91.3    5e-18   
emb|CDY26494.1|  BnaC09g41740D                                        89.7    6e-18   
ref|XP_003622297.1|  hypothetical protein MTR_7g032690                92.0    1e-17   
emb|CDY26493.1|  BnaC09g41750D                                        88.6    2e-17   
ref|XP_010485077.1|  PREDICTED: uncharacterized protein LOC104763398  88.2    1e-16   
ref|XP_006603061.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  86.3    1e-16   
gb|ABY66299.1|  DNA repair protein RAD23                              85.5    2e-16   
ref|XP_010446048.1|  PREDICTED: uncharacterized protein LOC104728818  85.9    7e-16   
emb|CEG67900.1|  Putative UV excision repair protein Rad23            83.6    2e-15   
ref|XP_009122868.1|  PREDICTED: ubiquitin receptor RAD23d-like        83.2    2e-15   
ref|XP_003455006.1|  PREDICTED: UV excision repair protein RAD23 ...  83.2    3e-15   
ref|XP_005931261.1|  PREDICTED: UV excision repair protein RAD23 ...  82.8    3e-15   
ref|XP_004549657.1|  PREDICTED: UV excision repair protein RAD23 ...  82.8    4e-15   
ref|XP_006789078.1|  PREDICTED: UV excision repair protein RAD23 ...  82.8    4e-15   
emb|CDY26496.1|  BnaC09g41720D                                        82.4    4e-15   
ref|XP_004951696.1|  PREDICTED: putative DNA repair protein RAD23...  80.5    2e-14   
ref|XP_004973490.1|  PREDICTED: probable DNA repair protein RAD23...  75.5    6e-14   
ref|XP_005646102.1|  UV excision repair protein Rad23                 79.3    6e-14   
gb|EYU21790.1|  hypothetical protein MIMGU_mgv1a026286mg              76.6    7e-14   
ref|XP_002873756.1|  hypothetical protein ARALYDRAFT_326056           74.7    2e-13   
gb|ABC60029.1|  DNA repair protein                                    77.0    3e-13   
ref|XP_010236294.1|  PREDICTED: ubiquitin receptor RAD23b-like        75.5    4e-13   
gb|EMT16092.1|  Putative DNA repair protein RAD23-1                   77.4    4e-13   
gb|AFK43607.1|  unknown                                               73.6    1e-12   
emb|CCA21947.1|  UV excision repair protein RAD23 putative            75.9    1e-12   
pdb|1P1A|A  Chain A, Nmr Structure Of Ubiquitin-Like Domain Of Hh...  68.2    1e-11   
pdb|1UEL|A  Chain A, Solution Structure Of Ubiquitin-Like Domain ...  68.2    2e-11   
ref|XP_007899245.1|  PREDICTED: UV excision repair protein RAD23 ...  70.9    5e-11   
ref|XP_005154948.1|  PREDICTED: UV excision repair protein RAD23 ...  70.5    8e-11   
ref|XP_006088115.1|  PREDICTED: UV excision repair protein RAD23 ...  70.5    9e-11   
ref|XP_010755175.1|  PREDICTED: UV excision repair protein RAD23 ...  70.5    9e-11   
ref|XP_006088114.1|  PREDICTED: UV excision repair protein RAD23 ...  70.5    9e-11   
ref|XP_007499697.1|  PREDICTED: UV excision repair protein RAD23 ...  70.1    1e-10   
ref|XP_005989968.1|  PREDICTED: UV excision repair protein RAD23 ...  70.1    1e-10   
ref|XP_007499698.1|  PREDICTED: UV excision repair protein RAD23 ...  70.1    1e-10   
ref|XP_008054682.1|  PREDICTED: UV excision repair protein RAD23 ...  69.7    1e-10   
dbj|BAE39643.1|  unnamed protein product                              69.3    1e-10   
ref|XP_008586188.1|  PREDICTED: UV excision repair protein RAD23 ...  69.7    1e-10   
ref|XP_001927901.1|  PREDICTED: UV excision repair protein RAD23 ...  69.7    1e-10   
ref|XP_011363293.1|  PREDICTED: UV excision repair protein RAD23 ...  68.9    2e-10   
ref|XP_429175.3|  PREDICTED: UV excision repair protein RAD23 hom...  69.7    2e-10   
gb|ETM32232.1|  UV excision repair protein Rad23                      69.7    2e-10   
gb|ETI31946.1|  UV excision repair protein Rad23                      69.7    2e-10   
gb|ETL78956.1|  UV excision repair protein Rad23                      69.7    2e-10   
ref|XP_004423355.1|  PREDICTED: UV excision repair protein RAD23 ...  69.7    2e-10   
ref|XP_006882076.1|  PREDICTED: UV excision repair protein RAD23 ...  69.7    2e-10   
gb|ETP29927.1|  UV excision repair protein Rad23                      69.7    2e-10   
gb|ETL25740.1|  UV excision repair protein Rad23                      69.7    2e-10   
gb|ETK72284.1|  UV excision repair protein Rad23                      69.7    2e-10   
ref|XP_008914834.1|  UV excision repair protein Rad23                 69.7    2e-10   
gb|AAH68193.1|  Rad23b protein                                        69.3    2e-10   
ref|XP_005362254.1|  PREDICTED: UV excision repair protein RAD23 ...  69.3    2e-10   
ref|XP_006985330.1|  PREDICTED: UV excision repair protein RAD23 ...  69.3    2e-10   
ref|XP_005362253.1|  PREDICTED: UV excision repair protein RAD23 ...  69.3    2e-10   
ref|NP_001020446.1|  UV excision repair protein RAD23 homolog B       69.3    2e-10   
ref|XP_004581217.1|  PREDICTED: UV excision repair protein RAD23 ...  68.6    2e-10   
ref|XP_006011153.1|  PREDICTED: UV excision repair protein RAD23 ...  69.3    2e-10   
ref|NP_002865.1|  UV excision repair protein RAD23 homolog B isof...  69.3    2e-10   
gb|AAV38508.1|  RAD23 homolog B (S. cerevisiae)                       69.3    2e-10   
ref|NP_033037.2|  UV excision repair protein RAD23 homolog B          69.3    2e-10   
ref|XP_004677510.1|  PREDICTED: UV excision repair protein RAD23 ...  69.3    2e-10   
ref|XP_005581182.1|  PREDICTED: UV excision repair protein RAD23 ...  68.9    2e-10   
ref|NP_001248717.1|  UV excision repair protein RAD23 homolog B       69.3    2e-10   
ref|XP_005076549.1|  PREDICTED: UV excision repair protein RAD23 ...  69.3    2e-10   
dbj|BAD97199.1|  UV excision repair protein RAD23 homolog B variant   69.3    2e-10   
ref|NP_001271836.1|  uncharacterized protein LOC101866175             69.3    2e-10   
gb|AAX43553.1|  RAD23-like B                                          69.3    2e-10   
ref|XP_010387756.1|  PREDICTED: UV excision repair protein RAD23 ...  69.3    2e-10   
gb|AAH20973.1|  RAD23B protein                                        69.3    2e-10   
dbj|BAG57014.1|  unnamed protein product                              69.3    2e-10   
emb|CAA63146.1|  MHR23B                                               69.3    2e-10   
dbj|BAE25006.1|  unnamed protein product                              69.3    2e-10   
ref|XP_004848222.1|  PREDICTED: UV excision repair protein RAD23 ...  69.3    2e-10   
ref|XP_009186622.1|  PREDICTED: UV excision repair protein RAD23 ...  68.9    2e-10   
ref|XP_005532282.1|  PREDICTED: UV excision repair protein RAD23 ...  68.9    2e-10   
dbj|BAE34014.1|  unnamed protein product                              69.3    2e-10   
ref|XP_009186620.1|  PREDICTED: UV excision repair protein RAD23 ...  68.9    2e-10   
ref|XP_003470962.1|  PREDICTED: UV excision repair protein RAD23 ...  68.9    2e-10   
ref|XP_007631606.1|  PREDICTED: LOW QUALITY PROTEIN: UV excision ...  69.3    2e-10   
ref|XP_007966681.1|  PREDICTED: UV excision repair protein RAD23 ...  68.9    2e-10   
ref|XP_004638157.1|  PREDICTED: UV excision repair protein RAD23 ...  69.3    2e-10   
ref|XP_005491419.1|  PREDICTED: UV excision repair protein RAD23 ...  68.9    2e-10   
ref|XP_005491420.1|  PREDICTED: UV excision repair protein RAD23 ...  68.9    2e-10   
ref|XP_004462422.1|  PREDICTED: UV excision repair protein RAD23 ...  68.9    2e-10   
ref|XP_004711018.1|  PREDICTED: UV excision repair protein RAD23 ...  68.9    2e-10   
ref|XP_002188381.1|  PREDICTED: UV excision repair protein RAD23 ...  68.9    2e-10   
ref|XP_007950131.1|  PREDICTED: UV excision repair protein RAD23 ...  68.9    2e-10   
ref|XP_002708173.1|  PREDICTED: UV excision repair protein RAD23 ...  68.9    2e-10   
ref|XP_005329791.1|  PREDICTED: UV excision repair protein RAD23 ...  68.9    2e-10   
ref|XP_006906141.1|  PREDICTED: UV excision repair protein RAD23 ...  68.9    3e-10   



>ref|XP_007227719.1| hypothetical protein PRUPE_ppa007047mg [Prunus persica]
 ref|XP_008243219.1| PREDICTED: ubiquitin receptor RAD23c-like [Prunus mume]
 gb|EMJ28918.1| hypothetical protein PRUPE_ppa007047mg [Prunus persica]
Length=385

 Score =   215 bits (548),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 147/194 (76%), Gaps = 0/194 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHF++EVKPEDTVADVKK IET QGS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFDVEVKPEDTVADVKKQIETSQGSDVYPASQQMLIHQGKVLKDSTTLD  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            ENKVAEN+FVV+M+ K+KSSSGEGS +STATT      S+ SA+         AP P  A
Sbjct  61   ENKVAENSFVVIMLTKSKSSSGEGSGASTATTTKAPQPSAPSAAPTATLTAPQAPIPTSA  120

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
                       + A T    D YGQAAS+L AG NLEG IQQILDMGGGTWDR+TVVRAL
Sbjct  121  PPASVTTPAPVSSATTEVESDPYGQAASDLVAGTNLEGTIQQILDMGGGTWDRDTVVRAL  180

Query  614  RAAYNNPERAVEYL  655
            RAA+NNP RA++YL
Sbjct  181  RAAFNNPARAIDYL  194



>ref|XP_011097188.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=380

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 125/194 (64%), Positives = 144/194 (74%), Gaps = 1/194 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQMLIHQGKVLKDETTLE  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            ENKVAEN+FVV+ M     +S  G+A+++A   + +   S ++        A +PAP  A
Sbjct  61   ENKVAENSFVVI-MLTKNKASSSGAATASAVASSTSQPVSNTSLPTQPVTAAPSPAPTVA  119

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
                   +        A S DVYGQAASNL AGNNLE  +QQILDMGGG+WDR+TVVRAL
Sbjct  120  PLQSAPESAPVPAPTPASSTDVYGQAASNLVAGNNLEATVQQILDMGGGSWDRDTVVRAL  179

Query  614  RAAYNNPERAVEYL  655
            RAAYNNPERAVEYL
Sbjct  180  RAAYNNPERAVEYL  193



>ref|XP_009607597.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
tomentosiformis]
Length=383

 Score =   213 bits (541),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 126/196 (64%), Positives = 146/196 (74%), Gaps = 2/196 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IET QG ++YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETAQGQDIYPAAQQMLIHQGKVLKDTTTLE  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasst--sastapapvpasapapv  427
            ENKVAEN+FVV+M++K K S+   SA+    + T  PA+ST     T  AP   +A    
Sbjct  61   ENKVAENSFVVIMLSKNKVSTSATSATQPTPSNTAQPATSTGQPTQTVTAPQATAASVAP  120

Query  428  pasapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVR  607
              SAP     PA  P       DVYGQAASNL AG+ LE  +QQILDMGGG+WDR+TV+R
Sbjct  121  AQSAPQSAPTPAAAPVSANPVTDVYGQAASNLVAGSTLEATVQQILDMGGGSWDRDTVIR  180

Query  608  ALRAAYNNPERAVEYL  655
            ALRAA+NNPERA+EYL
Sbjct  181  ALRAAFNNPERAIEYL  196



>ref|XP_009607598.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
tomentosiformis]
Length=365

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 135/194 (70%), Gaps = 16/194 (8%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IET QG ++YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETAQGQDIYPAAQQMLIHQGKVLKDTTTLE  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            ENKVAEN+FVV+M+                +    A ++     T  AP   +A      
Sbjct  61   ENKVAENSFVVIML----------------SKAQPATSTGQPTQTVTAPQATAASVAPAQ  104

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
            SAP     PA  P       DVYGQAASNL AG+ LE  +QQILDMGGG+WDR+TV+RAL
Sbjct  105  SAPQSAPTPAAAPVSANPVTDVYGQAASNLVAGSTLEATVQQILDMGGGSWDRDTVIRAL  164

Query  614  RAAYNNPERAVEYL  655
            RAA+NNPERA+EYL
Sbjct  165  RAAFNNPERAIEYL  178



>ref|XP_009781758.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
sylvestris]
Length=387

 Score =   210 bits (534),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 146/196 (74%), Gaps = 2/196 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IET QG  VYPA+Q MLIHQGKVLKD  TLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETAQGQAVYPAAQQMLIHQGKVLKDTATLE  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasst--sastapapvpasapapv  427
            ENKVAEN+FVV+M+AK K S+   SA+  A + T  PA+ST     T  AP   +A    
Sbjct  61   ENKVAENSFVVIMLAKNKVSTSATSAAQPAPSNTAQPATSTGQPTQTVTAPQATAASLAP  120

Query  428  pasapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVR  607
              SAP     PA  P  +    DVYGQAASNL AG+ LE  +QQILDMGGG+WDR+TV+R
Sbjct  121  AQSAPQSAPTPAAAPVSSNPVTDVYGQAASNLVAGSTLEATVQQILDMGGGSWDRDTVIR  180

Query  608  ALRAAYNNPERAVEYL  655
            ALRAA+NNPERA+EYL
Sbjct  181  ALRAAFNNPERAIEYL  196



>ref|XP_002283656.1| PREDICTED: ubiquitin receptor RAD23c [Vitis vinifera]
 emb|CBI33660.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   209 bits (533),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 120/194 (62%), Positives = 141/194 (73%), Gaps = 2/194 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IE V G++VYPA+Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIELVHGTDVYPAAQQMLIHQGKVLKDATTLD  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            EN+VAE++FVV+M+  +K+    G AS+T+   T      +S+         +  APV A
Sbjct  61   ENQVAESSFVVIML--SKNKVSAGGASTTSAAPTSQAQPVSSSPPTSNQPSTAPQAPVVA  118

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
               V            +   D+YGQAASNL AGNNLE  IQQILDMGGG+WDR+TVVRAL
Sbjct  119  LPEVIPEPAPAVAPSISSDSDIYGQAASNLVAGNNLEVTIQQILDMGGGSWDRDTVVRAL  178

Query  614  RAAYNNPERAVEYL  655
            RAAYNNPERAVEYL
Sbjct  179  RAAYNNPERAVEYL  192



>ref|XP_011099561.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=380

 Score =   209 bits (532),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 125/194 (64%), Positives = 144/194 (74%), Gaps = 1/194 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            M+IFVKTLKGTHFEIEVKPEDTVADVKK+IETVQG++VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MRIFVKTLKGTHFEIEVKPEDTVADVKKNIETVQGADVYPASQQMLIHQGKVLKDATTLE  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            ENKVAE +FV V+M     +S  G+A+++A   +   + S + S       A  PAPV A
Sbjct  61   ENKVAEKSFV-VVMLTKNKASSSGAATASAAPSSKTQSVSDTPSPTQPVSAAPTPAPVAA  119

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
                   +        A S DVYGQAASNL AG+NLE  +QQILDMGGG+WDRETV+RAL
Sbjct  120  PPQSAPESAPVPAPTPASSTDVYGQAASNLVAGSNLETTVQQILDMGGGSWDRETVIRAL  179

Query  614  RAAYNNPERAVEYL  655
            RAAYNNPERAVEYL
Sbjct  180  RAAYNNPERAVEYL  193



>ref|XP_006363121.1| PREDICTED: ubiquitin receptor RAD23c-like [Solanum tuberosum]
Length=390

 Score =   209 bits (533),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 146/194 (75%), Gaps = 0/194 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IE+VQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIESVQGQDVYPAAQQMLIHQGKVLKDATTLE  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            ENKVAEN+FVV+M++K K SS   S+   A + T  PA ST  +      P +  A   +
Sbjct  61   ENKVAENSFVVIMLSKNKVSSTGTSSIPAAPSNTAQPAGSTDQARQTITAPQATAALPQS  120

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
            ++    A+     A  +   DVY QAASNL AG+NLE  +QQILDMGGG+WDR+TVVRAL
Sbjct  121  ASESAPASAPVPAAAASSVTDVYDQAASNLVAGSNLETTVQQILDMGGGSWDRDTVVRAL  180

Query  614  RAAYNNPERAVEYL  655
            RAA+NNPERAV+YL
Sbjct  181  RAAFNNPERAVDYL  194



>ref|XP_007223090.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
 gb|EMJ24289.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
Length=385

 Score =   209 bits (532),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 125/194 (64%), Positives = 144/194 (74%), Gaps = 0/194 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHF++ VKPEDTV+DVKK IET QGS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFDVAVKPEDTVSDVKKQIETSQGSDVYPASQQMLIHQGKVLKDSTTLD  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            ENKVAEN+FVV+M+ K+KSS GEGS +STAT       S+ SA+         AP P  A
Sbjct  61   ENKVAENSFVVIMLTKSKSSLGEGSGASTATITKAPQPSAPSAAPTVTLTAPQAPIPTSA  120

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
            S          + A      + YGQAAS+L AG NLEG IQQILDMGGGTWDR+TVVRAL
Sbjct  121  SPASVTTPAPVSSATMEVESNPYGQAASDLVAGTNLEGTIQQILDMGGGTWDRDTVVRAL  180

Query  614  RAAYNNPERAVEYL  655
            RAA+NNP RA++YL
Sbjct  181  RAAFNNPARAIDYL  194



>ref|XP_007223091.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
 gb|EMJ24290.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
Length=322

 Score =   207 bits (526),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 143/195 (73%), Gaps = 1/195 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHF++ VKPEDTV+DVKK IET QGS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFDVAVKPEDTVSDVKKQIETSQGSDVYPASQQMLIHQGKVLKDSTTLD  60

Query  254  ENKVAENNFVVVMMaktksss-gegsasstattktiapasstsastapapvpasapapvp  430
            ENKVAEN+FVV+M+ K+KSS      AS+   TK   P++ ++A T     P +      
Sbjct  61   ENKVAENSFVVIMLTKSKSSLGEGSGASTATITKAPQPSAPSAAPTVTLTAPQAPIPTSA  120

Query  431  asapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRA  610
            + A V   AP  +        + YGQAAS+L AG NLEG IQQILDMGGGTWDR+TVVRA
Sbjct  121  SPASVTTPAPVSSATMDRVESNPYGQAASDLVAGTNLEGTIQQILDMGGGTWDRDTVVRA  180

Query  611  LRAAYNNPERAVEYL  655
            LRAA+NNP RA++YL
Sbjct  181  LRAAFNNPARAIDYL  195



>ref|XP_009781759.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
sylvestris]
Length=369

 Score =   207 bits (528),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 133/194 (69%), Gaps = 16/194 (8%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IET QG  VYPA+Q MLIHQGKVLKD  TLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETAQGQAVYPAAQQMLIHQGKVLKDTATLE  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            ENKVAEN+FVV+M+                     A ++     T  AP   +A      
Sbjct  61   ENKVAENSFVVIML----------------AKAQPATSTGQPTQTVTAPQATAASLAPAQ  104

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
            SAP     PA  P  +    DVYGQAASNL AG+ LE  +QQILDMGGG+WDR+TV+RAL
Sbjct  105  SAPQSAPTPAAAPVSSNPVTDVYGQAASNLVAGSTLEATVQQILDMGGGSWDRDTVIRAL  164

Query  614  RAAYNNPERAVEYL  655
            RAA+NNPERA+EYL
Sbjct  165  RAAFNNPERAIEYL  178



>ref|XP_002516727.1| uv excision repair protein rad23, putative [Ricinus communis]
 gb|EEF45625.1| uv excision repair protein rad23, putative [Ricinus communis]
Length=381

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 143/194 (74%), Gaps = 1/194 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGT+FEI+VKPEDTV DVK +IE  QG++VYPASQ MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTNFEIDVKPEDTVEDVKNNIEIAQGADVYPASQQMLIHQGKVLKDGTTLE  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            ENKVAEN+F+V+M+   +  S  G +++++   + A  +ST   +A  P   +    V A
Sbjct  61   ENKVAENSFIVIML-SKRKVSPSGGSTASSAPPSQAQPASTLPPSATQPSTTAQAPAVTA  119

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
              P   A   P   P +   D+YGQAASNL AG+NLE  +QQILDMGGG+WDRETV RAL
Sbjct  120  ELPQSAAESTPVVNPVSSETDIYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVARAL  179

Query  614  RAAYNNPERAVEYL  655
            RAA+NNPERAVEYL
Sbjct  180  RAAFNNPERAVEYL  193



>ref|XP_008243218.1| PREDICTED: ubiquitin receptor RAD23d-like [Prunus mume]
Length=384

 Score =   207 bits (526),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 139/194 (72%), Gaps = 1/194 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHF++EVKPEDTVADVKK IET QGS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFDVEVKPEDTVADVKKQIETSQGSDVYPASQQMLIHQGKVLKDSTTLD  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            ENKVAEN+FVV+M+     SS    + ++  T T AP  S SA+         AP P  A
Sbjct  61   ENKVAENSFVVIML-TKSKSSLGEGSGASTATITKAPQPSASAAPTVTLTAPQAPIPTSA  119

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
                       + A T    + YGQAAS+L AG NLEG IQQILDMGGGTWDR+TVVRAL
Sbjct  120  LPASVTTPAPVSLATTEVESNPYGQAASDLVAGTNLEGTIQQILDMGGGTWDRDTVVRAL  179

Query  614  RAAYNNPERAVEYL  655
            RAA+NNP RA++YL
Sbjct  180  RAAFNNPARAIDYL  193



>gb|KDP32945.1| hypothetical protein JCGZ_12976 [Jatropha curcas]
Length=382

 Score =   206 bits (525),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 127/194 (65%), Positives = 148/194 (76%), Gaps = 0/194 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGT+FEIEVKP+D VADVKK+IETVQG++VYPA++ MLI+QGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTNFEIEVKPDDRVADVKKAIETVQGADVYPAAKQMLIYQGKVLKDDTTLE  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            ENKVA+N+F+V+M++K+K SSG  SA+ST       PASS  +          APAP PA
Sbjct  61   ENKVADNSFIVIMLSKSKVSSGGTSAASTGPPSQAQPASSLPSHATQPSTTTEAPAPTPA  120

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
              P    +      P +   DVYGQAASNL AGNNLE  IQQILDMGGG+W RETVVRAL
Sbjct  121  PPPSAAESIPAVANPVSSESDVYGQAASNLVAGNNLEATIQQILDMGGGSWTRETVVRAL  180

Query  614  RAAYNNPERAVEYL  655
            RAAYNNPERAVEYL
Sbjct  181  RAAYNNPERAVEYL  194



>gb|AII99835.1| putative DNA repair protein RAD23-3-like protein [Nicotiana tabacum]
Length=387

 Score =   206 bits (525),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 148/196 (76%), Gaps = 2/196 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKPEDTV DVK++IE+VQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVVDVKRNIESVQGQDVYPAAQQMLIHQGKVLKDSTTLE  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            ENKVAEN+FVV+M++K K+SS   S+S  A + T  PASST  + A   + A       A
Sbjct  61   ENKVAENSFVVIMLSKNKASSTGTSSSPAAPSDTAQPASSTGQAQARQTITAPQALVASA  120

Query  434  sapvpvaapaptpap--tagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVR  607
            + P   +  AP P P   +   DVY QAASNL AG+ LE  +Q ILDMGGG+WDRETVVR
Sbjct  121  APPQSASEFAPAPVPGDASTVTDVYDQAASNLVAGSKLEATVQHILDMGGGSWDRETVVR  180

