BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF041I24

Length=644
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007227719.1|  hypothetical protein PRUPE_ppa007047mg             195   1e-56   Prunus persica
ref|XP_011097188.1|  PREDICTED: ubiquitin receptor RAD23c-like          191   7e-55   Sesamum indicum [beniseed]
ref|XP_009607597.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    189   3e-54   Nicotiana tomentosiformis
ref|XP_007223090.1|  hypothetical protein PRUPE_ppa007032mg             189   4e-54   Prunus persica
ref|XP_007223091.1|  hypothetical protein PRUPE_ppa007032mg             186   7e-54   
ref|XP_009607598.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    186   2e-53   Nicotiana tomentosiformis
ref|XP_008243218.1|  PREDICTED: ubiquitin receptor RAD23d-like          187   2e-53   
ref|XP_009781758.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    187   2e-53   Nicotiana sylvestris
ref|XP_011099561.1|  PREDICTED: ubiquitin receptor RAD23c-like          186   4e-53   Sesamum indicum [beniseed]
ref|XP_006363121.1|  PREDICTED: ubiquitin receptor RAD23c-like          186   4e-53   Solanum tuberosum [potatoes]
ref|XP_002283656.1|  PREDICTED: ubiquitin receptor RAD23c               186   6e-53   Vitis vinifera
ref|XP_009356279.1|  PREDICTED: ubiquitin receptor RAD23d-like          185   1e-52   Pyrus x bretschneideri [bai li]
ref|XP_002516727.1|  uv excision repair protein rad23, putative         184   1e-52   Ricinus communis
ref|XP_009781759.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    184   1e-52   Nicotiana sylvestris
gb|AII99835.1|  putative DNA repair protein RAD23-3-like protein        184   2e-52   Nicotiana tabacum [American tobacco]
gb|KDP32945.1|  hypothetical protein JCGZ_12976                         184   3e-52   Jatropha curcas
ref|XP_009784661.1|  PREDICTED: ubiquitin receptor RAD23d               184   4e-52   Nicotiana sylvestris
ref|XP_007215515.1|  hypothetical protein PRUPE_ppa007020mg             183   6e-52   Prunus persica
ref|XP_008230399.1|  PREDICTED: ubiquitin receptor RAD23d               183   7e-52   Prunus mume [ume]
gb|KJB80005.1|  hypothetical protein B456_013G076900                    181   3e-51   Gossypium raimondii
ref|XP_004232367.1|  PREDICTED: ubiquitin receptor RAD23d               181   3e-51   
gb|KJB80004.1|  hypothetical protein B456_013G076900                    181   3e-51   Gossypium raimondii
ref|XP_010552226.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    179   2e-50   Tarenaya hassleriana [spider flower]
ref|XP_008379541.1|  PREDICTED: ubiquitin receptor RAD23d-like          177   1e-49   
ref|XP_006846642.1|  hypothetical protein AMTR_s00156p00078120          176   2e-49   Amborella trichopoda
ref|XP_011021233.1|  PREDICTED: ubiquitin receptor RAD23c isoform X3    176   2e-49   Populus euphratica
ref|XP_008368214.1|  PREDICTED: ubiquitin receptor RAD23c-like          175   6e-49   
ref|XP_011035052.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    175   6e-49   Populus euphratica
ref|XP_002305813.1|  ubiquitin family protein                           173   5e-48   Populus trichocarpa [western balsam poplar]
ref|XP_009356676.1|  PREDICTED: ubiquitin receptor RAD23c-like          173   5e-48   Pyrus x bretschneideri [bai li]
ref|XP_011021236.1|  PREDICTED: ubiquitin receptor RAD23c isoform X4    171   3e-47   Populus euphratica
ref|XP_006383464.1|  ubiquitin family protein                           170   4e-47   
ref|XP_011035051.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    168   2e-46   Populus euphratica
ref|XP_010440953.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    165   3e-45   Camelina sativa [gold-of-pleasure]
ref|NP_001078680.1|  ubiquitin receptor RAD23d                          160   8e-44   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC76395.1|  RAD23-like protein                                     160   1e-43   Arabidopsis thaliana [mouse-ear cress]
emb|CDY58121.1|  BnaCnng32650D                                          161   1e-43   Brassica napus [oilseed rape]
ref|NP_001130219.1|  uncharacterized protein LOC100191313               156   2e-43   
ref|XP_010103794.1|  Putative DNA repair protein RAD23-4                162   4e-43   
ref|XP_004956778.1|  PREDICTED: probable DNA repair protein RAD23...    159   1e-42   Setaria italica
gb|KDO46132.1|  hypothetical protein CISIN_1g0198171mg                  154   1e-42   Citrus sinensis [apfelsine]
tpg|DAA61375.1|  TPA: hypothetical protein ZEAMMB73_350633              157   1e-42   
ref|XP_006283908.1|  hypothetical protein CARUB_v10005026mg             157   6e-42   Capsella rubella
gb|KDO46130.1|  hypothetical protein CISIN_1g0198171mg                  153   7e-42   Citrus sinensis [apfelsine]
ref|XP_008650775.1|  PREDICTED: uncharacterized protein LOC100191...    156   8e-42   
gb|KDO46129.1|  hypothetical protein CISIN_1g0198171mg                  154   9e-42   Citrus sinensis [apfelsine]
ref|XP_004956777.1|  PREDICTED: probable DNA repair protein RAD23...    157   1e-41   
ref|XP_007135849.1|  hypothetical protein PHAVU_010G163300g             152   3e-40   Phaseolus vulgaris [French bean]
gb|KJB69953.1|  hypothetical protein B456_011G053200                    150   6e-40   Gossypium raimondii
gb|KJB34920.1|  hypothetical protein B456_006G091100                    150   9e-40   Gossypium raimondii
gb|KHG13236.1|  Putative DNA repair RAD23-1 -like protein               150   1e-39   Gossypium arboreum [tree cotton]
gb|KJB69954.1|  hypothetical protein B456_011G053200                    149   1e-39   Gossypium raimondii
gb|KJB69952.1|  hypothetical protein B456_011G053200                    150   1e-39   Gossypium raimondii
gb|EMT27109.1|  Putative DNA repair protein RAD23                       150   2e-39   
ref|XP_008462953.1|  PREDICTED: ubiquitin receptor RAD23b isoform X1    149   3e-39   Cucumis melo [Oriental melon]
ref|XP_009365249.1|  PREDICTED: ubiquitin receptor RAD23b-like          148   7e-39   Pyrus x bretschneideri [bai li]
ref|XP_010435749.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    148   8e-39   Camelina sativa [gold-of-pleasure]
gb|KHG09850.1|  Putative DNA repair RAD23-1 -like protein               148   8e-39   Gossypium arboreum [tree cotton]
gb|ACU20959.1|  unknown                                                 147   2e-38   Glycine max [soybeans]
ref|NP_001240038.1|  uncharacterized protein LOC100819019               147   2e-38   Glycine max [soybeans]
ref|XP_003529480.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    147   2e-38   Glycine max [soybeans]
ref|NP_001149553.1|  LOC100283179                                       147   3e-38   Zea mays [maize]
gb|ACH72675.1|  RAD23                                                   147   4e-38   Pinus sylvestris var. mongolica
gb|ABK24371.1|  unknown                                                 145   1e-37   Picea sitchensis
gb|KGN58646.1|  hypothetical protein Csa_3G710740                       145   1e-37   Cucumis sativus [cucumbers]
gb|KJB67005.1|  hypothetical protein B456_010G170000                    144   3e-37   Gossypium raimondii
gb|AAB65841.1|  osRAD23                                                 144   4e-37   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001063134.1|  Os09g0407200                                       144   4e-37   
ref|XP_010532056.1|  PREDICTED: ubiquitin receptor RAD23b               141   3e-36   Tarenaya hassleriana [spider flower]
ref|XP_002889262.1|  hypothetical protein ARALYDRAFT_316857             138   3e-35   Arabidopsis lyrata subsp. lyrata
ref|XP_009791274.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    139   4e-35   Nicotiana sylvestris
ref|XP_009631150.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    139   4e-35   Nicotiana tomentosiformis
ref|XP_009791275.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    138   5e-35   Nicotiana sylvestris
ref|XP_009631151.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    138   6e-35   
gb|KHN38092.1|  Putative DNA repair protein RAD23-1                     139   7e-35   Glycine soja [wild soybean]
ref|NP_974181.1|  ubiquitin receptor RAD23b                             137   8e-35   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC76389.1|  RAD23-like protein                                     137   1e-34   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850982.1|  ubiquitin receptor RAD23b                             137   1e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009597821.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    131   1e-34   Nicotiana tomentosiformis
ref|XP_004233495.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    137   1e-34   Solanum lycopersicum
ref|XP_010317192.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    137   1e-34   Solanum lycopersicum
ref|XP_004236965.1|  PREDICTED: ubiquitin receptor RAD23c               137   1e-34   Solanum lycopersicum
ref|XP_004233496.1|  PREDICTED: ubiquitin receptor RAD23c isoform X3    137   1e-34   Solanum lycopersicum
ref|XP_006367045.1|  PREDICTED: ubiquitin receptor RAD23c-like          137   2e-34   
ref|NP_565216.2|  ubiquitin receptor RAD23b                             136   2e-34   Arabidopsis thaliana [mouse-ear cress]
gb|AAF18513.1|AC010924_26  Contains similarity to gb|Y12014 RAD23...    134   2e-34   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC76390.1|  RAD23-like protein                                     136   2e-34   Arabidopsis thaliana [mouse-ear cress]
gb|ABG89119.1|  Rad23-3Ai                                               136   2e-34   synthetic construct
ref|XP_010429866.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    135   4e-34   Camelina sativa [gold-of-pleasure]
gb|KDO58999.1|  hypothetical protein CISIN_1g014118mg                   134   5e-34   Citrus sinensis [apfelsine]
ref|XP_010429867.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    135   5e-34   Camelina sativa [gold-of-pleasure]
emb|CDP19777.1|  unnamed protein product                                135   7e-34   Coffea canephora [robusta coffee]
ref|XP_010498530.1|  PREDICTED: ubiquitin receptor RAD23c-like          135   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010463666.1|  PREDICTED: ubiquitin receptor RAD23c               135   1e-33   Camelina sativa [gold-of-pleasure]
gb|KDO59000.1|  hypothetical protein CISIN_1g014118mg                   134   2e-33   Citrus sinensis [apfelsine]
emb|CDX74251.1|  BnaA03g27960D                                          134   2e-33   
ref|XP_010647738.1|  PREDICTED: ubiquitin receptor RAD23c isoform X1    134   2e-33   Vitis vinifera
ref|XP_009134681.1|  PREDICTED: ubiquitin receptor RAD23c               134   2e-33   Brassica rapa
ref|XP_002282352.1|  PREDICTED: ubiquitin receptor RAD23c isoform X2    134   3e-33   Vitis vinifera
ref|XP_008361862.1|  PREDICTED: ubiquitin receptor RAD23c-like          125   3e-33   
gb|ACJ83348.1|  unknown                                                 128   4e-33   Medicago truncatula
ref|XP_006482261.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    133   4e-33   Citrus sinensis [apfelsine]
ref|XP_006482260.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    133   4e-33   Citrus sinensis [apfelsine]
gb|KFK37713.1|  hypothetical protein AALP_AA3G019400                    133   4e-33   Arabis alpina [alpine rockcress]
gb|KDO58994.1|  hypothetical protein CISIN_1g014118mg                   133   4e-33   Citrus sinensis [apfelsine]
gb|KDO58997.1|  hypothetical protein CISIN_1g014118mg                   133   4e-33   Citrus sinensis [apfelsine]
gb|KDO58996.1|  hypothetical protein CISIN_1g014118mg                   133   5e-33   Citrus sinensis [apfelsine]
gb|KFK37714.1|  hypothetical protein AALP_AA3G019400                    133   5e-33   Arabis alpina [alpine rockcress]
emb|CDX91998.1|  BnaC03g33000D                                          133   5e-33   
ref|XP_011070815.1|  PREDICTED: ubiquitin receptor RAD23c-like          133   5e-33   
gb|KDO58993.1|  hypothetical protein CISIN_1g014118mg                   133   5e-33   Citrus sinensis [apfelsine]
gb|EYU44643.1|  hypothetical protein MIMGU_mgv1a006427mg                133   6e-33   Erythranthe guttata [common monkey flower]
ref|XP_006430789.1|  hypothetical protein CICLE_v10011886mg             132   7e-33   Citrus clementina [clementine]
ref|XP_006430787.1|  hypothetical protein CICLE_v10011886mg             132   7e-33   
ref|XP_006430788.1|  hypothetical protein CICLE_v10011886mg             132   7e-33   Citrus clementina [clementine]
ref|XP_010485565.1|  PREDICTED: ubiquitin receptor RAD23c-like          132   8e-33   Camelina sativa [gold-of-pleasure]
ref|XP_007033285.1|  Rad23 UV excision repair protein family isof...    132   8e-33   
gb|KDO58995.1|  hypothetical protein CISIN_1g014118mg                   132   9e-33   Citrus sinensis [apfelsine]
gb|KDO58998.1|  hypothetical protein CISIN_1g014118mg                   132   9e-33   Citrus sinensis [apfelsine]
ref|XP_009597820.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    130   1e-32   Nicotiana tomentosiformis
ref|NP_974211.1|  UV excision repair protein RAD23C                     130   1e-32   Arabidopsis thaliana [mouse-ear cress]
gb|ABB02636.1|  RAD23-like                                              131   2e-32   Solanum tuberosum [potatoes]
ref|NP_001274760.1|  uncharacterized protein LOC102577665               131   2e-32   Solanum tuberosum [potatoes]
ref|XP_006408409.1|  hypothetical protein EUTSA_v10020817mg             131   3e-32   Eutrema salsugineum [saltwater cress]
ref|XP_010525156.1|  PREDICTED: ubiquitin receptor RAD23c-like          130   5e-32   Tarenaya hassleriana [spider flower]
ref|XP_008781229.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    130   5e-32   
ref|XP_008781245.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    130   5e-32   
ref|XP_008781237.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    130   5e-32   Phoenix dactylifera
gb|ACU18469.1|  unknown                                                 125   5e-32   Glycine max [soybeans]
ref|XP_008781252.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    130   5e-32   Phoenix dactylifera
gb|ABD96960.1|  hypothetical protein                                    130   5e-32   Tarenaya spinosa
gb|EYU34397.1|  hypothetical protein MIMGU_mgv1a008220mg                130   6e-32   Erythranthe guttata [common monkey flower]
ref|XP_006299986.1|  hypothetical protein CARUB_v10016200mg             130   6e-32   Capsella rubella
ref|XP_007033284.1|  Rad23 UV excision repair protein family isof...    130   6e-32   
ref|XP_004172134.1|  PREDICTED: putative DNA repair protein RAD23...    129   9e-32   
ref|XP_004135098.1|  PREDICTED: putative DNA repair protein RAD23...    129   1e-31   
ref|XP_010549930.1|  PREDICTED: ubiquitin receptor RAD23c-like          129   1e-31   Tarenaya hassleriana [spider flower]
ref|NP_186903.1|  UV excision repair protein RAD23C                     129   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008446578.1|  PREDICTED: ubiquitin receptor RAD23c-like          129   2e-31   Cucumis melo [Oriental melon]
ref|NP_001189793.1|  UV excision repair protein RAD23C                  129   2e-31   Arabidopsis thaliana [mouse-ear cress]
gb|KGN52072.1|  hypothetical protein Csa_5G608600                       129   2e-31   Cucumis sativus [cucumbers]
ref|NP_001240201.1|  uncharacterized protein LOC100809066               129   2e-31   Glycine max [soybeans]
gb|EYU29968.1|  hypothetical protein MIMGU_mgv1a008352mg                128   2e-31   Erythranthe guttata [common monkey flower]
gb|EYU29967.1|  hypothetical protein MIMGU_mgv1a008352mg                128   3e-31   Erythranthe guttata [common monkey flower]
ref|XP_010103792.1|  Putative DNA repair protein RAD23-3                128   4e-31   Morus notabilis
ref|XP_008775144.1|  PREDICTED: ubiquitin receptor RAD23d-like          127   4e-31   Phoenix dactylifera
ref|XP_010263550.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    127   5e-31   Nelumbo nucifera [Indian lotus]
ref|XP_010263555.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    127   5e-31   Nelumbo nucifera [Indian lotus]
ref|XP_010926135.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    127   5e-31   Elaeis guineensis
ref|XP_010926134.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    127   5e-31   Elaeis guineensis
ref|XP_006584605.1|  PREDICTED: uncharacterized protein LOC100813...    128   5e-31   Glycine max [soybeans]
ref|XP_006584604.1|  PREDICTED: uncharacterized protein LOC100813...    128   5e-31   
ref|XP_004497101.1|  PREDICTED: putative DNA repair protein RAD23...    127   6e-31   Cicer arietinum [garbanzo]
ref|XP_003555895.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    127   6e-31   Glycine max [soybeans]
ref|XP_006584608.1|  PREDICTED: uncharacterized protein LOC100813...    127   6e-31   
ref|XP_006584607.1|  PREDICTED: uncharacterized protein LOC100813...    127   7e-31   
gb|ACU18529.1|  unknown                                                 127   7e-31   Glycine max [soybeans]
ref|XP_010926132.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    127   7e-31   Elaeis guineensis
ref|XP_006584606.1|  PREDICTED: uncharacterized protein LOC100813...    127   7e-31   
gb|KEH44233.1|  RAD23 UV excision repair family protein                 127   7e-31   Medicago truncatula
ref|XP_010926133.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    127   7e-31   Elaeis guineensis
ref|NP_001242098.1|  uncharacterized protein LOC100813881               127   8e-31   
ref|XP_006437672.1|  hypothetical protein CICLE_v10031777mg             123   8e-31   
ref|XP_009117771.1|  PREDICTED: probable ubiquitin receptor RAD23a      126   9e-31   Brassica rapa
gb|KHN15504.1|  Putative DNA repair protein RAD23-3                     127   1e-30   Glycine soja [wild soybean]
ref|XP_002884326.1|  hypothetical protein ARALYDRAFT_477488             126   2e-30   
ref|XP_008390012.1|  PREDICTED: ubiquitin receptor RAD23c-like          125   2e-30   
ref|XP_006437673.1|  hypothetical protein CICLE_v10031777mg             124   2e-30   
ref|XP_010916168.1|  PREDICTED: ubiquitin receptor RAD23c-like          125   3e-30   Elaeis guineensis
ref|XP_006389863.1|  hypothetical protein EUTSA_v10018655mg             125   3e-30   
emb|CDP02781.1|  unnamed protein product                                125   4e-30   Coffea canephora [robusta coffee]
ref|XP_006437674.1|  hypothetical protein CICLE_v10031777mg             124   4e-30   
ref|XP_010265160.1|  PREDICTED: ubiquitin receptor RAD23c-like          125   4e-30   Nelumbo nucifera [Indian lotus]
ref|XP_010552232.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    125   4e-30   Tarenaya hassleriana [spider flower]
ref|XP_004299088.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    125   4e-30   Fragaria vesca subsp. vesca
ref|XP_011464118.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    125   4e-30   Fragaria vesca subsp. vesca
ref|XP_003536688.1|  PREDICTED: ubiquitin receptor RAD23c               124   7e-30   Glycine max [soybeans]
gb|KHN05574.1|  Putative DNA repair protein RAD23-3                     124   8e-30   Glycine soja [wild soybean]
ref|XP_007142903.1|  hypothetical protein PHAVU_007G026600g             124   8e-30   Phaseolus vulgaris [French bean]
ref|XP_006484457.1|  PREDICTED: ubiquitin receptor RAD23c-like          124   9e-30   Citrus sinensis [apfelsine]
ref|XP_002529115.1|  uv excision repair protein rad23, putative         124   1e-29   Ricinus communis
ref|XP_006437675.1|  hypothetical protein CICLE_v10031777mg             124   1e-29   Citrus clementina [clementine]
ref|XP_008801156.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    123   1e-29   
ref|XP_008801157.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    123   1e-29   
ref|XP_008801154.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    123   1e-29   Phoenix dactylifera
ref|XP_008801153.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    123   1e-29   Phoenix dactylifera
ref|XP_010907325.1|  PREDICTED: ubiquitin receptor RAD23d-like          123   2e-29   Elaeis guineensis
ref|XP_011035053.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    122   4e-29   Populus euphratica
ref|XP_011035049.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    122   5e-29   Populus euphratica
ref|XP_011035048.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    122   5e-29   Populus euphratica
ref|XP_008462954.1|  PREDICTED: ubiquitin receptor RAD23b isoform X2    121   6e-29   Cucumis melo [Oriental melon]
ref|XP_009417654.1|  PREDICTED: ubiquitin receptor RAD23d-like          121   7e-29   
ref|XP_007142901.1|  hypothetical protein PHAVU_007G026400g             121   1e-28   Phaseolus vulgaris [French bean]
ref|XP_006383465.1|  hypothetical protein POPTR_0005s15740g             120   1e-28   Populus trichocarpa [western balsam poplar]
ref|XP_010553920.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    120   2e-28   Tarenaya hassleriana [spider flower]
ref|XP_010553921.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    120   2e-28   Tarenaya hassleriana [spider flower]
ref|XP_002315945.2|  hypothetical protein POPTR_0010s13610g             119   3e-28   
ref|XP_011007998.1|  PREDICTED: ubiquitin receptor RAD23d-like          119   4e-28   Populus euphratica
ref|XP_011021232.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    119   5e-28   Populus euphratica
ref|XP_008341883.1|  PREDICTED: ubiquitin receptor RAD23d-like          119   5e-28   
ref|XP_011021231.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    119   6e-28   Populus euphratica
ref|XP_002312393.1|  hypothetical protein POPTR_0008s11840g             118   6e-28   
ref|XP_009399729.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    119   6e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011021237.1|  PREDICTED: ubiquitin receptor RAD23c isoform X5    118   7e-28   Populus euphratica
ref|XP_009399730.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    119   7e-28   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB80001.1|  hypothetical protein B456_013G076800                    117   1e-27   Gossypium raimondii
ref|XP_006655985.1|  PREDICTED: ubiquitin receptor RAD23c-like          117   2e-27   Oryza brachyantha
gb|KJB80000.1|  hypothetical protein B456_013G076800                    117   2e-27   Gossypium raimondii
gb|EPS71284.1|  hypothetical protein M569_03474                         117   2e-27   Genlisea aurea
gb|KJB79998.1|  hypothetical protein B456_013G076800                    117   2e-27   Gossypium raimondii
ref|XP_011022053.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    116   2e-27   Populus euphratica
emb|CAA72741.1|  RAD23, isoform I                                       117   3e-27   Daucus carota [carrots]
ref|XP_007046250.1|  Rad23 UV excision repair protein family isof...    116   3e-27   
ref|XP_009391404.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    117   4e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391405.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    117   4e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011022044.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    116   4e-27   Populus euphratica
ref|XP_004304134.1|  PREDICTED: ubiquitin receptor RAD23d-like          116   5e-27   Fragaria vesca subsp. vesca
ref|XP_010681566.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    116   5e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681568.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    115   6e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681565.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    116   6e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001057334.1|  Os06g0264300                                       116   6e-27   
gb|EAZ00429.1|  hypothetical protein OsI_22453                          116   6e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_010681564.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    116   6e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681567.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    115   6e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681563.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    116   7e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009357056.1|  PREDICTED: ubiquitin receptor RAD23d               115   7e-27   Pyrus x bretschneideri [bai li]
ref|XP_007046249.1|  Rad23 UV excision repair protein family isof...    115   8e-27   
ref|XP_003551850.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    115   2e-26   Glycine max [soybeans]