Query  608  ALRAAYNNPERAVEYL  655
            ALRAAYNNPERAV+YL
Sbjct  181  ALRAAYNNPERAVDYL  196



>ref|XP_009784661.1| PREDICTED: ubiquitin receptor RAD23d [Nicotiana sylvestris]
Length=387

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 148/196 (76%), Gaps = 2/196 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKPEDTV DVK++IE+VQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVVDVKRNIESVQGQDVYPAAQQMLIHQGKVLKDSTTLE  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            ENKVAEN+FVV+M++K K+SS   S+S  A + T  PASST  + A   + A       A
Sbjct  61   ENKVAENSFVVIMLSKNKASSTGTSSSPAAPSDTAQPASSTGQAQARQTITAPQALVASA  120

Query  434  sapvpvaapaptpap--tagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVR  607
            + P   +  AP P P   +   DVY QAASNL AG+ LE  +Q ILDMGGG+WDRETVVR
Sbjct  121  APPQSASEFAPAPVPGDASTVTDVYDQAASNLVAGSKLEATVQHILDMGGGSWDRETVVR  180

Query  608  ALRAAYNNPERAVEYL  655
            ALRAAYNNPERAV+YL
Sbjct  181  ALRAAYNNPERAVDYL  196



>gb|KJB80004.1| hypothetical protein B456_013G076900 [Gossypium raimondii]
Length=384

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 137/194 (71%), Gaps = 3/194 (2%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHF IEVKPED VADVKK+IETVQG++VYPA+Q MLI++GKVLKD TTL 
Sbjct  1    MKVFVKTLKGTHFNIEVKPEDAVADVKKNIETVQGADVYPAAQQMLIYKGKVLKDDTTLA  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            EN V EN+F+V+M+     + G     STA+T     A   S+        ++A   + A
Sbjct  61   ENSVTENSFIVIML---TKNKGASGEGSTASTAPTKKAPEASSLPTAPAPASTASVSMSA  117

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
             A     +     +      DVYGQAASNL AG+NLEG IQQILDMGGGTWDR+TVVRAL
Sbjct  118  MAAPATESAPVASSTPLSDSDVYGQAASNLVAGSNLEGTIQQILDMGGGTWDRDTVVRAL  177

Query  614  RAAYNNPERAVEYL  655
            RAAYNNPERAVEYL
Sbjct  178  RAAYNNPERAVEYL  191



>gb|KJB80005.1| hypothetical protein B456_013G076900 [Gossypium raimondii]
Length=385

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 137/194 (71%), Gaps = 3/194 (2%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHF IEVKPED VADVKK+IETVQG++VYPA+Q MLI++GKVLKD TTL 
Sbjct  1    MKVFVKTLKGTHFNIEVKPEDAVADVKKNIETVQGADVYPAAQQMLIYKGKVLKDDTTLA  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            EN V EN+F+V+M+     + G     STA+T     A   S+        ++A   + A
Sbjct  61   ENSVTENSFIVIML---TKNKGASGEGSTASTAPTKKAPEASSLPTAPAPASTASVSMSA  117

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
             A     +     +      DVYGQAASNL AG+NLEG IQQILDMGGGTWDR+TVVRAL
Sbjct  118  MAAPATESAPVASSTPLSDSDVYGQAASNLVAGSNLEGTIQQILDMGGGTWDRDTVVRAL  177

Query  614  RAAYNNPERAVEYL  655
            RAAYNNPERAVEYL
Sbjct  178  RAAYNNPERAVEYL  191



>ref|XP_007215515.1| hypothetical protein PRUPE_ppa007020mg [Prunus persica]
 gb|EMJ16714.1| hypothetical protein PRUPE_ppa007020mg [Prunus persica]
Length=385

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 145/194 (75%), Gaps = 2/194 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGT+FEIEVKPE+ VADVKK IETVQG++VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTNFEIEVKPEEMVADVKKIIETVQGADVYPASQQMLIHQGKVLKDTTTLE  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            EN+VAEN+F+V+M+  TK+ +    ASST    T     +++ ++   PV + AP    A
Sbjct  61   ENQVAENSFIVIML--TKNKASPSGASSTKGAATSQAQPASTPTSTAPPVASPAPVRAVA  118

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
             +   V  PA      +   DVYGQAASNL AG NLE  +QQILDMGGG+WDR+TVVRAL
Sbjct  119  ESQPVVETPAVAAPTDSSRSDVYGQAASNLVAGTNLEATVQQILDMGGGSWDRDTVVRAL  178

Query  614  RAAYNNPERAVEYL  655
            RAA+NNPERAVEYL
Sbjct  179  RAAFNNPERAVEYL  192



>ref|XP_008230399.1| PREDICTED: ubiquitin receptor RAD23d [Prunus mume]
Length=385

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 144/194 (74%), Gaps = 2/194 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGT+FEIEVKPE+ V+DVKK IETVQG++VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTNFEIEVKPEEMVSDVKKIIETVQGADVYPASQQMLIHQGKVLKDTTTLE  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            EN+VAEN+F+VVM+  TK+ +    ASST    T     +++ ++   PV   AP    A
Sbjct  61   ENQVAENSFIVVML--TKNKASPSGASSTKGAATSQAQPASTPTSTTPPVATPAPVRAVA  118

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
             +   V  PA      +   DVYGQAASNL AG NLE  +QQILDMGGG+WDR+TVVRAL
Sbjct  119  ESQPVVETPAVAAPTDSSRSDVYGQAASNLVAGTNLEATVQQILDMGGGSWDRDTVVRAL  178

Query  614  RAAYNNPERAVEYL  655
            RAA+NNPERAVEYL
Sbjct  179  RAAFNNPERAVEYL  192



>ref|XP_009356279.1| PREDICTED: ubiquitin receptor RAD23d-like [Pyrus x bretschneideri]
Length=385

 Score =   205 bits (521),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 139/194 (72%), Gaps = 0/194 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKG+HF++EVKPEDTVADVKK IE  +GS+VYPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGSHFDVEVKPEDTVADVKKHIEASKGSDVYPAPQQMLIHQGKVLKDDTTLD  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            ENKVAEN+FVV+M+ K+ S  GEGS +STA T      S+ + +       + APA    
Sbjct  61   ENKVAENSFVVIMLTKSTSPPGEGSGASTAATTKAPQPSAHTGAPTATLTASPAPAAAST  120

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
                         A T    D YGQAAS+L AG NLEG IQQILDMGGGTWDR+TVVRAL
Sbjct  121  LPASVATPAPVASATTDSQADSYGQAASDLVAGTNLEGTIQQILDMGGGTWDRDTVVRAL  180

Query  614  RAAYNNPERAVEYL  655
            RAA+NNP RA++YL
Sbjct  181  RAAFNNPARAIDYL  194



>ref|XP_004232367.1| PREDICTED: ubiquitin receptor RAD23d [Solanum lycopersicum]
 emb|CAB51544.1| RAD23 protein [Solanum lycopersicum var. cerasiforme]
Length=389

 Score =   204 bits (520),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 123/194 (63%), Positives = 142/194 (73%), Gaps = 1/194 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IE+VQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIESVQGQDVYPAAQQMLIHQGKVLKDTTTLE  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            ENKVAEN+FVV+ M      S  G++S +A     A    ++           A A +P 
Sbjct  61   ENKVAENSFVVI-MLSKNKVSSTGTSSISAALSNTAQPDGSTDQARQTITTPQATAALPQ  119

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
            SA      PAP PA  +   DVY QAASNL AG+NLE  +QQILDMGGG+WDR+TVVRAL
Sbjct  120  SASESAPTPAPVPAAASSVTDVYDQAASNLVAGSNLETTVQQILDMGGGSWDRDTVVRAL  179

Query  614  RAAYNNPERAVEYL  655
            RAAYNNPERAV+YL
Sbjct  180  RAAYNNPERAVDYL  193



>ref|XP_010552226.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Tarenaya 
hassleriana]
Length=387

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 118/194 (61%), Positives = 139/194 (72%), Gaps = 1/194 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGT FEIEVKP+D V DVKK+IETVQG+NVYPA+Q MLIHQGKVL D TTLE
Sbjct  1    MKIFVKTLKGTSFEIEVKPDDKVTDVKKTIETVQGANVYPAAQQMLIHQGKVLSDETTLE  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            ENK++EN F+V +M      S  G+++++A   + +  S   A+   +    + P P   
Sbjct  61   ENKISENGFIV-IMLSKSKVSSSGTSTASAPPASASQPSQAPAAPRVSAPTVAVPEPTSG  119

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
             A     A A   AP     DVYGQAASNL AG+NLE  IQQILDMGGG+WDR+TVVRAL
Sbjct  120  PATATATATATAAAPVLAQTDVYGQAASNLVAGSNLESTIQQILDMGGGSWDRDTVVRAL  179

Query  614  RAAYNNPERAVEYL  655
            RAAYNNPERAVEYL
Sbjct  180  RAAYNNPERAVEYL  193



>ref|XP_011021233.1| PREDICTED: ubiquitin receptor RAD23c isoform X3 [Populus euphratica]
Length=382

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 145/194 (75%), Gaps = 0/194 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGT+FEIEVKPEDTV +VKK+IE  QG++VYPA+Q MLI+QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENAQGADVYPAAQQMLIYQGKVLKDDTTLD  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            E+KVAEN+F+VVM++K+K SSG  S ++ A      P SS  ++       A A  P   
Sbjct  61   ESKVAENSFIVVMLSKSKVSSGGPSTATAAPPTLAQPTSSLPSNVTQPSSTAQAAVPAAV  120

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
                  ++PA   +  +   D+YGQAASNL AG+NLE  IQQILDMGGG+W+RETVVRAL
Sbjct  121  PQSAAESSPAVVVSDLSSDADMYGQAASNLVAGSNLEATIQQILDMGGGSWNRETVVRAL  180

Query  614  RAAYNNPERAVEYL  655
            RAA+NNPERAVEYL
Sbjct  181  RAAFNNPERAVEYL  194



>ref|XP_008379541.1| PREDICTED: ubiquitin receptor RAD23d-like [Malus domestica]
Length=387

 Score =   199 bits (506),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 140/194 (72%), Gaps = 0/194 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGT+FEIEVKPE+TVADVK  IET QG++VYPA Q MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTNFEIEVKPEETVADVKTIIETAQGADVYPAPQQMLIHQGKVLKDDTTLE  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            +N VAEN+F+V+M+ K K+S    S+   A T    PAS+   S AP P   +    +  
Sbjct  61   QNNVAENSFIVIMLTKPKASPAGASSKQGAATSQAQPASTAPTSAAPPPAAPAPAPALLQ  120

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
              P P    A   APT    DVYGQAASNL AG  LE  +QQILDMGGG+WDRETVVRAL
Sbjct  121  LLPQPXXQTAAVVAPTDSRSDVYGQAASNLVAGTTLESTVQQILDMGGGSWDRETVVRAL  180

Query  614  RAAYNNPERAVEYL  655
            RAA+NNPERAVEYL
Sbjct  181  RAAFNNPERAVEYL  194



>ref|XP_011035052.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Populus 
euphratica]
Length=385

 Score =   199 bits (505),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 143/194 (74%), Gaps = 0/194 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVYQGKVLKDDTTLD  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            ENKV+E++F VVM++K+K SS   S +  A      PASS  ++     + + AP P  A
Sbjct  61   ENKVSESSFFVVMLSKSKVSSSGPSTAPAAPPSQAPPASSLPSNVTQPSITSQAPVPAAA  120

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
                   +            ++YGQAASNL AG+NLE  IQQILDMGGG W+RETVVRAL
Sbjct  121  LPQSAAESSPAVVTSALLDTNMYGQAASNLVAGSNLEATIQQILDMGGGDWNRETVVRAL  180

Query  614  RAAYNNPERAVEYL  655
            RAA+NNPERAVEYL
Sbjct  181  RAAFNNPERAVEYL  194



>ref|XP_006846642.1| hypothetical protein AMTR_s00156p00078120 [Amborella trichopoda]
 gb|ERN08317.1| hypothetical protein AMTR_s00156p00078120 [Amborella trichopoda]
Length=389

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 117/196 (60%), Positives = 145/196 (74%), Gaps = 2/196 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKG+HFEIEV+P DTV+ VKK+IET+ G +VYPA+Q +LIHQGKVLKD TTL 
Sbjct  1    MKLFVKTLKGSHFEIEVEPSDTVSAVKKNIETIHGQDVYPAAQQLLIHQGKVLKDDTTLL  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            +NKVAENNF+V+M+ KTK+ +G G++++++ T  + P SS+  +   +  PA   A    
Sbjct  61   DNKVAENNFLVIMLTKTKAPAGGGTSTTSSATAQVQPPSSSPPNPPTSAPPAQTAATPSP  120

Query  434  sapvpvaapaptpaptagsgD--VYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVR  607
                              SGD  VYGQAASNL AG+NLE AIQQILDMGGG+WDR+TVVR
Sbjct  121  PVAAAPTTVNQPATALLSSGDADVYGQAASNLVAGSNLEQAIQQILDMGGGSWDRDTVVR  180

Query  608  ALRAAYNNPERAVEYL  655
            ALRAAYNNPERAVEYL
Sbjct  181  ALRAAYNNPERAVEYL  196



>ref|XP_002305813.1| ubiquitin family protein [Populus trichocarpa]
 gb|EEE86324.1| ubiquitin family protein [Populus trichocarpa]
Length=385

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 144/194 (74%), Gaps = 0/194 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVYQGKVLKDDTTLD  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            ENKV+E++F VVM++K+K SSG  S +  A      PASS  ++     + + AP P  A
Sbjct  61   ENKVSESSFFVVMLSKSKVSSGGPSTAPAAPASQAPPASSLPSNVTQPSITSQAPVPAAA  120

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
                   +            ++YGQAASNL AG+NLE  IQ+ILDMGGG W+RETVVRAL
Sbjct  121  LPQSAAESSPAVVTSALLDTNMYGQAASNLVAGSNLEATIQEILDMGGGDWNRETVVRAL  180

Query  614  RAAYNNPERAVEYL  655
            RAA+NNPERA++YL
Sbjct  181  RAAFNNPERAIDYL  194



>ref|XP_011021236.1| PREDICTED: ubiquitin receptor RAD23c isoform X4 [Populus euphratica]
Length=381

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 141/194 (73%), Gaps = 1/194 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGT+FEIEVKPEDTV +VKK+IE  QG++VYPA+Q MLI+QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENAQGADVYPAAQQMLIYQGKVLKDDTTLD  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            E+KVAEN+F+VV M      S  G +++TA   +  P SS  ++       A A  P   
Sbjct  61   ESKVAENSFIVV-MLSKSKVSSGGPSTATAAPPSAQPTSSLPSNVTQPSSTAQAAVPAAV  119

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
                  ++PA   +  +   D+YGQAASNL AG+NLE  IQQILDMGGG+W+RETVVRAL
Sbjct  120  PQSAAESSPAVVVSDLSSDADMYGQAASNLVAGSNLEATIQQILDMGGGSWNRETVVRAL  179

Query  614  RAAYNNPERAVEYL  655
            RAA+NNPERAVEYL
Sbjct  180  RAAFNNPERAVEYL  193



>ref|XP_006383464.1| ubiquitin family protein [Populus trichocarpa]
 gb|ERP61261.1| ubiquitin family protein [Populus trichocarpa]
Length=384

 Score =   194 bits (492),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 143/196 (73%), Gaps = 2/196 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVA-DVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTL  250
            MK+FVKTLKGT+FEIEVKPEDTV  +VKK+IE VQG++VYPA+Q MLI+QGKVLKD TTL
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVVEVKKNIENVQGADVYPAAQQMLIYQGKVLKDDTTL  60

Query  251  EENKVAENNFVVVMMaktksss-gegsasstattktiapasstsastapapvpasapapv  427
            +E+KVAEN+F+VVM++K+K SS G  +A++     +    S+ +A+           +  
Sbjct  61   DESKVAENSFIVVMLSKSKVSSGGPSTATAAPPNVSSGGPSTATAAPPTLVSAQPTSSLP  120

Query  428  pasapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVR  607
                     + A  PA      D+YGQAASNL AG+NLE  IQQILDMGGG+W+RETVVR
Sbjct  121  SNVTQPSSTSQAAVPAAAFSDADMYGQAASNLVAGSNLEATIQQILDMGGGSWNRETVVR  180

Query  608  ALRAAYNNPERAVEYL  655
            ALRAA+NNPERAVEYL
Sbjct  181  ALRAAFNNPERAVEYL  196



>ref|XP_008368214.1| PREDICTED: ubiquitin receptor RAD23c-like [Malus domestica]
Length=378

 Score =   193 bits (491),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 133/195 (68%), Gaps = 1/195 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHF++EVKPEDTVADVKK IE  +GS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFDLEVKPEDTVADVKKHIEACKGSDVYPASQQMLIHQGKVLKDDTTLD  60

Query  254  ENKVAENNF-VVVMMaktksssgegsasstattktiapasstsastapapvpasapapvp  430
             NKVAEN+F V+++        GEGS +STA T      S+ + +         AP    
Sbjct  61   GNKVAENSFVVIMLTKSKSPPGGEGSGASTAATTEAPQPSAHTGAPTATLTATPAPXAAS  120

Query  431  asapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRA  610
            A               T    D YGQAAS+L AG NLEG IQQILDMGGGTWDR+TVVRA
Sbjct  121  ALPAPVTTPAPVASPTTDSQADSYGQAASDLVAGTNLEGTIQQILDMGGGTWDRDTVVRA  180

Query  611  LRAAYNNPERAVEYL  655
            LRAA+NNP RA++YL
Sbjct  181  LRAAFNNPARAIDYL  195



>ref|XP_011035051.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Populus 
euphratica]
Length=386

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 143/195 (73%), Gaps = 1/195 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVYQGKVLKDDTTLD  60

Query  254  ENKVAENNF-VVVMMaktksssgegsasstattktiapasstsastapapvpasapapvp  430
            ENKV+E++F VV++     SSSG  +A +   ++    +S  S  T P+    +      
Sbjct  61   ENKVSESSFFVVMLSKSKVSSSGPSTAPAAPPSQAPPASSLPSNVTQPSITSQAPVPAAA  120

Query  431  asapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRA  610
                   ++PA   +  +   ++YGQAASNL AG+NLE  IQQILDMGGG W+RETVVRA
Sbjct  121  LPQSAAESSPAVVTSALSLDTNMYGQAASNLVAGSNLEATIQQILDMGGGDWNRETVVRA  180

Query  611  LRAAYNNPERAVEYL  655
            LRAA+NNPERAVEYL
Sbjct  181  LRAAFNNPERAVEYL  195



>ref|XP_009356676.1| PREDICTED: ubiquitin receptor RAD23c-like [Pyrus x bretschneideri]
Length=384

 Score =   191 bits (486),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 134/195 (69%), Gaps = 1/195 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHF++EVKPEDTVADVKK IE  +GS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFDLEVKPEDTVADVKKHIEACKGSDVYPASQQMLIHQGKVLKDDTTLD  60

Query  254  ENKVAENNF-VVVMMaktksssgegsasstattktiapasstsastapapvpasapapvp  430
             NKVAEN+F V+++      + GEGS +STA T      S+ + +         APA   
Sbjct  61   GNKVAENSFVVIMLTKSKSPTGGEGSGASTAATTEAPQPSAHTGAPTATLTATPAPAAAS  120

Query  431  asapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRA  610
            A               T    D YGQAAS+L AG NLEG IQQILDMGGGTWDR+TVV A
Sbjct  121  ALPASVTTPAPVASPTTNSQADSYGQAASDLVAGTNLEGTIQQILDMGGGTWDRDTVVCA  180

Query  611  LRAAYNNPERAVEYL  655
            LRAA+NNP RA++YL
Sbjct  181  LRAAFNNPARAIDYL  195



>ref|XP_009357056.1| PREDICTED: ubiquitin receptor RAD23d [Pyrus x bretschneideri]
Length=391

 Score =   188 bits (478),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 136/198 (69%), Gaps = 4/198 (2%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK++VKTLKGT+FEIEVK E+TVADVK  IET QG++VYPA Q MLIHQGKVLKD TTLE
Sbjct  1    MKVYVKTLKGTNFEIEVKLEETVADVKTIIETAQGADVYPAPQQMLIHQGKVLKDDTTLE  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            +N VAEN+F+V+M+ K K+S    S+   A T    PA +   S AP P   +       
Sbjct  61   QNNVAENSFIVIMLTKPKASPAGASSKQGAATSQAQPAGTAPTSAAPPPAAPAPAPAPAP  120

Query  434  sapvpvaapaptpaptagsgD----VYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETV  601
            +  V    PA   A      D    VYGQAASNL AG  LE  +QQILDMGGG+WDRETV
Sbjct  121  APVVAEPQPAAQTAAVVAPTDSRSDVYGQAASNLVAGTTLESTVQQILDMGGGSWDRETV  180

Query  602  VRALRAAYNNPERAVEYL  655
            VRALRAA+NNPERAVEYL
Sbjct  181  VRALRAAFNNPERAVEYL  198



>ref|XP_010440953.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Camelina 
sativa]
 ref|XP_010440954.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Camelina 
sativa]
 ref|XP_010440955.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Camelina 
sativa]
 ref|XP_010440956.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Camelina 
sativa]
Length=377

 Score =   188 bits (477),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 135/194 (70%), Gaps = 8/194 (4%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTL GT+FEIEVKP DTV+DVK++IETVQG+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSDVKQAIETVQGAQ-YPAAKQMLIHQGKVLKDETTLE  59

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            EN V EN+F+V+M+        +  AS +  +   APA S + S     V     +    
Sbjct  60   ENNVVENSFIVIML-------SKTKASPSGASTASAPAPSATQSQPAQTVATPQVSAPTV  112

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
            S P P +  A   A  +   DVYGQAASNL AG  LE  +QQILDMGGG+WDR+TVVRAL
Sbjct  113  SVPEPTSVTAAPAAAASVQTDVYGQAASNLVAGTVLESTVQQILDMGGGSWDRDTVVRAL  172

Query  614  RAAYNNPERAVEYL  655
            RAA+NNPERAVEYL
Sbjct  173  RAAFNNPERAVEYL  186



>ref|NP_001078680.1| ubiquitin receptor RAD23d [Arabidopsis thaliana]
 gb|AED94322.1| putative DNA repair protein RAD23-4 [Arabidopsis thaliana]
Length=332

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 130/194 (67%), Gaps = 8/194 (4%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTL G++FEIEVKP D V+DVK +IETV+G+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLSGSNFEIEVKPADKVSDVKTAIETVKGAE-YPAAKQMLIHQGKVLKDETTLE  59

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            EN V EN+F+V+M+        +  AS +  +   APA S +     A    SAP     
Sbjct  60   ENNVVENSFIVIML-------SKTKASPSGASTASAPAPSATQPQTVATPQVSAPTASVP  112

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
                  A  A      +   DVYGQAASNL AG  LE  +QQILDMGGG+WDR+TVVRAL
Sbjct  113  VPTSGTATAAAPATAASVQTDVYGQAASNLVAGTTLESTVQQILDMGGGSWDRDTVVRAL  172

Query  614  RAAYNNPERAVEYL  655
            RAA+NNPERAVEYL
Sbjct  173  RAAFNNPERAVEYL  186



>ref|NP_001130219.1| uncharacterized protein LOC100191313 [Zea mays]
 gb|ACF78374.1| unknown [Zea mays]
 tpg|DAA61377.1| TPA: hypothetical protein ZEAMMB73_350633 [Zea mays]
 tpg|DAA61378.1| TPA: hypothetical protein ZEAMMB73_350633 [Zea mays]
Length=225

 Score =   179 bits (454),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 125/194 (64%), Gaps = 0/194 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKG+ F IEV P D VADVKK IE++Q    YPA Q +LIHQGKVLKD TTLE
Sbjct  1    MKVSVKTLKGSSFHIEVDPTDKVADVKKVIESIQEQASYPADQQVLIHQGKVLKDDTTLE  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            EN+V ENNF+V+M+ + K SS    A  TA           +     A   A AP    +
Sbjct  61   ENQVVENNFLVIMLRQNKGSSSAAPAKVTANQAPSTQTVPATPPQTSAAPDAPAPIVPVS  120

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
            +      A A      +   D YGQA SNL AG+NLEG I+ IL+MGGGTWDR+TV+RAL
Sbjct  121  APAATATASAAPAVAVSTEADSYGQATSNLVAGSNLEGTIKSILEMGGGTWDRDTVLRAL  180

Query  614  RAAYNNPERAVEYL  655
            RAAYNNPERAVEYL
Sbjct  181  RAAYNNPERAVEYL  194



>emb|CDY58121.1| BnaCnng32650D [Brassica napus]
Length=384

 Score =   183 bits (465),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 137/194 (71%), Gaps = 2/194 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGT+FEIEV P +T++D KK IET+ G+  YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTNFEIEVNPAETISDTKKRIETLHGAQ-YPAAQQMLIHQGKVLKDETTLE  59

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            EN V EN+F+ V+M      S  G+++++A     +   +  A T   P  A+  A VP 
Sbjct  60   ENNVVENSFI-VIMLSKAKVSSSGASTASAPAPAPSATQAQPAQTVATPQVATPTASVPE  118

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
             +       AP+ A  +   DVYGQAASNL AGNNLE  +QQILDMGGG+WDR+TV+RAL
Sbjct  119  PSSGAATGAAPSAAAASTQTDVYGQAASNLVAGNNLESTVQQILDMGGGSWDRDTVIRAL  178

Query  614  RAAYNNPERAVEYL  655
            RAA+NNPERAVEYL
Sbjct  179  RAAFNNPERAVEYL  192



>ref|XP_010103794.1| Putative DNA repair protein RAD23-4 [Morus notabilis]
 gb|EXB97156.1| Putative DNA repair protein RAD23-4 [Morus notabilis]
Length=550

 Score =   187 bits (474),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 119/242 (49%), Positives = 144/242 (60%), Gaps = 45/242 (19%)
 Frame = +2

Query  65   RENMKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGT  244
            ++ MKI VKTLKGTHFEIEVKPEDTVADVKK+IE VQG++VYPASQ MLIHQGKVLKD T
Sbjct  115  KKKMKICVKTLKGTHFEIEVKPEDTVADVKKNIEVVQGADVYPASQQMLIHQGKVLKDVT  174

Query  245  TLEENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapap  424
            TLEENKV EN+F+V+M+ K K+S    S++S A T    P +++  +++     +  PA 
Sbjct  175  TLEENKVVENSFIVIMITKNKASPSGASSTSGAATSQAQPVTASPPASSTPSTTSETPAS  234

Query  425  vpasapvpvaapaptpaptagsgDVYGQAASNL---------------------------  523
            V                  +   DVYGQAASNL                           
Sbjct  235  VAPPPQSVPEPAPAAAPTASAELDVYGQAASNLVAGSNLEATVQQILDRNLFPNLLLQQL  294

Query  524  ------------------AAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVE  649
                               AG+NLE  +QQILDMGGG+WDR+TVVRALRAA+NNPERAVE
Sbjct  295  LLLRDAELDVYGQAASNLVAGSNLEATVQQILDMGGGSWDRDTVVRALRAAFNNPERAVE  354

Query  650  YL  655
            YL
Sbjct  355  YL  356



>tpg|DAA61375.1| TPA: hypothetical protein ZEAMMB73_350633 [Zea mays]
Length=339

 Score =   180 bits (457),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 125/194 (64%), Gaps = 0/194 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKG+ F IEV P D VADVKK IE++Q    YPA Q +LIHQGKVLKD TTLE
Sbjct  1    MKVSVKTLKGSSFHIEVDPTDKVADVKKVIESIQEQASYPADQQVLIHQGKVLKDDTTLE  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            EN+V ENNF+V+M+ + K SS    A  TA           +     A   A AP    +
Sbjct  61   ENQVVENNFLVIMLRQNKGSSSAAPAKVTANQAPSTQTVPATPPQTSAAPDAPAPIVPVS  120

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
            +      A A      +   D YGQA SNL AG+NLEG I+ IL+MGGGTWDR+TV+RAL
Sbjct  121  APAATATASAAPAVAVSTEADSYGQATSNLVAGSNLEGTIKSILEMGGGTWDRDTVLRAL  180

Query  614  RAAYNNPERAVEYL  655
            RAAYNNPERAVEYL
Sbjct  181  RAAYNNPERAVEYL  194



>ref|XP_006283908.1| hypothetical protein CARUB_v10005026mg [Capsella rubella]
 gb|EOA16806.1| hypothetical protein CARUB_v10005026mg [Capsella rubella]
Length=385

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 138/195 (71%), Gaps = 2/195 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTL GT+FEIEVKP DTV++VKK+IETVQG+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSEVKKAIETVQGAQ-YPAAKQMLIHQGKVLKDETTLE  59

Query  254  ENKVAENNF-VVVMMaktksssgegsasstattktiapasstsastapapvpasapapvp  430
            EN V E +F V+++     SSSG  +AS+ A T T +   +  A T   P  ++    VP
Sbjct  60   ENNVVEKSFIVIMLSKTKVSSSGASTASAPAPTPTPSATQAQPAQTVATPQVSAPTVSVP  119

Query  431  asapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRA  610
                    A AP  A  +   DVYGQAASNL AG  LE  +QQILDMGGG+WDR+TVVRA
Sbjct  120  EPTSGTATAAAPAAAAASVQTDVYGQAASNLVAGTTLESTVQQILDMGGGSWDRDTVVRA  179

Query  611  LRAAYNNPERAVEYL  655
            LRAA+NNPERAVEYL
Sbjct  180  LRAAFNNPERAVEYL  194



>ref|XP_008650775.1| PREDICTED: uncharacterized protein LOC100191313 isoform X1 [Zea 
mays]
 gb|ACF84200.1| unknown [Zea mays]
 gb|ACG34516.1| DNA repair protein RAD23 [Zea mays]
 tpg|DAA61376.1| TPA: DNA repair protein RAD23 [Zea mays]
Length=386

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 125/194 (64%), Gaps = 0/194 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKG+ F IEV P D VADVKK IE++Q    YPA Q +LIHQGKVLKD TTLE
Sbjct  1    MKVSVKTLKGSSFHIEVDPTDKVADVKKVIESIQEQASYPADQQVLIHQGKVLKDDTTLE  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            EN+V ENNF+V+M+ + K SS    A  TA           +     A   A AP    +
Sbjct  61   ENQVVENNFLVIMLRQNKGSSSAAPAKVTANQAPSTQTVPATPPQTSAAPDAPAPIVPVS  120

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
            +      A A      +   D YGQA SNL AG+NLEG I+ IL+MGGGTWDR+TV+RAL
Sbjct  121  APAATATASAAPAVAVSTEADSYGQATSNLVAGSNLEGTIKSILEMGGGTWDRDTVLRAL  180

Query  614  RAAYNNPERAVEYL  655
            RAAYNNPERAVEYL
Sbjct  181  RAAYNNPERAVEYL  194



>ref|XP_004956778.1| PREDICTED: probable DNA repair protein RAD23-like isoform X2 
[Setaria italica]
Length=394

 Score =   178 bits (451),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 126/195 (65%), Gaps = 1/195 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKG+ F+IEV+  D VADVKK IE+ QG NVYPA Q MLIHQGKVL D TTLE
Sbjct  1    MKVSVKTLKGSSFQIEVEATDKVADVKKVIESTQGQNVYPADQQMLIHQGKVLNDETTLE  60

Query  254  ENKVAENNFVVV-MMaktksssgegsasstattktiapasstsastapapvpasapapvp  430
            EN+V ENNF+V+ +     SSS   + +S           +T A   P    A AP    
Sbjct  61   ENQVLENNFLVIMLRQNKASSSAPPAKASANQAPPTQTVPATPAPQTPVAPAAPAPTVPV  120

Query  431  asapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRA  610
            ++      A        +   D YGQAASNL AG NLEG IQ IL+MGGGTWDR+TV+RA
Sbjct  121  SAPAPTATASPAPAVAVSTEADSYGQAASNLVAGGNLEGTIQSILEMGGGTWDRDTVLRA  180

Query  611  LRAAYNNPERAVEYL  655
            L+AAYNNPERAVEYL
Sbjct  181  LQAAYNNPERAVEYL  195



>gb|KDO46130.1| hypothetical protein CISIN_1g0198171mg, partial [Citrus sinensis]
Length=260

 Score =   174 bits (440),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 129/194 (66%), Gaps = 3/194 (2%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            +NKV+E+ F+VVM+     S   GSA +++         +T+ S+   P   ++  P   
Sbjct  61   DNKVSEDGFLVVML---SKSKTLGSAGASSAQPAHTTPPTTAPSSNSTPPQEASVPPPAP  117

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
            +  +P +           + D YGQAASNL AGN+LE  IQQI+DMGGGTWD+ETV RAL
Sbjct  118  TPSIPASNVTSNVTAANANSDTYGQAASNLVAGNDLEQTIQQIMDMGGGTWDKETVTRAL  177

Query  614  RAAYNNPERAVEYL  655
            +AAYNNPERAV+YL
Sbjct  178  QAAYNNPERAVDYL  191



>gb|KDO46129.1| hypothetical protein CISIN_1g0198171mg [Citrus sinensis]
Length=274

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 129/194 (66%), Gaps = 3/194 (2%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            +NKV+E+ F+VVM+     S   GSA +++         +T+ S+   P   ++  P   
Sbjct  61   DNKVSEDGFLVVML---SKSKTLGSAGASSAQPAHTTPPTTAPSSNSTPPQEASVPPPAP  117

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
            +  +P +           + D YGQAASNL AGN+LE  IQQI+DMGGGTWD+ETV RAL
Sbjct  118  TPSIPASNVTSNVTAANANSDTYGQAASNLVAGNDLEQTIQQIMDMGGGTWDKETVTRAL  177

Query  614  RAAYNNPERAVEYL  655
            +AAYNNPERAV+YL
Sbjct  178  QAAYNNPERAVDYL  191



>ref|XP_004956777.1| PREDICTED: probable DNA repair protein RAD23-like isoform X1 
[Setaria italica]
Length=468

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 126/195 (65%), Gaps = 1/195 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKG+ F+IEV+  D VADVKK IE+ QG NVYPA Q MLIHQGKVL D TTLE
Sbjct  1    MKVSVKTLKGSSFQIEVEATDKVADVKKVIESTQGQNVYPADQQMLIHQGKVLNDETTLE  60

Query  254  ENKVAENNF-VVVMMaktksssgegsasstattktiapasstsastapapvpasapapvp  430
            EN+V ENNF V+++     SSS   + +S           +T A   P    A AP    
Sbjct  61   ENQVLENNFLVIMLRQNKASSSAPPAKASANQAPPTQTVPATPAPQTPVAPAAPAPTVPV  120

Query  431  asapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRA  610
            ++      A        +   D YGQAASNL AG NLEG IQ IL+MGGGTWDR+TV+RA
Sbjct  121  SAPAPTATASPAPAVAVSTEADSYGQAASNLVAGGNLEGTIQSILEMGGGTWDRDTVLRA  180

Query  611  LRAAYNNPERAVEYL  655
            L+AAYNNPERAVEYL
Sbjct  181  LQAAYNNPERAVEYL  195



>gb|KJB69953.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
Length=330

 Score =   174 bits (440),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 118/194 (61%), Gaps = 18/194 (9%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKG+HFEI V+P DT+  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLIVKTLKGSHFEIRVQPNDTIMAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            ENKV+E+ F+VVM+                         ST AS+A       +     +
Sbjct  61   ENKVSEDGFLVVML------------------SKSKSLGSTGASSAQPASSTPSTTVPAS  102

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
            +           PA  +   D Y QAASNL AGNNLE  IQQ++DMGGG WD+ETV RAL
Sbjct  103  APSSNSTPATGAPAQASQQTDTYSQAASNLVAGNNLEQTIQQLMDMGGGNWDKETVTRAL  162

Query  614  RAAYNNPERAVEYL  655
            RAAYNNPERAV+YL
Sbjct  163  RAAYNNPERAVDYL  176



>gb|KJB69954.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
Length=317

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 118/194 (61%), Gaps = 18/194 (9%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKG+HFEI V+P DT+  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLIVKTLKGSHFEIRVQPNDTIMAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            ENKV+E+ F+VVM+                         ST AS+A       +     +
Sbjct  61   ENKVSEDGFLVVML------------------SKSKSLGSTGASSAQPASSTPSTTVPAS  102

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
            +           PA  +   D Y QAASNL AGNNLE  IQQ++DMGGG WD+ETV RAL
Sbjct  103  APSSNSTPATGAPAQASQQTDTYSQAASNLVAGNNLEQTIQQLMDMGGGNWDKETVTRAL  162

Query  614  RAAYNNPERAVEYL  655
            RAAYNNPERAV+YL
Sbjct  163  RAAYNNPERAVDYL  176



>gb|KJB69952.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
 gb|KJB69955.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
Length=362

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 118/194 (61%), Gaps = 18/194 (9%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKG+HFEI V+P DT+  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLIVKTLKGSHFEIRVQPNDTIMAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            ENKV+E+ F+VVM+                         ST AS+A       +     +
Sbjct  61   ENKVSEDGFLVVML------------------SKSKSLGSTGASSAQPASSTPSTTVPAS  102

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
            +           PA  +   D Y QAASNL AGNNLE  IQQ++DMGGG WD+ETV RAL
Sbjct  103  APSSNSTPATGAPAQASQQTDTYSQAASNLVAGNNLEQTIQQLMDMGGGNWDKETVTRAL  162

Query  614  RAAYNNPERAVEYL  655
            RAAYNNPERAV+YL
Sbjct  163  RAAYNNPERAVDYL  176



>ref|XP_007135849.1| hypothetical protein PHAVU_010G163300g [Phaseolus vulgaris]
 gb|ESW07843.1| hypothetical protein PHAVU_010G163300g [Phaseolus vulgaris]
Length=371

 Score =   172 bits (437),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 123/194 (63%), Gaps = 8/194 (4%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLV  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            +NKV+E+ F+VVM+          S +S +        +ST AST        A  P   
Sbjct  61   DNKVSEDGFLVVML--------SKSKASGSAAAPSVQPASTPASTVSTSNTNPASDPPVQ  112

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
            +  V           T  S D YGQAASNL AG+NLE  IQQI+DMGGG WDR+TV RAL
Sbjct  113  TQAVNNITSTTDAPTTNVSADTYGQAASNLVAGSNLEQTIQQIMDMGGGNWDRDTVTRAL  172

Query  614  RAAYNNPERAVEYL  655
            RAAYNNPERA++YL
Sbjct  173  RAAYNNPERAIDYL  186



>gb|KHG09850.1| Putative DNA repair RAD23-1 -like protein [Gossypium arboreum]
Length=362

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/194 (49%), Positives = 118/194 (61%), Gaps = 18/194 (9%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ +KTLKG+HFEI V+P DTV  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLIIKTLKGSHFEIRVQPNDTVMAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            ENKV+E+ F+VVM+                         ST AS+A       +     +
Sbjct  61   ENKVSEDGFLVVML------------------SKSKSLGSTGASSAQPASSTPSTTVPAS  102

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
            +           PA  +   + Y QAASNL AGNNLE  IQQ++DMGGG WD+ETV RAL
Sbjct  103  APSSNSTPATGAPAQASQQTNTYSQAASNLVAGNNLEQTIQQLMDMGGGNWDKETVTRAL  162

Query  614  RAAYNNPERAVEYL  655
            RAAYNNPERAV+YL
Sbjct  163  RAAYNNPERAVDYL  176



>gb|ACU20959.1| unknown [Glycine max]
Length=363

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 121/194 (62%), Gaps = 8/194 (4%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLV  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            ENKV+E+ F+VVM+          S +S +   +    +S   +T           P   
Sbjct  61   ENKVSEDGFLVVML--------SKSKTSGSAAASSVQPASNPPTTVSTSNSTPPSDPPVQ  112

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
            +     +  +     T  S D YG AASNL AG+NLE  IQQI+DMGGG WDR+TV RAL
Sbjct  113  TQAANNSTSSTDAPTTNVSADTYGLAASNLVAGSNLEQTIQQIMDMGGGNWDRDTVSRAL  172

Query  614  RAAYNNPERAVEYL  655
            RAAYNNPERA++YL
Sbjct  173  RAAYNNPERAIDYL  186



>ref|NP_001240038.1| uncharacterized protein LOC100819019 [Glycine max]
 gb|ACU24437.1| unknown [Glycine max]
Length=363

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 121/194 (62%), Gaps = 8/194 (4%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLV  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            ENKV+E+ F+VVM+          S +S +   +    +S   +T           P   
Sbjct  61   ENKVSEDGFLVVML--------SKSKTSGSAAASSVQPASNPPTTVSTSNSTPPSDPPVQ  112

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
            +     +  +     T  S D YG AASNL AG+NLE  IQQI+DMGGG WDR+TV RAL
Sbjct  113  TQAANNSTSSTDAPTTNVSADTYGLAASNLVAGSNLEQTIQQIMDMGGGNWDRDTVSRAL  172

Query  614  RAAYNNPERAVEYL  655
            RAAYNNPERA++YL
Sbjct  173  RAAYNNPERAIDYL  186



>gb|KJB34920.1| hypothetical protein B456_006G091100 [Gossypium raimondii]
Length=373

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 128/194 (66%), Gaps = 7/194 (4%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPNDTVMAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            +NKV+E+ F+VVM+        +  +  +A T +  PASS  ++TAP   P  AP     
Sbjct  61   DNKVSEDGFLVVML-------SKSKSLGSAGTSSAQPASSAPSTTAPVSNPTPAPEVPAQ  113

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
            +        A   A      D Y QAASNL AG+NLE  IQQ++DMGGG+WD+ETV RAL
Sbjct  114  APDSKSGTSASDAATANPDTDTYSQAASNLVAGSNLEQTIQQLMDMGGGSWDKETVTRAL  173

Query  614  RAAYNNPERAVEYL  655
            RAAYNNPERAV+YL
Sbjct  174  RAAYNNPERAVDYL  187



>ref|XP_008462953.1| PREDICTED: ubiquitin receptor RAD23b isoform X1 [Cucumis melo]
Length=387

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 132/198 (67%), Gaps = 4/198 (2%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKG+HFEI V+  DTV  VKK+IE VQG + YP  Q +LIH GKVLKD +TL 
Sbjct  1    MKLTVKTLKGSHFEIRVQLTDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDESTLA  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            ENKV+E  F+VVM++K+K+S+  G +S+             S++ A    P+  PAP   
Sbjct  61   ENKVSEEGFLVVMLSKSKTSASAGQSSTQPAQNPPVAQPVLSSTPAAQVTPSPTPAPQAP  120

Query  434  sapvpvaapaptpaptagsgDV----YGQAASNLAAGNNLEGAIQQILDMGGGTWDRETV  601
            +     A    T      + +V    YGQAASNL AGNNLE  +QQ++DMGGGTWDRETV
Sbjct  121  TQAPSSALKNTTSTSDRVTDNVQTDTYGQAASNLVAGNNLEQTVQQLMDMGGGTWDRETV  180

Query  602  VRALRAAYNNPERAVEYL  655
            VRALRAAYNNPERAV+YL
Sbjct  181  VRALRAAYNNPERAVDYL  198



>ref|XP_003529480.1| PREDICTED: ubiquitin receptor RAD23b-like isoform 1 [Glycine 
max]
 gb|KHN39368.1| Putative DNA repair protein RAD23-1 [Glycine soja]
Length=363

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 122/194 (63%), Gaps = 8/194 (4%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLV  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            ENKV+E+ F+VVM+          S +S +   +    +S  A+T           P   
Sbjct  61   ENKVSEDGFLVVML--------SKSKTSGSAAASSVQPASNPATTVSMSNSTPPSDPPVQ  112

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
            +     +  +     T  S D YG AASNL AG+NLE  IQQI+DMGGG WDR+TV RAL
Sbjct  113  TQAANNSTSSTDAPTTNVSADTYGLAASNLVAGSNLEQTIQQIMDMGGGNWDRDTVSRAL  172

Query  614  RAAYNNPERAVEYL  655
            RAAYNNPERA++YL
Sbjct  173  RAAYNNPERAIDYL  186



>gb|KHG13236.1| Putative DNA repair RAD23-1 -like protein [Gossypium arboreum]
Length=373

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 129/194 (66%), Gaps = 7/194 (4%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPNDTVMAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            +NKV+E+ F+VVM+        +  +  +A T +  PASS  ++TAP   P  AP     
Sbjct  61   DNKVSEDGFLVVML-------SKSKSLGSAGTSSAQPASSAPSTTAPVSNPTPAPEIPAQ  113

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
            +        A   A    + D Y QAASNL AG+NLE  IQQ++DMGGG+WD+ETV RAL
Sbjct  114  APDSKSGTSASDAATANPNTDTYSQAASNLVAGSNLEQTIQQLMDMGGGSWDKETVTRAL  173

Query  614  RAAYNNPERAVEYL  655
            RAAYNNPERAV+YL
Sbjct  174  RAAYNNPERAVDYL  187



>ref|XP_010435749.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Camelina 
sativa]
Length=376

 Score =   169 bits (429),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 125/194 (64%), Gaps = 6/194 (3%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTL GT+FEIEVKP DTV+DVK++IETVQG+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSDVKQAIETVQGAQ-YPAAKQMLIHQGKVLKDETTLE  59

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
                 ENN V         S  + S S  +T    AP  S + S        SAP     
Sbjct  60   -----ENNVVENSFIVIMLSKTKPSPSGASTASAPAPTPSATQSQPAPTPQVSAPTVSVP  114

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
                  A  A   A  +   DVYGQAASNL AG  LE  +QQILDMGGG+WDR+TVVRAL
Sbjct  115  EPTSVTATAAAPAAAASVQTDVYGQAASNLVAGTVLESTVQQILDMGGGSWDRDTVVRAL  174

Query  614  RAAYNNPERAVEYL  655
            RAA+NNPERAVEYL
Sbjct  175  RAAFNNPERAVEYL  188



>ref|NP_001149553.1| LOC100283179 [Zea mays]
 gb|ACF84553.1| unknown [Zea mays]
 gb|ACG35819.1| DNA repair protein RAD23 [Zea mays]
 tpg|DAA40041.1| TPA: DNA repair protein RAD23 [Zea mays]
Length=390

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 123/194 (63%), Gaps = 0/194 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKG+ F+IEV+P D VA VKK IE +Q    YPA Q +LIHQGKVL D TTLE
Sbjct  1    MKVSVKTLKGSSFQIEVEPTDKVAAVKKVIENMQEQASYPADQQVLIHQGKVLSDDTTLE  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            EN+V ENNF+V+M+ + K SS    A +TA                 A   A AP    +
Sbjct  61   ENQVTENNFLVIMLRQNKGSSSAAPAKTTANQAPPTQTVPVVPPQTSAAPAAPAPIVPVS  120

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
            +      A A      +   D YGQAASNL AG+NLEG IQ IL+MGGG WDR+TV+RAL
Sbjct  121  ALAATATASAAPAVAVSTEADSYGQAASNLVAGSNLEGTIQSILEMGGGIWDRDTVLRAL  180

Query  614  RAAYNNPERAVEYL  655
            R AYNNPERAVEYL
Sbjct  181  RVAYNNPERAVEYL  194



>ref|XP_009365249.1| PREDICTED: ubiquitin receptor RAD23b-like [Pyrus x bretschneideri]
Length=374

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/194 (49%), Positives = 119/194 (61%), Gaps = 9/194 (5%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKG+HFEI V+P D V  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPTDAVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            +NKV E+ F+VVM+           + ++    + +   +++  +   P   S       
Sbjct  61   DNKVTEDGFLVVML---------SKSKTSGLAGSSSGQLASTNPSTIPPTTDSTTRTEAP  111

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
                P+ +    P   +   D YGQAAS L AG NLE  IQQI+DMGGG WDRETV RAL
Sbjct  112  IQAPPLQSTTSAPDTASAHSDTYGQAASTLVAGTNLEQTIQQIMDMGGGNWDRETVTRAL  171

Query  614  RAAYNNPERAVEYL  655
            RAAYNNPERAV+YL
Sbjct  172  RAAYNNPERAVDYL  185



>gb|EMT27109.1| Putative DNA repair protein RAD23 [Aegilops tauschii]
Length=423

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 105/200 (53%), Positives = 133/200 (67%), Gaps = 6/200 (3%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKGT FEIE  PE +V +VK+ IE+ QG NVYPA QLM+I+QGK+LKD TTLE
Sbjct  1    MKLNVKTLKGTSFEIEATPESSVGEVKRIIESAQGQNVYPADQLMIIYQGKILKDDTTLE  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
             NKVAEN+F+V+M++K K+SS   S +S A      PA+  +   + A  P S      +
Sbjct  61   ANKVAENSFLVIMLSKPKASSSGASTASKAPASQSQPATPPAPVASAARSPPSQAPVAAS  120