gb|KJB79994.1|  hypothetical protein B456_013G076500                    115   2e-26   Gossypium raimondii
gb|KJB79995.1|  hypothetical protein B456_013G076600                    114   2e-26   Gossypium raimondii
ref|XP_004489115.1|  PREDICTED: putative DNA repair protein RAD23...    114   2e-26   Cicer arietinum [garbanzo]
gb|AFK37901.1|  unknown                                                 111   3e-26   Medicago truncatula
gb|KFK33251.1|  hypothetical protein AALP_AA6G350300                    113   4e-26   Arabis alpina [alpine rockcress]
ref|XP_003563980.1|  PREDICTED: ubiquitin receptor RAD23d-like          113   6e-26   Brachypodium distachyon [annual false brome]
ref|XP_010435751.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    112   7e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010450905.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    112   1e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010450906.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    112   1e-25   Camelina sativa [gold-of-pleasure]
gb|KEH21499.1|  RAD23 UV excision repair family protein                 111   3e-25   Medicago truncatula
ref|XP_002870839.1|  hypothetical protein ARALYDRAFT_494129             111   3e-25   
gb|AFK37577.1|  unknown                                                 110   5e-25   Lotus japonicus
emb|CDY01661.1|  BnaC04g30910D                                          110   6e-25   
ref|XP_009139789.1|  PREDICTED: ubiquitin receptor RAD23d               110   6e-25   Brassica rapa
ref|XP_003578094.1|  PREDICTED: probable ubiquitin receptor RAD23       109   1e-24   Brachypodium distachyon [annual false brome]
gb|EMS61794.1|  putative DNA repair protein RAD23                       110   1e-24   Triticum urartu
emb|CDX74522.1|  BnaA04g08670D                                          109   2e-24   
gb|EMS50196.1|  putative DNA repair protein RAD23                       111   2e-24   Triticum urartu
gb|KCW86330.1|  hypothetical protein EUGRSUZ_B03019                     108   2e-24   Eucalyptus grandis [rose gum]
dbj|BAJ98767.1|  predicted protein                                      108   2e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ97496.1|  predicted protein                                      108   3e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010044267.1|  PREDICTED: ubiquitin receptor RAD23d-like          108   3e-24   Eucalyptus grandis [rose gum]
ref|XP_010692904.1|  PREDICTED: ubiquitin receptor RAD23d               108   4e-24   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX67404.1|  BnaA07g14440D                                          107   5e-24   
ref|XP_009125074.1|  PREDICTED: ubiquitin receptor RAD23d               107   6e-24   Brassica rapa
ref|NP_198663.1|  ubiquitin receptor RAD23d                             107   6e-24   Arabidopsis thaliana [mouse-ear cress]
gb|AAK59766.1|  unknown protein                                         107   7e-24   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001061854.1|  Os08g0430200                                       107   9e-24   
gb|EAZ07072.1|  hypothetical protein OsI_29318                          107   9e-24   Oryza sativa Indica Group [Indian rice]
ref|XP_004965183.1|  PREDICTED: putative DNA repair protein RAD23...    106   2e-23   Setaria italica
ref|XP_006405766.1|  hypothetical protein EUTSA_v10027790mg             105   3e-23   Eutrema salsugineum [saltwater cress]
ref|XP_010235145.1|  PREDICTED: probable ubiquitin receptor RAD23...    105   3e-23   Brachypodium distachyon [annual false brome]
ref|XP_003574508.1|  PREDICTED: probable ubiquitin receptor RAD23...    105   3e-23   Brachypodium distachyon [annual false brome]
ref|XP_006427691.1|  hypothetical protein CICLE_v100258681mg          99.4    3e-23   
ref|XP_010268454.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    104   6e-23   Nelumbo nucifera [Indian lotus]
ref|XP_010268452.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    104   7e-23   Nelumbo nucifera [Indian lotus]
gb|ACN40029.1|  unknown                                                 104   1e-22   Picea sitchensis
tpg|DAA61379.1|  TPA: hypothetical protein ZEAMMB73_350633              103   1e-22   
ref|XP_001763027.1|  predicted protein                                  103   1e-22   
ref|XP_009418051.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    103   2e-22   
ref|XP_009418030.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    103   2e-22   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAC76393.1|  RAD23-like protein                                     102   2e-22   Arabidopsis thaliana [mouse-ear cress]
gb|ACG32894.1|  DNA repair protein RAD23                                102   3e-22   Zea mays [maize]
ref|XP_010246571.1|  PREDICTED: ubiquitin receptor RAD23b-like          102   4e-22   Nelumbo nucifera [Indian lotus]
ref|NP_001149140.1|  LOC100282762                                       102   4e-22   Zea mays [maize]
gb|ACJ84340.1|  unknown                                               97.8    4e-22   Medicago truncatula
ref|XP_006646968.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    102   6e-22   Oryza brachyantha
ref|XP_006646969.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    101   6e-22   Oryza brachyantha
gb|KDO46131.1|  hypothetical protein CISIN_1g0198171mg                  100   6e-22   Citrus sinensis [apfelsine]
gb|ACN26781.1|  unknown                                                 100   7e-22   Zea mays [maize]
ref|XP_006493449.1|  PREDICTED: ubiquitin receptor RAD23b-like          101   7e-22   Citrus sinensis [apfelsine]
ref|XP_006646966.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    101   8e-22   
ref|XP_006646967.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    101   8e-22   
ref|XP_004147454.1|  PREDICTED: putative DNA repair protein RAD23...    101   8e-22   
ref|XP_003543713.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    101   9e-22   
gb|KHN31866.1|  Putative DNA repair protein RAD23-1                     101   9e-22   
ref|XP_009408042.1|  PREDICTED: ubiquitin receptor RAD23b-like          101   1e-21   
gb|AFW87601.1|  hypothetical protein ZEAMMB73_681598                    100   1e-21   
ref|XP_009605626.1|  PREDICTED: probable ubiquitin receptor RAD23a    96.3    1e-21   
ref|XP_007150827.1|  hypothetical protein PHAVU_005G184000g             100   1e-21   
ref|XP_001775909.1|  predicted protein                                97.8    2e-21   
ref|XP_008228865.1|  PREDICTED: ubiquitin receptor RAD23b-like          100   2e-21   
ref|XP_007215553.1|  hypothetical protein PRUPE_ppa007284mg             100   2e-21   
ref|XP_007024819.1|  Rad23 UV excision repair protein family isof...  99.8    2e-21   
ref|NP_001142065.1|  uncharacterized protein LOC100274222               100   2e-21   
ref|NP_001266655.1|  DNA repair protein RAD23                           100   2e-21   
ref|XP_002512770.1|  uv excision repair protein rad23, putative       99.8    3e-21   
ref|XP_010034055.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  99.8    3e-21   
ref|XP_010034058.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  99.8    3e-21   
ref|XP_002961618.1|  hypothetical protein SELMODRAFT_77427            99.8    3e-21   
ref|XP_010034056.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  99.8    3e-21   
ref|XP_010034057.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  99.8    3e-21   
ref|XP_007024818.1|  Rad23 UV excision repair protein family isof...  99.8    4e-21   
ref|XP_002964690.1|  hypothetical protein SELMODRAFT_82644            99.8    4e-21   
ref|XP_010695313.1|  PREDICTED: probable ubiquitin receptor RAD23a    99.4    4e-21   
ref|XP_006368664.1|  hypothetical protein POPTR_0001s07510g           99.4    4e-21   
ref|XP_008443453.1|  PREDICTED: ubiquitin receptor RAD23b-like        99.4    4e-21   
ref|XP_011034604.1|  PREDICTED: ubiquitin receptor RAD23b-like        99.4    5e-21   
gb|KHG13156.1|  Putative DNA repair RAD23-1 -like protein             99.4    5e-21   
ref|XP_002299163.1|  DNA repair protein RAD23                         99.0    6e-21   
ref|XP_004303217.1|  PREDICTED: ubiquitin receptor RAD23b             99.0    6e-21   
ref|XP_001752113.1|  predicted protein                                93.6    6e-21   
ref|XP_003637291.1|  RAD23 protein                                    98.6    8e-21   
gb|EYU24565.1|  hypothetical protein MIMGU_mgv1a008731mg              98.2    8e-21   
ref|XP_008794386.1|  PREDICTED: ubiquitin receptor RAD23b-like        98.2    9e-21   
gb|EYU24564.1|  hypothetical protein MIMGU_mgv1a008731mg              98.2    9e-21   
ref|XP_008381163.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  98.2    1e-20   
ref|XP_008342756.1|  PREDICTED: ubiquitin receptor RAD23b-like        97.8    1e-20   
ref|XP_011082656.1|  PREDICTED: ubiquitin receptor RAD23b-like        97.8    1e-20   
ref|XP_009354240.1|  PREDICTED: ubiquitin receptor RAD23b-like        97.8    1e-20   
ref|XP_002303970.1|  DNA repair protein RAD23                         97.4    2e-20   
ref|XP_010107189.1|  Putative DNA repair protein RAD23-1              98.2    2e-20   
ref|XP_006385947.1|  hypothetical protein POPTR_0003s18540g           97.4    2e-20   
gb|ACF83232.1|  unknown                                               95.1    2e-20   
emb|CBI25247.3|  unnamed protein product                              97.8    2e-20   
ref|XP_010655132.1|  PREDICTED: ubiquitin receptor RAD23b             97.8    2e-20   
ref|XP_010929196.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  97.1    3e-20   
ref|XP_010929195.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  97.1    3e-20   
ref|XP_010929193.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  97.1    3e-20   
ref|XP_009615678.1|  PREDICTED: ubiquitin receptor RAD23b             96.7    4e-20   
ref|XP_004486596.1|  PREDICTED: putative DNA repair protein RAD23...  96.3    5e-20   
emb|CDX69473.1|  BnaA10g18220D                                        98.6    6e-20   
ref|XP_004486595.1|  PREDICTED: putative DNA repair protein RAD23...  96.3    6e-20   
ref|XP_006845449.1|  hypothetical protein AMTR_s00019p00116110        96.3    6e-20   
gb|EEC72612.1|  hypothetical protein OsI_06092                        95.9    6e-20   
ref|NP_001046083.1|  Os02g0179300                                     95.9    6e-20   
emb|CDO98260.1|  unnamed protein product                              95.9    7e-20   
emb|CDX69474.1|  BnaA10g18230D                                        95.9    7e-20   
ref|XP_011020549.1|  PREDICTED: ubiquitin receptor RAD23b-like        95.9    8e-20   
ref|XP_008677244.1|  PREDICTED: LOC100282427 isoform X2               95.1    1e-19   
ref|NP_001148810.1|  LOC100282427                                     95.1    1e-19   
ref|XP_001780766.1|  predicted protein                                95.5    1e-19   
gb|AFW66284.1|  hypothetical protein ZEAMMB73_839350                  94.7    1e-19   
ref|XP_009398645.1|  PREDICTED: ubiquitin receptor RAD23b-like        95.1    1e-19   
ref|XP_004235877.1|  PREDICTED: ubiquitin receptor RAD23b             94.7    2e-19   
ref|XP_006341431.1|  PREDICTED: ubiquitin receptor RAD23b-like        94.7    2e-19   
ref|XP_003622299.1|  hypothetical protein MTR_7g032690                94.7    2e-19   
ref|XP_003622298.1|  hypothetical protein MTR_7g032690                94.7    2e-19   
ref|XP_009797065.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  94.0    3e-19   
ref|XP_009797063.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  94.0    3e-19   
ref|XP_009598522.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  94.0    3e-19   
ref|XP_009598520.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  94.0    3e-19   
ref|XP_002451657.1|  hypothetical protein SORBIDRAFT_04g005370        93.6    4e-19   
ref|XP_009121517.1|  PREDICTED: ubiquitin receptor RAD23c-like        93.6    4e-19   
emb|CDY33351.1|  BnaC05g12320D                                        92.4    9e-19   
gb|EMS58233.1|  Putative DNA repair protein RAD23-1                   93.6    9e-19   
gb|ABY66298.1|  RAD23-like protein                                    92.4    1e-18   
ref|XP_009759117.1|  PREDICTED: ubiquitin receptor RAD23b isoform X1  92.4    1e-18   
ref|XP_009759118.1|  PREDICTED: ubiquitin receptor RAD23b isoform X2  92.4    1e-18   
gb|EPS72838.1|  hypothetical protein M569_01918                       92.0    1e-18   
ref|XP_009121516.1|  PREDICTED: ubiquitin receptor RAD23c-like        92.0    1e-18   
ref|XP_006281616.1|  hypothetical protein CARUB_v10027742mg           87.4    1e-18   
gb|ABN05900.1|  Ubiquitin                                             94.4    1e-18   
emb|CAA72742.1|  RAD23 protein, isoform II                            92.0    1e-18   
gb|AAF68123.1|AC010793_18  F20B17.8                                   92.0    2e-18   
ref|XP_006416841.1|  hypothetical protein EUTSA_v10007982mg           92.0    2e-18   
ref|XP_004137651.1|  PREDICTED: putative DNA repair protein RAD23...  91.7    2e-18   
ref|XP_002890153.1|  hypothetical protein ARALYDRAFT_312599           91.7    2e-18   
ref|XP_004161413.1|  PREDICTED: putative DNA repair protein RAD23...  92.0    2e-18   
gb|KFK25846.1|  hypothetical protein AALP_AA8G169700                  92.0    2e-18   
ref|NP_001185439.1|  ubiquitin receptor RAD23b                        91.7    2e-18   
emb|CAC01850.1|  putative protein                                     88.6    2e-18   
ref|XP_009149056.1|  PREDICTED: probable ubiquitin receptor RAD23a    91.7    2e-18   
emb|CDY35071.1|  BnaA06g10810D                                        91.7    2e-18   
dbj|BAK04690.1|  predicted protein                                    91.3    2e-18   
ref|NP_197113.4|  uncharacterized protein                             89.0    3e-18   
ref|XP_010417634.1|  PREDICTED: ubiquitin receptor RAD23b             90.9    4e-18   
ref|XP_006302422.1|  hypothetical protein CARUB_v10020503mg           90.9    4e-18   
emb|CDX81753.1|  BnaC08g38480D                                        90.5    5e-18   
ref|XP_010459157.1|  PREDICTED: probable ubiquitin receptor RAD23a    90.5    6e-18   
ref|XP_006306209.1|  hypothetical protein CARUB_v10011879mg           90.1    6e-18   
ref|XP_010497716.1|  PREDICTED: probable ubiquitin receptor RAD23a    90.1    7e-18   
ref|NP_173070.1|  DNA repair protein RAD23A                           90.1    7e-18   
emb|CDY26494.1|  BnaC09g41740D                                        89.0    9e-18   
ref|XP_003570619.1|  PREDICTED: ubiquitin receptor RAD23b-like        89.7    1e-17   
gb|KDO69966.1|  hypothetical protein CISIN_1g0163871mg                89.0    1e-17   
ref|XP_010472832.1|  PREDICTED: ubiquitin receptor RAD23b-like        89.0    2e-17   
ref|XP_006378490.1|  hypothetical protein POPTR_0010s13610g           88.6    2e-17   
ref|XP_003622297.1|  hypothetical protein MTR_7g032690                90.9    2e-17   
gb|KFK42374.1|  hypothetical protein AALP_AA2G247700                  88.6    3e-17   
gb|KDO69965.1|  hypothetical protein CISIN_1g0163871mg                88.2    3e-17   
emb|CDY26493.1|  BnaC09g41750D                                        87.4    5e-17   
gb|KJB79996.1|  hypothetical protein B456_013G076600                  86.7    8e-17   
emb|CDX67983.1|  BnaA07g20230D                                        87.4    1e-16   
ref|XP_010485077.1|  PREDICTED: uncharacterized protein LOC104763398  87.4    2e-16   
ref|XP_009104513.1|  PREDICTED: ubiquitin receptor RAD23b             85.5    3e-16   
ref|XP_002444556.1|  hypothetical protein SORBIDRAFT_07g023746        83.6    3e-16   
gb|ABY66299.1|  DNA repair protein RAD23                              84.7    4e-16   
emb|CDX79333.1|  BnaC06g19700D                                        85.1    5e-16   
ref|XP_006408408.1|  hypothetical protein EUTSA_v10020817mg           84.0    1e-15   
ref|XP_010446048.1|  PREDICTED: uncharacterized protein LOC104728818  85.1    1e-15   
dbj|BAC76391.1|  RAD23-like protein                                   83.6    2e-15   
ref|XP_009122868.1|  PREDICTED: ubiquitin receptor RAD23d-like        81.6    5e-15   
ref|XP_006427690.1|  hypothetical protein CICLE_v100258682mg          80.9    7e-15   
ref|XP_004164899.1|  PREDICTED: putative DNA repair protein RAD23...  81.6    9e-15   
emb|CDY26496.1|  BnaC09g41720D                                        80.9    1e-14   
ref|XP_011035054.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  80.1    2e-14   
ref|XP_006603061.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  79.7    3e-14   
gb|EEC73129.1|  hypothetical protein OsI_07141                        77.8    6e-14   
gb|EMT30328.1|  Putative DNA repair protein RAD23                     79.7    7e-14   
gb|KJB34921.1|  hypothetical protein B456_006G091100                  77.8    8e-14   
ref|XP_004951696.1|  PREDICTED: putative DNA repair protein RAD23...  78.2    1e-13   
ref|NP_001172955.1|  Os02g0465112                                     73.9    1e-13   
gb|ACF79443.1|  unknown                                               78.2    1e-13   
dbj|BAD19842.1|  RAD23 protein-like                                   74.3    2e-13   
ref|XP_008668010.1|  PREDICTED: LOC100283179 isoform X1               78.6    2e-13   
ref|XP_004973490.1|  PREDICTED: probable DNA repair protein RAD23...  73.9    2e-13   
ref|XP_006598286.1|  PREDICTED: ubiquitin receptor RAD23b-like        77.4    2e-13   
ref|XP_010476726.1|  PREDICTED: LOW QUALITY PROTEIN: probable ubi...  77.8    2e-13   
ref|XP_009797066.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  75.9    4e-13   
ref|XP_005646102.1|  UV excision repair protein Rad23                 77.0    4e-13   
ref|XP_002873756.1|  hypothetical protein ARALYDRAFT_326056           73.2    5e-13   
gb|KDP41924.1|  hypothetical protein JCGZ_26942                       75.9    8e-13   
gb|EEE56950.1|  hypothetical protein OsJ_06656                        74.3    8e-13   
ref|XP_008381164.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  74.3    1e-12   
emb|CCA21947.1|  UV excision repair protein RAD23 putative            73.9    4e-12   
emb|CAN62701.1|  hypothetical protein VITISV_007064                   73.2    6e-12   
ref|XP_007899245.1|  PREDICTED: UV excision repair protein RAD23 ...  72.4    1e-11   
ref|XP_005989968.1|  PREDICTED: UV excision repair protein RAD23 ...  72.4    1e-11   
pdb|1P1A|A  Chain A, Nmr Structure Of Ubiquitin-Like Domain Of Hh...  66.6    4e-11   
pdb|1UEL|A  Chain A, Solution Structure Of Ubiquitin-Like Domain ...  65.9    9e-11   
ref|XP_006640058.1|  PREDICTED: UV excision repair protein RAD23 ...  69.3    2e-10   
ref|XP_005154948.1|  PREDICTED: UV excision repair protein RAD23 ...  68.6    3e-10   
ref|XP_010755175.1|  PREDICTED: UV excision repair protein RAD23 ...  68.9    3e-10   
ref|XP_006088115.1|  PREDICTED: UV excision repair protein RAD23 ...  68.6    3e-10   
ref|XP_006088114.1|  PREDICTED: UV excision repair protein RAD23 ...  68.6    4e-10   
ref|XP_007499697.1|  PREDICTED: UV excision repair protein RAD23 ...  68.2    5e-10   
ref|XP_007499698.1|  PREDICTED: UV excision repair protein RAD23 ...  68.2    5e-10   
ref|XP_008586188.1|  PREDICTED: UV excision repair protein RAD23 ...  68.2    5e-10   
ref|XP_008054682.1|  PREDICTED: UV excision repair protein RAD23 ...  68.2    5e-10   
gb|ETL78956.1|  UV excision repair protein Rad23                      68.2    5e-10   
ref|XP_003964320.1|  PREDICTED: UV excision repair protein RAD23 ...  67.8    5e-10   
gb|ETM32232.1|  UV excision repair protein Rad23                      68.2    5e-10   
gb|ETI31946.1|  UV excision repair protein Rad23                      68.2    5e-10   
ref|XP_429175.3|  PREDICTED: UV excision repair protein RAD23 hom...  67.8    5e-10   
gb|ETP29927.1|  UV excision repair protein Rad23                      68.2    5e-10   
gb|ETL25740.1|  UV excision repair protein Rad23                      68.2    5e-10   
gb|ETK72284.1|  UV excision repair protein Rad23                      68.2    5e-10   
dbj|BAE39643.1|  unnamed protein product                              67.4    6e-10   
ref|XP_008914834.1|  UV excision repair protein Rad23                 67.8    6e-10   
ref|XP_006882076.1|  PREDICTED: UV excision repair protein RAD23 ...  67.8    6e-10   
ref|XP_001927901.1|  PREDICTED: UV excision repair protein RAD23 ...  67.8    6e-10   
ref|XP_005532282.1|  PREDICTED: UV excision repair protein RAD23 ...  67.8    6e-10   
ref|XP_005491419.1|  PREDICTED: UV excision repair protein RAD23 ...  67.8    6e-10   
ref|XP_005491420.1|  PREDICTED: UV excision repair protein RAD23 ...  67.8    6e-10   
ref|XP_004423355.1|  PREDICTED: UV excision repair protein RAD23 ...  67.8    6e-10   
ref|XP_011477015.1|  PREDICTED: UV excision repair protein RAD23 ...  67.4    6e-10   
ref|XP_002188381.1|  PREDICTED: UV excision repair protein RAD23 ...  67.8    6e-10   
emb|CCI46099.1|  unnamed protein product                              68.2    6e-10   
ref|XP_008413853.1|  PREDICTED: UV excision repair protein RAD23 ...  67.4    7e-10   
ref|XP_010741704.1|  PREDICTED: UV excision repair protein RAD23 ...  67.4    7e-10   
ref|XP_004570397.1|  PREDICTED: UV excision repair protein RAD23 ...  67.4    7e-10   
ref|XP_003446521.1|  PREDICTED: UV excision repair protein RAD23 ...  67.4    7e-10   
ref|XP_011363293.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    7e-10   
ref|XP_005362254.1|  PREDICTED: UV excision repair protein RAD23 ...  67.4    8e-10   
ref|XP_008297295.1|  PREDICTED: UV excision repair protein RAD23 ...  67.4    8e-10   
ref|XP_005362253.1|  PREDICTED: UV excision repair protein RAD23 ...  67.4    8e-10   
ref|XP_004581217.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    8e-10   
ref|XP_007573182.1|  PREDICTED: LOW QUALITY PROTEIN: UV excision ...  67.0    8e-10   
ref|NP_033037.2|  UV excision repair protein RAD23 homolog B          67.4    8e-10   
gb|AAH68193.1|  Rad23b protein                                        67.4    8e-10   
ref|XP_006011153.1|  PREDICTED: UV excision repair protein RAD23 ...  67.4    8e-10   
ref|NP_001020446.1|  UV excision repair protein RAD23 homolog B       67.4    8e-10   
ref|XP_006985330.1|  PREDICTED: UV excision repair protein RAD23 ...  67.4    8e-10   
gb|AAV38508.1|  RAD23 homolog B (S. cerevisiae)                       67.4    8e-10   
dbj|BAG57014.1|  unnamed protein product                              67.4    8e-10   
ref|NP_002865.1|  UV excision repair protein RAD23 homolog B isof...  67.4    8e-10   
dbj|BAD97199.1|  UV excision repair protein RAD23 homolog B variant   67.4    8e-10   
ref|XP_005802841.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    8e-10   
ref|XP_005076549.1|  PREDICTED: UV excision repair protein RAD23 ...  67.4    8e-10   
ref|NP_001248717.1|  UV excision repair protein RAD23 homolog B       67.4    9e-10   
ref|XP_004638157.1|  PREDICTED: UV excision repair protein RAD23 ...  67.4    9e-10   
ref|XP_009186620.1|  PREDICTED: UV excision repair protein RAD23 ...  67.4    9e-10   
ref|XP_004677510.1|  PREDICTED: UV excision repair protein RAD23 ...  67.4    9e-10   
ref|XP_009186622.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    9e-10   
ref|XP_005581182.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    9e-10   
emb|CAA63146.1|  MHR23B                                               67.4    9e-10   
ref|NP_001271836.1|  uncharacterized protein LOC101866175             67.4    9e-10   
dbj|BAE25006.1|  unnamed protein product                              67.4    9e-10   
ref|XP_007966681.1|  PREDICTED: UV excision repair protein RAD23 ...  67.4    9e-10   
ref|XP_004848222.1|  PREDICTED: UV excision repair protein RAD23 ...  67.4    9e-10   
gb|AAH20973.1|  RAD23B protein                                        67.0    9e-10   
dbj|BAE34014.1|  unnamed protein product                              67.0    9e-10   
ref|XP_007631606.1|  PREDICTED: LOW QUALITY PROTEIN: UV excision ...  67.4    9e-10   
gb|AAX43553.1|  RAD23-like B                                          67.0    9e-10   
ref|XP_010387756.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    9e-10   
ref|XP_006864754.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    9e-10   
ref|XP_002708173.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    1e-09   
ref|XP_004372251.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    1e-09   
ref|XP_007950131.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    1e-09   
ref|XP_004711018.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    1e-09   
ref|XP_006906141.1|  PREDICTED: UV excision repair protein RAD23 ...  67.0    1e-09   



>ref|XP_007227719.1| hypothetical protein PRUPE_ppa007047mg [Prunus persica]
 ref|XP_008243219.1| PREDICTED: ubiquitin receptor RAD23c-like [Prunus mume]
 gb|EMJ28918.1| hypothetical protein PRUPE_ppa007047mg [Prunus persica]
Length=385

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 140/186 (75%), Gaps = 0/186 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+F++EVKPEDTVADVKK IET QGS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFDVEVKPEDTVADVKKQIETSQGSDVYPASQQMLIHQGKVLKDSTTLD  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKVAEN+FVV+M+ K+KSSSGEGS +STATT      S+ SA+         AP P  A
Sbjct  61   ENKVAENSFVVIMLTKSKSSSGEGSGASTATTTKAPQPSAPSAAPTATLTAPQAPIPTSA  120

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
                       + A T    D YGQAAS+LVAG NLEG IQQILDMGGGT DR+TVVRAL
Sbjct  121  PPASVTTPAPVSSATTEVESDPYGQAASDLVAGTNLEGTIQQILDMGGGTWDRDTVVRAL  180

Query  627  RAAYNN  644
            RAA+NN
Sbjct  181  RAAFNN  186



>ref|XP_011097188.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=380

 Score =   191 bits (484),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 136/186 (73%), Gaps = 1/186 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG++FEIEVKPEDTVADVKK+IETVQGS+VYPA Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQMLIHQGKVLKDETTLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKVAEN+FVV+ M     +S  G+A+++A   + +   S ++        A +PAP  A
Sbjct  61   ENKVAENSFVVI-MLTKNKASSSGAATASAVASSTSQPVSNTSLPTQPVTAAPSPAPTVA  119

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
                   +        A S DVYGQAASNLVAGNNLE  +QQILDMGGG+ DR+TVVRAL
Sbjct  120  PLQSAPESAPVPAPTPASSTDVYGQAASNLVAGNNLEATVQQILDMGGGSWDRDTVVRAL  179

Query  627  RAAYNN  644
            RAAYNN
Sbjct  180  RAAYNN  185



>ref|XP_009607597.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
tomentosiformis]
Length=383

 Score =   189 bits (480),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 138/188 (73%), Gaps = 2/188 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKPEDTVADVKK+IET QG ++YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETAQGQDIYPAAQQMLIHQGKVLKDTTTLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasst--sastapapvpasapapv  440
            +NKVAEN+FVV+M++K K S+   SA+    + T  PA+ST     T  AP   +A    
Sbjct  61   ENKVAENSFVVIMLSKNKVSTSATSATQPTPSNTAQPATSTGQPTQTVTAPQATAASVAP  120

Query  441  pasapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVR  620
              SAP     PA  P       DVYGQAASNLVAG+ LE  +QQILDMGGG+ DR+TV+R
Sbjct  121  AQSAPQSAPTPAAAPVSANPVTDVYGQAASNLVAGSTLEATVQQILDMGGGSWDRDTVIR  180

Query  621  ALRAAYNN  644
            ALRAA+NN
Sbjct  181  ALRAAFNN  188



>ref|XP_007223090.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
 gb|EMJ24289.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
Length=385

 Score =   189 bits (479),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 137/186 (74%), Gaps = 0/186 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+F++ VKPEDTV+DVKK IET QGS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFDVAVKPEDTVSDVKKQIETSQGSDVYPASQQMLIHQGKVLKDSTTLD  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKVAEN+FVV+M+ K+KSS GEGS +STAT       S+ SA+         AP P  A
Sbjct  61   ENKVAENSFVVIMLTKSKSSLGEGSGASTATITKAPQPSAPSAAPTVTLTAPQAPIPTSA  120

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
            S          + A      + YGQAAS+LVAG NLEG IQQILDMGGGT DR+TVVRAL
Sbjct  121  SPASVTTPAPVSSATMEVESNPYGQAASDLVAGTNLEGTIQQILDMGGGTWDRDTVVRAL  180

Query  627  RAAYNN  644
            RAA+NN
Sbjct  181  RAAFNN  186



>ref|XP_007223091.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
 gb|EMJ24290.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
Length=322

 Score =   186 bits (473),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 136/187 (73%), Gaps = 1/187 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+F++ VKPEDTV+DVKK IET QGS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFDVAVKPEDTVSDVKKQIETSQGSDVYPASQQMLIHQGKVLKDSTTLD  60

Query  267  DNKVAENNFVVVMMaktksss-gegsasstattktiapasstsastapapvpasapapvp  443
            +NKVAEN+FVV+M+ K+KSS      AS+   TK   P++ ++A T     P +      
Sbjct  61   ENKVAENSFVVIMLTKSKSSLGEGSGASTATITKAPQPSAPSAAPTVTLTAPQAPIPTSA  120

Query  444  asapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRA  623
            + A V   AP  +        + YGQAAS+LVAG NLEG IQQILDMGGGT DR+TVVRA
Sbjct  121  SPASVTTPAPVSSATMDRVESNPYGQAASDLVAGTNLEGTIQQILDMGGGTWDRDTVVRA  180

Query  624  LRAAYNN  644
            LRAA+NN
Sbjct  181  LRAAFNN  187



>ref|XP_009607598.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
tomentosiformis]
Length=365

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 127/186 (68%), Gaps = 16/186 (9%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKPEDTVADVKK+IET QG ++YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETAQGQDIYPAAQQMLIHQGKVLKDTTTLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKVAEN+FVV+M+                +    A ++     T  AP   +A      
Sbjct  61   ENKVAENSFVVIML----------------SKAQPATSTGQPTQTVTAPQATAASVAPAQ  104

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
            SAP     PA  P       DVYGQAASNLVAG+ LE  +QQILDMGGG+ DR+TV+RAL
Sbjct  105  SAPQSAPTPAAAPVSANPVTDVYGQAASNLVAGSTLEATVQQILDMGGGSWDRDTVIRAL  164

Query  627  RAAYNN  644
            RAA+NN
Sbjct  165  RAAFNN  170



>ref|XP_008243218.1| PREDICTED: ubiquitin receptor RAD23d-like [Prunus mume]
Length=384

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 132/186 (71%), Gaps = 1/186 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+F++EVKPEDTVADVKK IET QGS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFDVEVKPEDTVADVKKQIETSQGSDVYPASQQMLIHQGKVLKDSTTLD  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKVAEN+FVV+M+     SS    + ++  T T AP  S SA+         AP P  A
Sbjct  61   ENKVAENSFVVIML-TKSKSSLGEGSGASTATITKAPQPSASAAPTVTLTAPQAPIPTSA  119

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
                       + A T    + YGQAAS+LVAG NLEG IQQILDMGGGT DR+TVVRAL
Sbjct  120  LPASVTTPAPVSLATTEVESNPYGQAASDLVAGTNLEGTIQQILDMGGGTWDRDTVVRAL  179

Query  627  RAAYNN  644
            RAA+NN
Sbjct  180  RAAFNN  185



>ref|XP_009781758.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
sylvestris]
Length=387

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 138/188 (73%), Gaps = 2/188 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKPEDTVADVKK+IET QG  VYPA+Q MLIHQGKVLKD  TLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETAQGQAVYPAAQQMLIHQGKVLKDTATLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasst--sastapapvpasapapv  440
            +NKVAEN+FVV+M+AK K S+   SA+  A + T  PA+ST     T  AP   +A    
Sbjct  61   ENKVAENSFVVIMLAKNKVSTSATSAAQPAPSNTAQPATSTGQPTQTVTAPQATAASLAP  120

Query  441  pasapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVR  620
              SAP     PA  P  +    DVYGQAASNLVAG+ LE  +QQILDMGGG+ DR+TV+R
Sbjct  121  AQSAPQSAPTPAAAPVSSNPVTDVYGQAASNLVAGSTLEATVQQILDMGGGSWDRDTVIR  180

Query  621  ALRAAYNN  644
            ALRAA+NN
Sbjct  181  ALRAAFNN  188



>ref|XP_011099561.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=380

 Score =   186 bits (472),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 136/186 (73%), Gaps = 1/186 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            M+IFVKTLKGT+FEIEVKPEDTVADVKK+IETVQG++VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MRIFVKTLKGTHFEIEVKPEDTVADVKKNIETVQGADVYPASQQMLIHQGKVLKDATTLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKVAE +FV V+M     +S  G+A+++A   +   + S + S       A  PAPV A
Sbjct  61   ENKVAEKSFV-VVMLTKNKASSSGAATASAAPSSKTQSVSDTPSPTQPVSAAPTPAPVAA  119

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
                   +        A S DVYGQAASNLVAG+NLE  +QQILDMGGG+ DRETV+RAL
Sbjct  120  PPQSAPESAPVPAPTPASSTDVYGQAASNLVAGSNLETTVQQILDMGGGSWDRETVIRAL  179

Query  627  RAAYNN  644
            RAAYNN
Sbjct  180  RAAYNN  185



>ref|XP_006363121.1| PREDICTED: ubiquitin receptor RAD23c-like [Solanum tuberosum]
Length=390

 Score =   186 bits (473),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 138/186 (74%), Gaps = 0/186 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKPED+VADVKK+IE+VQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIESVQGQDVYPAAQQMLIHQGKVLKDATTLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKVAEN+FVV+M++K K SS   S+   A + T  PA ST  +      P +  A   +
Sbjct  61   ENKVAENSFVVIMLSKNKVSSTGTSSIPAAPSNTAQPAGSTDQARQTITAPQATAALPQS  120

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
            ++    A+     A  +   DVY QAASNLVAG+NLE  +QQILDMGGG+ DR+TVVRAL
Sbjct  121  ASESAPASAPVPAAAASSVTDVYDQAASNLVAGSNLETTVQQILDMGGGSWDRDTVVRAL  180

Query  627  RAAYNN  644
            RAA+NN
Sbjct  181  RAAFNN  186



>ref|XP_002283656.1| PREDICTED: ubiquitin receptor RAD23c [Vitis vinifera]
 emb|CBI33660.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   186 bits (471),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 133/186 (72%), Gaps = 2/186 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKPEDTVADVKK+IE V G++VYPA+Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIELVHGTDVYPAAQQMLIHQGKVLKDATTLD  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +N+VAE++FVV+M+  +K+    G AS+T+   T      +S+         +  APV A
Sbjct  61   ENQVAESSFVVIML--SKNKVSAGGASTTSAAPTSQAQPVSSSPPTSNQPSTAPQAPVVA  118

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
               V            +   D+YGQAASNLVAGNNLE  IQQILDMGGG+ DR+TVVRAL
Sbjct  119  LPEVIPEPAPAVAPSISSDSDIYGQAASNLVAGNNLEVTIQQILDMGGGSWDRDTVVRAL  178

Query  627  RAAYNN  644
            RAAYNN
Sbjct  179  RAAYNN  184



>ref|XP_009356279.1| PREDICTED: ubiquitin receptor RAD23d-like [Pyrus x bretschneideri]
Length=385

 Score =   185 bits (469),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 132/186 (71%), Gaps = 0/186 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG++F++EVKPEDTVADVKK IE  +GS+VYPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGSHFDVEVKPEDTVADVKKHIEASKGSDVYPAPQQMLIHQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKVAEN+FVV+M+ K+ S  GEGS +STA T      S+ + +       + APA    
Sbjct  61   ENKVAENSFVVIMLTKSTSPPGEGSGASTAATTKAPQPSAHTGAPTATLTASPAPAAAST  120

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
                         A T    D YGQAAS+LVAG NLEG IQQILDMGGGT DR+TVVRAL
Sbjct  121  LPASVATPAPVASATTDSQADSYGQAASDLVAGTNLEGTIQQILDMGGGTWDRDTVVRAL  180

Query  627  RAAYNN  644
            RAA+NN
Sbjct  181  RAAFNN  186



>ref|XP_002516727.1| uv excision repair protein rad23, putative [Ricinus communis]
 gb|EEF45625.1| uv excision repair protein rad23, putative [Ricinus communis]
Length=381

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 134/186 (72%), Gaps = 1/186 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT FEI+VKPEDTV DVK +IE  QG++VYPASQ MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTNFEIDVKPEDTVEDVKNNIEIAQGADVYPASQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKVAEN+F+V+M+   +  S  G +++++   + A  +ST   +A  P   +    V A
Sbjct  61   ENKVAENSFIVIML-SKRKVSPSGGSTASSAPPSQAQPASTLPPSATQPSTTAQAPAVTA  119

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
              P   A   P   P +   D+YGQAASNLVAG+NLE  +QQILDMGGG+ DRETV RAL
Sbjct  120  ELPQSAAESTPVVNPVSSETDIYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVARAL  179

Query  627  RAAYNN  644
            RAA+NN
Sbjct  180  RAAFNN  185



>ref|XP_009781759.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
sylvestris]
Length=369

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 125/186 (67%), Gaps = 16/186 (9%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKPEDTVADVKK+IET QG  VYPA+Q MLIHQGKVLKD  TLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETAQGQAVYPAAQQMLIHQGKVLKDTATLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKVAEN+FVV+M+                     A ++     T  AP   +A      
Sbjct  61   ENKVAENSFVVIML----------------AKAQPATSTGQPTQTVTAPQATAASLAPAQ  104

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
            SAP     PA  P  +    DVYGQAASNLVAG+ LE  +QQILDMGGG+ DR+TV+RAL
Sbjct  105  SAPQSAPTPAAAPVSSNPVTDVYGQAASNLVAGSTLEATVQQILDMGGGSWDRDTVIRAL  164

Query  627  RAAYNN  644
            RAA+NN
Sbjct  165  RAAFNN  170



>gb|AII99835.1| putative DNA repair protein RAD23-3-like protein [Nicotiana tabacum]
Length=387

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 140/188 (74%), Gaps = 2/188 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKPEDTV DVK++IE+VQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVVDVKRNIESVQGQDVYPAAQQMLIHQGKVLKDSTTLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKVAEN+FVV+M++K K+SS   S+S  A + T  PASST  + A   + A       A
Sbjct  61   ENKVAENSFVVIMLSKNKASSTGTSSSPAAPSDTAQPASSTGQAQARQTITAPQALVASA  120

Query  447  sapvpvaapaptpap--tagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVR  620
            + P   +  AP P P   +   DVY QAASNLVAG+ LE  +Q ILDMGGG+ DRETVVR
Sbjct  121  APPQSASEFAPAPVPGDASTVTDVYDQAASNLVAGSKLEATVQHILDMGGGSWDRETVVR  180

Query  621  ALRAAYNN  644
            ALRAAYNN
Sbjct  181  ALRAAYNN  188



>gb|KDP32945.1| hypothetical protein JCGZ_12976 [Jatropha curcas]
Length=382

 Score =   184 bits (466),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 139/186 (75%), Gaps = 0/186 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT FEIEVKP+D VADVKK+IETVQG++VYPA++ MLI+QGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTNFEIEVKPDDRVADVKKAIETVQGADVYPAAKQMLIYQGKVLKDDTTLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKVA+N+F+V+M++K+K SSG  SA+ST       PASS  +          APAP PA
Sbjct  61   ENKVADNSFIVIMLSKSKVSSGGTSAASTGPPSQAQPASSLPSHATQPSTTTEAPAPTPA  120

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
              P    +      P +   DVYGQAASNLVAGNNLE  IQQILDMGGG+  RETVVRAL
Sbjct  121  PPPSAAESIPAVANPVSSESDVYGQAASNLVAGNNLEATIQQILDMGGGSWTRETVVRAL  180

Query  627  RAAYNN  644
            RAAYNN
Sbjct  181  RAAYNN  186



>ref|XP_009784661.1| PREDICTED: ubiquitin receptor RAD23d [Nicotiana sylvestris]
Length=387

 Score =   184 bits (466),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 140/188 (74%), Gaps = 2/188 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKPEDTV DVK++IE+VQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVVDVKRNIESVQGQDVYPAAQQMLIHQGKVLKDSTTLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKVAEN+FVV+M++K K+SS   S+S  A + T  PASST  + A   + A       A
Sbjct  61   ENKVAENSFVVIMLSKNKASSTGTSSSPAAPSDTAQPASSTGQAQARQTITAPQALVASA  120

Query  447  sapvpvaapaptpap--tagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVR  620
            + P   +  AP P P   +   DVY QAASNLVAG+ LE  +Q ILDMGGG+ DRETVVR
Sbjct  121  APPQSASEFAPAPVPGDASTVTDVYDQAASNLVAGSKLEATVQHILDMGGGSWDRETVVR  180

Query  621  ALRAAYNN  644
            ALRAAYNN
Sbjct  181  ALRAAYNN  188



>ref|XP_007215515.1| hypothetical protein PRUPE_ppa007020mg [Prunus persica]
 gb|EMJ16714.1| hypothetical protein PRUPE_ppa007020mg [Prunus persica]
Length=385

 Score =   183 bits (464),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 136/186 (73%), Gaps = 2/186 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT FEIEVKPE+ VADVKK IETVQG++VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTNFEIEVKPEEMVADVKKIIETVQGADVYPASQQMLIHQGKVLKDTTTLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +N+VAEN+F+V+M+  TK+ +    ASST    T     +++ ++   PV + AP    A
Sbjct  61   ENQVAENSFIVIML--TKNKASPSGASSTKGAATSQAQPASTPTSTAPPVASPAPVRAVA  118

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
             +   V  PA      +   DVYGQAASNLVAG NLE  +QQILDMGGG+ DR+TVVRAL
Sbjct  119  ESQPVVETPAVAAPTDSSRSDVYGQAASNLVAGTNLEATVQQILDMGGGSWDRDTVVRAL  178

Query  627  RAAYNN  644
            RAA+NN
Sbjct  179  RAAFNN  184



>ref|XP_008230399.1| PREDICTED: ubiquitin receptor RAD23d [Prunus mume]
Length=385

 Score =   183 bits (464),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 135/186 (73%), Gaps = 2/186 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT FEIEVKPE+ V+DVKK IETVQG++VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTNFEIEVKPEEMVSDVKKIIETVQGADVYPASQQMLIHQGKVLKDTTTLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +N+VAEN+F+VVM+  TK+ +    ASST    T     +++ ++   PV   AP    A
Sbjct  61   ENQVAENSFIVVML--TKNKASPSGASSTKGAATSQAQPASTPTSTTPPVATPAPVRAVA  118

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
             +   V  PA      +   DVYGQAASNLVAG NLE  +QQILDMGGG+ DR+TVVRAL
Sbjct  119  ESQPVVETPAVAAPTDSSRSDVYGQAASNLVAGTNLEATVQQILDMGGGSWDRDTVVRAL  178

Query  627  RAAYNN  644
            RAA+NN
Sbjct  179  RAAFNN  184



>gb|KJB80005.1| hypothetical protein B456_013G076900 [Gossypium raimondii]
Length=385

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 129/186 (69%), Gaps = 3/186 (2%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+F IEVKPED VADVKK+IETVQG++VYPA+Q MLI++GKVLKD TTL 
Sbjct  1    MKVFVKTLKGTHFNIEVKPEDAVADVKKNIETVQGADVYPAAQQMLIYKGKVLKDDTTLA  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +N V EN+F+V+M+     + G     STA+T     A   S+        ++A   + A
Sbjct  61   ENSVTENSFIVIML---TKNKGASGEGSTASTAPTKKAPEASSLPTAPAPASTASVSMSA  117

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
             A     +     +      DVYGQAASNLVAG+NLEG IQQILDMGGGT DR+TVVRAL
Sbjct  118  MAAPATESAPVASSTPLSDSDVYGQAASNLVAGSNLEGTIQQILDMGGGTWDRDTVVRAL  177

Query  627  RAAYNN  644
            RAAYNN
Sbjct  178  RAAYNN  183



>ref|XP_004232367.1| PREDICTED: ubiquitin receptor RAD23d [Solanum lycopersicum]
 emb|CAB51544.1| RAD23 protein [Solanum lycopersicum var. cerasiforme]
Length=389

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 134/186 (72%), Gaps = 1/186 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKPED+VADVKK+IE+VQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIESVQGQDVYPAAQQMLIHQGKVLKDTTTLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKVAEN+FVV+ M      S  G++S +A     A    ++           A A +P 
Sbjct  61   ENKVAENSFVVI-MLSKNKVSSTGTSSISAALSNTAQPDGSTDQARQTITTPQATAALPQ  119

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
            SA      PAP PA  +   DVY QAASNLVAG+NLE  +QQILDMGGG+ DR+TVVRAL
Sbjct  120  SASESAPTPAPVPAAASSVTDVYDQAASNLVAGSNLETTVQQILDMGGGSWDRDTVVRAL  179

Query  627  RAAYNN  644
            RAAYNN
Sbjct  180  RAAYNN  185



>gb|KJB80004.1| hypothetical protein B456_013G076900 [Gossypium raimondii]
Length=384

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 129/186 (69%), Gaps = 3/186 (2%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+F IEVKPED VADVKK+IETVQG++VYPA+Q MLI++GKVLKD TTL 
Sbjct  1    MKVFVKTLKGTHFNIEVKPEDAVADVKKNIETVQGADVYPAAQQMLIYKGKVLKDDTTLA  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +N V EN+F+V+M+     + G     STA+T     A   S+        ++A   + A
Sbjct  61   ENSVTENSFIVIML---TKNKGASGEGSTASTAPTKKAPEASSLPTAPAPASTASVSMSA  117

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
             A     +     +      DVYGQAASNLVAG+NLEG IQQILDMGGGT DR+TVVRAL
Sbjct  118  MAAPATESAPVASSTPLSDSDVYGQAASNLVAGSNLEGTIQQILDMGGGTWDRDTVVRAL  177

Query  627  RAAYNN  644
            RAAYNN
Sbjct  178  RAAYNN  183



>ref|XP_010552226.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Tarenaya 
hassleriana]
Length=387

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 131/186 (70%), Gaps = 1/186 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT FEIEVKP+D V DVKK+IETVQG+NVYPA+Q MLIHQGKVL D TTLE
Sbjct  1    MKIFVKTLKGTSFEIEVKPDDKVTDVKKTIETVQGANVYPAAQQMLIHQGKVLSDETTLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NK++EN F+V+ M      S  G+++++A   + +  S   A+   +    + P P   
Sbjct  61   ENKISENGFIVI-MLSKSKVSSSGTSTASAPPASASQPSQAPAAPRVSAPTVAVPEPTSG  119