Query  434  sapvpvaapaptpaptagsgDVYG------QAASNLAAGNNLEGAIQQILDMGGGTWDRE  595
                P A P+      A +    G      QAASNL +G +LE  +QQILDMGGGTW+R+
Sbjct  121  EPAPPSAQPSAVSDTPAPAVTASGDADVYSQAASNLVSGGSLEQTVQQILDMGGGTWERD  180

Query  596  TVVRALRAAYNNPERAVEYL  655
             VVRALRAAYNNPERA++YL
Sbjct  181  MVVRALRAAYNNPERAIDYL  200



>gb|ACH72675.1| RAD23 [Pinus sylvestris var. mongolica]
Length=390

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 126/195 (65%), Gaps = 1/195 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKG  FEIE +P DTV  VKK IE +QG + YP  Q +LIHQGKVLKD TT+E
Sbjct  1    MKLSVKTLKGNRFEIEAQPNDTVMAVKKQIEEIQGKDTYPCGQQLLIHQGKVLKDDTTIE  60

Query  254  ENKVAENNF-VVVMMaktksssgegsasstattktiapasstsastapapvpasapapvp  430
            +N + EN F VV++     SS+   S++STA+T      S+  A  +     AS      
Sbjct  61   DNTITENGFLVVMLTKSKTSSAVGASSTSTASTVQPTQTSTPPAPASNPVEVASPVVSQL  120

Query  431  asapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRA  610
             +     +  AP       + D YG+AAS L AG+NLE  IQQ+LDMGGG+WDR+TVVRA
Sbjct  121  PAVAPAASVSAPETTAVQANADPYGEAASILVAGSNLEQTIQQMLDMGGGSWDRDTVVRA  180

Query  611  LRAAYNNPERAVEYL  655
            LRAAYNNPERAVEYL
Sbjct  181  LRAAYNNPERAVEYL  195



>ref|NP_001063134.1| Os09g0407200 [Oryza sativa Japonica Group]
 sp|Q40742.2|RAD23_ORYSJ RecName: Full=Probable ubiquitin receptor RAD23; Short=OsRAD23; 
AltName: Full=Probable DNA repair protein RAD23 [Oryza sativa 
Japonica Group]
 dbj|BAD36240.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAD36295.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAF25048.1| Os09g0407200 [Oryza sativa Japonica Group]
 gb|EAZ09053.1| hypothetical protein OsI_31314 [Oryza sativa Indica Group]
 gb|EAZ44680.1| hypothetical protein OsJ_29306 [Oryza sativa Japonica Group]
Length=392

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 122/196 (62%), Gaps = 2/196 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKI VKTLKG+ F+IEV     VADVK+ IET QG ++YPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKISVKTLKGSTFQIEVDSAQKVADVKRIIETTQGQHIYPAEQQMLIHQGKVLKDDTTLD  60

Query  254  ENKVAENNFVVVMMak--tksssgegsasstattktiapasstsastapapvpasapapv  427
            ENKV EN+F+V+M+ +    SSS   ++ + +           + ++     PA+     
Sbjct  61   ENKVLENSFLVIMLRQGKGSSSSAPATSKAPSNQAPPTQTVPAAPASQAPVAPATTVPVT  120

Query  428  pasapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVR  607
             ++      A        +   D YGQA SNL AG+NLE  IQ IL+MGGG WDR+ V+ 
Sbjct  121  VSAPTPTATASPAPAVAVSSEADNYGQATSNLVAGSNLEATIQSILEMGGGIWDRDIVLH  180

Query  608  ALRAAYNNPERAVEYL  655
            AL AA+NNPERAVEYL
Sbjct  181  ALSAAFNNPERAVEYL  196



>gb|AAB65841.1| osRAD23 [Oryza sativa Japonica Group]
Length=392

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 122/196 (62%), Gaps = 2/196 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKI VKTLKG+ F+IEV     VADVK+ IET QG ++YPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKISVKTLKGSTFQIEVDSAQKVADVKRIIETTQGQHIYPAEQQMLIHQGKVLKDDTTLD  60

Query  254  ENKVAENNFVVVMMak--tksssgegsasstattktiapasstsastapapvpasapapv  427
            ENKV EN+F+V+M+ +    SSS   ++ + +           + ++     PA+     
Sbjct  61   ENKVLENSFLVIMLRQGKGSSSSAPATSKAPSNQAPPTQTVPAAPASQAPVAPATTVPVT  120

Query  428  pasapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVR  607
             ++      A        +   D YGQA SNL AG+NLE  IQ IL+MGGG WDR+ V+ 
Sbjct  121  VSAPTPTATASPAPAVAVSSEADNYGQATSNLVAGSNLEATIQSILEMGGGIWDRDIVLH  180

Query  608  ALRAAYNNPERAVEYL  655
            AL AA+NNPERAVEYL
Sbjct  181  ALSAAFNNPERAVEYL  196



>gb|ABK24371.1| unknown [Picea sitchensis]
Length=390

 Score =   164 bits (416),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 128/195 (66%), Gaps = 1/195 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKG  FEI+ +P DTV  VKK IE +QG + YP  Q +LIHQGKVLKD TT+E
Sbjct  1    MKLSVKTLKGNRFEIDAQPNDTVMAVKKQIEEIQGKDTYPCGQQLLIHQGKVLKDDTTIE  60

Query  254  ENKVAENNF-VVVMMaktksssgegsasstattktiapasstsastapapvpasapapvp  430
            +N++ EN F VV++     SS+   S++S+A+T      S+  A  +     AS     P
Sbjct  61   DNQITENGFLVVMLTKTKTSSAAGASSTSSASTIQHTQTSTPLAPASNPVEAASPVVSQP  120

Query  431  asapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRA  610
             +     +  AP       + D YG+AAS L AG+NLE  IQQ+LDMGGG+WDR+TVVRA
Sbjct  121  PAVAPATSVSAPETTAVQANADPYGEAASILVAGSNLEQTIQQMLDMGGGSWDRDTVVRA  180

Query  611  LRAAYNNPERAVEYL  655
            LRAAYNNPERAVEYL
Sbjct  181  LRAAYNNPERAVEYL  195



>ref|XP_010532056.1| PREDICTED: ubiquitin receptor RAD23b [Tarenaya hassleriana]
Length=360

 Score =   164 bits (414),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 119/194 (61%), Gaps = 14/194 (7%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKG HFEI V+P DT+  VKK+IE  QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGRHFEIRVQPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            ENKV E  F+VVM+              + +    +  +S++     A     A  P   
Sbjct  61   ENKVTEEGFLVVML--------------SKSKTAGSAGTSSAQPAYTASSTKPAAPPASQ  106

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
               VP   P P    TA   D YGQAAS L +G+NLE  +QQI++MGGG+WD+ETV RAL
Sbjct  107  PTSVPALNPTPAQEQTAAPTDTYGQAASTLVSGSNLEQMVQQIMEMGGGSWDKETVTRAL  166

Query  614  RAAYNNPERAVEYL  655
            RAAYNNPERAV+YL
Sbjct  167  RAAYNNPERAVDYL  180



>gb|KJB67005.1| hypothetical protein B456_010G170000 [Gossypium raimondii]
Length=371

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 125/194 (64%), Gaps = 7/194 (4%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKG+HF+I V P DTV  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFQITVNPNDTVMAVKKNIEGIQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            +NKV+E++F+VVM+        +  +  +A   +  PASST ++ AP   P   P     
Sbjct  61   DNKVSEDSFLVVML-------SKSKSLGSAGASSAQPASSTPSTIAPVSNPTPTPEAPTQ  113

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
            +        A   A    + + Y QAASNL AG+NLE  IQQ++DMGGG WD+ETV  AL
Sbjct  114  APASMGTTSASDAATANPNTNTYSQAASNLVAGSNLEQTIQQLMDMGGGNWDKETVTHAL  173

Query  614  RAAYNNPERAVEYL  655
            RAAYNNPERAV+YL
Sbjct  174  RAAYNNPERAVDYL  187



>ref|XP_002889262.1| hypothetical protein ARALYDRAFT_316857 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65521.1| hypothetical protein ARALYDRAFT_316857 [Arabidopsis lyrata subsp. 
lyrata]
Length=365

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/194 (47%), Positives = 115/194 (59%), Gaps = 14/194 (7%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKG+HFEI V P DT+  VKK+IE  QG N YP  Q +LIH GKVLKD T+L 
Sbjct  1    MKLTVKTLKGSHFEIRVLPSDTIMAVKKNIEDSQGKNNYPCGQQLLIHNGKVLKDETSLV  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            ENKV E  F+VVM+              + +    +   S+    +          P   
Sbjct  61   ENKVTEEGFLVVML--------------SKSKTAGSAGQSSVQPASATTSSTKPETPSTT  106

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
             +    A+P       A   D YGQAAS L +G++LE  +QQI++MGGG+WD+ETV RAL
Sbjct  107  QSIAVPASPITAQEQPAAQTDTYGQAASTLVSGSSLEQMVQQIMEMGGGSWDKETVTRAL  166

Query  614  RAAYNNPERAVEYL  655
            RAAYNNPERAV+YL
Sbjct  167  RAAYNNPERAVDYL  180



>ref|NP_974181.1| ubiquitin receptor RAD23b [Arabidopsis thaliana]
 gb|AEE36280.1| putative DNA repair protein RAD23-1 [Arabidopsis thaliana]
Length=351

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 96/194 (49%), Positives = 119/194 (61%), Gaps = 8/194 (4%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKG+HFEI V P DT+  VKK+IE  QG + YP  Q +LIH GKVLKD T+L 
Sbjct  1    MKLTVKTLKGSHFEIRVLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLV  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            ENKV E  F+VVM+          S S  +  +     SS S   +         AP   
Sbjct  61   ENKVTEEGFLVVML--------SKSKSGGSAGQASVQTSSVSQPVSATTSSTKPAAPSTT  112

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
             +    A+P P     A   D YGQAAS L +G++LE  +QQI++MGGG+WD+ETV RAL
Sbjct  113  QSSPVPASPIPAQEQPAAQTDTYGQAASTLVSGSSLEQMVQQIMEMGGGSWDKETVTRAL  172

Query  614  RAAYNNPERAVEYL  655
            RAAYNNPERAV+YL
Sbjct  173  RAAYNNPERAVDYL  186



>ref|NP_850982.1| ubiquitin receptor RAD23b [Arabidopsis thaliana]
 sp|Q84L33.3|RD23B_ARATH RecName: Full=Ubiquitin receptor RAD23b; Short=AtRAD23b; AltName: 
Full=Putative DNA repair protein RAD23-1; AltName: Full=RAD23-like 
protein 1; Short=AtRAD23-1 [Arabidopsis thaliana]
 gb|AAM65583.1| DNA repair protein RAD23, putative [Arabidopsis thaliana]
 gb|ABG89118.1| Rad23-3Aii [synthetic construct]
 gb|AEE36281.1| putative DNA repair protein RAD23-1 [Arabidopsis thaliana]
Length=371

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 96/194 (49%), Positives = 119/194 (61%), Gaps = 8/194 (4%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKG+HFEI V P DT+  VKK+IE  QG + YP  Q +LIH GKVLKD T+L 
Sbjct  1    MKLTVKTLKGSHFEIRVLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLV  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            ENKV E  F+VVM+          S S  +  +     SS S   +         AP   
Sbjct  61   ENKVTEEGFLVVML--------SKSKSGGSAGQASVQTSSVSQPVSATTSSTKPAAPSTT  112

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
             +    A+P P     A   D YGQAAS L +G++LE  +QQI++MGGG+WD+ETV RAL
Sbjct  113  QSSPVPASPIPAQEQPAAQTDTYGQAASTLVSGSSLEQMVQQIMEMGGGSWDKETVTRAL  172

Query  614  RAAYNNPERAVEYL  655
            RAAYNNPERAV+YL
Sbjct  173  RAAYNNPERAVDYL  186



>dbj|BAC76389.1| RAD23-like protein [Arabidopsis thaliana]
Length=371

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 96/194 (49%), Positives = 119/194 (61%), Gaps = 8/194 (4%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKG+HFEI V P DT+  VKK+IE  QG + YP  Q +LIH GKVLKD T+L 
Sbjct  1    MKLTVKTLKGSHFEIRVLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLV  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            ENKV E  F+VVM+          S S  +  +     SS S   +         AP   
Sbjct  61   ENKVTEEGFLVVML--------SKSKSGGSAGQASVQTSSVSQPVSATTSSTKPAAPSTT  112

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
             +    A+P P     A   D YGQAAS L +G++LE  +QQI++MGGG+WD+ETV RAL
Sbjct  113  QSSPVPASPIPAQEQPAAQTDTYGQAASTLVSGSSLEQMVQQIMEMGGGSWDKETVTRAL  172

Query  614  RAAYNNPERAVEYL  655
            RAAYNNPERAV+YL
Sbjct  173  RAAYNNPERAVDYL  186



>ref|NP_565216.2| ubiquitin receptor RAD23b [Arabidopsis thaliana]
 gb|AAK59419.1| putative DNA repair protein RAD23 [Arabidopsis thaliana]
 gb|AAL34277.1| putative DNA repair protein RAD23 [Arabidopsis thaliana]
 gb|AEE36279.1| putative DNA repair protein RAD23-1 [Arabidopsis thaliana]
Length=365

 Score =   159 bits (402),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 91/194 (47%), Positives = 117/194 (60%), Gaps = 14/194 (7%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKG+HFEI V P DT+  VKK+IE  QG + YP  Q +LIH GKVLKD T+L 
Sbjct  1    MKLTVKTLKGSHFEIRVLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLV  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            ENKV E  F+VVM+              + +    +   ++    +         AP   
Sbjct  61   ENKVTEEGFLVVML--------------SKSKSGGSAGQASVQPVSATTSSTKPAAPSTT  106

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
             +    A+P P     A   D YGQAAS L +G++LE  +QQI++MGGG+WD+ETV RAL
Sbjct  107  QSSPVPASPIPAQEQPAAQTDTYGQAASTLVSGSSLEQMVQQIMEMGGGSWDKETVTRAL  166

Query  614  RAAYNNPERAVEYL  655
            RAAYNNPERAV+YL
Sbjct  167  RAAYNNPERAVDYL  180



>dbj|BAC76390.1| RAD23-like protein [Arabidopsis thaliana]
Length=365

 Score =   159 bits (402),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 91/194 (47%), Positives = 117/194 (60%), Gaps = 14/194 (7%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKG+HFEI V P DT+  VKK+IE  QG + YP  Q +LIH GKVLKD T+L 
Sbjct  1    MKLTVKTLKGSHFEIRVLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLV  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            ENKV E  F+VVM+              + +    +   ++    +         AP   
Sbjct  61   ENKVTEEGFLVVML--------------SKSKSGGSAGQASVQPVSATTSSTKPAAPSTT  106

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
             +    A+P P     A   D YGQAAS L +G++LE  +QQI++MGGG+WD+ETV RAL
Sbjct  107  QSSPVPASPIPAQEQPAAQTDTYGQAASTLVSGSSLEQMVQQIMEMGGGSWDKETVTRAL  166

Query  614  RAAYNNPERAVEYL  655
            RAAYNNPERAV+YL
Sbjct  167  RAAYNNPERAVDYL  180



>gb|ABG89119.1| Rad23-3Ai [synthetic construct]
Length=365

 Score =   159 bits (402),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 91/194 (47%), Positives = 118/194 (61%), Gaps = 14/194 (7%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKG+HFEI V P DT+  VKK+IE  QG + YP  Q +LIH GKVLKD T+L 
Sbjct  1    MKLTVKTLKGSHFEIRVLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLV  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            ENKV E  F+VVM+              + +    +   ++    +      +  AP   
Sbjct  61   ENKVTEEGFLVVML--------------SKSKSGGSAGQASVQPVSATTSSTNPAAPSTT  106

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
             +    A+P P     A   D YGQAAS L +G++LE  +QQI++MGGG+WD+ETV RAL
Sbjct  107  QSSPVPASPIPAQEQPAAQTDTYGQAASTLVSGSSLEQMVQQIMEMGGGSWDKETVTRAL  166

Query  614  RAAYNNPERAVEYL  655
            RAAYNNPERAV+YL
Sbjct  167  RAAYNNPERAVDYL  180



>gb|KHN38092.1| Putative DNA repair protein RAD23-1 [Glycine soja]
Length=446

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 127/206 (62%), Gaps = 20/206 (10%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDT------------VADVKKSIETVQGSNVYPASQLMLIH  217
            MK+ VKTLKG+HFEI V+P DT            V  VKK+IE VQG + YP  Q +LIH
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTLEWEESVTRLYVVMAVKKNIEDVQGKDNYPCGQQLLIH  60

Query  218  QGKVLKDGTTLEENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapa  397
             GKVLKD TTL ENKV+E+ F+VVM++K+K+S    ++S    +      S+++++    
Sbjct  61   NGKVLKDETTLVENKVSEDGFLVVMLSKSKTSGSAAASSVQPASNPPTTVSTSNSTPPSD  120

Query  398  pvpasapapvpasapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGG  577
            P   +  A    S+                  D YG AASNL AG+NLE  IQQI+DMGG
Sbjct  121  PPVQTQAANNSTSSTDAPTTNVSA--------DTYGLAASNLVAGSNLEQTIQQIMDMGG  172

Query  578  GTWDRETVVRALRAAYNNPERAVEYL  655
            G WDR+TV RALRAAYNNPERA++YL
Sbjct  173  GNWDRDTVSRALRAAYNNPERAIDYL  198



>ref|XP_010429866.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Camelina 
sativa]
Length=370

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 120/194 (62%), Gaps = 9/194 (5%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKG HFEI V P DT+  VKK+IE  QG + YP  Q +LIH GKVLKD T+L 
Sbjct  1    MKLTVKTLKGNHFEIRVLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLV  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            ENKV E  F+VVM+           + +  +    +   +++A +  +     A      
Sbjct  61   ENKVTEEGFLVVML---------SKSKTAGSAGQSSAQPASAAMSTTSLAKQPAAPTTSQ  111

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
            S  VP +       P A + D YGQAAS L +G++LE  +QQI++MGGG+WD+ETV RAL
Sbjct  112  STAVPPSLIPAQEQPGAPTDDTYGQAASTLVSGSSLEQMVQQIMEMGGGSWDKETVTRAL  171

Query  614  RAAYNNPERAVEYL  655
            RAAYNNPERAV+YL
Sbjct  172  RAAYNNPERAVDYL  185



>ref|XP_010429867.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X2 [Camelina 
sativa]
Length=369

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 122/194 (63%), Gaps = 10/194 (5%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKG HFEI V P DT+  VKK+IE  QG + YP  Q +LIH GKVLKD T+L 
Sbjct  1    MKLTVKTLKGNHFEIRVLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLV  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            ENKV E  F+VVM+          S S TA +   + A   SA+ +   +   A      
Sbjct  61   ENKVTEEGFLVVML----------SKSKTAGSAGQSSAQPASAAMSTTSLAKPAAPTTSQ  110

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
            S  VP +       P A + D YGQAAS L +G++LE  +QQI++MGGG+WD+ETV RAL
Sbjct  111  STAVPPSLIPAQEQPGAPTDDTYGQAASTLVSGSSLEQMVQQIMEMGGGSWDKETVTRAL  170

Query  614  RAAYNNPERAVEYL  655
            RAAYNNPERAV+YL
Sbjct  171  RAAYNNPERAVDYL  184



>ref|XP_009117771.1| PREDICTED: probable ubiquitin receptor RAD23a [Brassica rapa]
 emb|CDY52848.1| BnaA09g56400D [Brassica napus]
Length=359

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 95/194 (49%), Positives = 117/194 (60%), Gaps = 13/194 (7%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKG+HFEI V P DT+  VKK+IE  Q  + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVLPTDTIMAVKKNIEDSQSKDNYPCGQQLLIHNGKVLKDETTLV  60

Query  254  ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  433
            ENKV E  F+VVM+             S + T + A  SS   ++        A A    
Sbjct  61   ENKVTEEGFLVVML-------------SKSKTASSAGPSSAQPTSTTTSSAMPAAASTTH  107

Query  434  sapvpvaapaptpaptagsgDVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRAL  613
            S PVP +         A   D   QAAS LA+G++ E  +QQI++MGGG+WD+ETV RAL
Sbjct  108  SIPVPASVSTLAQEQPAAPSDTNAQAASTLASGSSTEQMVQQIMEMGGGSWDKETVARAL  167

Query  614  RAAYNNPERAVEYL  655
            RAAYNNPERAV+YL
Sbjct  168  RAAYNNPERAVDYL  181



>ref|XP_008462954.1| PREDICTED: ubiquitin receptor RAD23b isoform X2 [Cucumis melo]
Length=364

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 112/173 (65%), Gaps = 4/173 (2%)
 Frame = +2

Query  149  VKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLEENKVAENNFVVVMMaktksssgegs  328
            VKK+IE VQG + YP  Q +LIH GKVLKD +TL ENKV+E  F+VVM++K+K+S+  G 
Sbjct  3    VKKNIEDVQGKDNYPCGQQLLIHNGKVLKDESTLAENKVSEEGFLVVMLSKSKTSASAGQ  62

Query  329  asstattktiapasstsastapapvpasapapvpasapvpvaapaptpaptags----gD  496
            +S+             S++ A    P+  PAP   +     A    T      +     D
Sbjct  63   SSTQPAQNPPVAQPVLSSTPAAQVTPSPTPAPQAPTQAPSSALKNTTSTSDRVTDNVQTD  122

Query  497  VYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
             YGQAASNL AGNNLE  +QQ++DMGGGTWDRETVVRALRAAYNNPERAV+YL
Sbjct  123  TYGQAASNLVAGNNLEQTVQQLMDMGGGTWDRETVVRALRAAYNNPERAVDYL  175



>ref|XP_009791274.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Nicotiana 
sylvestris]
Length=395

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQMLIHQGKVLKDGTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAENNF+V+M+
Sbjct  61   ENKVAENNFIVIML  74


 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAAS+L AGNNL+GAIQQILDMGGG WDR+TVVRALRAA+NNPERAVEYL
Sbjct  148  DVYGQAASSLVAGNNLDGAIQQILDMGGGMWDRDTVVRALRAAFNNPERAVEYL  201



>ref|XP_009631150.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
tomentosiformis]
Length=395

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQMLIHQGKVLKDGTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAENNF+V+M+
Sbjct  61   ENKVAENNFIVIML  74


 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAAS+L AGNNL+GAIQQILDMGGG WDR+TVVRALRAA+NNPERAVEYL
Sbjct  149  DVYGQAASSLVAGNNLDGAIQQILDMGGGMWDRDTVVRALRAAFNNPERAVEYL  202



>ref|XP_009631151.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
tomentosiformis]
Length=377

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQMLIHQGKVLKDGTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAENNF+V+M+
Sbjct  61   ENKVAENNFIVIML  74


 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAAS+L AGNNL+GAIQQILDMGGG WDR+TVVRALRAA+NNPERAVEYL
Sbjct  131  DVYGQAASSLVAGNNLDGAIQQILDMGGGMWDRDTVVRALRAAFNNPERAVEYL  184



>ref|XP_009791275.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
sylvestris]
Length=377

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQMLIHQGKVLKDGTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAENNF+V+M+
Sbjct  61   ENKVAENNFIVIML  74


 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAAS+L AGNNL+GAIQQILDMGGG WDR+TVVRALRAA+NNPERAVEYL
Sbjct  130  DVYGQAASSLVAGNNLDGAIQQILDMGGGMWDRDTVVRALRAAFNNPERAVEYL  183



>ref|XP_009597821.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
tomentosiformis]
Length=148

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IE+VQG + YPA+Q MLIHQGKVLKD  TLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIESVQGQDFYPAAQQMLIHQGKVLKDTATLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74



>ref|XP_004233496.1| PREDICTED: ubiquitin receptor RAD23c isoform X3 [Solanum lycopersicum]
Length=365

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGQDVYPAAQQMLIHQGKVLKDPTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74


 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG+ LE  +QQILDMGGG+W+R+TVVRALRAAYNNPERA+EYL
Sbjct  130  DVYGQAASNLVAGSTLETTVQQILDMGGGSWERDTVVRALRAAYNNPERAIEYL  183



>ref|XP_004233495.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Solanum lycopersicum]
Length=383

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGQDVYPAAQQMLIHQGKVLKDPTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74