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
             A     A A   AP     DVYGQAASNLVAG+NLE  IQQILDMGGG+ DR+TVVRAL
Sbjct  120  PATATATATATAAAPVLAQTDVYGQAASNLVAGSNLESTIQQILDMGGGSWDRDTVVRAL  179

Query  627  RAAYNN  644
            RAAYNN
Sbjct  180  RAAYNN  185



>ref|XP_008379541.1| PREDICTED: ubiquitin receptor RAD23d-like [Malus domestica]
Length=387

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 130/186 (70%), Gaps = 0/186 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT FEIEVKPE+TVADVK  IET QG++VYPA Q MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTNFEIEVKPEETVADVKTIIETAQGADVYPAPQQMLIHQGKVLKDDTTLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
             N VAEN+F+V+M+ K K+S    S+   A T    PAS+   S AP P   +    +  
Sbjct  61   QNNVAENSFIVIMLTKPKASPAGASSKQGAATSQAQPASTAPTSAAPPPAAPAPAPALLQ  120

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
              P P    A   APT    DVYGQAASNLVAG  LE  +QQILDMGGG+ DRETVVRAL
Sbjct  121  LLPQPXXQTAAVVAPTDSRSDVYGQAASNLVAGTTLESTVQQILDMGGGSWDRETVVRAL  180

Query  627  RAAYNN  644
            RAA+NN
Sbjct  181  RAAFNN  186



>ref|XP_006846642.1| hypothetical protein AMTR_s00156p00078120 [Amborella trichopoda]
 gb|ERN08317.1| hypothetical protein AMTR_s00156p00078120 [Amborella trichopoda]
Length=389

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 137/188 (73%), Gaps = 2/188 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKG++FEIEV+P DTV+ VKK+IET+ G +VYPA+Q +LIHQGKVLKD TTL 
Sbjct  1    MKLFVKTLKGSHFEIEVEPSDTVSAVKKNIETIHGQDVYPAAQQLLIHQGKVLKDDTTLL  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            DNKVAENNF+V+M+ KTK+ +G G++++++ T  + P SS+  +   +  PA   A    
Sbjct  61   DNKVAENNFLVIMLTKTKAPAGGGTSTTSSATAQVQPPSSSPPNPPTSAPPAQTAATPSP  120

Query  447  sapvpvaapaptpaptagsgD--VYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVR  620
                              SGD  VYGQAASNLVAG+NLE AIQQILDMGGG+ DR+TVVR
Sbjct  121  PVAAAPTTVNQPATALLSSGDADVYGQAASNLVAGSNLEQAIQQILDMGGGSWDRDTVVR  180

Query  621  ALRAAYNN  644
            ALRAAYNN
Sbjct  181  ALRAAYNN  188



>ref|XP_011021233.1| PREDICTED: ubiquitin receptor RAD23c isoform X3 [Populus euphratica]
Length=382

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 136/186 (73%), Gaps = 0/186 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT FEIEVKPEDTV +VKK+IE  QG++VYPA+Q MLI+QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENAQGADVYPAAQQMLIYQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            ++KVAEN+F+VVM++K+K SSG  S ++ A      P SS  ++       A A  P   
Sbjct  61   ESKVAENSFIVVMLSKSKVSSGGPSTATAAPPTLAQPTSSLPSNVTQPSSTAQAAVPAAV  120

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
                  ++PA   +  +   D+YGQAASNLVAG+NLE  IQQILDMGGG+ +RETVVRAL
Sbjct  121  PQSAAESSPAVVVSDLSSDADMYGQAASNLVAGSNLEATIQQILDMGGGSWNRETVVRAL  180

Query  627  RAAYNN  644
            RAA+NN
Sbjct  181  RAAFNN  186



>ref|XP_008368214.1| PREDICTED: ubiquitin receptor RAD23c-like [Malus domestica]
Length=378

 Score =   175 bits (444),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 126/187 (67%), Gaps = 1/187 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+F++EVKPEDTVADVKK IE  +GS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFDLEVKPEDTVADVKKHIEACKGSDVYPASQQMLIHQGKVLKDDTTLD  60

Query  267  DNKVAENNF-VVVMMaktksssgegsasstattktiapasstsastapapvpasapapvp  443
             NKVAEN+F V+++        GEGS +STA T      S+ + +         AP    
Sbjct  61   GNKVAENSFVVIMLTKSKSPPGGEGSGASTAATTEAPQPSAHTGAPTATLTATPAPXAAS  120

Query  444  asapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRA  623
            A               T    D YGQAAS+LVAG NLEG IQQILDMGGGT DR+TVVRA
Sbjct  121  ALPAPVTTPAPVASPTTDSQADSYGQAASDLVAGTNLEGTIQQILDMGGGTWDRDTVVRA  180

Query  624  LRAAYNN  644
            LRAA+NN
Sbjct  181  LRAAFNN  187



>ref|XP_011035052.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Populus 
euphratica]
Length=385

 Score =   175 bits (444),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 134/186 (72%), Gaps = 0/186 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVYQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKV+E++F VVM++K+K SS   S +  A      PASS  ++     + + AP P  A
Sbjct  61   ENKVSESSFFVVMLSKSKVSSSGPSTAPAAPPSQAPPASSLPSNVTQPSITSQAPVPAAA  120

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
                   +            ++YGQAASNLVAG+NLE  IQQILDMGGG  +RETVVRAL
Sbjct  121  LPQSAAESSPAVVTSALLDTNMYGQAASNLVAGSNLEATIQQILDMGGGDWNRETVVRAL  180

Query  627  RAAYNN  644
            RAA+NN
Sbjct  181  RAAFNN  186



>ref|XP_002305813.1| ubiquitin family protein [Populus trichocarpa]
 gb|EEE86324.1| ubiquitin family protein [Populus trichocarpa]
Length=385

 Score =   173 bits (438),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 135/186 (73%), Gaps = 0/186 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVYQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKV+E++F VVM++K+K SSG  S +  A      PASS  ++     + + AP P  A
Sbjct  61   ENKVSESSFFVVMLSKSKVSSGGPSTAPAAPASQAPPASSLPSNVTQPSITSQAPVPAAA  120

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
                   +            ++YGQAASNLVAG+NLE  IQ+ILDMGGG  +RETVVRAL
Sbjct  121  LPQSAAESSPAVVTSALLDTNMYGQAASNLVAGSNLEATIQEILDMGGGDWNRETVVRAL  180

Query  627  RAAYNN  644
            RAA+NN
Sbjct  181  RAAFNN  186



>ref|XP_009356676.1| PREDICTED: ubiquitin receptor RAD23c-like [Pyrus x bretschneideri]
Length=384

 Score =   173 bits (438),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 127/187 (68%), Gaps = 1/187 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+F++EVKPEDTVADVKK IE  +GS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFDLEVKPEDTVADVKKHIEACKGSDVYPASQQMLIHQGKVLKDDTTLD  60

Query  267  DNKVAENNF-VVVMMaktksssgegsasstattktiapasstsastapapvpasapapvp  443
             NKVAEN+F V+++      + GEGS +STA T      S+ + +         APA   
Sbjct  61   GNKVAENSFVVIMLTKSKSPTGGEGSGASTAATTEAPQPSAHTGAPTATLTATPAPAAAS  120

Query  444  asapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRA  623
            A               T    D YGQAAS+LVAG NLEG IQQILDMGGGT DR+TVV A
Sbjct  121  ALPASVTTPAPVASPTTNSQADSYGQAASDLVAGTNLEGTIQQILDMGGGTWDRDTVVCA  180

Query  624  LRAAYNN  644
            LRAA+NN
Sbjct  181  LRAAFNN  187



>ref|XP_011021236.1| PREDICTED: ubiquitin receptor RAD23c isoform X4 [Populus euphratica]
Length=381

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 132/186 (71%), Gaps = 1/186 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT FEIEVKPEDTV +VKK+IE  QG++VYPA+Q MLI+QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENAQGADVYPAAQQMLIYQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            ++KVAEN+F+VV M      S  G +++TA   +  P SS  ++       A A  P   
Sbjct  61   ESKVAENSFIVV-MLSKSKVSSGGPSTATAAPPSAQPTSSLPSNVTQPSSTAQAAVPAAV  119

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
                  ++PA   +  +   D+YGQAASNLVAG+NLE  IQQILDMGGG+ +RETVVRAL
Sbjct  120  PQSAAESSPAVVVSDLSSDADMYGQAASNLVAGSNLEATIQQILDMGGGSWNRETVVRAL  179

Query  627  RAAYNN  644
            RAA+NN
Sbjct  180  RAAFNN  185



>ref|XP_006383464.1| ubiquitin family protein [Populus trichocarpa]
 gb|ERP61261.1| ubiquitin family protein [Populus trichocarpa]
Length=384

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 134/188 (71%), Gaps = 2/188 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVA-DVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTL  263
            MK+FVKTLKGT FEIEVKPEDTV  +VKK+IE VQG++VYPA+Q MLI+QGKVLKD TTL
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVVEVKKNIENVQGADVYPAAQQMLIYQGKVLKDDTTL  60

Query  264  EDNKVAENNFVVVMMaktksss-gegsasstattktiapasstsastapapvpasapapv  440
            +++KVAEN+F+VVM++K+K SS G  +A++     +    S+ +A+           +  
Sbjct  61   DESKVAENSFIVVMLSKSKVSSGGPSTATAAPPNVSSGGPSTATAAPPTLVSAQPTSSLP  120

Query  441  pasapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVR  620
                     + A  PA      D+YGQAASNLVAG+NLE  IQQILDMGGG+ +RETVVR
Sbjct  121  SNVTQPSSTSQAAVPAAAFSDADMYGQAASNLVAGSNLEATIQQILDMGGGSWNRETVVR  180

Query  621  ALRAAYNN  644
            ALRAA+NN
Sbjct  181  ALRAAFNN  188



>ref|XP_011035051.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Populus 
euphratica]
Length=386

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 134/187 (72%), Gaps = 1/187 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVYQGKVLKDDTTLD  60

Query  267  DNKVAENNF-VVVMMaktksssgegsasstattktiapasstsastapapvpasapapvp  443
            +NKV+E++F VV++     SSSG  +A +   ++    +S  S  T P+    +      
Sbjct  61   ENKVSESSFFVVMLSKSKVSSSGPSTAPAAPPSQAPPASSLPSNVTQPSITSQAPVPAAA  120

Query  444  asapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRA  623
                   ++PA   +  +   ++YGQAASNLVAG+NLE  IQQILDMGGG  +RETVVRA
Sbjct  121  LPQSAAESSPAVVTSALSLDTNMYGQAASNLVAGSNLEATIQQILDMGGGDWNRETVVRA  180

Query  624  LRAAYNN  644
            LRAA+NN
Sbjct  181  LRAAFNN  187



>ref|XP_010440953.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Camelina 
sativa]
 ref|XP_010440954.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Camelina 
sativa]
 ref|XP_010440955.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Camelina 
sativa]
 ref|XP_010440956.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Camelina 
sativa]
Length=377

 Score =   165 bits (418),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 126/186 (68%), Gaps = 8/186 (4%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTL GT FEIEVKP DTV+DVK++IETVQG+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSDVKQAIETVQGAQ-YPAAKQMLIHQGKVLKDETTLE  59

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +N V EN+F+V+M+        +  AS +  +   APA S + S     V     +    
Sbjct  60   ENNVVENSFIVIML-------SKTKASPSGASTASAPAPSATQSQPAQTVATPQVSAPTV  112

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
            S P P +  A   A  +   DVYGQAASNLVAG  LE  +QQILDMGGG+ DR+TVVRAL
Sbjct  113  SVPEPTSVTAAPAAAASVQTDVYGQAASNLVAGTVLESTVQQILDMGGGSWDRDTVVRAL  172

Query  627  RAAYNN  644
            RAA+NN
Sbjct  173  RAAFNN  178



>ref|NP_001078680.1| ubiquitin receptor RAD23d [Arabidopsis thaliana]
 gb|AED94322.1| putative DNA repair protein RAD23-4 [Arabidopsis thaliana]
Length=332

 Score =   160 bits (406),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 121/186 (65%), Gaps = 8/186 (4%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTL G+ FEIEVKP D V+DVK +IETV+G+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLSGSNFEIEVKPADKVSDVKTAIETVKGAE-YPAAKQMLIHQGKVLKDETTLE  59

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +N V EN+F+V+M+        +  AS +  +   APA S +     A    SAP     
Sbjct  60   ENNVVENSFIVIML-------SKTKASPSGASTASAPAPSATQPQTVATPQVSAPTASVP  112

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
                  A  A      +   DVYGQAASNLVAG  LE  +QQILDMGGG+ DR+TVVRAL
Sbjct  113  VPTSGTATAAAPATAASVQTDVYGQAASNLVAGTTLESTVQQILDMGGGSWDRDTVVRAL  172

Query  627  RAAYNN  644
            RAA+NN
Sbjct  173  RAAFNN  178



>dbj|BAC76395.1| RAD23-like protein [Arabidopsis thaliana]
Length=343

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 121/186 (65%), Gaps = 8/186 (4%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTL G+ FEIEVKP D V+DVK +IETV+G+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLSGSNFEIEVKPADKVSDVKTAIETVKGAE-YPAAKQMLIHQGKVLKDETTLE  59

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +N V EN+F+V+M+        +  AS +  +   APA S +     A    SAP     
Sbjct  60   ENNVVENSFIVIML-------SKTKASPSGASTASAPAPSATQPQTVATPQVSAPTASVP  112

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
                  A  A      +   DVYGQAASNLVAG  LE  +QQILDMGGG+ DR+TVVRAL
Sbjct  113  VPTSGTATAAAPATAASVQTDVYGQAASNLVAGTTLESTVQQILDMGGGSWDRDTVVRAL  172

Query  627  RAAYNN  644
            RAA+NN
Sbjct  173  RAAFNN  178



>emb|CDY58121.1| BnaCnng32650D [Brassica napus]
Length=384

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 128/186 (69%), Gaps = 2/186 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT FEIEV P +T++D KK IET+ G+  YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTNFEIEVNPAETISDTKKRIETLHGAQ-YPAAQQMLIHQGKVLKDETTLE  59

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +N V EN+F+ V+M      S  G+++++A     +   +  A T   P  A+  A VP 
Sbjct  60   ENNVVENSFI-VIMLSKAKVSSSGASTASAPAPAPSATQAQPAQTVATPQVATPTASVPE  118

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
             +       AP+ A  +   DVYGQAASNLVAGNNLE  +QQILDMGGG+ DR+TV+RAL
Sbjct  119  PSSGAATGAAPSAAAASTQTDVYGQAASNLVAGNNLESTVQQILDMGGGSWDRDTVIRAL  178

Query  627  RAAYNN  644
            RAA+NN
Sbjct  179  RAAFNN  184



>ref|NP_001130219.1| uncharacterized protein LOC100191313 [Zea mays]
 gb|ACF78374.1| unknown [Zea mays]
 tpg|DAA61377.1| TPA: hypothetical protein ZEAMMB73_350633 [Zea mays]
 tpg|DAA61378.1| TPA: hypothetical protein ZEAMMB73_350633 [Zea mays]
Length=225

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 117/186 (63%), Gaps = 0/186 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG+ F IEV P D VADVKK IE++Q    YPA Q +LIHQGKVLKD TTLE
Sbjct  1    MKVSVKTLKGSSFHIEVDPTDKVADVKKVIESIQEQASYPADQQVLIHQGKVLKDDTTLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +N+V ENNF+V+M+ + K SS    A  TA           +     A   A AP    +
Sbjct  61   ENQVVENNFLVIMLRQNKGSSSAAPAKVTANQAPSTQTVPATPPQTSAAPDAPAPIVPVS  120

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
            +      A A      +   D YGQA SNLVAG+NLEG I+ IL+MGGGT DR+TV+RAL
Sbjct  121  APAATATASAAPAVAVSTEADSYGQATSNLVAGSNLEGTIKSILEMGGGTWDRDTVLRAL  180

Query  627  RAAYNN  644
            RAAYNN
Sbjct  181  RAAYNN  186



>ref|XP_010103794.1| Putative DNA repair protein RAD23-4 [Morus notabilis]
 gb|EXB97156.1| Putative DNA repair protein RAD23-4 [Morus notabilis]
Length=550

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 109/234 (47%), Positives = 136/234 (58%), Gaps = 45/234 (19%)
 Frame = +3

Query  78   RENMKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGT  257
            ++ MKI VKTLKGT+FEIEVKPEDTVADVKK+IE VQG++VYPASQ MLIHQGKVLKD T
Sbjct  115  KKKMKICVKTLKGTHFEIEVKPEDTVADVKKNIEVVQGADVYPASQQMLIHQGKVLKDVT  174

Query  258  TLEDNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapap  437
            TLE+NKV EN+F+V+M+ K K+S    S++S A T    P +++  +++     +  PA 
Sbjct  175  TLEENKVVENSFIVIMITKNKASPSGASSTSGAATSQAQPVTASPPASSTPSTTSETPAS  234

Query  438  vpasapvpvaapaptpaptagsgDVYGQAASNL---------------------------  536
            V                  +   DVYGQAASNL                           
Sbjct  235  VAPPPQSVPEPAPAAAPTASAELDVYGQAASNLVAGSNLEATVQQILDRNLFPNLLLQQL  294

Query  537  ------------------VAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
                              VAG+NLE  +QQILDMGGG+ DR+TVVRALRAA+NN
Sbjct  295  LLLRDAELDVYGQAASNLVAGSNLEATVQQILDMGGGSWDRDTVVRALRAAFNN  348



>ref|XP_004956778.1| PREDICTED: probable DNA repair protein RAD23-like isoform X2 
[Setaria italica]
Length=394

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 122/187 (65%), Gaps = 1/187 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG+ F+IEV+  D VADVKK IE+ QG NVYPA Q MLIHQGKVL D TTLE
Sbjct  1    MKVSVKTLKGSSFQIEVEATDKVADVKKVIESTQGQNVYPADQQMLIHQGKVLNDETTLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapa-sstsastapapvpasapapvp  443
            +N+V ENNF+V+M+ + K+SS    A ++A          +T A   P    A AP    
Sbjct  61   ENQVLENNFLVIMLRQNKASSSAPPAKASANQAPPTQTVPATPAPQTPVAPAAPAPTVPV  120

Query  444  asapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRA  623
            ++      A        +   D YGQAASNLVAG NLEG IQ IL+MGGGT DR+TV+RA
Sbjct  121  SAPAPTATASPAPAVAVSTEADSYGQAASNLVAGGNLEGTIQSILEMGGGTWDRDTVLRA  180

Query  624  LRAAYNN  644
            L+AAYNN
Sbjct  181  LQAAYNN  187



>gb|KDO46132.1| hypothetical protein CISIN_1g0198171mg [Citrus sinensis]
Length=197

 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 121/186 (65%), Gaps = 3/186 (2%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG++FEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            DNKV+E+ F+VVM+     S   GSA +++         +T+ S+   P   ++  P   
Sbjct  61   DNKVSEDGFLVVML---SKSKTLGSAGASSAQPAHTTPPTTAPSSNSTPPQEASVPPPAP  117

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
            +  +P +           + D YGQAASNLVAGN+LE  IQQI+DMGGGT D+ETV RAL
Sbjct  118  TPSIPASNVTSNVTAANANSDTYGQAASNLVAGNDLEQTIQQIMDMGGGTWDKETVTRAL  177

Query  627  RAAYNN  644
            +AAYNN
Sbjct  178  QAAYNN  183



>tpg|DAA61375.1| TPA: hypothetical protein ZEAMMB73_350633 [Zea mays]
Length=339

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 117/186 (63%), Gaps = 0/186 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG+ F IEV P D VADVKK IE++Q    YPA Q +LIHQGKVLKD TTLE
Sbjct  1    MKVSVKTLKGSSFHIEVDPTDKVADVKKVIESIQEQASYPADQQVLIHQGKVLKDDTTLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +N+V ENNF+V+M+ + K SS    A  TA           +     A   A AP    +
Sbjct  61   ENQVVENNFLVIMLRQNKGSSSAAPAKVTANQAPSTQTVPATPPQTSAAPDAPAPIVPVS  120

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
            +      A A      +   D YGQA SNLVAG+NLEG I+ IL+MGGGT DR+TV+RAL
Sbjct  121  APAATATASAAPAVAVSTEADSYGQATSNLVAGSNLEGTIKSILEMGGGTWDRDTVLRAL  180

Query  627  RAAYNN  644
            RAAYNN
Sbjct  181  RAAYNN  186



>ref|XP_006283908.1| hypothetical protein CARUB_v10005026mg [Capsella rubella]
 gb|EOA16806.1| hypothetical protein CARUB_v10005026mg [Capsella rubella]
Length=385

 Score =   157 bits (396),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 129/187 (69%), Gaps = 2/187 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTL GT FEIEVKP DTV++VKK+IETVQG+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSEVKKAIETVQGAQ-YPAAKQMLIHQGKVLKDETTLE  59

Query  267  DNKVAENNF-VVVMMaktksssgegsasstattktiapasstsastapapvpasapapvp  443
            +N V E +F V+++     SSSG  +AS+ A T T +   +  A T   P  ++    VP
Sbjct  60   ENNVVEKSFIVIMLSKTKVSSSGASTASAPAPTPTPSATQAQPAQTVATPQVSAPTVSVP  119

Query  444  asapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRA  623
                    A AP  A  +   DVYGQAASNLVAG  LE  +QQILDMGGG+ DR+TVVRA
Sbjct  120  EPTSGTATAAAPAAAAASVQTDVYGQAASNLVAGTTLESTVQQILDMGGGSWDRDTVVRA  179

Query  624  LRAAYNN  644
            LRAA+NN
Sbjct  180  LRAAFNN  186



>gb|KDO46130.1| hypothetical protein CISIN_1g0198171mg, partial [Citrus sinensis]
Length=260

 Score =   153 bits (387),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 121/186 (65%), Gaps = 3/186 (2%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG++FEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            DNKV+E+ F+VVM+     S   GSA +++         +T+ S+   P   ++  P   
Sbjct  61   DNKVSEDGFLVVML---SKSKTLGSAGASSAQPAHTTPPTTAPSSNSTPPQEASVPPPAP  117

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
            +  +P +           + D YGQAASNLVAGN+LE  IQQI+DMGGGT D+ETV RAL
Sbjct  118  TPSIPASNVTSNVTAANANSDTYGQAASNLVAGNDLEQTIQQIMDMGGGTWDKETVTRAL  177

Query  627  RAAYNN  644
            +AAYNN
Sbjct  178  QAAYNN  183



>ref|XP_008650775.1| PREDICTED: uncharacterized protein LOC100191313 isoform X1 [Zea 
mays]
 gb|ACF84200.1| unknown [Zea mays]
 gb|ACG34516.1| DNA repair protein RAD23 [Zea mays]
 tpg|DAA61376.1| TPA: DNA repair protein RAD23 [Zea mays]
Length=386

 Score =   156 bits (395),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 117/186 (63%), Gaps = 0/186 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG+ F IEV P D VADVKK IE++Q    YPA Q +LIHQGKVLKD TTLE
Sbjct  1    MKVSVKTLKGSSFHIEVDPTDKVADVKKVIESIQEQASYPADQQVLIHQGKVLKDDTTLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +N+V ENNF+V+M+ + K SS    A  TA           +     A   A AP    +
Sbjct  61   ENQVVENNFLVIMLRQNKGSSSAAPAKVTANQAPSTQTVPATPPQTSAAPDAPAPIVPVS  120