 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG+ LE  +QQILDMGGG+W+R+TVVRALRAAYNNPERA+EYL
Sbjct  148  DVYGQAASNLVAGSTLETTVQQILDMGGGSWERDTVVRALRAAYNNPERAIEYL  201



>ref|XP_010317192.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Solanum lycopersicum]
Length=381

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGQDVYPAAQQMLIHQGKVLKDPTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74


 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG+ LE  +QQILDMGGG+W+R+TVVRALRAAYNNPERA+EYL
Sbjct  146  DVYGQAASNLVAGSTLETTVQQILDMGGGSWERDTVVRALRAAYNNPERAIEYL  199



>ref|XP_004236965.1| PREDICTED: ubiquitin receptor RAD23c [Solanum lycopersicum]
Length=409

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAAQQMLIHQGKVLKDGTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAE+NF+V+M+
Sbjct  61   ENKVAESNFIVIML  74


 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAAS+L AGNNL+GAIQQILDMGGGTWDRETVVRALRAA+NNPERAVEYL
Sbjct  162  DVYGQAASSLVAGNNLDGAIQQILDMGGGTWDRETVVRALRAAFNNPERAVEYL  215



>ref|XP_006367045.1| PREDICTED: ubiquitin receptor RAD23c-like [Solanum tuberosum]
Length=398

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAAQQMLIHQGKVLKDGTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAE+NF+V+M+
Sbjct  61   ENKVAESNFIVIML  74


 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAAS+L AGNNL+GAIQQILDMGGGTWDRETVVRALRAA+NNPERAVEYL
Sbjct  151  DVYGQAASSLVAGNNLDGAIQQILDMGGGTWDRETVVRALRAAFNNPERAVEYL  204



>gb|KDO58999.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=308

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYL
Sbjct  157  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYL  210



>emb|CDP19777.1| unnamed protein product [Coffea canephora]
Length=390

 Score =   138 bits (347),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHFEIEVKPEDTV DVKKSIET QG+ VYPASQ MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDTVTDVKKSIETAQGAEVYPASQQMLIHQGKVLKDGTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKV EN+F+V+M+
Sbjct  61   ENKVVENSFIVIML  74


 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/54 (94%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAAS L AGNNLEGAIQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYL
Sbjct  144  DVYGQAASTLVAGNNLEGAIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYL  197



>ref|XP_010498530.1| PREDICTED: ubiquitin receptor RAD23c-like [Camelina sativa]
Length=420

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG++VYPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIHQGKVLKDETTIE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNLAAG+NL+  IQQILDMGGGTWDR+TVV ALRAA+NNPERAVEYL
Sbjct  173  DVYGQAASNLAAGSNLDSTIQQILDMGGGTWDRDTVVHALRAAFNNPERAVEYL  226



>ref|XP_010463666.1| PREDICTED: ubiquitin receptor RAD23c [Camelina sativa]
Length=422

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG++VYPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIHQGKVLKDETTIE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNLAAG+NL+  IQQILDMGGGTWDR+TVVRAL AA+NNPERAVEYL
Sbjct  176  DVYGQAASNLAAGSNLDSTIQQILDMGGGTWDRDTVVRALHAAFNNPERAVEYL  229



>gb|KDO59000.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=364

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYL
Sbjct  157  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYL  210



>ref|XP_010647738.1| PREDICTED: ubiquitin receptor RAD23c isoform X1 [Vitis vinifera]
Length=398

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEI+VKPEDTVADVK +IE VQGS+VYPASQ MLIHQGKVLKDGTTL+
Sbjct  1    MKIFVKTLKGTHFEIQVKPEDTVADVKANIEAVQGSDVYPASQQMLIHQGKVLKDGTTLD  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D YGQAASNL AGNN E AIQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYL
Sbjct  155  DAYGQAASNLVAGNNFEEAIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYL  208



>ref|XP_002282352.1| PREDICTED: ubiquitin receptor RAD23c isoform X2 [Vitis vinifera]
 emb|CBI27030.3| unnamed protein product [Vitis vinifera]
Length=397

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEI+VKPEDTVADVK +IE VQGS+VYPASQ MLIHQGKVLKDGTTL+
Sbjct  1    MKIFVKTLKGTHFEIQVKPEDTVADVKANIEAVQGSDVYPASQQMLIHQGKVLKDGTTLD  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D YGQAASNL AGNN E AIQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYL
Sbjct  154  DAYGQAASNLVAGNNFEEAIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYL  207



>emb|CDX74251.1| BnaA03g27960D [Brassica napus]
Length=401

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG++VYPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIHQGKVLKDETTIE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNLAAG+NLE  I QILDMGGG WDR+TVVRALRAA+NNPERAVEYL
Sbjct  157  DVYGQAASNLAAGSNLESTILQILDMGGGAWDRDTVVRALRAAFNNPERAVEYL  210



>gb|ACJ83348.1| unknown [Medicago truncatula]
Length=159

 Score =   131 bits (330),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHFEIEV P+DT++ VKK+IETVQG +VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTISAVKKNIETVQGVDVYPAAQQMLIHQGKVLKDGTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74



>ref|XP_009134681.1| PREDICTED: ubiquitin receptor RAD23c [Brassica rapa]
Length=401

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG++VYPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIHQGKVLKDETTIE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNLAAG+NLE  I QILDMGGG WDR+TVVRALRAA+NNPERAVEYL
Sbjct  157  DVYGQAASNLAAGSNLESTILQILDMGGGAWDRDTVVRALRAAFNNPERAVEYL  210



>ref|XP_006482260.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Citrus 
sinensis]
Length=397

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYL
Sbjct  152  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYL  205



>gb|KDO58997.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=403

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYL
Sbjct  158  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYL  211



>gb|KDO58996.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=403

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYL
Sbjct  157  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYL  210



>gb|KDO58993.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=398

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYL
Sbjct  157  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYL  210



>ref|XP_006482261.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Citrus 
sinensis]
Length=396

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYL
Sbjct  151  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYL  204



>gb|KFK37714.1| hypothetical protein AALP_AA3G019400 [Arabis alpina]
Length=435

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG+++YPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADLYPATKLMLIHQGKVLKDETTIE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNLAAG+NLE  IQQILDMGGG WDR+TVVRALRAA+NNPERAVEYL
Sbjct  188  DVYGQAASNLAAGSNLESTIQQILDMGGGNWDRDTVVRALRAAFNNPERAVEYL  241



>ref|XP_011070815.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=433

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IE+ QG+++YPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKTIESTQGADIYPATQQMLIHQGKVLKDGTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAE++FVVVM+
Sbjct  61   ENKVAESSFVVVML  74


 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/54 (94%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AGNNLEGA+QQILDMGGGTWDR+TVVRALRAAYNNPERAVEYL
Sbjct  187  DVYGQAASNLVAGNNLEGAVQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYL  240



>gb|KFK37713.1| hypothetical protein AALP_AA3G019400 [Arabis alpina]
Length=425

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG+++YPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADLYPATKLMLIHQGKVLKDETTIE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNLAAG+NLE  IQQILDMGGG WDR+TVVRALRAA+NNPERAVEYL
Sbjct  178  DVYGQAASNLAAGSNLESTIQQILDMGGGNWDRDTVVRALRAAFNNPERAVEYL  231



>gb|KDO58994.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=402

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYL
Sbjct  157  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYL  210



>emb|CDX91998.1| BnaC03g33000D [Brassica napus]
Length=403

 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG++VYPA++LMLIHQG+VLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIHQGRVLKDETTIE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNLAAG+NLE  I QILDMGGG WDR+TVVRALRAA+NNPERAVEYL
Sbjct  159  DVYGQAASNLAAGSNLESTILQILDMGGGAWDRDTVVRALRAAFNNPERAVEYL  212



>ref|XP_006430789.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44029.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=401

 Score =   136 bits (342),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYL
Sbjct  156  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYL  209



>ref|XP_006430787.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44027.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=401

 Score =   136 bits (342),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYL
Sbjct  155  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYL  208



>ref|XP_006430788.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44028.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=400

 Score =   136 bits (342),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYL
Sbjct  155  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYL  208



>gb|EYU44643.1| hypothetical protein MIMGU_mgv1a006427mg [Erythranthe guttata]
Length=444

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +2

Query  71   NMKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTL  250
            +MKIFVKTLKGTHFEIEVKPEDTVADVKK++ETVQGS+VYPA+Q MLIHQGKVLKD TTL
Sbjct  65   SMKIFVKTLKGTHFEIEVKPEDTVADVKKNVETVQGSDVYPAAQQMLIHQGKVLKDETTL  124

Query  251  EENKVAENNFVVVMM  295
            EENKVAE +FVVVM+
Sbjct  125  EENKVAEKSFVVVML  139


 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVY +AASNL AG NLEG IQQI+DMGGG+WDR+TVVRALRAA+NNPERAVEYL
Sbjct  203  DVYSEAASNLVAGTNLEGTIQQIIDMGGGSWDRDTVVRALRAAFNNPERAVEYL  256



>ref|XP_008361862.1| PREDICTED: ubiquitin receptor RAD23c-like [Malus domestica]
Length=83

 Score =   127 bits (320),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHF++EVKPEDTVADVKK IE  +GS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFDLEVKPEDTVADVKKHIEACKGSDVYPASQQMLIHQGKVLKDDTTLD  60

Query  254  ENKVAENNFVVVMM  295
             NKVAEN+FVV+M+
Sbjct  61   GNKVAENSFVVIML  74



>ref|XP_009597820.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Nicotiana 
tomentosiformis]
Length=288

 Score =   133 bits (335),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IE+VQG + YPA+Q MLIHQGKVLKD  TLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIESVQGQDFYPAAQQMLIHQGKVLKDTATLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74


 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVY  AASNL AG+NLE  +QQILDMGGG+WDR+TVVRALRAAYNNPERAV+YL
Sbjct  145  DVYDLAASNLVAGSNLEATVQQILDMGGGSWDRDTVVRALRAAYNNPERAVDYL  198



>gb|KDO58995.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=430

 Score =   136 bits (342),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score =   107 bits (267),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYL
Sbjct  157  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYL  210



>ref|XP_010485565.1| PREDICTED: ubiquitin receptor RAD23c-like [Camelina sativa]
Length=419

 Score =   135 bits (341),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG++VYPA++LMLIHQGKVLKD  T+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIHQGKVLKDEKTIE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D+YGQAASNLAAG+NL+  IQQILDMGGGTWDR+TVVRALRAA+NNPERAVEYL
Sbjct  172  DIYGQAASNLAAGSNLDSTIQQILDMGGGTWDRDTVVRALRAAFNNPERAVEYL  225



>ref|NP_974211.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
 gb|AEE73825.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
Length=299

 Score =   133 bits (335),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKPED+V DVKK+IE+VQG++VYPA++ MLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVVDVKKNIESVQGADVYPAAKQMLIHQGKVLKDETTIE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNLAAG+NLE  IQQILDMGGGTWDRETVV ALRAA+NNPERAVEYL
Sbjct  172  DVYGQAASNLAAGSNLESTIQQILDMGGGTWDRETVVLALRAAFNNPERAVEYL  225



>gb|ABB02636.1| RAD23-like [Solanum tuberosum]
Length=384

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQG +VYPA+Q MLIHQ KVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGQDVYPAAQQMLIHQVKVLKDPTTLD  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74


 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG+ LE  +QQILDMGGG+W+R+TVVRALRAAYNNPERA+EYL
Sbjct  146  DVYGQAASNLVAGSTLETTVQQILDMGGGSWERDTVVRALRAAYNNPERAIEYL  199



>gb|KDO58998.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=397

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYL
Sbjct  152  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYL  205



>ref|NP_001274760.1| uncharacterized protein LOC102577665 [Solanum tuberosum]
 gb|ABB16981.1| unknown [Solanum tuberosum]
Length=382

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQG +VYPA+Q MLI  GKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGQDVYPAAQQMLIPPGKVLKDPTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74


 Score =   101 bits (252),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG+ LE  +QQILDMGGG+W+R+TVVRALRAAYNNPERA+EYL
Sbjct  144  DVYGQAASNLVAGSTLETTVQQILDMGGGSWERDTVVRALRAAYNNPERAIEYL  197



>ref|XP_006408409.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
 gb|ESQ49862.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
Length=416

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKG HFEIEVKP+D+VADVKK+IETVQG++VYPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGIHFEIEVKPDDSVADVKKNIETVQGADVYPAAKLMLIHQGKVLKDETTIE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNLAAG+NLE  IQQILDMGGGTWDR TVVRALRAA+NNPERAVEYL
Sbjct  169  DVYGQAASNLAAGSNLESTIQQILDMGGGTWDRNTVVRALRAAFNNPERAVEYL  222



>gb|ACU18469.1| unknown [Glycine max]
Length=160

 Score =   128 bits (321),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHFEIEV P+DTV++VKK+IETVQG++VYPA+Q MLIHQGKVL+D +TLE
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTVSEVKKNIETVQGADVYPAAQQMLIHQGKVLRDASTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKV EN F+V+M+
Sbjct  61   ENKVVENTFIVIML  74



>ref|XP_010525156.1| PREDICTED: ubiquitin receptor RAD23c-like [Tarenaya hassleriana]
Length=407

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IETVQ  +VYPA+Q MLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETVQSPDVYPAAQQMLIHQGKVLKDETTME  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74


 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG+NLE  IQQILDMGGG+WDR+TVVRALRAAYNNPERAVEYL
Sbjct  162  DVYGQAASNLVAGSNLEAIIQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYL  215



>ref|XP_006299986.1| hypothetical protein CARUB_v10016200mg [Capsella rubella]
 gb|EOA32884.1| hypothetical protein CARUB_v10016200mg [Capsella rubella]
Length=427

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKI+VKTLKGTHFEIEVKPED+++DVKK+IET QG++VYPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIYVKTLKGTHFEIEVKPEDSISDVKKNIETAQGADVYPAAKLMLIHQGKVLKDETTIE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNLAAG+NLE  IQQILDMGGGTWDR+TVVRALRAA+NNPERAVEYL
Sbjct  180  DVYGQAASNLAAGSNLESTIQQILDMGGGTWDRDTVVRALRAAFNNPERAVEYL  233



>gb|ABD96960.1| hypothetical protein [Cleome spinosa]
Length=435

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IETVQ  +VYPA+Q MLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETVQSPDVYPAAQQMLIHQGKVLKDETTME  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74


 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG+NLE  IQQILDMGGG+WDR+TVVRALRAAYNNPERAVEYL
Sbjct  190  DVYGQAASNLVAGSNLEAIIQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYL  243



>ref|XP_004172134.1| PREDICTED: putative DNA repair protein RAD23-3-like [Cucumis 
sativus]
Length=407

 Score =   133 bits (334),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKG+HFEIEV+P DTVADVKK+IETVQG++VYPA+Q MLIHQGKVLKD +TLE
Sbjct  1    MKIFVKTLKGSHFEIEVQPADTVADVKKNIETVQGADVYPAAQQMLIHQGKVLKDSSTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74


 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVY QAASNL AG+NLE  +QQILDMG G WDR+TVVRALRAAYNNPERAV+YL
Sbjct  172  DVYSQAASNLVAGSNLEETVQQILDMGEGVWDRDTVVRALRAAYNNPERAVDYL  225



>ref|XP_004135098.1| PREDICTED: putative DNA repair protein RAD23-3-like [Cucumis 
sativus]
Length=407

 Score =   133 bits (334),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKG+HFEIEV+P DTVADVKK+IETVQG++VYPA+Q MLIHQGKVLKD +TLE
Sbjct  1    MKIFVKTLKGSHFEIEVQPADTVADVKKNIETVQGADVYPAAQQMLIHQGKVLKDSSTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74


 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVY QAASNL AG+NLE  +QQILDMG G WDR+TVVRALRAAYNNPERAV+YL
Sbjct  172  DVYSQAASNLVAGSNLEETVQQILDMGEGVWDRDTVVRALRAAYNNPERAVDYL  225



>ref|XP_007033285.1| Rad23 UV excision repair protein family isoform 2 [Theobroma 
cacao]
 gb|EOY04211.1| Rad23 UV excision repair protein family isoform 2 [Theobroma 
cacao]
Length=350

 Score =   132 bits (331),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+I+T QG ++YPA+Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIDTAQGPDIYPAAQQMLIHQGKVLKDNTTLD  60

Query  254  ENKVAENNFVVVMM  295
            +NKVAEN+F+V+M+
Sbjct  61   DNKVAENSFIVIML  74


 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVY QAASNL AGNN+E  IQQILDMGGG+WDR+TVVRALRAAYNNPERAVEYL
Sbjct  161  DVYSQAASNLVAGNNIEAIIQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYL  214



>gb|EYU34397.1| hypothetical protein MIMGU_mgv1a008220mg [Erythranthe guttata]
Length=381

 Score =   132 bits (332),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGSN+YPA Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSNIYPAGQQMLIHQGKVLKDDTTLE  60

Query  254  ENKVAENNFVVVMM  295
             N VAE +FVV+M+
Sbjct  61   ANNVAEKSFVVIML  74


 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  497  VYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            VY QAASNL AG+ LE  +QQILDMGGG+WDR+TVVRALRAA+NNPERAVEYL
Sbjct  139  VYDQAASNLVAGSTLETTVQQILDMGGGSWDRDTVVRALRAAFNNPERAVEYL  191



>ref|XP_008446578.1| PREDICTED: ubiquitin receptor RAD23c-like [Cucumis melo]
Length=422

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKG+HFEIEV+P DTVADVKK+IETVQG++VYPA+Q MLIHQGKVLKD +TLE
Sbjct  1    MKIFVKTLKGSHFEIEVQPADTVADVKKNIETVQGADVYPAAQQMLIHQGKVLKDSSTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74


 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVY QAASNL AG+NLE  IQQILDMG G WDR+TVVRALRAAYNNPERAV+YL
Sbjct  174  DVYSQAASNLVAGSNLEETIQQILDMGEGVWDRDTVVRALRAAYNNPERAVDYL  227



>gb|KGN52072.1| hypothetical protein Csa_5G608600 [Cucumis sativus]
Length=420

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKG+HFEIEV+P DTVADVKK+IETVQG++VYPA+Q MLIHQGKVLKD +TLE
Sbjct  1    MKIFVKTLKGSHFEIEVQPADTVADVKKNIETVQGADVYPAAQQMLIHQGKVLKDSSTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74


 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVY QAASNL AG+NLE  +QQILDMG G WDR+TVVRALRAAYNNPERAV+YL
Sbjct  172  DVYSQAASNLVAGSNLEETVQQILDMGEGVWDRDTVVRALRAAYNNPERAVDYL  225



>ref|NP_186903.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
 sp|Q84L31.2|RD23C_ARATH RecName: Full=Ubiquitin receptor RAD23c; Short=AtRAD23c; AltName: 
Full=Putative DNA repair protein RAD23-3; AltName: Full=RAD23-like 
protein 3; Short=AtRAD23-3 [Arabidopsis thaliana]
 gb|AAF32461.1| putative RAD23 [Arabidopsis thaliana]
 gb|AAK62617.1| AT3g02540/F16B3_17 [Arabidopsis thaliana]
 gb|AAM47342.1| AT3g02540/F16B3_17 [Arabidopsis thaliana]
 dbj|BAC76392.1| RAD23-like protein [Arabidopsis thaliana]
 gb|ABG89116.1| Rad23-1 [synthetic construct]
 gb|AEE73824.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
Length=419

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKPED+V DVKK+IE+VQG++VYPA++ MLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVVDVKKNIESVQGADVYPAAKQMLIHQGKVLKDETTIE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNLAAG+NLE  IQQILDMGGGTWDRETVV ALRAA+NNPERAVEYL
Sbjct  172  DVYGQAASNLAAGSNLESTIQQILDMGGGTWDRETVVLALRAAFNNPERAVEYL  225



>ref|XP_010549930.1| PREDICTED: ubiquitin receptor RAD23c-like [Tarenaya hassleriana]
 gb|ABD96879.1| hypothetical protein [Cleome spinosa]
Length=383

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IETVQG++VYP++Q MLIHQGKVL+D TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETVQGADVYPSAQQMLIHQGKVLRDETTME  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAE +F+V+M+
Sbjct  61   ENKVAEKSFIVIML  74


 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D+YGQAASNL AG+NLE  IQQILDMGGG+WDR+TVVRALRAAYNNPERAVEYL
Sbjct  138  DIYGQAASNLVAGSNLEATIQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYL  191



>ref|NP_001189793.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
 gb|AEE73826.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
Length=418

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKPED+V DVKK+IE+VQG++VYPA++ MLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVVDVKKNIESVQGADVYPAAKQMLIHQGKVLKDETTIE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNLAAG+NLE  IQQILDMGGGTWDRETVV ALRAA+NNPERAVEYL
Sbjct  171  DVYGQAASNLAAGSNLESTIQQILDMGGGTWDRETVVLALRAAFNNPERAVEYL  224



>ref|NP_001240201.1| uncharacterized protein LOC100809066 [Glycine max]
 gb|ACU22776.1| unknown [Glycine max]
 gb|KHN47572.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=392

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74


 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D+YGQAASNL AG+NLEG IQQILDMGGG+WDR+TVVRALRAAYNNPERAVEYL
Sbjct  146  DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYL  199



>gb|EYU29968.1| hypothetical protein MIMGU_mgv1a008352mg [Erythranthe guttata]
Length=375

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKP+DT+ADVKK++E  QG++VYPA+Q +LIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPDDTIADVKKTVENTQGADVYPATQQLLIHQGKVLKDATTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AGN LEG IQQILDMGGG WDR+TVVRALRAAYNNPERA++YL
Sbjct  138  DVYGQAASNLVAGNILEGTIQQILDMGGGIWDRDTVVRALRAAYNNPERAIDYL  191



>gb|EYU29967.1| hypothetical protein MIMGU_mgv1a008352mg [Erythranthe guttata]
Length=376

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKP+DT+ADVKK++E  QG++VYPA+Q +LIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPDDTIADVKKTVENTQGADVYPATQQLLIHQGKVLKDATTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AGN LEG IQQILDMGGG WDR+TVVRALRAAYNNPERA++YL
Sbjct  139  DVYGQAASNLVAGNILEGTIQQILDMGGGIWDRDTVVRALRAAYNNPERAIDYL  192



>ref|XP_010263555.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nelumbo 
nucifera]
Length=386

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEI+V PEDTVADVKK+IETVQG +VYPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIQVNPEDTVADVKKNIETVQGPDVYPAGQQMLIHQGKVLKDATTLD  60

Query  254  ENKVAENNFVVVMM  295
            ENKV+EN+F+V+M+
Sbjct  61   ENKVSENSFLVIML  74


 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D YGQAASNL AGNN E AI+QILDMGGG+WDR+TVVRALRAAYNNPERAVEYL
Sbjct  144  DAYGQAASNLVAGNNFEEAIKQILDMGGGSWDRDTVVRALRAAYNNPERAVEYL  197



>ref|XP_010263550.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Nelumbo 
nucifera]
Length=387

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEI+V PEDTVADVKK+IETVQG +VYPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIQVNPEDTVADVKKNIETVQGPDVYPAGQQMLIHQGKVLKDATTLD  60

Query  254  ENKVAENNFVVVMM  295
            ENKV+EN+F+V+M+
Sbjct  61   ENKVSENSFLVIML  74


 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D YGQAASNL AGNN E AI+QILDMGGG+WDR+TVVRALRAAYNNPERAVEYL
Sbjct  145  DAYGQAASNLVAGNNFEEAIKQILDMGGGSWDRDTVVRALRAAYNNPERAVEYL  198



>ref|XP_010103792.1| Putative DNA repair protein RAD23-3 [Morus notabilis]
 gb|EXB97154.1| Putative DNA repair protein RAD23-3 [Morus notabilis]
Length=421

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKGTHFEIEVKPEDTVADVKK+IE VQG++VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVCVKTLKGTHFEIEVKPEDTVADVKKNIEAVQGADVYPASQQMLIHQGKVLKDTTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKV EN+F+V+M+
Sbjct  61   ENKVVENSFIVIMI  74


 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG+NLE  +QQI+DMGGG+WDR+TVVRALRAA+NNPERAVEYL
Sbjct  173  DVYGQAASNLVAGSNLEATVQQIIDMGGGSWDRDTVVRALRAAFNNPERAVEYL  226



>ref|XP_006584607.1| PREDICTED: uncharacterized protein LOC100813881 isoform X4 [Glycine 
max]
Length=383

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74


 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D+YGQAASNL AG+NLEG IQQILDMGGG+WDR+TVVR LRAAYNNPERAVEYL
Sbjct  137  DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRTLRAAYNNPERAVEYL  190



>ref|XP_006584608.1| PREDICTED: uncharacterized protein LOC100813881 isoform X5 [Glycine 
max]
Length=382

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74


 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D+YGQAASNL AG+NLEG IQQILDMGGG+WDR+TVVR LRAAYNNPERAVEYL
Sbjct  136  DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRTLRAAYNNPERAVEYL  189



>gb|ACU18529.1| unknown [Glycine max]
Length=382

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74


 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D+YGQAASNL AG+NLEG IQQILDMGGG+WDR+TVVR LRAAYNNPERAVEYL
Sbjct  136  DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRTLRAAYNNPERAVEYL  189



>ref|XP_004497101.1| PREDICTED: putative DNA repair protein RAD23-3-like [Cicer arietinum]
Length=400

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHFEIEVKP+DT+++VKK+IE VQG +VYPA+Q MLIHQGKVLKDGT+LE
Sbjct  1    MKVFVKTLKGTHFEIEVKPQDTISEVKKNIENVQGVDVYPAAQQMLIHQGKVLKDGTSLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74


 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG+NLE  +QQILDMGGG+WDR+TVVRALRAA+NNPERAVEYL
Sbjct  153  DVYGQAASNLVAGSNLEETVQQILDMGGGSWDRDTVVRALRAAFNNPERAVEYL  206



>ref|XP_006584606.1| PREDICTED: uncharacterized protein LOC100813881 isoform X3 [Glycine 
max]
Length=401

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74


 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D+YGQAASNL AG+NLEG IQQILDMGGG+WDR+TVVR LRAAYNNPERAVEYL
Sbjct  155  DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRTLRAAYNNPERAVEYL  208



>ref|XP_006584604.1| PREDICTED: uncharacterized protein LOC100813881 isoform X1 [Glycine 
max]
Length=469

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74


 Score =   107 bits (268),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D+YGQAASNL AG+NLEG IQQILDMGGG+WDR+TVVR LRAAYNNPERAVEYL
Sbjct  223  DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRTLRAAYNNPERAVEYL  276



>gb|KEH44233.1| RAD23 UV excision repair family protein [Medicago truncatula]
Length=397

 Score =   130 bits (327),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHFEIEV P+DT++ VKK+IETVQG +VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTISAVKKNIETVQGVDVYPAAQQMLIHQGKVLKDGTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74


 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG+NLEG +QQILDMGGG+WDR+TV+RALRAA+NNPERAVEYL
Sbjct  147  DVYGQAASNLVAGSNLEGTVQQILDMGGGSWDRDTVIRALRAAFNNPERAVEYL  200



>ref|NP_001242098.1| uncharacterized protein LOC100813881 [Glycine max]
 gb|ACU21107.1| unknown [Glycine max]
Length=400

 Score =   130 bits (327),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74


 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D+YGQAASNL AG+NLEG IQQILDMGGG+WDR+TVVR LRAAYNNPERAVEYL
Sbjct  154  DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRTLRAAYNNPERAVEYL  207



>ref|XP_003555895.1| PREDICTED: ubiquitin receptor RAD23c-like isoform 1 [Glycine 
max]
 gb|KHN11428.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=402

 Score =   130 bits (327),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHFEIEV P+DTV++VKK+IETVQG++VYPA+Q MLIHQGKVL+D TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTVSEVKKNIETVQGADVYPAAQQMLIHQGKVLRDATTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN F+V+M+
Sbjct  61   ENKVAENTFIVIML  74


 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D+YGQAASNL AG+NLEG IQQILDMGGG+WDR+TVVRALRAAYNNPERAVEYL
Sbjct  155  DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYL  208



>ref|XP_006584605.1| PREDICTED: uncharacterized protein LOC100813881 isoform X2 [Glycine 
max]
Length=468

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74


 Score =   108 bits (269),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D+YGQAASNL AG+NLEG IQQILDMGGG+WDR+TVVR LRAAYNNPERAVEYL
Sbjct  222  DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRTLRAAYNNPERAVEYL  275



>ref|XP_008781252.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X4 [Phoenix 
dactylifera]
Length=450

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +2

Query  65   RENMKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGT  244
            R  MKIFVKTLKGTHFEIEVKPED VADVKK+IE VQG  VYPA Q MLIHQGK+LKD T
Sbjct  36   RGEMKIFVKTLKGTHFEIEVKPEDAVADVKKNIEAVQGQGVYPAEQQMLIHQGKILKDDT  95

Query  245  TLEENKVAENNFVVVMM  295
            TL++NKVAEN+F+V+M+
Sbjct  96   TLQDNKVAENSFIVIML  112


 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D YGQAASNL AG+ LE  +Q ILDMGGGTWDR+TV+RALRAAYNNPERAVEYL
Sbjct  206  DAYGQAASNLVAGSALEQTVQHILDMGGGTWDRDTVIRALRAAYNNPERAVEYL  259



>ref|XP_008781229.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Phoenix 
dactylifera]
Length=452

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +2

Query  65   RENMKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGT  244
            R  MKIFVKTLKGTHFEIEVKPED VADVKK+IE VQG  VYPA Q MLIHQGK+LKD T
Sbjct  36   RGEMKIFVKTLKGTHFEIEVKPEDAVADVKKNIEAVQGQGVYPAEQQMLIHQGKILKDDT  95

Query  245  TLEENKVAENNFVVVMM  295
            TL++NKVAEN+F+V+M+
Sbjct  96   TLQDNKVAENSFIVIML  112


 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D YGQAASNL AG+ LE  +Q ILDMGGGTWDR+TV+RALRAAYNNPERAVEYL
Sbjct  207  DAYGQAASNLVAGSALEQTVQHILDMGGGTWDRDTVIRALRAAYNNPERAVEYL  260



>ref|XP_008781237.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Phoenix 
dactylifera]
Length=451

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +2

Query  65   RENMKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGT  244
            R  MKIFVKTLKGTHFEIEVKPED VADVKK+IE VQG  VYPA Q MLIHQGK+LKD T
Sbjct  36   RGEMKIFVKTLKGTHFEIEVKPEDAVADVKKNIEAVQGQGVYPAEQQMLIHQGKILKDDT  95

Query  245  TLEENKVAENNFVVVMM  295
            TL++NKVAEN+F+V+M+
Sbjct  96   TLQDNKVAENSFIVIML  112


 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D YGQAASNL AG+ LE  +Q ILDMGGGTWDR+TV+RALRAAYNNPERAVEYL
Sbjct  207  DAYGQAASNLVAGSALEQTVQHILDMGGGTWDRDTVIRALRAAYNNPERAVEYL  260



>ref|XP_008781245.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X3 [Phoenix 
dactylifera]
Length=451

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +2

Query  65   RENMKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGT  244
            R  MKIFVKTLKGTHFEIEVKPED VADVKK+IE VQG  VYPA Q MLIHQGK+LKD T
Sbjct  36   RGEMKIFVKTLKGTHFEIEVKPEDAVADVKKNIEAVQGQGVYPAEQQMLIHQGKILKDDT  95

Query  245  TLEENKVAENNFVVVMM  295
            TL++NKVAEN+F+V+M+
Sbjct  96   TLQDNKVAENSFIVIML  112


 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D YGQAASNL AG+ LE  +Q ILDMGGGTWDR+TV+RALRAAYNNPERAVEYL
Sbjct  206  DAYGQAASNLVAGSALEQTVQHILDMGGGTWDRDTVIRALRAAYNNPERAVEYL  259



>ref|XP_007033284.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
 gb|EOY04210.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
Length=487

 Score =   130 bits (328),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+I+T QG ++YPA+Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIDTAQGPDIYPAAQQMLIHQGKVLKDNTTLD  60

Query  254  ENKVAENNFVVVMM  295
            +NKVAEN+F+V+M+
Sbjct  61   DNKVAENSFIVIML  74


 Score =   105 bits (262),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVY QAASNL AGNN+E  IQQILDMGGG+WDR+TVVRALRAAYNNPERAVEYL
Sbjct  247  DVYSQAASNLVAGNNIEAIIQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYL  300



>gb|KHN15504.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=416

 Score =   130 bits (326),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74


 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D+YGQAASNL AG+NLEG IQQILDMGGG+WDR+TVVR LRAAYNNPERAVEYL
Sbjct  170  DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRTLRAAYNNPERAVEYL  223



>ref|XP_008390012.1| PREDICTED: ubiquitin receptor RAD23c-like [Malus domestica]
Length=359

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKG+HF++EVKPEDTVADVKK IE  +GS+VYPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGSHFDVEVKPEDTVADVKKHIEACKGSDVYPAPQQMLIHQGKVLKDDTTLD  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74


 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D YGQAAS+L AG NLEG IQQILDMGGGTWDR+TVVRALRAA+NNP RA++YL
Sbjct  127  DSYGQAASDLVAGTNLEGTIQQILDMGGGTWDRDTVVRALRAAFNNPARAIDYL  180



>ref|XP_002884326.1| hypothetical protein ARALYDRAFT_477488 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60585.1| hypothetical protein ARALYDRAFT_477488 [Arabidopsis lyrata subsp. 
lyrata]
Length=417

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVK ED+VADVKK+IETVQG++VYPA++ MLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKLEDSVADVKKNIETVQGADVYPAAKQMLIHQGKVLKDETTIE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+F+VVM+
Sbjct  61   ENKVAENSFIVVML  74


 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNLAAG+NLE  IQQILDMGGGTWDRETVVRALRAA+NNPERAVEYL
Sbjct  170  DVYGQAASNLAAGSNLESTIQQILDMGGGTWDRETVVRALRAAFNNPERAVEYL  223



>ref|XP_006437672.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
 gb|ESR50912.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
Length=212

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGT F++EVKPEDTV DVK  IETVQGS+VYPA+Q MLI+QGKVLKD TTLE
Sbjct  2    MKIFVKTLKGTSFDVEVKPEDTVFDVKMKIETVQGSDVYPAAQQMLIYQGKVLKDDTTLE  61

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+FVV+M+
Sbjct  62   ENKVAENSFVVIML  75


 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/53 (94%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  497  VYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            VYG AASNL AGNNLEGAIQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYL
Sbjct  145  VYGHAASNLVAGNNLEGAIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYL  197



>ref|XP_011464118.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=401

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEI+V+P+D+V DVKKSIET QG  VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIQVQPQDSVVDVKKSIETSQGLTVYPAAQQMLIHQGKVLKDDTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKV+EN+FVV+M+
Sbjct  61   ENKVSENSFVVIML  74


 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  500  YGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            YGQAAS+L AGNNLEG IQ ILDMGGGTWDR+TVVRALRAA+NNP RA++YL
Sbjct  154  YGQAASDLVAGNNLEGTIQHILDMGGGTWDRDTVVRALRAAFNNPARAIDYL  205



>emb|CDP02781.1| unnamed protein product [Coffea canephora]
Length=387

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKGTHF+IEVKP+D+VADVK+ IET+QGS+VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKVSVKTLKGTHFQIEVKPDDSVADVKRIIETIQGSDVYPAAQQMLIHQGKVLKDDTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74


 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG  LE  IQQILDMGGG+WDR+TV+RALRAAYNNPERAVEYL
Sbjct  147  DVYGQAASNLVAGTTLESTIQQILDMGGGSWDRDTVIRALRAAYNNPERAVEYL  200



>ref|XP_004299088.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=400

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEI+V+P+D+V DVKKSIET QG  VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIQVQPQDSVVDVKKSIETSQGLTVYPAAQQMLIHQGKVLKDDTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKV+EN+FVV+M+
Sbjct  61   ENKVSENSFVVIML  74


 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  500  YGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            YGQAAS+L AGNNLEG IQ ILDMGGGTWDR+TVVRALRAA+NNP RA++YL
Sbjct  153  YGQAASDLVAGNNLEGTIQHILDMGGGTWDRDTVVRALRAAFNNPARAIDYL  204



>ref|XP_010265160.1| PREDICTED: ubiquitin receptor RAD23c-like [Nelumbo nucifera]
Length=383

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKPEDTV DVKK+IE+V G +VYPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVDDVKKNIESVHGPDVYPAGQQMLIHQGKVLKDATTLD  60

Query  254  ENKVAENNFVVVMM  295
            ENKV+EN+F+V+M+
Sbjct  61   ENKVSENSFLVIML  74


 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG+N E AI+QILDMGGG+WDR+TVVRALRAAYNNPERAVEYL
Sbjct  143  DVYGQAASNLVAGSNFEEAIKQILDMGGGSWDRDTVVRALRAAYNNPERAVEYL  196



>ref|XP_006437673.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
 gb|ESR50913.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
Length=300

 Score =   126 bits (316),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGT F++EVKPEDTV DVK  IETVQGS+VYPA+Q MLI+QGKVLKD TTLE
Sbjct  2    MKIFVKTLKGTSFDVEVKPEDTVFDVKMKIETVQGSDVYPAAQQMLIYQGKVLKDDTTLE  61

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+FVV+M+
Sbjct  62   ENKVAENSFVVIML  75


 Score =   109 bits (272),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 50/53 (94%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  497  VYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            VYG AASNL AGNNLEGAIQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYL
Sbjct  145  VYGHAASNLVAGNNLEGAIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYL  197



>ref|XP_010926134.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Elaeis 
guineensis]
Length=396

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKG+HFEIEVKPEDTV DVKK+IE +QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVTDVKKNIEAIQGKGVYPAEQQMLIHQGKILKDDTTLQ  60

Query  254  ENKVAENNFVVVMM  295
            +NKVAEN+F+V+M+
Sbjct  61   DNKVAENSFIVIML  74


 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D YGQAASNL AGN LE  IQ ILDMGGGTWDR+TVVRALRAAYNNPERAVEYL
Sbjct  145  DAYGQAASNLVAGNALEQTIQHILDMGGGTWDRDTVVRALRAAYNNPERAVEYL  198



>ref|XP_010926135.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Elaeis 
guineensis]
Length=395

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKG+HFEIEVKPEDTV DVKK+IE +QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVTDVKKNIEAIQGKGVYPAEQQMLIHQGKILKDDTTLQ  60

Query  254  ENKVAENNFVVVMM  295
            +NKVAEN+F+V+M+
Sbjct  61   DNKVAENSFIVIML  74


 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D YGQAASNL AGN LE  IQ ILDMGGGTWDR+TVVRALRAAYNNPERAVEYL
Sbjct  145  DAYGQAASNLVAGNALEQTIQHILDMGGGTWDRDTVVRALRAAYNNPERAVEYL  198



>ref|XP_008775144.1| PREDICTED: ubiquitin receptor RAD23d-like [Phoenix dactylifera]
Length=384

 Score =   127 bits (319),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIF+KTLKGTHFEIEVKPEDTV DVK++IE  QG +VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFIKTLKGTHFEIEVKPEDTVTDVKRNIEATQGQSVYPAEQQMLIHQGKILKDETTLQ  60

Query  254  ENKVAENNFVVVMM  295
            +NKVAEN+F+V+M+
Sbjct  61   DNKVAENSFIVIML  74


 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG NLE  IQ ILDMGGGTWDR+ VVRALRAAYNNPERAVEYL
Sbjct  145  DVYGQAASNLVAGTNLEQTIQHILDMGGGTWDRDIVVRALRAAYNNPERAVEYL  198



>ref|XP_003536688.1| PREDICTED: ubiquitin receptor RAD23c [Glycine max]
Length=408

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHFEIEV P+DTV++VKK+IETVQG++VYPA+Q MLIHQGKVL+D +TLE
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTVSEVKKNIETVQGADVYPAAQQMLIHQGKVLRDASTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKV EN F+V+M+
Sbjct  61   ENKVVENTFIVIML  74


 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D+YGQAASNL AG+NLEG IQQILDMGGG+WDR+TVVRALRAAYNNPERAVEYL
Sbjct  161  DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYL  214



>gb|KHN05574.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=410

 Score =   127 bits (320),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHFEIEV P+DTV++VKK+IETVQG++VYPA+Q MLIHQGKVL+D +TLE
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTVSEVKKNIETVQGADVYPAAQQMLIHQGKVLRDASTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKV EN F+V+M+
Sbjct  61   ENKVVENTFIVIML  74


 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D+YGQAASNL AG+NLEG IQQILDMGGG+WDR+TVVRALRAAYNNPERAVEYL
Sbjct  163  DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYL  216



>ref|XP_007142903.1| hypothetical protein PHAVU_007G026600g [Phaseolus vulgaris]
 gb|ESW14897.1| hypothetical protein PHAVU_007G026600g [Phaseolus vulgaris]
Length=400

 Score =   127 bits (319),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHFEIEV+P+DTV++VKKSIETVQG +VYPA+  MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVQPQDTVSEVKKSIETVQGVDVYPAALQMLIHQGKVLKDATTLE  60

Query  254  ENKVAENNFVVVMM  295
            EN VAEN+F+V+M+
Sbjct  61   ENNVAENSFIVIML  74


 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYG AASNL AG+NLEG IQQI+DMGGG+WDR+TVVRALRAAYNNPERAVEYL
Sbjct  152  DVYGLAASNLVAGSNLEGTIQQIIDMGGGSWDRDTVVRALRAAYNNPERAVEYL  205



>ref|XP_010926133.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Elaeis 
guineensis]
Length=421

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKG+HFEIEVKPEDTV DVKK+IE +QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVTDVKKNIEAIQGKGVYPAEQQMLIHQGKILKDDTTLQ  60

Query  254  ENKVAENNFVVVMM  295
            +NKVAEN+F+V+M+
Sbjct  61   DNKVAENSFIVIML  74


 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D YGQAASNL AGN LE  IQ ILDMGGGTWDR+TVVRALRAAYNNPERAVEYL
Sbjct  145  DAYGQAASNLVAGNALEQTIQHILDMGGGTWDRDTVVRALRAAYNNPERAVEYL  198



>ref|XP_010926132.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Elaeis 
guineensis]
Length=422

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKG+HFEIEVKPEDTV DVKK+IE +QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVTDVKKNIEAIQGKGVYPAEQQMLIHQGKILKDDTTLQ  60

Query  254  ENKVAENNFVVVMM  295
            +NKVAEN+F+V+M+
Sbjct  61   DNKVAENSFIVIML  74


 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D YGQAASNL AGN LE  IQ ILDMGGGTWDR+TVVRALRAAYNNPERAVEYL
Sbjct  145  DAYGQAASNLVAGNALEQTIQHILDMGGGTWDRDTVVRALRAAYNNPERAVEYL  198



>ref|XP_006437674.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
 gb|ESR50914.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
Length=331

 Score =   126 bits (316),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGT F++EVKPEDTV DVK  IETVQGS+VYPA+Q MLI+QGKVLKD TTLE
Sbjct  2    MKIFVKTLKGTSFDVEVKPEDTVFDVKMKIETVQGSDVYPAAQQMLIYQGKVLKDDTTLE  61

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+FVV+M+
Sbjct  62   ENKVAENSFVVIML  75


 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/53 (94%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  497  VYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            VYG AASNL AGNNLEGAIQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYL
Sbjct  145  VYGHAASNLVAGNNLEGAIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYL  197



>ref|XP_010552232.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Tarenaya 
hassleriana]
Length=384

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGT FEIEVKP+D V DVKK+IETVQG+NVYPA+Q MLIHQGKVL D TTLE
Sbjct  1    MKIFVKTLKGTSFEIEVKPDDKVTDVKKTIETVQGANVYPAAQQMLIHQGKVLSDETTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENK++EN F+V+M+
Sbjct  61   ENKISENGFIVIML  74


 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG+NLE  IQQILDMGGG+WDR+TVVRALRAAYNNPERAVEYL
Sbjct  137  DVYGQAASNLVAGSNLESTIQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYL  190



>ref|XP_006484457.1| PREDICTED: ubiquitin receptor RAD23c-like [Citrus sinensis]
Length=390

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGT F++EVKPEDTV DVK  IETVQGS+VYPA+Q MLI+QGKVLKD TTLE
Sbjct  2    MKIFVKTLKGTSFDVEVKPEDTVFDVKMKIETVQGSDVYPAAQQMLIYQGKVLKDDTTLE  61

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+FVV+M+
Sbjct  62   ENKVAENSFVVIML  75


 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/53 (94%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  497  VYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            VYG AASNL AGNNLEGAIQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYL
Sbjct  145  VYGHAASNLVAGNNLEGAIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYL  197



>ref|XP_006437675.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
 gb|ESR50915.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
Length=390

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGT F++EVKPEDTV DVK  IETVQGS+VYPA+Q MLI+QGKVLKD TTLE
Sbjct  2    MKIFVKTLKGTSFDVEVKPEDTVFDVKMKIETVQGSDVYPAAQQMLIYQGKVLKDDTTLE  61

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+FVV+M+
Sbjct  62   ENKVAENSFVVIML  75


 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/53 (94%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  497  VYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            VYG AASNL AGNNLEGAIQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYL
Sbjct  145  VYGHAASNLVAGNNLEGAIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYL  197



>ref|XP_002529115.1| uv excision repair protein rad23, putative [Ricinus communis]
 gb|EEF33228.1| uv excision repair protein rad23, putative [Ricinus communis]
Length=409

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGT F++EVKPEDT+ADVKKSIET QG++VYPA Q MLI+QGKVLKD TT++
Sbjct  1    MKIFVKTLKGTTFDVEVKPEDTIADVKKSIETTQGADVYPAGQQMLIYQGKVLKDNTTID  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74


 Score =   113 bits (282),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 52/54 (96%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AGNNLEGAIQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYL
Sbjct  159  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYL  212



>ref|XP_010916168.1| PREDICTED: ubiquitin receptor RAD23c-like [Elaeis guineensis]
Length=384

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKPEDTVADVK++IE  QG +VYPA Q MLI+QGK+LKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKRNIEATQGQSVYPAEQQMLIYQGKILKDETTLQ  60

Query  254  ENKVAENNFVVVMM  295
            ++KVAEN+FVV+M+
Sbjct  61   DSKVAENSFVVIML  74


 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG+ LE  IQ ILDMGGGTW+R+ VVRALRAAYNNPERAVEYL
Sbjct  145  DVYGQAASNLVAGSGLEQTIQHILDMGGGTWERDIVVRALRAAYNNPERAVEYL  198



>ref|XP_011035053.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X5 [Populus 
euphratica]
Length=373

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVYQGKVLKDDTTLD  60

Query  254  ENKVAENNFVVVMM  295
            ENKV+E++F VVM+
Sbjct  61   ENKVSESSFFVVML  74


 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            ++YGQAASNL AG+NLE  IQQILDMGGG W+RETVVRALRAA+NNPERAVEYL
Sbjct  129  NMYGQAASNLVAGSNLEATIQQILDMGGGDWNRETVVRALRAAFNNPERAVEYL  182



>ref|XP_011035049.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Populus 
euphratica]
Length=390

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVYQGKVLKDDTTLD  60

Query  254  ENKVAENNFVVVMM  295
            ENKV+E++F VVM+
Sbjct  61   ENKVSESSFFVVML  74


 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            ++YGQAASNL AG+NLE  IQQILDMGGG W+RETVVRALRAA+NNPERAVEYL
Sbjct  146  NMYGQAASNLVAGSNLEATIQQILDMGGGDWNRETVVRALRAAFNNPERAVEYL  199



>ref|XP_011035048.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Populus 
euphratica]
Length=391

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVYQGKVLKDDTTLD  60

Query  254  ENKVAENNFVVVMM  295
            ENKV+E++F VVM+
Sbjct  61   ENKVSESSFFVVML  74


 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            ++YGQAASNL AG+NLE  IQQILDMGGG W+RETVVRALRAA+NNPERAVEYL
Sbjct  147  NMYGQAASNLVAGSNLEATIQQILDMGGGDWNRETVVRALRAAFNNPERAVEYL  200



>ref|XP_009417654.1| PREDICTED: ubiquitin receptor RAD23d-like [Musa acuminata subsp. 
malaccensis]
Length=391

 Score =   124 bits (311),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGT+FEI+VKPEDTVADVK+ IET QG  VYPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTNFEIDVKPEDTVADVKRYIETSQGKTVYPADQQMLIHQGKVLKDDTTLD  60

Query  254  ENKVAENNFVVVMM  295
            ENKV+EN+F+V+M+
Sbjct  61   ENKVSENSFLVIML  74


 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D YGQAASNL AGN LE  IQQILDMGGGTWDR+TVVRALRAAYNNPERA+EYL
Sbjct  146  DAYGQAASNLVAGNTLEQIIQQILDMGGGTWDRDTVVRALRAAYNNPERAIEYL  199