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
            +      A A      +   D YGQA SNLVAG+NLEG I+ IL+MGGGT DR+TV+RAL
Sbjct  121  APAATATASAAPAVAVSTEADSYGQATSNLVAGSNLEGTIKSILEMGGGTWDRDTVLRAL  180

Query  627  RAAYNN  644
            RAAYNN
Sbjct  181  RAAYNN  186



>gb|KDO46129.1| hypothetical protein CISIN_1g0198171mg [Citrus sinensis]
Length=274

 Score =   154 bits (388),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 121/186 (65%), Gaps = 3/186 (2%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG++FEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            DNKV+E+ F+VVM+     S   GSA +++         +T+ S+   P   ++  P   
Sbjct  61   DNKVSEDGFLVVML---SKSKTLGSAGASSAQPAHTTPPTTAPSSNSTPPQEASVPPPAP  117

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
            +  +P +           + D YGQAASNLVAGN+LE  IQQI+DMGGGT D+ETV RAL
Sbjct  118  TPSIPASNVTSNVTAANANSDTYGQAASNLVAGNDLEQTIQQIMDMGGGTWDKETVTRAL  177

Query  627  RAAYNN  644
            +AAYNN
Sbjct  178  QAAYNN  183



>ref|XP_004956777.1| PREDICTED: probable DNA repair protein RAD23-like isoform X1 
[Setaria italica]
Length=468

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 118/187 (63%), Gaps = 1/187 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG+ F+IEV+  D VADVKK IE+ QG NVYPA Q MLIHQGKVL D TTLE
Sbjct  1    MKVSVKTLKGSSFQIEVEATDKVADVKKVIESTQGQNVYPADQQMLIHQGKVLNDETTLE  60

Query  267  DNKVAENNFVVV-MMaktksssgegsasstattktiapasstsastapapvpasapapvp  443
            +N+V ENNF+V+ +     SSS   + +S           +T A   P    A AP    
Sbjct  61   ENQVLENNFLVIMLRQNKASSSAPPAKASANQAPPTQTVPATPAPQTPVAPAAPAPTVPV  120

Query  444  asapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRA  623
            ++      A        +   D YGQAASNLVAG NLEG IQ IL+MGGGT DR+TV+RA
Sbjct  121  SAPAPTATASPAPAVAVSTEADSYGQAASNLVAGGNLEGTIQSILEMGGGTWDRDTVLRA  180

Query  624  LRAAYNN  644
            L+AAYNN
Sbjct  181  LQAAYNN  187



>ref|XP_007135849.1| hypothetical protein PHAVU_010G163300g [Phaseolus vulgaris]
 gb|ESW07843.1| hypothetical protein PHAVU_010G163300g [Phaseolus vulgaris]
Length=371

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 115/186 (62%), Gaps = 8/186 (4%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG++FEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLV  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            DNKV+E+ F+VVM+          S +S +        +ST AST        A  P   
Sbjct  61   DNKVSEDGFLVVML--------SKSKASGSAAAPSVQPASTPASTVSTSNTNPASDPPVQ  112

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
            +  V           T  S D YGQAASNLVAG+NLE  IQQI+DMGGG  DR+TV RAL
Sbjct  113  TQAVNNITSTTDAPTTNVSADTYGQAASNLVAGSNLEQTIQQIMDMGGGNWDRDTVTRAL  172

Query  627  RAAYNN  644
            RAAYNN
Sbjct  173  RAAYNN  178



>gb|KJB69953.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
Length=330

 Score =   150 bits (379),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 110/186 (59%), Gaps = 18/186 (10%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG++FEI V+P DT+  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLIVKTLKGSHFEIRVQPNDTIMAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKV+E+ F+VVM+                         ST AS+A       +     +
Sbjct  61   ENKVSEDGFLVVML------------------SKSKSLGSTGASSAQPASSTPSTTVPAS  102

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
            +           PA  +   D Y QAASNLVAGNNLE  IQQ++DMGGG  D+ETV RAL
Sbjct  103  APSSNSTPATGAPAQASQQTDTYSQAASNLVAGNNLEQTIQQLMDMGGGNWDKETVTRAL  162

Query  627  RAAYNN  644
            RAAYNN
Sbjct  163  RAAYNN  168



>gb|KJB34920.1| hypothetical protein B456_006G091100 [Gossypium raimondii]
Length=373

 Score =   150 bits (380),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 120/186 (65%), Gaps = 7/186 (4%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG++FEI V+P DTV  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPNDTVMAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            DNKV+E+ F+VVM+        +  +  +A T +  PASS  ++TAP   P  AP     
Sbjct  61   DNKVSEDGFLVVML-------SKSKSLGSAGTSSAQPASSAPSTTAPVSNPTPAPEVPAQ  113

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
            +        A   A      D Y QAASNLVAG+NLE  IQQ++DMGGG+ D+ETV RAL
Sbjct  114  APDSKSGTSASDAATANPDTDTYSQAASNLVAGSNLEQTIQQLMDMGGGSWDKETVTRAL  173

Query  627  RAAYNN  644
            RAAYNN
Sbjct  174  RAAYNN  179



>gb|KHG13236.1| Putative DNA repair RAD23-1 -like protein [Gossypium arboreum]
Length=373

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 121/186 (65%), Gaps = 7/186 (4%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG++FEI V+P DTV  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPNDTVMAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            DNKV+E+ F+VVM+        +  +  +A T +  PASS  ++TAP   P  AP     
Sbjct  61   DNKVSEDGFLVVML-------SKSKSLGSAGTSSAQPASSAPSTTAPVSNPTPAPEIPAQ  113

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
            +        A   A    + D Y QAASNLVAG+NLE  IQQ++DMGGG+ D+ETV RAL
Sbjct  114  APDSKSGTSASDAATANPNTDTYSQAASNLVAGSNLEQTIQQLMDMGGGSWDKETVTRAL  173

Query  627  RAAYNN  644
            RAAYNN
Sbjct  174  RAAYNN  179



>gb|KJB69954.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
Length=317

 Score =   149 bits (376),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 110/186 (59%), Gaps = 18/186 (10%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG++FEI V+P DT+  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLIVKTLKGSHFEIRVQPNDTIMAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKV+E+ F+VVM+                         ST AS+A       +     +
Sbjct  61   ENKVSEDGFLVVML------------------SKSKSLGSTGASSAQPASSTPSTTVPAS  102

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
            +           PA  +   D Y QAASNLVAGNNLE  IQQ++DMGGG  D+ETV RAL
Sbjct  103  APSSNSTPATGAPAQASQQTDTYSQAASNLVAGNNLEQTIQQLMDMGGGNWDKETVTRAL  162

Query  627  RAAYNN  644
            RAAYNN
Sbjct  163  RAAYNN  168



>gb|KJB69952.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
 gb|KJB69955.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
Length=362

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 110/186 (59%), Gaps = 18/186 (10%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG++FEI V+P DT+  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLIVKTLKGSHFEIRVQPNDTIMAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKV+E+ F+VVM+                         ST AS+A       +     +
Sbjct  61   ENKVSEDGFLVVML------------------SKSKSLGSTGASSAQPASSTPSTTVPAS  102

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
            +           PA  +   D Y QAASNLVAGNNLE  IQQ++DMGGG  D+ETV RAL
Sbjct  103  APSSNSTPATGAPAQASQQTDTYSQAASNLVAGNNLEQTIQQLMDMGGGNWDKETVTRAL  162

Query  627  RAAYNN  644
            RAAYNN
Sbjct  163  RAAYNN  168



>gb|EMT27109.1| Putative DNA repair protein RAD23 [Aegilops tauschii]
Length=423

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 125/192 (65%), Gaps = 6/192 (3%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKGT FEIE  PE +V +VK+ IE+ QG NVYPA QLM+I+QGK+LKD TTLE
Sbjct  1    MKLNVKTLKGTSFEIEATPESSVGEVKRIIESAQGQNVYPADQLMIIYQGKILKDDTTLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
             NKVAEN+F+V+M++K K+SS   S +S A      PA+  +   + A  P S      +
Sbjct  61   ANKVAENSFLVIMLSKPKASSSGASTASKAPASQSQPATPPAPVASAARSPPSQAPVAAS  120

Query  447  sapvpvaapaptpaptagsgDVYG------QAASNLVAGNNLEGAIQQILDMGGGTXDRE  608
                P A P+      A +    G      QAASNLV+G +LE  +QQILDMGGGT +R+
Sbjct  121  EPAPPSAQPSAVSDTPAPAVTASGDADVYSQAASNLVSGGSLEQTVQQILDMGGGTWERD  180

Query  609  TVVRALRAAYNN  644
             VVRALRAAYNN
Sbjct  181  MVVRALRAAYNN  192



>ref|XP_008462953.1| PREDICTED: ubiquitin receptor RAD23b isoform X1 [Cucumis melo]
Length=387

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 123/190 (65%), Gaps = 4/190 (2%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG++FEI V+  DTV  VKK+IE VQG + YP  Q +LIH GKVLKD +TL 
Sbjct  1    MKLTVKTLKGSHFEIRVQLTDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDESTLA  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKV+E  F+VVM++K+K+S+  G +S+             S++ A    P+  PAP   
Sbjct  61   ENKVSEEGFLVVMLSKSKTSASAGQSSTQPAQNPPVAQPVLSSTPAAQVTPSPTPAPQAP  120

Query  447  sapvpvaapaptpaptags----gDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETV  614
            +     A    T      +     D YGQAASNLVAGNNLE  +QQ++DMGGGT DRETV
Sbjct  121  TQAPSSALKNTTSTSDRVTDNVQTDTYGQAASNLVAGNNLEQTVQQLMDMGGGTWDRETV  180

Query  615  VRALRAAYNN  644
            VRALRAAYNN
Sbjct  181  VRALRAAYNN  190



>ref|XP_009365249.1| PREDICTED: ubiquitin receptor RAD23b-like [Pyrus x bretschneideri]
Length=374

 Score =   148 bits (374),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 111/186 (60%), Gaps = 9/186 (5%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG++FEI V+P D V  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPTDAVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            DNKV E+ F+VVM+           + ++    + +   +++  +   P   S       
Sbjct  61   DNKVTEDGFLVVML---------SKSKTSGLAGSSSGQLASTNPSTIPPTTDSTTRTEAP  111

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
                P+ +    P   +   D YGQAAS LVAG NLE  IQQI+DMGGG  DRETV RAL
Sbjct  112  IQAPPLQSTTSAPDTASAHSDTYGQAASTLVAGTNLEQTIQQIMDMGGGNWDRETVTRAL  171

Query  627  RAAYNN  644
            RAAYNN
Sbjct  172  RAAYNN  177



>ref|XP_010435749.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Camelina 
sativa]
Length=376

 Score =   148 bits (374),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 116/186 (62%), Gaps = 6/186 (3%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTL GT FEIEVKP DTV+DVK++IETVQG+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSDVKQAIETVQGAQ-YPAAKQMLIHQGKVLKDETTLE  59

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
                 ENN V         S  + S S  +T    AP  S + S        SAP     
Sbjct  60   -----ENNVVENSFIVIMLSKTKPSPSGASTASAPAPTPSATQSQPAPTPQVSAPTVSVP  114

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
                  A  A   A  +   DVYGQAASNLVAG  LE  +QQILDMGGG+ DR+TVVRAL
Sbjct  115  EPTSVTATAAAPAAAASVQTDVYGQAASNLVAGTVLESTVQQILDMGGGSWDRDTVVRAL  174

Query  627  RAAYNN  644
            RAA+NN
Sbjct  175  RAAFNN  180



>gb|KHG09850.1| Putative DNA repair RAD23-1 -like protein [Gossypium arboreum]
Length=362

 Score =   148 bits (373),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 87/186 (47%), Positives = 110/186 (59%), Gaps = 18/186 (10%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ +KTLKG++FEI V+P DTV  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLIIKTLKGSHFEIRVQPNDTVMAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKV+E+ F+VVM+                         ST AS+A       +     +
Sbjct  61   ENKVSEDGFLVVML------------------SKSKSLGSTGASSAQPASSTPSTTVPAS  102

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
            +           PA  +   + Y QAASNLVAGNNLE  IQQ++DMGGG  D+ETV RAL
Sbjct  103  APSSNSTPATGAPAQASQQTNTYSQAASNLVAGNNLEQTIQQLMDMGGGNWDKETVTRAL  162

Query  627  RAAYNN  644
            RAAYNN
Sbjct  163  RAAYNN  168



>gb|ACU20959.1| unknown [Glycine max]
Length=363

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 113/186 (61%), Gaps = 8/186 (4%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG++FEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLV  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKV+E+ F+VVM+          S +S +   +    +S   +T           P   
Sbjct  61   ENKVSEDGFLVVML--------SKSKTSGSAAASSVQPASNPPTTVSTSNSTPPSDPPVQ  112

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
            +     +  +     T  S D YG AASNLVAG+NLE  IQQI+DMGGG  DR+TV RAL
Sbjct  113  TQAANNSTSSTDAPTTNVSADTYGLAASNLVAGSNLEQTIQQIMDMGGGNWDRDTVSRAL  172

Query  627  RAAYNN  644
            RAAYNN
Sbjct  173  RAAYNN  178



>ref|NP_001240038.1| uncharacterized protein LOC100819019 [Glycine max]
 gb|ACU24437.1| unknown [Glycine max]
Length=363

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 113/186 (61%), Gaps = 8/186 (4%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG++FEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLV  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKV+E+ F+VVM+          S +S +   +    +S   +T           P   
Sbjct  61   ENKVSEDGFLVVML--------SKSKTSGSAAASSVQPASNPPTTVSTSNSTPPSDPPVQ  112

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
            +     +  +     T  S D YG AASNLVAG+NLE  IQQI+DMGGG  DR+TV RAL
Sbjct  113  TQAANNSTSSTDAPTTNVSADTYGLAASNLVAGSNLEQTIQQIMDMGGGNWDRDTVSRAL  172

Query  627  RAAYNN  644
            RAAYNN
Sbjct  173  RAAYNN  178



>ref|XP_003529480.1| PREDICTED: ubiquitin receptor RAD23b-like isoform 1 [Glycine 
max]
 gb|KHN39368.1| Putative DNA repair protein RAD23-1 [Glycine soja]
Length=363

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 114/186 (61%), Gaps = 8/186 (4%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG++FEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLV  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKV+E+ F+VVM+          S +S +   +    +S  A+T           P   
Sbjct  61   ENKVSEDGFLVVML--------SKSKTSGSAAASSVQPASNPATTVSMSNSTPPSDPPVQ  112

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
            +     +  +     T  S D YG AASNLVAG+NLE  IQQI+DMGGG  DR+TV RAL
Sbjct  113  TQAANNSTSSTDAPTTNVSADTYGLAASNLVAGSNLEQTIQQIMDMGGGNWDRDTVSRAL  172

Query  627  RAAYNN  644
            RAAYNN
Sbjct  173  RAAYNN  178



>ref|NP_001149553.1| LOC100283179 [Zea mays]
 gb|ACF84553.1| unknown [Zea mays]
 gb|ACG35819.1| DNA repair protein RAD23 [Zea mays]
 tpg|DAA40041.1| TPA: DNA repair protein RAD23 [Zea mays]
Length=390

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 115/186 (62%), Gaps = 0/186 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG+ F+IEV+P D VA VKK IE +Q    YPA Q +LIHQGKVL D TTLE
Sbjct  1    MKVSVKTLKGSSFQIEVEPTDKVAAVKKVIENMQEQASYPADQQVLIHQGKVLSDDTTLE  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +N+V ENNF+V+M+ + K SS    A +TA                 A   A AP    +
Sbjct  61   ENQVTENNFLVIMLRQNKGSSSAAPAKTTANQAPPTQTVPVVPPQTSAAPAAPAPIVPVS  120

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
            +      A A      +   D YGQAASNLVAG+NLEG IQ IL+MGGG  DR+TV+RAL
Sbjct  121  ALAATATASAAPAVAVSTEADSYGQAASNLVAGSNLEGTIQSILEMGGGIWDRDTVLRAL  180

Query  627  RAAYNN  644
            R AYNN
Sbjct  181  RVAYNN  186



>gb|ACH72675.1| RAD23 [Pinus sylvestris var. mongolica]
Length=390

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 118/187 (63%), Gaps = 1/187 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG  FEIE +P DTV  VKK IE +QG + YP  Q +LIHQGKVLKD TT+E
Sbjct  1    MKLSVKTLKGNRFEIEAQPNDTVMAVKKQIEEIQGKDTYPCGQQLLIHQGKVLKDDTTIE  60

Query  267  DNKVAENNF-VVVMMaktksssgegsasstattktiapasstsastapapvpasapapvp  443
            DN + EN F VV++     SS+   S++STA+T      S+  A  +     AS      
Sbjct  61   DNTITENGFLVVMLTKSKTSSAVGASSTSTASTVQPTQTSTPPAPASNPVEVASPVVSQL  120

Query  444  asapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRA  623
             +     +  AP       + D YG+AAS LVAG+NLE  IQQ+LDMGGG+ DR+TVVRA
Sbjct  121  PAVAPAASVSAPETTAVQANADPYGEAASILVAGSNLEQTIQQMLDMGGGSWDRDTVVRA  180

Query  624  LRAAYNN  644
            LRAAYNN
Sbjct  181  LRAAYNN  187



>gb|ABK24371.1| unknown [Picea sitchensis]
Length=390

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 120/187 (64%), Gaps = 1/187 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG  FEI+ +P DTV  VKK IE +QG + YP  Q +LIHQGKVLKD TT+E
Sbjct  1    MKLSVKTLKGNRFEIDAQPNDTVMAVKKQIEEIQGKDTYPCGQQLLIHQGKVLKDDTTIE  60

Query  267  DNKVAENNF-VVVMMaktksssgegsasstattktiapasstsastapapvpasapapvp  443
            DN++ EN F VV++     SS+   S++S+A+T      S+  A  +     AS     P
Sbjct  61   DNQITENGFLVVMLTKTKTSSAAGASSTSSASTIQHTQTSTPLAPASNPVEAASPVVSQP  120

Query  444  asapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRA  623
             +     +  AP       + D YG+AAS LVAG+NLE  IQQ+LDMGGG+ DR+TVVRA
Sbjct  121  PAVAPATSVSAPETTAVQANADPYGEAASILVAGSNLEQTIQQMLDMGGGSWDRDTVVRA  180

Query  624  LRAAYNN  644
            LRAAYNN
Sbjct  181  LRAAYNN  187



>gb|KGN58646.1| hypothetical protein Csa_3G710740 [Cucumis sativus]
Length=391

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 123/194 (63%), Gaps = 8/194 (4%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG++FEI V+  DTV  VKK+IE VQG + YP  Q +LIH GKVLKD +TL 
Sbjct  1    MKLTVKTLKGSHFEIRVQLTDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDESTLA  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKV+E  F+VVM++K+K+S   G +S+             S++ A    P+  PAP   
Sbjct  61   ENKVSEEGFLVVMLSKSKTSVSAGQSSTQPAQNPPVAQPVLSSTPAAQVTPSPTPAPQAP  120

Query  447  sapvpvaapaptpaptagsgDV--------YGQAASNLVAGNNLEGAIQQILDMGGGTXD  602
            +     A  +     T+ S  V        YGQAASNLVAGNNLE  +QQ++DMGGG  D
Sbjct  121  TQAPTQAPSSAPKNTTSTSERVTDNVQTDTYGQAASNLVAGNNLEQTVQQLMDMGGGNWD  180

Query  603  RETVVRALRAAYNN  644
            RETVVRALRAAYNN
Sbjct  181  RETVVRALRAAYNN  194



>gb|KJB67005.1| hypothetical protein B456_010G170000 [Gossypium raimondii]
Length=371

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 117/186 (63%), Gaps = 7/186 (4%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG++F+I V P DTV  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFQITVNPNDTVMAVKKNIEGIQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            DNKV+E++F+VVM+        +  +  +A   +  PASST ++ AP   P   P     
Sbjct  61   DNKVSEDSFLVVML-------SKSKSLGSAGASSAQPASSTPSTIAPVSNPTPTPEAPTQ  113

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
            +        A   A    + + Y QAASNLVAG+NLE  IQQ++DMGGG  D+ETV  AL
Sbjct  114  APASMGTTSASDAATANPNTNTYSQAASNLVAGSNLEQTIQQLMDMGGGNWDKETVTHAL  173

Query  627  RAAYNN  644
            RAAYNN
Sbjct  174  RAAYNN  179



>gb|AAB65841.1| osRAD23 [Oryza sativa Japonica Group]
Length=392

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 114/188 (61%), Gaps = 2/188 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI VKTLKG+ F+IEV     VADVK+ IET QG ++YPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKISVKTLKGSTFQIEVDSAQKVADVKRIIETTQGQHIYPAEQQMLIHQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMMak--tksssgegsasstattktiapasstsastapapvpasapapv  440
            +NKV EN+F+V+M+ +    SSS   ++ + +           + ++     PA+     
Sbjct  61   ENKVLENSFLVIMLRQGKGSSSSAPATSKAPSNQAPPTQTVPAAPASQAPVAPATTVPVT  120

Query  441  pasapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVR  620
             ++      A        +   D YGQA SNLVAG+NLE  IQ IL+MGGG  DR+ V+ 
Sbjct  121  VSAPTPTATASPAPAVAVSSEADNYGQATSNLVAGSNLEATIQSILEMGGGIWDRDIVLH  180

Query  621  ALRAAYNN  644
            AL AA+NN
Sbjct  181  ALSAAFNN  188



>ref|NP_001063134.1| Os09g0407200 [Oryza sativa Japonica Group]
 sp|Q40742.2|RAD23_ORYSJ RecName: Full=Probable ubiquitin receptor RAD23; Short=OsRAD23; 
AltName: Full=Probable DNA repair protein RAD23 [Oryza sativa 
Japonica Group]
 dbj|BAD36240.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAD36295.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAF25048.1| Os09g0407200 [Oryza sativa Japonica Group]
 gb|EAZ09053.1| hypothetical protein OsI_31314 [Oryza sativa Indica Group]
 gb|EAZ44680.1| hypothetical protein OsJ_29306 [Oryza sativa Japonica Group]
Length=392

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 114/188 (61%), Gaps = 2/188 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI VKTLKG+ F+IEV     VADVK+ IET QG ++YPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKISVKTLKGSTFQIEVDSAQKVADVKRIIETTQGQHIYPAEQQMLIHQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMMak--tksssgegsasstattktiapasstsastapapvpasapapv  440
            +NKV EN+F+V+M+ +    SSS   ++ + +           + ++     PA+     
Sbjct  61   ENKVLENSFLVIMLRQGKGSSSSAPATSKAPSNQAPPTQTVPAAPASQAPVAPATTVPVT  120

Query  441  pasapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVR  620
             ++      A        +   D YGQA SNLVAG+NLE  IQ IL+MGGG  DR+ V+ 
Sbjct  121  VSAPTPTATASPAPAVAVSSEADNYGQATSNLVAGSNLEATIQSILEMGGGIWDRDIVLH  180

Query  621  ALRAAYNN  644
            AL AA+NN
Sbjct  181  ALSAAFNN  188



>ref|XP_010532056.1| PREDICTED: ubiquitin receptor RAD23b [Tarenaya hassleriana]
Length=360

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 111/186 (60%), Gaps = 14/186 (8%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG +FEI V+P DT+  VKK+IE  QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGRHFEIRVQPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKV E  F+VVM+              + +    +  +S++     A     A  P   
Sbjct  61   ENKVTEEGFLVVML--------------SKSKTAGSAGTSSAQPAYTASSTKPAAPPASQ  106

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
               VP   P P    TA   D YGQAAS LV+G+NLE  +QQI++MGGG+ D+ETV RAL
Sbjct  107  PTSVPALNPTPAQEQTAAPTDTYGQAASTLVSGSNLEQMVQQIMEMGGGSWDKETVTRAL  166