>ref|XP_007142901.1| hypothetical protein PHAVU_007G026400g [Phaseolus vulgaris]
 gb|ESW14895.1| hypothetical protein PHAVU_007G026400g [Phaseolus vulgaris]
Length=402

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHFEIEV+P+D V++VKKSIE+ QG++VYPA+  MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVQPQDAVSEVKKSIESAQGADVYPAALQMLIHQGKVLKDATTLE  60

Query  254  ENKVAENNFVVVMM  295
            EN VAEN+F+V+M+
Sbjct  61   ENNVAENSFIVIML  74


 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYG AASNL AG+NLEG IQQI+DMGGG+WDR+TVVRALRAAYNNPERAVEYL
Sbjct  154  DVYGLAASNLVAGSNLEGTIQQIIDMGGGSWDRDTVVRALRAAYNNPERAVEYL  207



>ref|XP_008801157.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Phoenix 
dactylifera]
Length=367

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHFEIEVKPEDTVA+VK+ IE+ QG +VYPA Q MLIHQGK+LKD +TL 
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDTVAEVKRIIESAQGQSVYPAEQQMLIHQGKILKDDSTLN  60

Query  254  ENKVAENNFVVVMM  295
            +NKV+EN+F+V+M+
Sbjct  61   DNKVSENSFIVIML  74


 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D YGQAASNL AGNNLE  IQQILDMGGGTW+R+TVVRAL AAYNNPERAVEYL
Sbjct  126  DAYGQAASNLVAGNNLEKTIQQILDMGGGTWERDTVVRALHAAYNNPERAVEYL  179



>ref|XP_008801156.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Phoenix 
dactylifera]
Length=370

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHFEIEVKPEDTVA+VK+ IE+ QG +VYPA Q MLIHQGK+LKD +TL 
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDTVAEVKRIIESAQGQSVYPAEQQMLIHQGKILKDDSTLN  60

Query  254  ENKVAENNFVVVMM  295
            +NKV+EN+F+V+M+
Sbjct  61   DNKVSENSFIVIML  74


 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D YGQAASNL AGNNLE  IQQILDMGGGTW+R+TVVRAL AAYNNPERAVEYL
Sbjct  129  DAYGQAASNLVAGNNLEKTIQQILDMGGGTWERDTVVRALHAAYNNPERAVEYL  182



>ref|XP_006383465.1| hypothetical protein POPTR_0005s15740g [Populus trichocarpa]
 gb|ERP61262.1| hypothetical protein POPTR_0005s15740g [Populus trichocarpa]
Length=399

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGT+FEIEVKPEDTV +VKK+IE VQG++VYPA+Q MLI+QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENVQGADVYPAAQQMLIYQGKVLKDDTTLD  60

Query  254  ENKVAENNFVVVMM  295
            E+KVAEN+F+VVM+
Sbjct  61   ESKVAENSFIVVML  74


 Score =   104 bits (259),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D+YGQAASNL AG+NLE  IQQILDMGGG+W+RETVVRALRAA+NNPERAVEYL
Sbjct  158  DMYGQAASNLVAGSNLEATIQQILDMGGGSWNRETVVRALRAAFNNPERAVEYL  211



>ref|XP_008801153.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Phoenix 
dactylifera]
Length=391

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHFEIEVKPEDTVA+VK+ IE+ QG +VYPA Q MLIHQGK+LKD +TL 
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDTVAEVKRIIESAQGQSVYPAEQQMLIHQGKILKDDSTLN  60

Query  254  ENKVAENNFVVVMM  295
            +NKV+EN+F+V+M+
Sbjct  61   DNKVSENSFIVIML  74


 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D YGQAASNL AGNNLE  IQQILDMGGGTW+R+TVVRAL AAYNNPERAVEYL
Sbjct  150  DAYGQAASNLVAGNNLEKTIQQILDMGGGTWERDTVVRALHAAYNNPERAVEYL  203



>ref|XP_008801154.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Phoenix 
dactylifera]
Length=388

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGTHFEIEVKPEDTVA+VK+ IE+ QG +VYPA Q MLIHQGK+LKD +TL 
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDTVAEVKRIIESAQGQSVYPAEQQMLIHQGKILKDDSTLN  60

Query  254  ENKVAENNFVVVMM  295
            +NKV+EN+F+V+M+
Sbjct  61   DNKVSENSFIVIML  74


 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D YGQAASNL AGNNLE  IQQILDMGGGTW+R+TVVRAL AAYNNPERAVEYL
Sbjct  147  DAYGQAASNLVAGNNLEKTIQQILDMGGGTWERDTVVRALHAAYNNPERAVEYL  200



>gb|KJB80001.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
Length=320

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKGTHF+IEVKPED VADVKK+IETVQG++VYPASQ MLI++GKVLKD TTL 
Sbjct  1    MKVSVKTLKGTHFDIEVKPEDAVADVKKNIETVQGTDVYPASQQMLIYKGKVLKDDTTLA  60

Query  254  ENKVAENNFVVVMM  295
            EN V EN+F+V+M+
Sbjct  61   ENSVTENSFIVIML  74


 Score =   109 bits (273),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG+NLEG IQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYL
Sbjct  138  DVYGQAASNLVAGSNLEGTIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYL  191



>ref|XP_010907325.1| PREDICTED: ubiquitin receptor RAD23d-like [Elaeis guineensis]
Length=391

 Score =   122 bits (305),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGT+FEIEVKPEDTVADVK+ IE+ QG +VYP+ Q MLIHQGK+LKD TT+ 
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKRIIESTQGQSVYPSEQQMLIHQGKILKDDTTMN  60

Query  254  ENKVAENNFVVVMM  295
            +NKV+ENNF+++M+
Sbjct  61   DNKVSENNFIIIML  74


 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D YGQAASNL AG NLE  IQQILDMGGGTW+R+TVVRAL AA NNPERAVEYL
Sbjct  147  DAYGQAASNLVAGGNLEQTIQQILDMGGGTWERDTVVRALHAACNNPERAVEYL  200



>ref|XP_011021231.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Populus euphratica]
Length=399

 Score =   122 bits (305),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGT+FEIEVKPEDTV +VKK+IE  QG++VYPA+Q MLI+QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENAQGADVYPAAQQMLIYQGKVLKDDTTLD  60

Query  254  ENKVAENNFVVVMM  295
            E+KVAEN+F+VVM+
Sbjct  61   ESKVAENSFIVVML  74


 Score =   104 bits (259),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D+YGQAASNL AG+NLE  IQQILDMGGG+W+RETVVRALRAA+NNPERAVEYL
Sbjct  158  DMYGQAASNLVAGSNLEATIQQILDMGGGSWNRETVVRALRAAFNNPERAVEYL  211



>ref|XP_010553920.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Tarenaya hassleriana]
Length=379

 Score =   121 bits (304),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKI VKTLKGT FEIEVKPED V DVKK+IETVQG+NVYPA+Q +LIHQGKVL D TTLE
Sbjct  1    MKISVKTLKGTSFEIEVKPEDKVTDVKKTIETVQGANVYPAAQQILIHQGKVLNDDTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENK+AE  F+V+M+
Sbjct  61   ENKIAEKGFIVIML  74


 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AGN LE  +QQILDMGGG+WDR+TVVRALRAAYNNPERAVEYL
Sbjct  135  DVYGQAASNLVAGNKLESTVQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYL  188



>ref|XP_010553921.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Tarenaya hassleriana]
Length=378

 Score =   121 bits (304),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKI VKTLKGT FEIEVKPED V DVKK+IETVQG+NVYPA+Q +LIHQGKVL D TTLE
Sbjct  1    MKISVKTLKGTSFEIEVKPEDKVTDVKKTIETVQGANVYPAAQQILIHQGKVLNDDTTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENK+AE  F+V+M+
Sbjct  61   ENKIAEKGFIVIML  74


 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AGN LE  +QQILDMGGG+WDR+TVVRALRAAYNNPERAVEYL
Sbjct  134  DVYGQAASNLVAGNKLESTVQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYL  187



>ref|XP_011021232.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Populus euphratica]
Length=398

 Score =   121 bits (304),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGT+FEIEVKPEDTV +VKK+IE  QG++VYPA+Q MLI+QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENAQGADVYPAAQQMLIYQGKVLKDDTTLD  60

Query  254  ENKVAENNFVVVMM  295
            E+KVAEN+F+VVM+
Sbjct  61   ESKVAENSFIVVML  74


 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D+YGQAASNL AG+NLE  IQQILDMGGG+W+RETVVRALRAA+NNPERAVEYL
Sbjct  157  DMYGQAASNLVAGSNLEATIQQILDMGGGSWNRETVVRALRAAFNNPERAVEYL  210



>ref|XP_011021237.1| PREDICTED: ubiquitin receptor RAD23c isoform X5 [Populus euphratica]
Length=364

 Score =   121 bits (303),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGT+FEIEVKPEDTV +VKK+IE  QG++VYPA+Q MLI+QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENAQGADVYPAAQQMLIYQGKVLKDDTTLD  60

Query  254  ENKVAENNFVVVMM  295
            E+KVAEN+F+VVM+
Sbjct  61   ESKVAENSFIVVML  74


 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D+YGQAASNL AG+NLE  IQQILDMGGG+W+RETVVRALRAA+NNPERAVEYL
Sbjct  123  DMYGQAASNLVAGSNLEATIQQILDMGGGSWNRETVVRALRAAFNNPERAVEYL  176



>gb|KJB80000.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
Length=382

 Score =   121 bits (303),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKGTHF+IEVKPED VADVKK+IETVQG++VYPASQ MLI++GKVLKD TTL 
Sbjct  1    MKVSVKTLKGTHFDIEVKPEDAVADVKKNIETVQGTDVYPASQQMLIYKGKVLKDDTTLA  60

Query  254  ENKVAENNFVVVMM  295
            EN V EN+F+V+M+
Sbjct  61   ENSVTENSFIVIML  74


 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG+NLEG IQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYL
Sbjct  136  DVYGQAASNLVAGSNLEGTIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYL  189



>ref|XP_009399729.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=392

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKG++FEI+V PEDTVADVKK+IET QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGSNFEIDVNPEDTVADVKKNIETSQGKTVYPAEQQMLIHQGKILKDDTTLD  60

Query  254  ENKVAENNFVVVMM  295
            ENKV EN+F+V+M+
Sbjct  61   ENKVFENSFLVIML  74


 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D YGQAASNL AG+ LE  IQQILDMGGGTW+R+TVVRALRAAYNNPERAVEYL
Sbjct  147  DSYGQAASNLVAGSTLEQTIQQILDMGGGTWERDTVVRALRAAYNNPERAVEYL  200



>ref|XP_009399730.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=391

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKG++FEI+V PEDTVADVKK+IET QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGSNFEIDVNPEDTVADVKKNIETSQGKTVYPAEQQMLIHQGKILKDDTTLD  60

Query  254  ENKVAENNFVVVMM  295
            ENKV EN+F+V+M+
Sbjct  61   ENKVFENSFLVIML  74


 Score =   102 bits (253),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D YGQAASNL AG+ LE  IQQILDMGGGTW+R+TVVRALRAAYNNPERAVEYL
Sbjct  147  DSYGQAASNLVAGSTLEQTIQQILDMGGGTWERDTVVRALRAAYNNPERAVEYL  200



>ref|XP_002315945.2| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
 gb|EEF02116.2| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
Length=396

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKG+ F+IEVKP DTVADVKK+IET QG++VYPA Q MLI+QGKVLKD TTL 
Sbjct  1    MKIFVKTLKGSTFDIEVKPGDTVADVKKNIETAQGASVYPAEQQMLIYQGKVLKDDTTLG  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74


 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  497  VYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            VYGQAASNL AGNNLEGA+QQILDMGGG+WDR+TVVRALRAAYNNPERAVEYL
Sbjct  152  VYGQAASNLVAGNNLEGAVQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYL  204



>gb|KJB79998.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
 gb|KJB79999.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
Length=384

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKGTHF+IEVKPED VADVKK+IETVQG++VYPASQ MLI++GKVLKD TTL 
Sbjct  1    MKVSVKTLKGTHFDIEVKPEDAVADVKKNIETVQGTDVYPASQQMLIYKGKVLKDDTTLA  60

Query  254  ENKVAENNFVVVMM  295
            EN V EN+F+V+M+
Sbjct  61   ENSVTENSFIVIML  74


 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG+NLEG IQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYL
Sbjct  138  DVYGQAASNLVAGSNLEGTIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYL  191



>ref|XP_011007998.1| PREDICTED: ubiquitin receptor RAD23d-like [Populus euphratica]
Length=388

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKG+ F+IEVKP DTVADVKK+IET QG++VYPA Q MLI+QGKVLKD TTL 
Sbjct  1    MKIFVKTLKGSTFDIEVKPGDTVADVKKNIETAQGASVYPAEQQMLIYQGKVLKDDTTLG  60

Query  254  ENKVAENNFVVVMM  295
            ENKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74


 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  497  VYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            VYGQAASNL AGNNLEGA+QQILDMGGG+WDR+TVVRALRAAYNNPERAVEYL
Sbjct  144  VYGQAASNLVAGNNLEGAVQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYL  196



>ref|XP_007046250.1| Rad23 UV excision repair protein family isoform 2 [Theobroma 
cacao]
 gb|EOY02082.1| Rad23 UV excision repair protein family isoform 2 [Theobroma 
cacao]
Length=340

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKG+HF++EVK ED V+DVKK+IETVQG++VYPA+Q MLIH+GKVLKD TTL 
Sbjct  1    MKIFVKTLKGSHFDVEVKAEDVVSDVKKNIETVQGADVYPAAQQMLIHKGKVLKDDTTLA  60

Query  254  ENKVAENNFVVVMM  295
            EN V EN+F+V+M+
Sbjct  61   ENSVTENSFIVIML  74


 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG++LEGAIQQILDMGGGTWDR+ VVRALRAAYNNPERAVEYL
Sbjct  138  DVYGQAASNLVAGSHLEGAIQQILDMGGGTWDRDIVVRALRAAYNNPERAVEYL  191



>ref|XP_002312393.1| hypothetical protein POPTR_0008s11840g [Populus trichocarpa]
 gb|EEE89760.1| hypothetical protein POPTR_0008s11840g [Populus trichocarpa]
Length=333

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            M+IFVKTLKG+ F+IEVKPEDTVADVKK IET QG  VYPA Q MLIHQ KVLKD TTL+
Sbjct  1    MRIFVKTLKGSTFDIEVKPEDTVADVKKKIETAQGVAVYPAEQQMLIHQAKVLKDNTTLD  60

Query  254  ENKVAENNFVVVMM  295
            ENK+ EN+FVV+M+
Sbjct  61   ENKIVENSFVVIML  74


 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  497  VYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            VYGQAAS+L AG+NLE A+QQILDMGGGTWDR+TVVRALRAAYNNPERA+EYL
Sbjct  91   VYGQAASSLVAGSNLEVAVQQILDMGGGTWDRDTVVRALRAAYNNPERAIEYL  143



>gb|EPS71284.1| hypothetical protein M569_03474, partial [Genlisea aurea]
Length=389

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 64/74 (86%), Gaps = 2/74 (3%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGTHFEIEVKPEDTV+DVK  IET QG   YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVSDVKTIIETAQGE--YPAAQQMLIHQGKVLKDATTLE  58

Query  254  ENKVAENNFVVVMM  295
            EN VAE +FVV+M+
Sbjct  59   ENNVAEKSFVVIML  72


 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVY QAASNL AGNNLEG IQQILDMGGGTWDR++VVRALRAA+NNPERAVEYL
Sbjct  143  DVYSQAASNLVAGNNLEGTIQQILDMGGGTWDRDSVVRALRAAFNNPERAVEYL  196



>ref|XP_008341883.1| PREDICTED: ubiquitin receptor RAD23d-like [Malus domestica]
Length=408

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGT+F IEVKPE+TVADVK  IET QG++VYPA Q MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTNFAIEVKPEETVADVKTIIETAQGADVYPAPQQMLIHQGKVLKDDTTLE  60

Query  254  ENKVAENNFVVVMM  295
             N VAEN+F+V+M+
Sbjct  61   ANNVAENSFIVIML  74


 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG  LE  +QQILDMGGG+WDRETV+RALRAA+NNPERAVEYL
Sbjct  143  DVYGQAASNLVAGTTLESTVQQILDMGGGSWDRETVIRALRAAFNNPERAVEYL  196



>ref|XP_007046249.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
 gb|EOY02081.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
Length=385

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKG+HF++EVK ED V+DVKK+IETVQG++VYPA+Q MLIH+GKVLKD TTL 
Sbjct  1    MKIFVKTLKGSHFDVEVKAEDVVSDVKKNIETVQGADVYPAAQQMLIHKGKVLKDDTTLA  60

Query  254  ENKVAENNFVVVMM  295
            EN V EN+F+V+M+
Sbjct  61   ENSVTENSFIVIML  74


 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG++LEGAIQQILDMGGGTWDR+ VVRALRAAYNNPERAVEYL
Sbjct  138  DVYGQAASNLVAGSHLEGAIQQILDMGGGTWDRDIVVRALRAAYNNPERAVEYL  191



>emb|CAA72741.1| RAD23, isoform I [Daucus carota]
Length=382

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKI+VKTLKG+ FEI+V P+D+VADVK+SIET QG+ VYPA+Q MLI+QGKVLKDGTTL 
Sbjct  1    MKIYVKTLKGSQFEIQVNPDDSVADVKRSIETAQGAAVYPAAQQMLIYQGKVLKDGTTLL  60

Query  254  ENKVAENNFVVVMM  295
            EN VAEN+F+V+M+
Sbjct  61   ENNVAENSFIVIML  74


 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            +VY  AAS L AG+NLEGAIQQILDMGGGTWDR+TV+R +RAA+NNPERAVEYL
Sbjct  143  NVYDSAASLLVAGSNLEGAIQQILDMGGGTWDRDTVIRIVRAAFNNPERAVEYL  196



>ref|XP_009391405.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=408

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGT+FEI+VKPEDTVA VK+ IET QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGTNFEIDVKPEDTVAAVKRYIETSQGKTVYPAEQQMLIHQGKILKDDTTLD  60

Query  254  ENKVAENNFVVVMM  295
            ENKV E+ F+V+M+
Sbjct  61   ENKVCESTFLVIML  74


 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D YGQAASNL AGN LE  IQQILDMGGGTW R+TVVRALRAAYNNPERAVEYL
Sbjct  164  DAYGQAASNLVAGNTLEQTIQQILDMGGGTWARDTVVRALRAAYNNPERAVEYL  217



>ref|XP_009391404.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=409

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGT+FEI+VKPEDTVA VK+ IET QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGTNFEIDVKPEDTVAAVKRYIETSQGKTVYPAEQQMLIHQGKILKDDTTLD  60

Query  254  ENKVAENNFVVVMM  295
            ENKV E+ F+V+M+
Sbjct  61   ENKVCESTFLVIML  74


 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            D YGQAASNL AGN LE  IQQILDMGGGTW R+TVVRALRAAYNNPERAVEYL
Sbjct  165  DAYGQAASNLVAGNTLEQTIQQILDMGGGTWARDTVVRALRAAYNNPERAVEYL  218



>gb|KJB79994.1| hypothetical protein B456_013G076500 [Gossypium raimondii]
Length=384

 Score =   119 bits (297),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKGTHF+IEVKPED VADVKK+IETVQG++VYPA+Q MLI++GKVLKD TTL 
Sbjct  1    MKVSVKTLKGTHFDIEVKPEDAVADVKKNIETVQGADVYPAAQQMLIYKGKVLKDDTTLA  60

Query  254  ENKVAENNFVVVMM  295
            E+ V EN+F+V+M+
Sbjct  61   ESSVTENSFIVIML  74


 Score =   110 bits (274),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG+NLEG IQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYL
Sbjct  138  DVYGQAASNLVAGSNLEGTIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYL  191



>ref|XP_003551850.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Glycine 
max]
 gb|KHN17319.1| Putative DNA repair protein RAD23-4 [Glycine soja]
Length=375

 Score =   118 bits (296),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKI VKTLKGTHF ++V P+DTVA VKK+IET QG++VYPA+Q MLIHQGKVL D TTLE
Sbjct  1    MKINVKTLKGTHFVLQVNPQDTVAVVKKNIETAQGADVYPAAQQMLIHQGKVLNDATTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKV ENNFVV+M+
Sbjct  61   ENKVVENNFVVIML  74


 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  497  VYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            +Y  AASNL AG+NLE  IQQIL+MGGG WDR+TV  AL AA+NNPERA+EYL
Sbjct  135  IYDHAASNLMAGSNLETTIQQILEMGGGNWDRDTVTGALHAAFNNPERAIEYL  187



>gb|KJB79995.1| hypothetical protein B456_013G076600 [Gossypium raimondii]
Length=384

 Score =   118 bits (296),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKGTHF+IEVKPED VADVKK+IETVQG++VYPA+Q MLI +GKVLKD TTL 
Sbjct  1    MKVSVKTLKGTHFDIEVKPEDAVADVKKNIETVQGADVYPAAQQMLIFKGKVLKDDTTLA  60

Query  254  ENKVAENNFVVVMM  295
            EN V EN+F+V+M+
Sbjct  61   ENSVNENSFIVIML  74


 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQ ASNL AG+N EG IQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYL
Sbjct  138  DVYGQTASNLVAGSNFEGTIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYL  191



>ref|XP_011022053.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Populus 
euphratica]
Length=324

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKI VKTLKG+ F+IEV+PEDTVADVKK+IET QG  VYPA Q MLIHQ KVLKD TTL+
Sbjct  1    MKILVKTLKGSTFDIEVRPEDTVADVKKNIETAQGVAVYPAEQQMLIHQAKVLKDNTTLD  60

Query  254  ENKVAENNFVVVMM  295
            ENK+ EN+FVV+M+
Sbjct  61   ENKIVENSFVVIML  74


 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  497  VYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            VY QAAS+L AGNNLE A+QQILDMGGGTWDR+TVVRALRAAYNNPERA+EYL
Sbjct  136  VYDQAASSLVAGNNLEVAVQQILDMGGGTWDRDTVVRALRAAYNNPERAIEYL  188



>ref|XP_010681568.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X6 [Beta vulgaris 
subsp. vulgaris]
Length=354

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKI+VK LKG HF+IEVKP+DTV DVKK+IE+V+G+N++PAS  MLI+QGKVL DGTTLE
Sbjct  4    MKIYVKNLKGKHFQIEVKPQDTVLDVKKNIESVKGANLFPASHQMLIYQGKVLIDGTTLE  63

Query  254  ENKVAENNFVVVMM  295
             NKVAEN+F+V+M+
Sbjct  64   HNKVAENSFIVIML  77


 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  506  QAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            + A +L AGN LE  IQ ILD+GGG WDRETV+RALRAA NNPERAVEYL
Sbjct  165  KTAPDLVAGNGLENTIQHILDIGGGIWDRETVLRALRAASNNPERAVEYL  214



>ref|XP_010681566.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X4 [Beta vulgaris 
subsp. vulgaris]
Length=373

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKI+VK LKG HF+IEVKP+DTV DVKK+IE+V+G+N++PAS  MLI+QGKVL DGTTLE
Sbjct  4    MKIYVKNLKGKHFQIEVKPQDTVLDVKKNIESVKGANLFPASHQMLIYQGKVLIDGTTLE  63

Query  254  ENKVAENNFVVVMM  295
             NKVAEN+F+V+M+
Sbjct  64   HNKVAENSFIVIML  77


 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  506  QAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            + A +L AGN LE  IQ ILD+GGG WDRETV+RALRAA NNPERAVEYL
Sbjct  184  KTAPDLVAGNGLENTIQHILDIGGGIWDRETVLRALRAASNNPERAVEYL  233



>ref|XP_010681565.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X3 [Beta vulgaris 
subsp. vulgaris]
Length=376

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKI+VK LKG HF+IEVKP+DTV DVKK+IE+V+G+N++PAS  MLI+QGKVL DGTTLE
Sbjct  4    MKIYVKNLKGKHFQIEVKPQDTVLDVKKNIESVKGANLFPASHQMLIYQGKVLIDGTTLE  63

Query  254  ENKVAENNFVVVMM  295
             NKVAEN+F+V+M+
Sbjct  64   HNKVAENSFIVIML  77


 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  506  QAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            + A +L AGN LE  IQ ILD+GGG WDRETV+RALRAA NNPERAVEYL
Sbjct  187  KTAPDLVAGNGLENTIQHILDIGGGIWDRETVLRALRAASNNPERAVEYL  236