Query  627  RAAYNN  644
            RAAYNN
Sbjct  167  RAAYNN  172



>ref|XP_002889262.1| hypothetical protein ARALYDRAFT_316857 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65521.1| hypothetical protein ARALYDRAFT_316857 [Arabidopsis lyrata subsp. 
lyrata]
Length=365

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 107/186 (58%), Gaps = 14/186 (8%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG++FEI V P DT+  VKK+IE  QG N YP  Q +LIH GKVLKD T+L 
Sbjct  1    MKLTVKTLKGSHFEIRVLPSDTIMAVKKNIEDSQGKNNYPCGQQLLIHNGKVLKDETSLV  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKV E  F+VVM+              + +    +   S+    +          P   
Sbjct  61   ENKVTEEGFLVVML--------------SKSKTAGSAGQSSVQPASATTSSTKPETPSTT  106

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
             +    A+P       A   D YGQAAS LV+G++LE  +QQI++MGGG+ D+ETV RAL
Sbjct  107  QSIAVPASPITAQEQPAAQTDTYGQAASTLVSGSSLEQMVQQIMEMGGGSWDKETVTRAL  166

Query  627  RAAYNN  644
            RAAYNN
Sbjct  167  RAAYNN  172



>ref|XP_009791274.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Nicotiana 
sylvestris]
Length=395

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG++FEIEVKPEDTVADVKK+IETVQGS+VYPA Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAENNF+V+M+
Sbjct  61   ENKVAENNFIVIML  74


 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAAS+LVAGNNL+GAIQQILDMGGG  DR+TVVRALRAA+NN
Sbjct  148  DVYGQAASSLVAGNNLDGAIQQILDMGGGMWDRDTVVRALRAAFNN  193



>ref|XP_009631150.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
tomentosiformis]
Length=395

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG++FEIEVKPEDTVADVKK+IETVQGS+VYPA Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAENNF+V+M+
Sbjct  61   ENKVAENNFIVIML  74


 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAAS+LVAGNNL+GAIQQILDMGGG  DR+TVVRALRAA+NN
Sbjct  149  DVYGQAASSLVAGNNLDGAIQQILDMGGGMWDRDTVVRALRAAFNN  194



>ref|XP_009791275.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
sylvestris]
Length=377

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG++FEIEVKPEDTVADVKK+IETVQGS+VYPA Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAENNF+V+M+
Sbjct  61   ENKVAENNFIVIML  74


 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAAS+LVAGNNL+GAIQQILDMGGG  DR+TVVRALRAA+NN
Sbjct  130  DVYGQAASSLVAGNNLDGAIQQILDMGGGMWDRDTVVRALRAAFNN  175



>ref|XP_009631151.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
tomentosiformis]
Length=377

 Score =   138 bits (347),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG++FEIEVKPEDTVADVKK+IETVQGS+VYPA Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAENNF+V+M+
Sbjct  61   ENKVAENNFIVIML  74


 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAAS+LVAGNNL+GAIQQILDMGGG  DR+TVVRALRAA+NN
Sbjct  131  DVYGQAASSLVAGNNLDGAIQQILDMGGGMWDRDTVVRALRAAFNN  176



>gb|KHN38092.1| Putative DNA repair protein RAD23-1 [Glycine soja]
Length=446

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 113/198 (57%), Gaps = 20/198 (10%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDT------------VADVKKSIETVQGSNVYPASQLMLIH  230
            MK+ VKTLKG++FEI V+P DT            V  VKK+IE VQG + YP  Q +LIH
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTLEWEESVTRLYVVMAVKKNIEDVQGKDNYPCGQQLLIH  60

Query  231  QGKVLKDGTTLEDNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapa  410
             GKVLKD TTL +NKV+E+ F+VVM+          S +S +   +    +S   +T   
Sbjct  61   NGKVLKDETTLVENKVSEDGFLVVML--------SKSKTSGSAAASSVQPASNPPTTVST  112

Query  411  pvpasapapvpasapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGG  590
                    P   +     +  +     T  S D YG AASNLVAG+NLE  IQQI+DMGG
Sbjct  113  SNSTPPSDPPVQTQAANNSTSSTDAPTTNVSADTYGLAASNLVAGSNLEQTIQQIMDMGG  172

Query  591  GTXDRETVVRALRAAYNN  644
            G  DR+TV RALRAAYNN
Sbjct  173  GNWDRDTVSRALRAAYNN  190



>ref|NP_974181.1| ubiquitin receptor RAD23b [Arabidopsis thaliana]
 gb|AEE36280.1| putative DNA repair protein RAD23-1 [Arabidopsis thaliana]
Length=351

 Score =   137 bits (345),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 87/186 (47%), Positives = 111/186 (60%), Gaps = 8/186 (4%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG++FEI V P DT+  VKK+IE  QG + YP  Q +LIH GKVLKD T+L 
Sbjct  1    MKLTVKTLKGSHFEIRVLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLV  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKV E  F+VVM+          S S  +  +     SS S   +         AP   
Sbjct  61   ENKVTEEGFLVVML--------SKSKSGGSAGQASVQTSSVSQPVSATTSSTKPAAPSTT  112

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
             +    A+P P     A   D YGQAAS LV+G++LE  +QQI++MGGG+ D+ETV RAL
Sbjct  113  QSSPVPASPIPAQEQPAAQTDTYGQAASTLVSGSSLEQMVQQIMEMGGGSWDKETVTRAL  172

Query  627  RAAYNN  644
            RAAYNN
Sbjct  173  RAAYNN  178



>dbj|BAC76389.1| RAD23-like protein [Arabidopsis thaliana]
Length=371

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 87/186 (47%), Positives = 111/186 (60%), Gaps = 8/186 (4%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG++FEI V P DT+  VKK+IE  QG + YP  Q +LIH GKVLKD T+L 
Sbjct  1    MKLTVKTLKGSHFEIRVLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLV  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKV E  F+VVM+          S S  +  +     SS S   +         AP   
Sbjct  61   ENKVTEEGFLVVML--------SKSKSGGSAGQASVQTSSVSQPVSATTSSTKPAAPSTT  112

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
             +    A+P P     A   D YGQAAS LV+G++LE  +QQI++MGGG+ D+ETV RAL
Sbjct  113  QSSPVPASPIPAQEQPAAQTDTYGQAASTLVSGSSLEQMVQQIMEMGGGSWDKETVTRAL  172

Query  627  RAAYNN  644
            RAAYNN
Sbjct  173  RAAYNN  178



>ref|NP_850982.1| ubiquitin receptor RAD23b [Arabidopsis thaliana]
 sp|Q84L33.3|RD23B_ARATH RecName: Full=Ubiquitin receptor RAD23b; Short=AtRAD23b; AltName: 
Full=Putative DNA repair protein RAD23-1; AltName: Full=RAD23-like 
protein 1; Short=AtRAD23-1 [Arabidopsis thaliana]
 gb|AAM65583.1| DNA repair protein RAD23, putative [Arabidopsis thaliana]
 gb|ABG89118.1| Rad23-3Aii [synthetic construct]
 gb|AEE36281.1| putative DNA repair protein RAD23-1 [Arabidopsis thaliana]
Length=371

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 87/186 (47%), Positives = 111/186 (60%), Gaps = 8/186 (4%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG++FEI V P DT+  VKK+IE  QG + YP  Q +LIH GKVLKD T+L 
Sbjct  1    MKLTVKTLKGSHFEIRVLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLV  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKV E  F+VVM+          S S  +  +     SS S   +         AP   
Sbjct  61   ENKVTEEGFLVVML--------SKSKSGGSAGQASVQTSSVSQPVSATTSSTKPAAPSTT  112

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
             +    A+P P     A   D YGQAAS LV+G++LE  +QQI++MGGG+ D+ETV RAL
Sbjct  113  QSSPVPASPIPAQEQPAAQTDTYGQAASTLVSGSSLEQMVQQIMEMGGGSWDKETVTRAL  172

Query  627  RAAYNN  644
            RAAYNN
Sbjct  173  RAAYNN  178



>ref|XP_009597821.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
tomentosiformis]
Length=148

 Score =   131 bits (330),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG + YPA+Q MLIHQGKVLKD  TLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIESVQGQDFYPAAQQMLIHQGKVLKDTATLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74



>ref|XP_004233495.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Solanum lycopersicum]
Length=383

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKPEDTVADVKKSIETVQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGQDVYPAAQQMLIHQGKVLKDPTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74


 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG+ LE  +QQILDMGGG+ +R+TVVRALRAAYNN
Sbjct  148  DVYGQAASNLVAGSTLETTVQQILDMGGGSWERDTVVRALRAAYNN  193



>ref|XP_010317192.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Solanum lycopersicum]
Length=381

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKPEDTVADVKKSIETVQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGQDVYPAAQQMLIHQGKVLKDPTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74


 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG+ LE  +QQILDMGGG+ +R+TVVRALRAAYNN
Sbjct  146  DVYGQAASNLVAGSTLETTVQQILDMGGGSWERDTVVRALRAAYNN  191



>ref|XP_004236965.1| PREDICTED: ubiquitin receptor RAD23c [Solanum lycopersicum]
Length=409

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG++FEIEVKPEDTVADVKK+IETVQGS+VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAAQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAE+NF+V+M+
Sbjct  61   ENKVAESNFIVIML  74


 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/46 (91%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAAS+LVAGNNL+GAIQQILDMGGGT DRETVVRALRAA+NN
Sbjct  162  DVYGQAASSLVAGNNLDGAIQQILDMGGGTWDRETVVRALRAAFNN  207



>ref|XP_004233496.1| PREDICTED: ubiquitin receptor RAD23c isoform X3 [Solanum lycopersicum]
Length=365

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKPEDTVADVKKSIETVQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGQDVYPAAQQMLIHQGKVLKDPTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74


 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG+ LE  +QQILDMGGG+ +R+TVVRALRAAYNN
Sbjct  130  DVYGQAASNLVAGSTLETTVQQILDMGGGSWERDTVVRALRAAYNN  175



>ref|XP_006367045.1| PREDICTED: ubiquitin receptor RAD23c-like [Solanum tuberosum]
Length=398

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG++FEIEVKPEDTVADVKK+IETVQGS+VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAAQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAE+NF+V+M+
Sbjct  61   ENKVAESNFIVIML  74


 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/46 (91%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAAS+LVAGNNL+GAIQQILDMGGGT DRETVVRALRAA+NN
Sbjct  151  DVYGQAASSLVAGNNLDGAIQQILDMGGGTWDRETVVRALRAAFNN  196



>ref|NP_565216.2| ubiquitin receptor RAD23b [Arabidopsis thaliana]
 gb|AAK59419.1| putative DNA repair protein RAD23 [Arabidopsis thaliana]
 gb|AAL34277.1| putative DNA repair protein RAD23 [Arabidopsis thaliana]
 gb|AEE36279.1| putative DNA repair protein RAD23-1 [Arabidopsis thaliana]
Length=365

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 109/186 (59%), Gaps = 14/186 (8%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG++FEI V P DT+  VKK+IE  QG + YP  Q +LIH GKVLKD T+L 
Sbjct  1    MKLTVKTLKGSHFEIRVLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLV  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKV E  F+VVM+              + +    +   ++    +         AP   
Sbjct  61   ENKVTEEGFLVVML--------------SKSKSGGSAGQASVQPVSATTSSTKPAAPSTT  106

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
             +    A+P P     A   D YGQAAS LV+G++LE  +QQI++MGGG+ D+ETV RAL
Sbjct  107  QSSPVPASPIPAQEQPAAQTDTYGQAASTLVSGSSLEQMVQQIMEMGGGSWDKETVTRAL  166

Query  627  RAAYNN  644
            RAAYNN
Sbjct  167  RAAYNN  172



>gb|AAF18513.1|AC010924_26 Contains similarity to gb|Y12014 RAD23 protein isoform II from 
Daucus carota and is a member of the Ubiquitin PF|00240 family 
containing a UBA PF|00627 domain. EST gb|H37284 comes from 
this gene [Arabidopsis thaliana]
Length=246

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 107/186 (58%), Gaps = 23/186 (12%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG++FEI V P DT+  VKK+IE  Q  + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVLPTDTIMAVKKNIEDSQSKDNYPCGQQLLIHNGKVLKDETTLV  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKV E  F+VVM+                       + S +AS+A       A      
Sbjct  61   ENKVTEEGFLVVML-----------------------SKSKTASSAGPSSTQLAAPSTTQ  97

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
            S  VP +   P         D YGQAAS LV+G+++E  +QQI++MGGG+ D+ETV RAL
Sbjct  98   SIAVPASNSTPVQEQPTAQSDTYGQAASTLVSGSSIEQMVQQIMEMGGGSWDKETVTRAL  157

Query  627  RAAYNN  644
            RAAYNN
Sbjct  158  RAAYNN  163



>dbj|BAC76390.1| RAD23-like protein [Arabidopsis thaliana]
Length=365

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 109/186 (59%), Gaps = 14/186 (8%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG++FEI V P DT+  VKK+IE  QG + YP  Q +LIH GKVLKD T+L 
Sbjct  1    MKLTVKTLKGSHFEIRVLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLV  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKV E  F+VVM+              + +    +   ++    +         AP   
Sbjct  61   ENKVTEEGFLVVML--------------SKSKSGGSAGQASVQPVSATTSSTKPAAPSTT  106

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
             +    A+P P     A   D YGQAAS LV+G++LE  +QQI++MGGG+ D+ETV RAL
Sbjct  107  QSSPVPASPIPAQEQPAAQTDTYGQAASTLVSGSSLEQMVQQIMEMGGGSWDKETVTRAL  166

Query  627  RAAYNN  644
            RAAYNN
Sbjct  167  RAAYNN  172



>gb|ABG89119.1| Rad23-3Ai [synthetic construct]
Length=365

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 110/186 (59%), Gaps = 14/186 (8%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG++FEI V P DT+  VKK+IE  QG + YP  Q +LIH GKVLKD T+L 
Sbjct  1    MKLTVKTLKGSHFEIRVLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLV  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKV E  F+VVM+              + +    +   ++    +      +  AP   
Sbjct  61   ENKVTEEGFLVVML--------------SKSKSGGSAGQASVQPVSATTSSTNPAAPSTT  106

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
             +    A+P P     A   D YGQAAS LV+G++LE  +QQI++MGGG+ D+ETV RAL
Sbjct  107  QSSPVPASPIPAQEQPAAQTDTYGQAASTLVSGSSLEQMVQQIMEMGGGSWDKETVTRAL  166

Query  627  RAAYNN  644
            RAAYNN
Sbjct  167  RAAYNN  172



>ref|XP_010429866.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Camelina 
sativa]
Length=370

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 112/186 (60%), Gaps = 9/186 (5%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG +FEI V P DT+  VKK+IE  QG + YP  Q +LIH GKVLKD T+L 
Sbjct  1    MKLTVKTLKGNHFEIRVLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLV  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKV E  F+VVM+           + +  +    +   +++A +  +     A      
Sbjct  61   ENKVTEEGFLVVML---------SKSKTAGSAGQSSAQPASAAMSTTSLAKQPAAPTTSQ  111

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
            S  VP +       P A + D YGQAAS LV+G++LE  +QQI++MGGG+ D+ETV RAL
Sbjct  112  STAVPPSLIPAQEQPGAPTDDTYGQAASTLVSGSSLEQMVQQIMEMGGGSWDKETVTRAL  171

Query  627  RAAYNN  644
            RAAYNN
Sbjct  172  RAAYNN  177



>gb|KDO58999.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=308

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG+NLE  +QQILDMGGG+ DRETV+RALRAAYNN
Sbjct  157  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNN  202



>ref|XP_010429867.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X2 [Camelina 
sativa]
Length=369

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 114/186 (61%), Gaps = 10/186 (5%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG +FEI V P DT+  VKK+IE  QG + YP  Q +LIH GKVLKD T+L 
Sbjct  1    MKLTVKTLKGNHFEIRVLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLV  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKV E  F+VVM+          S S TA +   + A   SA+ +   +   A      
Sbjct  61   ENKVTEEGFLVVML----------SKSKTAGSAGQSSAQPASAAMSTTSLAKPAAPTTSQ  110

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
            S  VP +       P A + D YGQAAS LV+G++LE  +QQI++MGGG+ D+ETV RAL
Sbjct  111  STAVPPSLIPAQEQPGAPTDDTYGQAASTLVSGSSLEQMVQQIMEMGGGSWDKETVTRAL  170

Query  627  RAAYNN  644
            RAAYNN
Sbjct  171  RAAYNN  176



>emb|CDP19777.1| unnamed protein product [Coffea canephora]
Length=390

 Score =   135 bits (340),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEVKPEDTV DVKKSIET QG+ VYPASQ MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDTVTDVKKSIETAQGAEVYPASQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKV EN+F+V+M+
Sbjct  61   ENKVVENSFIVIML  74


 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/46 (93%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAAS LVAGNNLEGAIQQILDMGGGT DR+TVVRALRAAYNN
Sbjct  144  DVYGQAASTLVAGNNLEGAIQQILDMGGGTWDRDTVVRALRAAYNN  189



>ref|XP_010498530.1| PREDICTED: ubiquitin receptor RAD23c-like [Camelina sativa]
Length=420

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKPED+VADVKK+IETVQG++VYPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIHQGKVLKDETTIE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNL AG+NL+  IQQILDMGGGT DR+TVV ALRAA+NN
Sbjct  173  DVYGQAASNLAAGSNLDSTIQQILDMGGGTWDRDTVVHALRAAFNN  218



>ref|XP_010463666.1| PREDICTED: ubiquitin receptor RAD23c [Camelina sativa]
Length=422

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKPED+VADVKK+IETVQG++VYPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIHQGKVLKDETTIE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNL AG+NL+  IQQILDMGGGT DR+TVVRAL AA+NN
Sbjct  176  DVYGQAASNLAAGSNLDSTIQQILDMGGGTWDRDTVVRALHAAFNN  221



>gb|KDO59000.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=364

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG+NLE  +QQILDMGGG+ DRETV+RALRAAYNN
Sbjct  157  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNN  202



>emb|CDX74251.1| BnaA03g27960D [Brassica napus]
Length=401

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKPED+VADVKK+IETVQG++VYPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIHQGKVLKDETTIE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNL AG+NLE  I QILDMGGG  DR+TVVRALRAA+NN
Sbjct  157  DVYGQAASNLAAGSNLESTILQILDMGGGAWDRDTVVRALRAAFNN  202



>ref|XP_010647738.1| PREDICTED: ubiquitin receptor RAD23c isoform X1 [Vitis vinifera]
Length=398

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEI+VKPEDTVADVK +IE VQGS+VYPASQ MLIHQGKVLKDGTTL+
Sbjct  1    MKIFVKTLKGTHFEIQVKPEDTVADVKANIEAVQGSDVYPASQQMLIHQGKVLKDGTTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 41/46 (89%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D YGQAASNLVAGNN E AIQQILDMGGGT DR+TVVRALRAAYNN
Sbjct  155  DAYGQAASNLVAGNNFEEAIQQILDMGGGTWDRDTVVRALRAAYNN  200



>ref|XP_009134681.1| PREDICTED: ubiquitin receptor RAD23c [Brassica rapa]
Length=401

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKPED+VADVKK+IETVQG++VYPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIHQGKVLKDETTIE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNL AG+NLE  I QILDMGGG  DR+TVVRALRAA+NN
Sbjct  157  DVYGQAASNLAAGSNLESTILQILDMGGGAWDRDTVVRALRAAFNN  202



>ref|XP_002282352.1| PREDICTED: ubiquitin receptor RAD23c isoform X2 [Vitis vinifera]
 emb|CBI27030.3| unnamed protein product [Vitis vinifera]
Length=397

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEI+VKPEDTVADVK +IE VQGS+VYPASQ MLIHQGKVLKDGTTL+
Sbjct  1    MKIFVKTLKGTHFEIQVKPEDTVADVKANIEAVQGSDVYPASQQMLIHQGKVLKDGTTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 41/46 (89%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D YGQAASNLVAGNN E AIQQILDMGGGT DR+TVVRALRAAYNN
Sbjct  154  DAYGQAASNLVAGNNFEEAIQQILDMGGGTWDRDTVVRALRAAYNN  199



>ref|XP_008361862.1| PREDICTED: ubiquitin receptor RAD23c-like [Malus domestica]
Length=83

 Score =   125 bits (315),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+F++EVKPEDTVADVKK IE  +GS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFDLEVKPEDTVADVKKHIEACKGSDVYPASQQMLIHQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMM  308
             NKVAEN+FVV+M+
Sbjct  61   GNKVAENSFVVIML  74



>gb|ACJ83348.1| unknown [Medicago truncatula]
Length=159

 Score =   128 bits (321),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEV P+DT++ VKK+IETVQG +VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTISAVKKNIETVQGVDVYPAAQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74



>ref|XP_006482261.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Citrus 
sinensis]
Length=396

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG+NLE  +QQILDMGGG+ DRETV+RALRAAYNN
Sbjct  151  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNN  196



>ref|XP_006482260.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Citrus 
sinensis]
Length=397

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG+NLE  +QQILDMGGG+ DRETV+RALRAAYNN
Sbjct  152  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNN  197



>gb|KFK37713.1| hypothetical protein AALP_AA3G019400 [Arabis alpina]
Length=425

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKPED+VADVKK+IETVQG+++YPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADLYPATKLMLIHQGKVLKDETTIE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNL AG+NLE  IQQILDMGGG  DR+TVVRALRAA+NN
Sbjct  178  DVYGQAASNLAAGSNLESTIQQILDMGGGNWDRDTVVRALRAAFNN  223



>gb|KDO58994.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=402

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG+NLE  +QQILDMGGG+ DRETV+RALRAAYNN
Sbjct  157  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNN  202



>gb|KDO58997.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=403

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG+NLE  +QQILDMGGG+ DRETV+RALRAAYNN
Sbjct  158  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNN  203



>gb|KDO58996.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=403

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG+NLE  +QQILDMGGG+ DRETV+RALRAAYNN
Sbjct  157  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNN  202



>gb|KFK37714.1| hypothetical protein AALP_AA3G019400 [Arabis alpina]
Length=435

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKPED+VADVKK+IETVQG+++YPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADLYPATKLMLIHQGKVLKDETTIE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNL AG+NLE  IQQILDMGGG  DR+TVVRALRAA+NN
Sbjct  188  DVYGQAASNLAAGSNLESTIQQILDMGGGNWDRDTVVRALRAAFNN  233



>emb|CDX91998.1| BnaC03g33000D [Brassica napus]
Length=403

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKPED+VADVKK+IETVQG++VYPA++LMLIHQG+VLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIHQGRVLKDETTIE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNL AG+NLE  I QILDMGGG  DR+TVVRALRAA+NN
Sbjct  159  DVYGQAASNLAAGSNLESTILQILDMGGGAWDRDTVVRALRAAFNN  204



>ref|XP_011070815.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=433

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKPEDTVADVKK+IE+ QG+++YPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKTIESTQGADIYPATQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAE++FVVVM+
Sbjct  61   ENKVAESSFVVVML  74


 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/46 (93%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAGNNLEGA+QQILDMGGGT DR+TVVRALRAAYNN
Sbjct  187  DVYGQAASNLVAGNNLEGAVQQILDMGGGTWDRDTVVRALRAAYNN  232



>gb|KDO58993.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=398

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG+NLE  +QQILDMGGG+ DRETV+RALRAAYNN
Sbjct  157  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNN  202



>gb|EYU44643.1| hypothetical protein MIMGU_mgv1a006427mg [Erythranthe guttata]
Length=444

 Score =   133 bits (335),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +3

Query  84   NMKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTL  263
            +MKIFVKTLKGT+FEIEVKPEDTVADVKK++ETVQGS+VYPA+Q MLIHQGKVLKD TTL
Sbjct  65   SMKIFVKTLKGTHFEIEVKPEDTVADVKKNVETVQGSDVYPAAQQMLIHQGKVLKDETTL  124

Query  264  EDNKVAENNFVVVMM  308
            E+NKVAE +FVVVM+
Sbjct  125  EENKVAEKSFVVVML  139


 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVY +AASNLVAG NLEG IQQI+DMGGG+ DR+TVVRALRAA+NN
Sbjct  203  DVYSEAASNLVAGTNLEGTIQQIIDMGGGSWDRDTVVRALRAAFNN  248



>ref|XP_006430789.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44029.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=401

 Score =   132 bits (333),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG+NLE  +QQILDMGGG+ DRETV+RALRAAYNN
Sbjct  156  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNN  201



>ref|XP_006430787.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44027.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=401

 Score =   132 bits (333),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG+NLE  +QQILDMGGG+ DRETV+RALRAAYNN
Sbjct  155  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNN  200



>ref|XP_006430788.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44028.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=400

 Score =   132 bits (333),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG+NLE  +QQILDMGGG+ DRETV+RALRAAYNN
Sbjct  155  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNN  200



>ref|XP_010485565.1| PREDICTED: ubiquitin receptor RAD23c-like [Camelina sativa]
Length=419

 Score =   132 bits (333),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKPED+VADVKK+IETVQG++VYPA++LMLIHQGKVLKD  T+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIHQGKVLKDEKTIE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D+YGQAASNL AG+NL+  IQQILDMGGGT DR+TVVRALRAA+NN
Sbjct  172  DIYGQAASNLAAGSNLDSTIQQILDMGGGTWDRDTVVRALRAAFNN  217



>ref|XP_007033285.1| Rad23 UV excision repair protein family isoform 2 [Theobroma 
cacao]
 gb|EOY04211.1| Rad23 UV excision repair protein family isoform 2 [Theobroma 
cacao]
Length=350

 Score =   132 bits (331),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKPEDTVADVKK+I+T QG ++YPA+Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIDTAQGPDIYPAAQQMLIHQGKVLKDNTTLD  60

Query  267  DNKVAENNFVVVMM  308
            DNKVAEN+F+V+M+
Sbjct  61   DNKVAENSFIVIML  74


 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVY QAASNLVAGNN+E  IQQILDMGGG+ DR+TVVRALRAAYNN
Sbjct  161  DVYSQAASNLVAGNNIEAIIQQILDMGGGSWDRDTVVRALRAAYNN  206



>gb|KDO58995.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=430

 Score =   132 bits (333),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG+NLE  +QQILDMGGG+ DRETV+RALRAAYNN
Sbjct  157  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNN  202



>gb|KDO58998.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=397

 Score =   132 bits (332),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG+NLE  +QQILDMGGG+ DRETV+RALRAAYNN
Sbjct  152  DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNN  197



>ref|XP_009597820.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Nicotiana 
tomentosiformis]
Length=288

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG + YPA+Q MLIHQGKVLKD  TLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIESVQGQDFYPAAQQMLIHQGKVLKDTATLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74


 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVY  AASNLVAG+NLE  +QQILDMGGG+ DR+TVVRALRAAYNN
Sbjct  145  DVYDLAASNLVAGSNLEATVQQILDMGGGSWDRDTVVRALRAAYNN  190



>ref|NP_974211.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
 gb|AEE73825.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
Length=299

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKPED+V DVKK+IE+VQG++VYPA++ MLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVVDVKKNIESVQGADVYPAAKQMLIHQGKVLKDETTIE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNL AG+NLE  IQQILDMGGGT DRETVV ALRAA+NN
Sbjct  172  DVYGQAASNLAAGSNLESTIQQILDMGGGTWDRETVVLALRAAFNN  217



>gb|ABB02636.1| RAD23-like [Solanum tuberosum]
Length=384

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKPEDTVADVKKSIETVQG +VYPA+Q MLIHQ KVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGQDVYPAAQQMLIHQVKVLKDPTTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74


 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG+ LE  +QQILDMGGG+ +R+TVVRALRAAYNN
Sbjct  146  DVYGQAASNLVAGSTLETTVQQILDMGGGSWERDTVVRALRAAYNN  191



>ref|NP_001274760.1| uncharacterized protein LOC102577665 [Solanum tuberosum]
 gb|ABB16981.1| unknown [Solanum tuberosum]
Length=382

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKPEDTVADVKKSIETVQG +VYPA+Q MLI  GKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGQDVYPAAQQMLIPPGKVLKDPTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74


 Score = 81.6 bits (200),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG+ LE  +QQILDMGGG+ +R+TVVRALRAAYNN
Sbjct  144  DVYGQAASNLVAGSTLETTVQQILDMGGGSWERDTVVRALRAAYNN  189



>ref|XP_006408409.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
 gb|ESQ49862.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
Length=416

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG +FEIEVKP+D+VADVKK+IETVQG++VYPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGIHFEIEVKPDDSVADVKKNIETVQGADVYPAAKLMLIHQGKVLKDETTIE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNL AG+NLE  IQQILDMGGGT DR TVVRALRAA+NN
Sbjct  169  DVYGQAASNLAAGSNLESTIQQILDMGGGTWDRNTVVRALRAAFNN  214



>ref|XP_010525156.1| PREDICTED: ubiquitin receptor RAD23c-like [Tarenaya hassleriana]
Length=407

 Score =   130 bits (327),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKPEDTVADVKK+IETVQ  +VYPA+Q MLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETVQSPDVYPAAQQMLIHQGKVLKDETTME  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74


 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG+NLE  IQQILDMGGG+ DR+TVVRALRAAYNN
Sbjct  162  DVYGQAASNLVAGSNLEAIIQQILDMGGGSWDRDTVVRALRAAYNN  207



>ref|XP_008781229.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Phoenix 
dactylifera]
Length=452

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +3

Query  78   RENMKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGT  257
            R  MKIFVKTLKGT+FEIEVKPED VADVKK+IE VQG  VYPA Q MLIHQGK+LKD T
Sbjct  36   RGEMKIFVKTLKGTHFEIEVKPEDAVADVKKNIEAVQGQGVYPAEQQMLIHQGKILKDDT  95

Query  258  TLEDNKVAENNFVVVMM  308
            TL+DNKVAEN+F+V+M+
Sbjct  96   TLQDNKVAENSFIVIML  112


 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D YGQAASNLVAG+ LE  +Q ILDMGGGT DR+TV+RALRAAYNN
Sbjct  207  DAYGQAASNLVAGSALEQTVQHILDMGGGTWDRDTVIRALRAAYNN  252



>ref|XP_008781245.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X3 [Phoenix 
dactylifera]
Length=451

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +3

Query  78   RENMKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGT  257
            R  MKIFVKTLKGT+FEIEVKPED VADVKK+IE VQG  VYPA Q MLIHQGK+LKD T
Sbjct  36   RGEMKIFVKTLKGTHFEIEVKPEDAVADVKKNIEAVQGQGVYPAEQQMLIHQGKILKDDT  95

Query  258  TLEDNKVAENNFVVVMM  308
            TL+DNKVAEN+F+V+M+
Sbjct  96   TLQDNKVAENSFIVIML  112


 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D YGQAASNLVAG+ LE  +Q ILDMGGGT DR+TV+RALRAAYNN
Sbjct  206  DAYGQAASNLVAGSALEQTVQHILDMGGGTWDRDTVIRALRAAYNN  251



>ref|XP_008781237.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Phoenix 
dactylifera]
Length=451

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +3

Query  78   RENMKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGT  257
            R  MKIFVKTLKGT+FEIEVKPED VADVKK+IE VQG  VYPA Q MLIHQGK+LKD T
Sbjct  36   RGEMKIFVKTLKGTHFEIEVKPEDAVADVKKNIEAVQGQGVYPAEQQMLIHQGKILKDDT  95

Query  258  TLEDNKVAENNFVVVMM  308
            TL+DNKVAEN+F+V+M+
Sbjct  96   TLQDNKVAENSFIVIML  112


 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D YGQAASNLVAG+ LE  +Q ILDMGGGT DR+TV+RALRAAYNN
Sbjct  207  DAYGQAASNLVAGSALEQTVQHILDMGGGTWDRDTVIRALRAAYNN  252



>gb|ACU18469.1| unknown [Glycine max]
Length=160

 Score =   125 bits (313),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEV P+DTV++VKK+IETVQG++VYPA+Q MLIHQGKVL+D +TLE
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTVSEVKKNIETVQGADVYPAAQQMLIHQGKVLRDASTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKV EN F+V+M+
Sbjct  61   ENKVVENTFIVIML  74



>ref|XP_008781252.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X4 [Phoenix 
dactylifera]
Length=450

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +3

Query  78   RENMKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGT  257
            R  MKIFVKTLKGT+FEIEVKPED VADVKK+IE VQG  VYPA Q MLIHQGK+LKD T
Sbjct  36   RGEMKIFVKTLKGTHFEIEVKPEDAVADVKKNIEAVQGQGVYPAEQQMLIHQGKILKDDT  95

Query  258  TLEDNKVAENNFVVVMM  308
            TL+DNKVAEN+F+V+M+
Sbjct  96   TLQDNKVAENSFIVIML  112


 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D YGQAASNLVAG+ LE  +Q ILDMGGGT DR+TV+RALRAAYNN
Sbjct  206  DAYGQAASNLVAGSALEQTVQHILDMGGGTWDRDTVIRALRAAYNN  251



>gb|ABD96960.1| hypothetical protein [Cleome spinosa]
Length=435

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKPEDTVADVKK+IETVQ  +VYPA+Q MLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETVQSPDVYPAAQQMLIHQGKVLKDETTME  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74


 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG+NLE  IQQILDMGGG+ DR+TVVRALRAAYNN
Sbjct  190  DVYGQAASNLVAGSNLEAIIQQILDMGGGSWDRDTVVRALRAAYNN  235



>gb|EYU34397.1| hypothetical protein MIMGU_mgv1a008220mg [Erythranthe guttata]
Length=381

 Score =   130 bits (326),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG++FEIEVKPEDTVADVKK+IETVQGSN+YPA Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSNIYPAGQQMLIHQGKVLKDDTTLE  60

Query  267  DNKVAENNFVVVMM  308
             N VAE +FVV+M+
Sbjct  61   ANNVAEKSFVVIML  74


 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  510  VYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            VY QAASNLVAG+ LE  +QQILDMGGG+ DR+TVVRALRAA+NN
Sbjct  139  VYDQAASNLVAGSTLETTVQQILDMGGGSWDRDTVVRALRAAFNN  183



>ref|XP_006299986.1| hypothetical protein CARUB_v10016200mg [Capsella rubella]
 gb|EOA32884.1| hypothetical protein CARUB_v10016200mg [Capsella rubella]
Length=427

 Score =   130 bits (327),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI+VKTLKGT+FEIEVKPED+++DVKK+IET QG++VYPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIYVKTLKGTHFEIEVKPEDSISDVKKNIETAQGADVYPAAKLMLIHQGKVLKDETTIE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNL AG+NLE  IQQILDMGGGT DR+TVVRALRAA+NN
Sbjct  180  DVYGQAASNLAAGSNLESTIQQILDMGGGTWDRDTVVRALRAAFNN  225



>ref|XP_007033284.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
 gb|EOY04210.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
Length=487

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKPEDTVADVKK+I+T QG ++YPA+Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIDTAQGPDIYPAAQQMLIHQGKVLKDNTTLD  60

Query  267  DNKVAENNFVVVMM  308
            DNKVAEN+F+V+M+
Sbjct  61   DNKVAENSFIVIML  74


 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVY QAASNLVAGNN+E  IQQILDMGGG+ DR+TVVRALRAAYNN
Sbjct  247  DVYSQAASNLVAGNNIEAIIQQILDMGGGSWDRDTVVRALRAAYNN  292



>ref|XP_004172134.1| PREDICTED: putative DNA repair protein RAD23-3-like [Cucumis 
sativus]
Length=407

 Score =   129 bits (325),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG++FEIEV+P DTVADVKK+IETVQG++VYPA+Q MLIHQGKVLKD +TLE
Sbjct  1    MKIFVKTLKGSHFEIEVQPADTVADVKKNIETVQGADVYPAAQQMLIHQGKVLKDSSTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74


 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVY QAASNLVAG+NLE  +QQILDMG G  DR+TVVRALRAAYNN
Sbjct  172  DVYSQAASNLVAGSNLEETVQQILDMGEGVWDRDTVVRALRAAYNN  217



>ref|XP_004135098.1| PREDICTED: putative DNA repair protein RAD23-3-like [Cucumis 
sativus]
Length=407

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG++FEIEV+P DTVADVKK+IETVQG++VYPA+Q MLIHQGKVLKD +TLE
Sbjct  1    MKIFVKTLKGSHFEIEVQPADTVADVKKNIETVQGADVYPAAQQMLIHQGKVLKDSSTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74


 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVY QAASNLVAG+NLE  +QQILDMG G  DR+TVVRALRAAYNN
Sbjct  172  DVYSQAASNLVAGSNLEETVQQILDMGEGVWDRDTVVRALRAAYNN  217



>ref|XP_010549930.1| PREDICTED: ubiquitin receptor RAD23c-like [Tarenaya hassleriana]
 gb|ABD96879.1| hypothetical protein [Cleome spinosa]
Length=383

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKPEDTVADVKK+IETVQG++VYP++Q MLIHQGKVL+D TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETVQGADVYPSAQQMLIHQGKVLRDETTME  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAE +F+V+M+
Sbjct  61   ENKVAEKSFIVIML  74


 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D+YGQAASNLVAG+NLE  IQQILDMGGG+ DR+TVVRALRAAYNN
Sbjct  138  DIYGQAASNLVAGSNLEATIQQILDMGGGSWDRDTVVRALRAAYNN  183



>ref|NP_186903.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
 sp|Q84L31.2|RD23C_ARATH RecName: Full=Ubiquitin receptor RAD23c; Short=AtRAD23c; AltName: 
Full=Putative DNA repair protein RAD23-3; AltName: Full=RAD23-like 
protein 3; Short=AtRAD23-3 [Arabidopsis thaliana]
 gb|AAF32461.1| putative RAD23 [Arabidopsis thaliana]
 gb|AAK62617.1| AT3g02540/F16B3_17 [Arabidopsis thaliana]
 gb|AAM47342.1| AT3g02540/F16B3_17 [Arabidopsis thaliana]
 dbj|BAC76392.1| RAD23-like protein [Arabidopsis thaliana]
 gb|ABG89116.1| Rad23-1 [synthetic construct]
 gb|AEE73824.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
Length=419

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKPED+V DVKK+IE+VQG++VYPA++ MLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVVDVKKNIESVQGADVYPAAKQMLIHQGKVLKDETTIE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNL AG+NLE  IQQILDMGGGT DRETVV ALRAA+NN
Sbjct  172  DVYGQAASNLAAGSNLESTIQQILDMGGGTWDRETVVLALRAAFNN  217



>ref|XP_008446578.1| PREDICTED: ubiquitin receptor RAD23c-like [Cucumis melo]
Length=422

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG++FEIEV+P DTVADVKK+IETVQG++VYPA+Q MLIHQGKVLKD +TLE
Sbjct  1    MKIFVKTLKGSHFEIEVQPADTVADVKKNIETVQGADVYPAAQQMLIHQGKVLKDSSTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74


 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVY QAASNLVAG+NLE  IQQILDMG G  DR+TVVRALRAAYNN
Sbjct  174  DVYSQAASNLVAGSNLEETIQQILDMGEGVWDRDTVVRALRAAYNN  219



>ref|NP_001189793.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
 gb|AEE73826.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
Length=418

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKPED+V DVKK+IE+VQG++VYPA++ MLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVVDVKKNIESVQGADVYPAAKQMLIHQGKVLKDETTIE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74


 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNL AG+NLE  IQQILDMGGGT DRETVV ALRAA+NN
Sbjct  171  DVYGQAASNLAAGSNLESTIQQILDMGGGTWDRETVVLALRAAFNN  216



>gb|KGN52072.1| hypothetical protein Csa_5G608600 [Cucumis sativus]
Length=420

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG++FEIEV+P DTVADVKK+IETVQG++VYPA+Q MLIHQGKVLKD +TLE
Sbjct  1    MKIFVKTLKGSHFEIEVQPADTVADVKKNIETVQGADVYPAAQQMLIHQGKVLKDSSTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74


 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVY QAASNLVAG+NLE  +QQILDMG G  DR+TVVRALRAAYNN
Sbjct  172  DVYSQAASNLVAGSNLEETVQQILDMGEGVWDRDTVVRALRAAYNN  217



>ref|NP_001240201.1| uncharacterized protein LOC100809066 [Glycine max]
 gb|ACU22776.1| unknown [Glycine max]
 gb|KHN47572.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=392

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74


 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D+YGQAASNLVAG+NLEG IQQILDMGGG+ DR+TVVRALRAAYNN
Sbjct  146  DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRALRAAYNN  191



>gb|EYU29968.1| hypothetical protein MIMGU_mgv1a008352mg [Erythranthe guttata]
Length=375

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKP+DT+ADVKK++E  QG++VYPA+Q +LIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPDDTIADVKKTVENTQGADVYPATQQLLIHQGKVLKDATTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/46 (89%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAGN LEG IQQILDMGGG  DR+TVVRALRAAYNN
Sbjct  138  DVYGQAASNLVAGNILEGTIQQILDMGGGIWDRDTVVRALRAAYNN  183



>gb|EYU29967.1| hypothetical protein MIMGU_mgv1a008352mg [Erythranthe guttata]
Length=376

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKP+DT+ADVKK++E  QG++VYPA+Q +LIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPDDTIADVKKTVENTQGADVYPATQQLLIHQGKVLKDATTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74


 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/46 (89%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAGN LEG IQQILDMGGG  DR+TVVRALRAAYNN
Sbjct  139  DVYGQAASNLVAGNILEGTIQQILDMGGGIWDRDTVVRALRAAYNN  184



>ref|XP_010103792.1| Putative DNA repair protein RAD23-3 [Morus notabilis]
 gb|EXB97154.1| Putative DNA repair protein RAD23-3 [Morus notabilis]
Length=421

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKGT+FEIEVKPEDTVADVKK+IE VQG++VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVCVKTLKGTHFEIEVKPEDTVADVKKNIEAVQGADVYPASQQMLIHQGKVLKDTTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKV EN+F+V+M+
Sbjct  61   ENKVVENSFIVIMI  74


 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG+NLE  +QQI+DMGGG+ DR+TVVRALRAA+NN
Sbjct  173  DVYGQAASNLVAGSNLEATVQQIIDMGGGSWDRDTVVRALRAAFNN  218



>ref|XP_008775144.1| PREDICTED: ubiquitin receptor RAD23d-like [Phoenix dactylifera]
Length=384

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIF+KTLKGT+FEIEVKPEDTV DVK++IE  QG +VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFIKTLKGTHFEIEVKPEDTVTDVKRNIEATQGQSVYPAEQQMLIHQGKILKDETTLQ  60

Query  267  DNKVAENNFVVVMM  308
            DNKVAEN+F+V+M+
Sbjct  61   DNKVAENSFIVIML  74


 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG NLE  IQ ILDMGGGT DR+ VVRALRAAYNN
Sbjct  145  DVYGQAASNLVAGTNLEQTIQHILDMGGGTWDRDIVVRALRAAYNN  190



>ref|XP_010263550.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Nelumbo 
nucifera]
Length=387

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEI+V PEDTVADVKK+IETVQG +VYPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIQVNPEDTVADVKKNIETVQGPDVYPAGQQMLIHQGKVLKDATTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NKV+EN+F+V+M+
Sbjct  61   ENKVSENSFLVIML  74


 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D YGQAASNLVAGNN E AI+QILDMGGG+ DR+TVVRALRAAYNN
Sbjct  145  DAYGQAASNLVAGNNFEEAIKQILDMGGGSWDRDTVVRALRAAYNN  190



>ref|XP_010263555.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nelumbo 
nucifera]
Length=386

 Score =   127 bits (319),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEI+V PEDTVADVKK+IETVQG +VYPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIQVNPEDTVADVKKNIETVQGPDVYPAGQQMLIHQGKVLKDATTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NKV+EN+F+V+M+
Sbjct  61   ENKVSENSFLVIML  74


 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D YGQAASNLVAGNN E AI+QILDMGGG+ DR+TVVRALRAAYNN
Sbjct  144  DAYGQAASNLVAGNNFEEAIKQILDMGGGSWDRDTVVRALRAAYNN  189



>ref|XP_010926135.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Elaeis 
guineensis]
Length=395

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG++FEIEVKPEDTV DVKK+IE +QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVTDVKKNIEAIQGKGVYPAEQQMLIHQGKILKDDTTLQ  60

Query  267  DNKVAENNFVVVMM  308
            DNKVAEN+F+V+M+
Sbjct  61   DNKVAENSFIVIML  74


 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D YGQAASNLVAGN LE  IQ ILDMGGGT DR+TVVRALRAAYNN
Sbjct  145  DAYGQAASNLVAGNALEQTIQHILDMGGGTWDRDTVVRALRAAYNN  190



>ref|XP_010926134.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Elaeis 
guineensis]
Length=396

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG++FEIEVKPEDTV DVKK+IE +QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVTDVKKNIEAIQGKGVYPAEQQMLIHQGKILKDDTTLQ  60

Query  267  DNKVAENNFVVVMM  308
            DNKVAEN+F+V+M+
Sbjct  61   DNKVAENSFIVIML  74


 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D YGQAASNLVAGN LE  IQ ILDMGGGT DR+TVVRALRAAYNN
Sbjct  145  DAYGQAASNLVAGNALEQTIQHILDMGGGTWDRDTVVRALRAAYNN  190



>ref|XP_006584605.1| PREDICTED: uncharacterized protein LOC100813881 isoform X2 [Glycine 
max]
Length=468

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74


 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D+YGQAASNLVAG+NLEG IQQILDMGGG+ DR+TVVR LRAAYNN
Sbjct  222  DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRTLRAAYNN  267



>ref|XP_006584604.1| PREDICTED: uncharacterized protein LOC100813881 isoform X1 [Glycine 
max]
Length=469

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74


 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D+YGQAASNLVAG+NLEG IQQILDMGGG+ DR+TVVR LRAAYNN
Sbjct  223  DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRTLRAAYNN  268



>ref|XP_004497101.1| PREDICTED: putative DNA repair protein RAD23-3-like [Cicer arietinum]
Length=400

 Score =   127 bits (319),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEVKP+DT+++VKK+IE VQG +VYPA+Q MLIHQGKVLKDGT+LE
Sbjct  1    MKVFVKTLKGTHFEIEVKPQDTISEVKKNIENVQGVDVYPAAQQMLIHQGKVLKDGTSLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74


 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG+NLE  +QQILDMGGG+ DR+TVVRALRAA+NN
Sbjct  153  DVYGQAASNLVAGSNLEETVQQILDMGGGSWDRDTVVRALRAAFNN  198



>ref|XP_003555895.1| PREDICTED: ubiquitin receptor RAD23c-like isoform 1 [Glycine 
max]
 gb|KHN11428.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=402

 Score =   127 bits (319),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEV P+DTV++VKK+IETVQG++VYPA+Q MLIHQGKVL+D TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTVSEVKKNIETVQGADVYPAAQQMLIHQGKVLRDATTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN F+V+M+
Sbjct  61   ENKVAENTFIVIML  74


 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D+YGQAASNLVAG+NLEG IQQILDMGGG+ DR+TVVRALRAAYNN
Sbjct  155  DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRALRAAYNN  200



>ref|XP_006584608.1| PREDICTED: uncharacterized protein LOC100813881 isoform X5 [Glycine 
max]
Length=382

 Score =   127 bits (319),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74


 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D+YGQAASNLVAG+NLEG IQQILDMGGG+ DR+TVVR LRAAYNN
Sbjct  136  DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRTLRAAYNN  181