>ref|XP_010681567.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X5 [Beta vulgaris 
subsp. vulgaris]
Length=357

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKI+VK LKG HF+IEVKP+DTV DVKK+IE+V+G+N++PAS  MLI+QGKVL DGTTLE
Sbjct  4    MKIYVKNLKGKHFQIEVKPQDTVLDVKKNIESVKGANLFPASHQMLIYQGKVLIDGTTLE  63

Query  254  ENKVAENNFVVVMM  295
             NKVAEN+F+V+M+
Sbjct  64   HNKVAENSFIVIML  77


 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  506  QAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            + A +L AGN LE  IQ ILD+GGG WDRETV+RALRAA NNPERAVEYL
Sbjct  168  KTAPDLVAGNGLENTIQHILDIGGGIWDRETVLRALRAASNNPERAVEYL  217



>ref|XP_010681564.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=392

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKI+VK LKG HF+IEVKP+DTV DVKK+IE+V+G+N++PAS  MLI+QGKVL DGTTLE
Sbjct  4    MKIYVKNLKGKHFQIEVKPQDTVLDVKKNIESVKGANLFPASHQMLIYQGKVLIDGTTLE  63

Query  254  ENKVAENNFVVVMM  295
             NKVAEN+F+V+M+
Sbjct  64   HNKVAENSFIVIML  77


 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  506  QAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            + A +L AGN LE  IQ ILD+GGG WDRETV+RALRAA NNPERAVEYL
Sbjct  203  KTAPDLVAGNGLENTIQHILDIGGGIWDRETVLRALRAASNNPERAVEYL  252



>ref|XP_004304134.1| PREDICTED: ubiquitin receptor RAD23d-like [Fragaria vesca subsp. 
vesca]
Length=390

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGT+FEIEV+P+  VADVK+ IE  QG++VYPAS+ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTNFEIEVEPKQLVADVKQVIEKAQGADVYPASKQMLIHQGKVLKDATTLE  60

Query  254  ENKVAENNFVVVMM  295
            EN+VAEN+F+V+M+
Sbjct  61   ENQVAENSFIVIML  74


 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AGNNLE  +QQILDMGGG+WDR+TV+RALRAA+NNPERAVEYL
Sbjct  137  DVYGQAASNLVAGNNLEVIVQQILDMGGGSWDRDTVLRALRAAFNNPERAVEYL  190



>ref|XP_010681563.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=395

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKI+VK LKG HF+IEVKP+DTV DVKK+IE+V+G+N++PAS  MLI+QGKVL DGTTLE
Sbjct  4    MKIYVKNLKGKHFQIEVKPQDTVLDVKKNIESVKGANLFPASHQMLIYQGKVLIDGTTLE  63

Query  254  ENKVAENNFVVVMM  295
             NKVAEN+F+V+M+
Sbjct  64   HNKVAENSFIVIML  77


 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  506  QAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            + A +L AGN LE  IQ ILD+GGG WDRETV+RALRAA NNPERAVEYL
Sbjct  206  KTAPDLVAGNGLENTIQHILDIGGGIWDRETVLRALRAASNNPERAVEYL  255



>ref|XP_004489115.1| PREDICTED: putative DNA repair protein RAD23-4-like [Cicer arietinum]
Length=377

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKI VKTLKGTHFEI+V  +DTV DVKK+IE VQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKINVKTLKGTHFEIQVNLQDTVGDVKKNIEAVQGVDVYPAAQQMLIHQGKVLKDDTTLE  60

Query  254  ENKVAENNFVVVMM  295
            EN+VAEN+FVV+M+
Sbjct  61   ENQVAENSFVVIML  74


 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  497  VYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
             YGQA SNL AG+NLE  IQQIL+MGGG+WDR+TV+RALRAAYNNPERAVEYL
Sbjct  139  TYGQAESNLIAGSNLESTIQQILEMGGGSWDRDTVIRALRAAYNNPERAVEYL  191



>ref|XP_006655985.1| PREDICTED: ubiquitin receptor RAD23c-like [Oryza brachyantha]
Length=409

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGT+FEIE  PE +VA+VKK IET QG NVYPA Q MLIHQGK+LKD TTLE
Sbjct  1    MKLFVKTLKGTNFEIEASPEASVAEVKKIIETTQGQNVYPADQQMLIHQGKILKDDTTLE  60

Query  254  ENKVAENNFVVVMM  295
             NKVAEN+F+V+M+
Sbjct  61   GNKVAENSFLVIML  74


 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVY QAASNL +G+NLE  IQQILDMGGGTW+R+ VVRALRAAYNNPERA++YL
Sbjct  147  DVYSQAASNLVSGSNLEETIQQILDMGGGTWERDMVVRALRAAYNNPERAIDYL  200



>ref|XP_011022044.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Populus 
euphratica]
Length=378

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKI VKTLKG+ F+IEV+PEDTVADVKK+IET QG  VYPA Q MLIHQ KVLKD TTL+
Sbjct  1    MKILVKTLKGSTFDIEVRPEDTVADVKKNIETAQGVAVYPAEQQMLIHQAKVLKDNTTLD  60

Query  254  ENKVAENNFVVVMM  295
            ENK+ EN+FVV+M+
Sbjct  61   ENKIVENSFVVIML  74


 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  497  VYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            VY QAAS+L AGNNLE A+QQILDMGGGTWDR+TVVRALRAAYNNPERA+EYL
Sbjct  136  VYDQAASSLVAGNNLEVAVQQILDMGGGTWDRDTVVRALRAAYNNPERAIEYL  188



>gb|AFK37901.1| unknown [Medicago truncatula]
Length=215

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKI VKTLKGTHFEI+V   DTV DVKK+IE  QG+ VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKINVKTLKGTHFEIQVNLHDTVGDVKKNIEGAQGAAVYPAAQQMLIHQGKVLKDETTLE  60

Query  254  ENKVAENNFVVVMM  295
            EN+VAEN+F+V+M+
Sbjct  61   ENQVAENSFIVIML  74


 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  515  SNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            SNL AG+ LE  IQQIL+MGGG+WDR+TV+RALRAAYNNPERAVEYL
Sbjct  137  SNLIAGSTLEPTIQQILEMGGGSWDRDTVIRALRAAYNNPERAVEYL  183



>ref|NP_001057334.1| Os06g0264300 [Oryza sativa Japonica Group]
 dbj|BAD54365.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAD54370.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAF19248.1| Os06g0264300 [Oryza sativa Japonica Group]
 gb|EAZ36555.1| hypothetical protein OsJ_20893 [Oryza sativa Japonica Group]
 dbj|BAG88004.1| unnamed protein product [Oryza sativa Japonica Group]
Length=413

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGT+FEIE  PE +VA+VK+ IE+ QG NVYPA Q MLIHQGK+LKD TTLE
Sbjct  1    MKLFVKTLKGTNFEIEASPEASVAEVKRIIESTQGQNVYPADQQMLIHQGKILKDDTTLE  60

Query  254  ENKVAENNFVVVMM  295
             NKVAEN+F+V+M+
Sbjct  61   GNKVAENSFLVIML  74


 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVY QAASNL +G+NLE  IQQILDMGGGTW+R+ VVRALRAAYNNPERA++YL
Sbjct  150  DVYSQAASNLVSGSNLEQTIQQILDMGGGTWERDMVVRALRAAYNNPERAIDYL  203



>gb|EAZ00429.1| hypothetical protein OsI_22453 [Oryza sativa Indica Group]
Length=413

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGT+FEIE  PE +VA+VK+ IE+ QG NVYPA Q MLIHQGK+LKD TTLE
Sbjct  1    MKLFVKTLKGTNFEIEASPEASVAEVKRIIESTQGQNVYPADQQMLIHQGKILKDDTTLE  60

Query  254  ENKVAENNFVVVMM  295
             NKVAEN+F+V+M+
Sbjct  61   GNKVAENSFLVIML  74


 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVY QAASNL +G+NLE  IQQILDMGGGTW+R+ VVRALRAAYNNPERA++YL
Sbjct  150  DVYSQAASNLVSGSNLEQTIQQILDMGGGTWERDMVVRALRAAYNNPERAIDYL  203



>gb|KFK33251.1| hypothetical protein AALP_AA6G350300 [Arabis alpina]
Length=392

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGT+FEIEVKP DTV+DVKK+IET+ G + YPA+Q MLIHQGK+L D +TLE
Sbjct  1    MKIFVKTLKGTNFEIEVKPVDTVSDVKKAIETLHGEH-YPAAQQMLIHQGKILNDASTLE  59

Query  254  ENKVAENNFVVVMM  295
            EN VAEN+F+V+M+
Sbjct  60   ENNVAENSFIVIML  73


 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG NLE  +QQILDMGGG+WDR+TV+RALRAA+NNPERAVEYL
Sbjct  147  DVYGQAASNLVAGTNLESTVQQILDMGGGSWDRDTVIRALRAAFNNPERAVEYL  200



>ref|XP_010435751.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Camelina 
sativa]
Length=374

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTL GT+FEIEVKP DTV+DVK++IETVQG+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSDVKQAIETVQGAQ-YPAAKQMLIHQGKVLKDETTLE  59

Query  254  ENKVAENNFVVVMM  295
            EN V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73


 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG  LE  +QQILDMGGG+WDR+TVVRALRAA+NNPERAVEYL
Sbjct  133  DVYGQAASNLVAGTVLESTVQQILDMGGGSWDRDTVVRALRAAFNNPERAVEYL  186



>gb|KEH21499.1| RAD23 UV excision repair family protein [Medicago truncatula]
Length=370

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKI VKTLKGTHFEI+V   DTV DVKK+IE  QG+ VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKINVKTLKGTHFEIQVNLHDTVGDVKKNIEGAQGAAVYPAAQQMLIHQGKVLKDETTLE  60

Query  254  ENKVAENNFVVVMM  295
            EN+VAEN+F+V+M+
Sbjct  61   ENQVAENSFIVIML  74


 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  515  SNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            SNL AG+ LE  IQQIL+MGGG+WDR+TV+RALRAAYNNPERAVEYL
Sbjct  137  SNLIAGSTLEPTIQQILEMGGGSWDRDTVIRALRAAYNNPERAVEYL  183



>ref|XP_010450905.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Camelina sativa]
Length=381

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTL GT+FEIEVKP DTV+DVK++IETVQG+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSDVKQAIETVQGAQ-YPAAKQMLIHQGKVLKDETTLE  59

Query  254  ENKVAENNFVVVMM  295
            EN V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73


 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG  LE  +QQILDMGGG+WDR+TVVRALRAA+NNPERAVEYL
Sbjct  137  DVYGQAASNLVAGTVLESTVQQILDMGGGSWDRDTVVRALRAAFNNPERAVEYL  190



>gb|AFK37577.1| unknown [Lotus japonicus]
Length=376

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKI VKTLKGTHF+I+V  +D+VADVKK+IE  QG+ VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKINVKTLKGTHFQIQVNLQDSVADVKKTIEVAQGAGVYPAAQQMLIHQGKVLKDDTTLE  60

Query  254  ENKVAENNFVVVMM  295
            EN VAE++FVV+M+
Sbjct  61   ENNVAEDSFVVIML  74


 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  497  VYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            VYGQAASNL AG+N++  +QQIL+MGGG+WDR+TV+RALRAAYNNPERAVEYL
Sbjct  141  VYGQAASNLIAGSNVDPTVQQILEMGGGSWDRDTVIRALRAAYNNPERAVEYL  193



>ref|XP_010450906.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Camelina sativa]
Length=379

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTL GT+FEIEVKP DTV+DVK++IETVQG+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSDVKQAIETVQGAQ-YPAAKQMLIHQGKVLKDETTLE  59

Query  254  ENKVAENNFVVVMM  295
            EN V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73


 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG  LE  +QQILDMGGG+WDR+TVVRALRAA+NNPERAVEYL
Sbjct  135  DVYGQAASNLVAGTVLESTVQQILDMGGGSWDRDTVVRALRAAFNNPERAVEYL  188



>ref|XP_003563980.1| PREDICTED: ubiquitin receptor RAD23d-like [Brachypodium distachyon]
Length=413

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+FVKTLKGT+FEIE  PE +VA+VK+ IE  QG NVYPA Q MLIHQGK+LKD TTLE
Sbjct  1    MKLFVKTLKGTNFEIEASPEASVAEVKRIIEGAQGQNVYPADQQMLIHQGKILKDDTTLE  60

Query  254  ENKVAENNFVVVMM  295
             N VAEN+F+V+M+
Sbjct  61   GNNVAENSFLVIML  74


 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVY QAASNL +G +LE  +Q ILDMGGGTW+R+ VVRALRAAYNNPERA++YL
Sbjct  153  DVYSQAASNLVSGGSLEQTVQHILDMGGGTWERDMVVRALRAAYNNPERAIDYL  206



>ref|XP_002870839.1| hypothetical protein ARALYDRAFT_494129 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47098.1| hypothetical protein ARALYDRAFT_494129 [Arabidopsis lyrata subsp. 
lyrata]
Length=377

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 65/74 (88%), Gaps = 1/74 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTL GT+FEIEVKP DTV+DVKK+IETV+G+  YPA + MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLSGTNFEIEVKPADTVSDVKKAIETVKGAE-YPAVKQMLIHQGKVLKDETTLE  59

Query  254  ENKVAENNFVVVMM  295
            EN V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73


 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG  LE  +QQILDMGGG+WDR+TVVRALRAA+NNPERAVEYL
Sbjct  133  DVYGQAASNLVAGTTLESTVQQILDMGGGSWDRDTVVRALRAAFNNPERAVEYL  186



>emb|CDY01661.1| BnaC04g30910D [Brassica napus]
Length=378

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGT+FEIEV P DT++D K+ IET QG+  YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTNFEIEVNPADTISDTKRRIETHQGAQ-YPAAQQMLIHQGKVLKDETTLE  59

Query  254  ENKVAENNFVVVMM  295
            EN V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73


 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AGN LE  +QQILDMGGG+WDR+TVVRALRAA+NNPERAVEYL
Sbjct  136  DVYGQAASNLVAGNTLESTVQQILDMGGGSWDRDTVVRALRAAFNNPERAVEYL  189



>ref|XP_009139789.1| PREDICTED: ubiquitin receptor RAD23d [Brassica rapa]
Length=378

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGT+FEIEV P DT++D K+ IET QG+  YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTNFEIEVNPADTISDTKRRIETHQGAQ-YPAAQQMLIHQGKVLKDETTLE  59

Query  254  ENKVAENNFVVVMM  295
            EN V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73


 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AGN LE  +QQILDMGGG+WDR+TVVRALRAA+NNPERAVEYL
Sbjct  136  DVYGQAASNLVAGNTLESTVQQILDMGGGSWDRDTVVRALRAAFNNPERAVEYL  189



>ref|XP_003578094.1| PREDICTED: probable ubiquitin receptor RAD23 [Brachypodium distachyon]
Length=395

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKG+ F+IEV P D V+DVKK IE+ QG NVYPA Q MLIHQG VLKD TTLE
Sbjct  1    MKVSVKTLKGSSFQIEVNPADKVSDVKKLIESSQGQNVYPADQQMLIHQGTVLKDDTTLE  60

Query  254  ENKVAENNFVVVMM  295
            E+KV ENNF+V+M+
Sbjct  61   ESKVLENNFLVIML  74


 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            + YGQAASNL AG NLE  IQ IL+MGGGTWDR+TV+RALRAA+NNPERAVEYL
Sbjct  149  ETYGQAASNLVAGGNLEATIQSILEMGGGTWDRDTVLRALRAAFNNPERAVEYL  202



>gb|KCW86330.1| hypothetical protein EUGRSUZ_B03019 [Eucalyptus grandis]
Length=320

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKI VKTLKGT+FEIEV+P++ V DVKK IE +QG++++PASQ MLIHQGKVLKD TTL+
Sbjct  1    MKINVKTLKGTNFEIEVEPQEAVVDVKKKIEIIQGASMFPASQQMLIHQGKVLKDETTLD  60

Query  254  ENKVAENNFVVVMM  295
            ENK+ E +F+V+M+
Sbjct  61   ENKIVEGSFIVIML  74


 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG+NLEG IQ+IL+MGGGTWDR+TVVRALRAA+NNPERAVEYL
Sbjct  147  DVYGQAASNLVAGSNLEGTIQEILEMGGGTWDRDTVVRALRAAFNNPERAVEYL  200



>emb|CDX74522.1| BnaA04g08670D [Brassica napus]
Length=380

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGT+FEIEV P DT++D K+ IE+ QG+  YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTNFEIEVNPADTISDTKRRIESHQGAQ-YPAAQQMLIHQGKVLKDETTLE  59

Query  254  ENKVAENNFVVVMM  295
            EN V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73


 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AGN LE  +QQILDMGGG+WDR+TVVRALRAA+NNPERAVEYL
Sbjct  138  DVYGQAASNLVAGNTLESTVQQILDMGGGSWDRDTVVRALRAAFNNPERAVEYL  191



>ref|XP_010692904.1| PREDICTED: ubiquitin receptor RAD23d [Beta vulgaris subsp. vulgaris]
Length=409

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGT+FEI+   +DTVADVKKSIE +QG+  YPA+  MLIHQGKVLKD TTL 
Sbjct  1    MKIFVKTLKGTNFEIDANIDDTVADVKKSIEKIQGAETYPANLQMLIHQGKVLKDTTTLG  60

Query  254  ENKVAENNFVVVMM  295
            EN VAEN+F+V+M+
Sbjct  61   ENNVAENSFLVIML  74


 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYG AASNL AG++LE  +QQILDMGGG+WDR+TVVRALRAAYNNPERAVEYL
Sbjct  143  DVYGLAASNLVAGSHLETTVQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYL  196



>gb|EMS50196.1| putative DNA repair protein RAD23 [Triticum urartu]
Length=610

 Score =   112 bits (281),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKG+ FEIEV P D V+DVKK IET QG NVYPA Q MLI+QG VLKD TTLE
Sbjct  1    MKVSVKTLKGSKFEIEVNPADKVSDVKKLIETSQGQNVYPADQQMLIYQGSVLKDETTLE  60

Query  254  ENKVAENNFVVVMM  295
            ENKV ENNF+V+M+
Sbjct  61   ENKVVENNFLVIML  74


 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            + YGQAASNL AG  LE  IQ IL+MGGGTWDR+TV+RALRAA+NNPERAVEYL
Sbjct  149  ETYGQAASNLVAGGTLEATIQSILEMGGGTWDRDTVLRALRAAFNNPERAVEYL  202



>ref|XP_010044267.1| PREDICTED: ubiquitin receptor RAD23d-like [Eucalyptus grandis]
 gb|KCW86329.1| hypothetical protein EUGRSUZ_B03019 [Eucalyptus grandis]
Length=401

 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKI VKTLKGT+FEIEV+P++ V DVKK IE +QG++++PASQ MLIHQGKVLKD TTL+
Sbjct  1    MKINVKTLKGTNFEIEVEPQEAVVDVKKKIEIIQGASMFPASQQMLIHQGKVLKDETTLD  60

Query  254  ENKVAENNFVVVMM  295
            ENK+ E +F+V+M+
Sbjct  61   ENKIVEGSFIVIML  74


 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG+NLEG IQ+IL+MGGGTWDR+TVVRALRAA+NNPERAVEYL
Sbjct  147  DVYGQAASNLVAGSNLEGTIQEILEMGGGTWDRDTVVRALRAAFNNPERAVEYL  200



>dbj|BAC76395.1| RAD23-like protein [Arabidopsis thaliana]
Length=343

 Score =   110 bits (274),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTL G++FEIEVKP D V+DVK +IETV+G+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLSGSNFEIEVKPADKVSDVKTAIETVKGAE-YPAAKQMLIHQGKVLKDETTLE  59

Query  254  ENKVAENNFVVVMM  295
            EN V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73


 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AG  LE  +QQILDMGGG+WDR+TVVRALRAA+NNPERAVEYL
Sbjct  133  DVYGQAASNLVAGTTLESTVQQILDMGGGSWDRDTVVRALRAAFNNPERAVEYL  186



>gb|EMS61794.1| putative DNA repair protein RAD23 [Triticum urartu]
Length=424

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKGT FEIE  PE +V +VK+ IE+ QG NVYPA QLM+I+QGK+LKD TTLE
Sbjct  1    MKLNVKTLKGTSFEIEATPESSVGEVKRIIESAQGQNVYPADQLMIIYQGKILKDDTTLE  60

Query  254  ENKVAENNFVVVMM  295
             NKVAEN+F+V+M+
Sbjct  61   ANKVAENSFLVIML  74


 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVY QAASNL +G +LE  +QQILDMGGGTW+R+ VVRALRAAYNNPERA++YL
Sbjct  148  DVYSQAASNLVSGGSLEQTVQQILDMGGGTWERDMVVRALRAAYNNPERAIDYL  201



>gb|KDO69966.1| hypothetical protein CISIN_1g0163871mg, partial [Citrus sinensis]
Length=277

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/53 (94%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  497  VYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            VYG AASNL AGNNLEGAIQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYL
Sbjct  122  VYGHAASNLVAGNNLEGAIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYL  174


 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  140  VADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLEENKVAENNFVVVMM  295
            V DVK  IETVQGS+VYPA+Q MLI+QGKVLKD TTLEENKVAEN+FVV+M+
Sbjct  1    VFDVKMKIETVQGSDVYPAAQQMLIYQGKVLKDDTTLEENKVAENSFVVIML  52



>emb|CDX67404.1| BnaA07g14440D [Brassica napus]
Length=382

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGT+FEIEV P +T++D KK IET+ G+  YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTNFEIEVNPAETISDTKKRIETLHGAQ-YPAAQQMLIHQGKVLKDETTLE  59

Query  254  ENKVAENNFVVVMM  295
            EN V +N+F+V+M+
Sbjct  60   ENNVVDNSFIVIML  73


 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AGNNLE  +QQILDMGGG+WDR+TV+RALRAA+NNPERAVEYL
Sbjct  137  DVYGQAASNLVAGNNLESTVQQILDMGGGSWDRDTVIRALRAAFNNPERAVEYL  190



>dbj|BAJ97496.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=420

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKGT FEIE  PE +V +VK+ IE+ QG NVYPA QLM+I+QGK+LKD TTL+
Sbjct  1    MKLNVKTLKGTSFEIEATPESSVGEVKRIIESAQGQNVYPADQLMIIYQGKILKDDTTLD  60

Query  254  ENKVAENNFVVVMM  295
             NKVAEN+F+V+M+
Sbjct  61   ANKVAENSFLVIML  74


 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVY QAASNL +G  LE  +QQILDMGGGTW+R+ VVRALRAAYNNPERA++YL
Sbjct  153  DVYSQAASNLVSGGILEQTVQQILDMGGGTWERDMVVRALRAAYNNPERAIDYL  206



>dbj|BAJ98767.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=414

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MK+ VKTLKGT FEIE  PE +V +VK+ IE+ QG NVYPA QLM+I+QGK+LKD TTL+
Sbjct  1    MKLNVKTLKGTSFEIEATPESSVGEVKRIIESAQGQNVYPADQLMIIYQGKILKDDTTLD  60

Query  254  ENKVAENNFVVVMM  295
             NKVAEN+F+V+M+
Sbjct  61   ANKVAENSFLVIML  74


 Score = 93.6 bits (231),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVY QAASNL +G  LE  +QQILDMGGGTW+R+ VVRALRAAYNNPERA++YL
Sbjct  153  DVYSQAASNLVSGGILEQTVQQILDMGGGTWERDMVVRALRAAYNNPERAIDYL  206



>ref|XP_009125074.1| PREDICTED: ubiquitin receptor RAD23d [Brassica rapa]
Length=382

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = +2

Query  74   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  253
            MKIFVKTLKGT+FEIEV P +T++D KK IET+ G+  YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTNFEIEVNPAETISDTKKRIETLHGAQ-YPAAQQMLIHQGKVLKDETTLE  59

Query  254  ENKVAENNFVVVMM  295
            EN V +N+F+V+M+
Sbjct  60   ENNVVDNSFIVIML  73


 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  494  DVYGQAASNLAAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYL  655
            DVYGQAASNL AGNNLE  +QQILDMGGG+WDR+TV+RALRAA+NNPERAVEYL
Sbjct  137  DVYGQAASNLVAGNNLESTVQQILDMGGGSWDRDTVIRALRAAFNNPERAVEYL  190



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1028498319500