>ref|XP_006584607.1| PREDICTED: uncharacterized protein LOC100813881 isoform X4 [Glycine 
max]
Length=383

 Score =   127 bits (318),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74


 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D+YGQAASNLVAG+NLEG IQQILDMGGG+ DR+TVVR LRAAYNN
Sbjct  137  DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRTLRAAYNN  182



>gb|ACU18529.1| unknown [Glycine max]
Length=382

 Score =   127 bits (318),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74


 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D+YGQAASNLVAG+NLEG IQQILDMGGG+ DR+TVVR LRAAYNN
Sbjct  136  DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRTLRAAYNN  181



>ref|XP_010926132.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Elaeis 
guineensis]
Length=422

 Score =   127 bits (319),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG++FEIEVKPEDTV DVKK+IE +QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVTDVKKNIEAIQGKGVYPAEQQMLIHQGKILKDDTTLQ  60

Query  267  DNKVAENNFVVVMM  308
            DNKVAEN+F+V+M+
Sbjct  61   DNKVAENSFIVIML  74


 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D YGQAASNLVAGN LE  IQ ILDMGGGT DR+TVVRALRAAYNN
Sbjct  145  DAYGQAASNLVAGNALEQTIQHILDMGGGTWDRDTVVRALRAAYNN  190



>ref|XP_006584606.1| PREDICTED: uncharacterized protein LOC100813881 isoform X3 [Glycine 
max]
Length=401

 Score =   127 bits (319),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74


 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D+YGQAASNLVAG+NLEG IQQILDMGGG+ DR+TVVR LRAAYNN
Sbjct  155  DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRTLRAAYNN  200



>gb|KEH44233.1| RAD23 UV excision repair family protein [Medicago truncatula]
Length=397

 Score =   127 bits (319),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEV P+DT++ VKK+IETVQG +VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTISAVKKNIETVQGVDVYPAAQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74


 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG+NLEG +QQILDMGGG+ DR+TV+RALRAA+NN
Sbjct  147  DVYGQAASNLVAGSNLEGTVQQILDMGGGSWDRDTVIRALRAAFNN  192



>ref|XP_010926133.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Elaeis 
guineensis]
Length=421

 Score =   127 bits (319),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG++FEIEVKPEDTV DVKK+IE +QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVTDVKKNIEAIQGKGVYPAEQQMLIHQGKILKDDTTLQ  60

Query  267  DNKVAENNFVVVMM  308
            DNKVAEN+F+V+M+
Sbjct  61   DNKVAENSFIVIML  74


 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D YGQAASNLVAGN LE  IQ ILDMGGGT DR+TVVRALRAAYNN
Sbjct  145  DAYGQAASNLVAGNALEQTIQHILDMGGGTWDRDTVVRALRAAYNN  190



>ref|NP_001242098.1| uncharacterized protein LOC100813881 [Glycine max]
 gb|ACU21107.1| unknown [Glycine max]
Length=400

 Score =   127 bits (318),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74


 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D+YGQAASNLVAG+NLEG IQQILDMGGG+ DR+TVVR LRAAYNN
Sbjct  154  DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRTLRAAYNN  199



>ref|XP_006437672.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
 gb|ESR50912.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
Length=212

 Score =   123 bits (309),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT F++EVKPEDTV DVK  IETVQGS+VYPA+Q MLI+QGKVLKD TTLE
Sbjct  2    MKIFVKTLKGTSFDVEVKPEDTVFDVKMKIETVQGSDVYPAAQQMLIYQGKVLKDDTTLE  61

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVV+M+
Sbjct  62   ENKVAENSFVVIML  75


 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/45 (93%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +3

Query  510  VYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            VYG AASNLVAGNNLEGAIQQILDMGGGT DR+TVVRALRAAYNN
Sbjct  145  VYGHAASNLVAGNNLEGAIQQILDMGGGTWDRDTVVRALRAAYNN  189



>ref|XP_009117771.1| PREDICTED: probable ubiquitin receptor RAD23a [Brassica rapa]
 emb|CDY52848.1| BnaA09g56400D [Brassica napus]
Length=359

 Score =   126 bits (317),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 107/186 (58%), Gaps = 13/186 (7%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG++FEI V P DT+  VKK+IE  Q  + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVLPTDTIMAVKKNIEDSQSKDNYPCGQQLLIHNGKVLKDETTLV  60

Query  267  DNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  446
            +NKV E  F+VVM+             S + T + A  SS   ++        A A    
Sbjct  61   ENKVTEEGFLVVML-------------SKSKTASSAGPSSAQPTSTTTSSAMPAAASTTH  107

Query  447  sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRAL  626
            S PVP +         A   D   QAAS L +G++ E  +QQI++MGGG+ D+ETV RAL
Sbjct  108  SIPVPASVSTLAQEQPAAPSDTNAQAASTLASGSSTEQMVQQIMEMGGGSWDKETVARAL  167

Query  627  RAAYNN  644
            RAAYNN
Sbjct  168  RAAYNN  173



>gb|KHN15504.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=416

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74


 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D+YGQAASNLVAG+NLEG IQQILDMGGG+ DR+TVVR LRAAYNN
Sbjct  170  DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRTLRAAYNN  215



>ref|XP_002884326.1| hypothetical protein ARALYDRAFT_477488 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60585.1| hypothetical protein ARALYDRAFT_477488 [Arabidopsis lyrata subsp. 
lyrata]
Length=417

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVK ED+VADVKK+IETVQG++VYPA++ MLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKLEDSVADVKKNIETVQGADVYPAAKQMLIHQGKVLKDETTIE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+VVM+
Sbjct  61   ENKVAENSFIVVML  74


 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNL AG+NLE  IQQILDMGGGT DRETVVRALRAA+NN
Sbjct  170  DVYGQAASNLAAGSNLESTIQQILDMGGGTWDRETVVRALRAAFNN  215



>ref|XP_008390012.1| PREDICTED: ubiquitin receptor RAD23c-like [Malus domestica]
Length=359

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG++F++EVKPEDTVADVKK IE  +GS+VYPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGSHFDVEVKPEDTVADVKKHIEACKGSDVYPAPQQMLIHQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74


 Score = 84.0 bits (206),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D YGQAAS+LVAG NLEG IQQILDMGGGT DR+TVVRALRAA+NN
Sbjct  127  DSYGQAASDLVAGTNLEGTIQQILDMGGGTWDRDTVVRALRAAFNN  172



>ref|XP_006437673.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
 gb|ESR50913.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
Length=300

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT F++EVKPEDTV DVK  IETVQGS+VYPA+Q MLI+QGKVLKD TTLE
Sbjct  2    MKIFVKTLKGTSFDVEVKPEDTVFDVKMKIETVQGSDVYPAAQQMLIYQGKVLKDDTTLE  61

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVV+M+
Sbjct  62   ENKVAENSFVVIML  75


 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/45 (93%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +3

Query  510  VYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            VYG AASNLVAGNNLEGAIQQILDMGGGT DR+TVVRALRAAYNN
Sbjct  145  VYGHAASNLVAGNNLEGAIQQILDMGGGTWDRDTVVRALRAAYNN  189



>ref|XP_010916168.1| PREDICTED: ubiquitin receptor RAD23c-like [Elaeis guineensis]
Length=384

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKPEDTVADVK++IE  QG +VYPA Q MLI+QGK+LKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKRNIEATQGQSVYPAEQQMLIYQGKILKDETTLQ  60

Query  267  DNKVAENNFVVVMM  308
            D+KVAEN+FVV+M+
Sbjct  61   DSKVAENSFVVIML  74


 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG+ LE  IQ ILDMGGGT +R+ VVRALRAAYNN
Sbjct  145  DVYGQAASNLVAGSGLEQTIQHILDMGGGTWERDIVVRALRAAYNN  190



>ref|XP_006389863.1| hypothetical protein EUTSA_v10018655mg [Eutrema salsugineum]
 gb|ESQ27149.1| hypothetical protein EUTSA_v10018655mg [Eutrema salsugineum]
Length=403

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 83/193 (43%), Positives = 108/193 (56%), Gaps = 14/193 (7%)
 Frame = +3

Query  66   RKI*RENMKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVL  245
            R+     MK+ VKTL G  FEI V+  DTV  VKK+IE  QG N YP  Q +LIH GKVL
Sbjct  30   RRPLYRTMKLTVKTLMGRQFEIRVQSSDTVMAVKKNIEDSQGKNNYPCGQQLLIHNGKVL  89

Query  246  KDGTTLEDNKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpas  425
            KD TTL +NKV+E  F+VVM+           + S         ++  +++T        
Sbjct  90   KDETTLLENKVSEEGFLVVML-----------SKSRTAASAGQSSAQPASTTTSTTSSTK  138

Query  426  apapvpasapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTXDR  605
              A     +    A+P       A   D YGQAAS LV+GN++E   QQ+++MGGG+ D+
Sbjct  139  PAATSTTQSTAVPASPIHAQEQPAAQTDNYGQAASTLVSGNSVE---QQLMEMGGGSWDK  195

Query  606  ETVVRALRAAYNN  644
            ETV RALRAAYNN
Sbjct  196  ETVARALRAAYNN  208



>emb|CDP02781.1| unnamed protein product [Coffea canephora]
Length=387

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKGT+F+IEVKP+D+VADVK+ IET+QGS+VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKVSVKTLKGTHFQIEVKPDDSVADVKRIIETIQGSDVYPAAQQMLIHQGKVLKDDTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74


 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG  LE  IQQILDMGGG+ DR+TV+RALRAAYNN
Sbjct  147  DVYGQAASNLVAGTTLESTIQQILDMGGGSWDRDTVIRALRAAYNN  192



>ref|XP_006437674.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
 gb|ESR50914.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
Length=331

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT F++EVKPEDTV DVK  IETVQGS+VYPA+Q MLI+QGKVLKD TTLE
Sbjct  2    MKIFVKTLKGTSFDVEVKPEDTVFDVKMKIETVQGSDVYPAAQQMLIYQGKVLKDDTTLE  61

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVV+M+
Sbjct  62   ENKVAENSFVVIML  75


 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/45 (93%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +3

Query  510  VYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            VYG AASNLVAGNNLEGAIQQILDMGGGT DR+TVVRALRAAYNN
Sbjct  145  VYGHAASNLVAGNNLEGAIQQILDMGGGTWDRDTVVRALRAAYNN  189



>ref|XP_010265160.1| PREDICTED: ubiquitin receptor RAD23c-like [Nelumbo nucifera]
Length=383

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKPEDTV DVKK+IE+V G +VYPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVDDVKKNIESVHGPDVYPAGQQMLIHQGKVLKDATTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NKV+EN+F+V+M+
Sbjct  61   ENKVSENSFLVIML  74


 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG+N E AI+QILDMGGG+ DR+TVVRALRAAYNN
Sbjct  143  DVYGQAASNLVAGSNFEEAIKQILDMGGGSWDRDTVVRALRAAYNN  188



>ref|XP_010552232.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Tarenaya 
hassleriana]
Length=384

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT FEIEVKP+D V DVKK+IETVQG+NVYPA+Q MLIHQGKVL D TTLE
Sbjct  1    MKIFVKTLKGTSFEIEVKPDDKVTDVKKTIETVQGANVYPAAQQMLIHQGKVLSDETTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NK++EN F+V+M+
Sbjct  61   ENKISENGFIVIML  74


 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG+NLE  IQQILDMGGG+ DR+TVVRALRAAYNN
Sbjct  137  DVYGQAASNLVAGSNLESTIQQILDMGGGSWDRDTVVRALRAAYNN  182



>ref|XP_004299088.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=400

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEI+V+P+D+V DVKKSIET QG  VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIQVQPQDSVVDVKKSIETSQGLTVYPAAQQMLIHQGKVLKDDTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKV+EN+FVV+M+
Sbjct  61   ENKVSENSFVVIML  74


 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +3

Query  513  YGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            YGQAAS+LVAGNNLEG IQ ILDMGGGT DR+TVVRALRAA+NN
Sbjct  153  YGQAASDLVAGNNLEGTIQHILDMGGGTWDRDTVVRALRAAFNN  196



>ref|XP_011464118.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=401

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEI+V+P+D+V DVKKSIET QG  VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIQVQPQDSVVDVKKSIETSQGLTVYPAAQQMLIHQGKVLKDDTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKV+EN+FVV+M+
Sbjct  61   ENKVSENSFVVIML  74


 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +3

Query  513  YGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            YGQAAS+LVAGNNLEG IQ ILDMGGGT DR+TVVRALRAA+NN
Sbjct  154  YGQAASDLVAGNNLEGTIQHILDMGGGTWDRDTVVRALRAAFNN  197



>ref|XP_003536688.1| PREDICTED: ubiquitin receptor RAD23c [Glycine max]
Length=408

 Score =   124 bits (311),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEV P+DTV++VKK+IETVQG++VYPA+Q MLIHQGKVL+D +TLE
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTVSEVKKNIETVQGADVYPAAQQMLIHQGKVLRDASTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKV EN F+V+M+
Sbjct  61   ENKVVENTFIVIML  74


 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D+YGQAASNLVAG+NLEG IQQILDMGGG+ DR+TVVRALRAAYNN
Sbjct  161  DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRALRAAYNN  206



>gb|KHN05574.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=410

 Score =   124 bits (311),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEV P+DTV++VKK+IETVQG++VYPA+Q MLIHQGKVL+D +TLE
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTVSEVKKNIETVQGADVYPAAQQMLIHQGKVLRDASTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKV EN F+V+M+
Sbjct  61   ENKVVENTFIVIML  74


 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D+YGQAASNLVAG+NLEG IQQILDMGGG+ DR+TVVRALRAAYNN
Sbjct  163  DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRALRAAYNN  208



>ref|XP_007142903.1| hypothetical protein PHAVU_007G026600g [Phaseolus vulgaris]
 gb|ESW14897.1| hypothetical protein PHAVU_007G026600g [Phaseolus vulgaris]
Length=400

 Score =   124 bits (311),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEV+P+DTV++VKKSIETVQG +VYPA+  MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVQPQDTVSEVKKSIETVQGVDVYPAALQMLIHQGKVLKDATTLE  60

Query  267  DNKVAENNFVVVMM  308
            +N VAEN+F+V+M+
Sbjct  61   ENNVAENSFIVIML  74


 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYG AASNLVAG+NLEG IQQI+DMGGG+ DR+TVVRALRAAYNN
Sbjct  152  DVYGLAASNLVAGSNLEGTIQQIIDMGGGSWDRDTVVRALRAAYNN  197



>ref|XP_006484457.1| PREDICTED: ubiquitin receptor RAD23c-like [Citrus sinensis]
Length=390

 Score =   124 bits (310),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT F++EVKPEDTV DVK  IETVQGS+VYPA+Q MLI+QGKVLKD TTLE
Sbjct  2    MKIFVKTLKGTSFDVEVKPEDTVFDVKMKIETVQGSDVYPAAQQMLIYQGKVLKDDTTLE  61

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVV+M+
Sbjct  62   ENKVAENSFVVIML  75


 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/45 (93%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +3

Query  510  VYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            VYG AASNLVAGNNLEGAIQQILDMGGGT DR+TVVRALRAAYNN
Sbjct  145  VYGHAASNLVAGNNLEGAIQQILDMGGGTWDRDTVVRALRAAYNN  189



>ref|XP_002529115.1| uv excision repair protein rad23, putative [Ricinus communis]
 gb|EEF33228.1| uv excision repair protein rad23, putative [Ricinus communis]
Length=409

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT F++EVKPEDT+ADVKKSIET QG++VYPA Q MLI+QGKVLKD TT++
Sbjct  1    MKIFVKTLKGTTFDVEVKPEDTIADVKKSIETTQGADVYPAGQQMLIYQGKVLKDNTTID  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74


 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/46 (96%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAGNNLEGAIQQILDMGGGT DR+TVVRALRAAYNN
Sbjct  159  DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRDTVVRALRAAYNN  204



>ref|XP_006437675.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
 gb|ESR50915.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
Length=390

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT F++EVKPEDTV DVK  IETVQGS+VYPA+Q MLI+QGKVLKD TTLE
Sbjct  2    MKIFVKTLKGTSFDVEVKPEDTVFDVKMKIETVQGSDVYPAAQQMLIYQGKVLKDDTTLE  61

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVV+M+
Sbjct  62   ENKVAENSFVVIML  75


 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/45 (93%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +3

Query  510  VYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            VYG AASNLVAGNNLEGAIQQILDMGGGT DR+TVVRALRAAYNN
Sbjct  145  VYGHAASNLVAGNNLEGAIQQILDMGGGTWDRDTVVRALRAAYNN  189



>ref|XP_008801156.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Phoenix 
dactylifera]
Length=370

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEVKPEDTVA+VK+ IE+ QG +VYPA Q MLIHQGK+LKD +TL 
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDTVAEVKRIIESAQGQSVYPAEQQMLIHQGKILKDDSTLN  60

Query  267  DNKVAENNFVVVMM  308
            DNKV+EN+F+V+M+
Sbjct  61   DNKVSENSFIVIML  74


 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D YGQAASNLVAGNNLE  IQQILDMGGGT +R+TVVRAL AAYNN
Sbjct  129  DAYGQAASNLVAGNNLEKTIQQILDMGGGTWERDTVVRALHAAYNN  174



>ref|XP_008801157.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Phoenix 
dactylifera]
Length=367

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEVKPEDTVA+VK+ IE+ QG +VYPA Q MLIHQGK+LKD +TL 
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDTVAEVKRIIESAQGQSVYPAEQQMLIHQGKILKDDSTLN  60

Query  267  DNKVAENNFVVVMM  308
            DNKV+EN+F+V+M+
Sbjct  61   DNKVSENSFIVIML  74


 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D YGQAASNLVAGNNLE  IQQILDMGGGT +R+TVVRAL AAYNN
Sbjct  126  DAYGQAASNLVAGNNLEKTIQQILDMGGGTWERDTVVRALHAAYNN  171



>ref|XP_008801154.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Phoenix 
dactylifera]
Length=388

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEVKPEDTVA+VK+ IE+ QG +VYPA Q MLIHQGK+LKD +TL 
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDTVAEVKRIIESAQGQSVYPAEQQMLIHQGKILKDDSTLN  60

Query  267  DNKVAENNFVVVMM  308
            DNKV+EN+F+V+M+
Sbjct  61   DNKVSENSFIVIML  74


 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D YGQAASNLVAGNNLE  IQQILDMGGGT +R+TVVRAL AAYNN
Sbjct  147  DAYGQAASNLVAGNNLEKTIQQILDMGGGTWERDTVVRALHAAYNN  192



>ref|XP_008801153.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Phoenix 
dactylifera]
Length=391

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEVKPEDTVA+VK+ IE+ QG +VYPA Q MLIHQGK+LKD +TL 
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDTVAEVKRIIESAQGQSVYPAEQQMLIHQGKILKDDSTLN  60

Query  267  DNKVAENNFVVVMM  308
            DNKV+EN+F+V+M+
Sbjct  61   DNKVSENSFIVIML  74


 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D YGQAASNLVAGNNLE  IQQILDMGGGT +R+TVVRAL AAYNN
Sbjct  150  DAYGQAASNLVAGNNLEKTIQQILDMGGGTWERDTVVRALHAAYNN  195



>ref|XP_010907325.1| PREDICTED: ubiquitin receptor RAD23d-like [Elaeis guineensis]
Length=391

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT FEIEVKPEDTVADVK+ IE+ QG +VYP+ Q MLIHQGK+LKD TT+ 
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKRIIESTQGQSVYPSEQQMLIHQGKILKDDTTMN  60

Query  267  DNKVAENNFVVVMM  308
            DNKV+ENNF+++M+
Sbjct  61   DNKVSENNFIIIML  74


 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D YGQAASNLVAG NLE  IQQILDMGGGT +R+TVVRAL AA NN
Sbjct  147  DAYGQAASNLVAGGNLEQTIQQILDMGGGTWERDTVVRALHAACNN  192



>ref|XP_011035053.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X5 [Populus 
euphratica]
Length=373

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVYQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NKV+E++F VVM+
Sbjct  61   ENKVSESSFFVVML  74


 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            ++YGQAASNLVAG+NLE  IQQILDMGGG  +RETVVRALRAA+NN
Sbjct  129  NMYGQAASNLVAGSNLEATIQQILDMGGGDWNRETVVRALRAAFNN  174



>ref|XP_011035049.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Populus 
euphratica]
Length=390

 Score =   122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVYQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NKV+E++F VVM+
Sbjct  61   ENKVSESSFFVVML  74


 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            ++YGQAASNLVAG+NLE  IQQILDMGGG  +RETVVRALRAA+NN
Sbjct  146  NMYGQAASNLVAGSNLEATIQQILDMGGGDWNRETVVRALRAAFNN  191



>ref|XP_011035048.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Populus 
euphratica]
Length=391

 Score =   122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVYQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NKV+E++F VVM+
Sbjct  61   ENKVSESSFFVVML  74


 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            ++YGQAASNLVAG+NLE  IQQILDMGGG  +RETVVRALRAA+NN
Sbjct  147  NMYGQAASNLVAGSNLEATIQQILDMGGGDWNRETVVRALRAAFNN  192



>ref|XP_008462954.1| PREDICTED: ubiquitin receptor RAD23b isoform X2 [Cucumis melo]
Length=364

 Score =   121 bits (304),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 104/165 (63%), Gaps = 4/165 (2%)
 Frame = +3

Query  162  VKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLEDNKVAENNFVVVMMaktksssgegs  341
            VKK+IE VQG + YP  Q +LIH GKVLKD +TL +NKV+E  F+VVM++K+K+S+  G 
Sbjct  3    VKKNIEDVQGKDNYPCGQQLLIHNGKVLKDESTLAENKVSEEGFLVVMLSKSKTSASAGQ  62

Query  342  asstattktiapasstsastapapvpasapapvpasapvpvaapaptpaptags----gD  509
            +S+             S++ A    P+  PAP   +     A    T      +     D
Sbjct  63   SSTQPAQNPPVAQPVLSSTPAAQVTPSPTPAPQAPTQAPSSALKNTTSTSDRVTDNVQTD  122

Query  510  VYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
             YGQAASNLVAGNNLE  +QQ++DMGGGT DRETVVRALRAAYNN
Sbjct  123  TYGQAASNLVAGNNLEQTVQQLMDMGGGTWDRETVVRALRAAYNN  167



>ref|XP_009417654.1| PREDICTED: ubiquitin receptor RAD23d-like [Musa acuminata subsp. 
malaccensis]
Length=391

 Score =   121 bits (304),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT FEI+VKPEDTVADVK+ IET QG  VYPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTNFEIDVKPEDTVADVKRYIETSQGKTVYPADQQMLIHQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NKV+EN+F+V+M+
Sbjct  61   ENKVSENSFLVIML  74


 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D YGQAASNLVAGN LE  IQQILDMGGGT DR+TVVRALRAAYNN
Sbjct  146  DAYGQAASNLVAGNTLEQIIQQILDMGGGTWDRDTVVRALRAAYNN  191



>ref|XP_007142901.1| hypothetical protein PHAVU_007G026400g [Phaseolus vulgaris]
 gb|ESW14895.1| hypothetical protein PHAVU_007G026400g [Phaseolus vulgaris]
Length=402

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT+FEIEV+P+D V++VKKSIE+ QG++VYPA+  MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVQPQDAVSEVKKSIESAQGADVYPAALQMLIHQGKVLKDATTLE  60

Query  267  DNKVAENNFVVVMM  308
            +N VAEN+F+V+M+
Sbjct  61   ENNVAENSFIVIML  74


 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYG AASNLVAG+NLEG IQQI+DMGGG+ DR+TVVRALRAAYNN
Sbjct  154  DVYGLAASNLVAGSNLEGTIQQIIDMGGGSWDRDTVVRALRAAYNN  199



>ref|XP_006383465.1| hypothetical protein POPTR_0005s15740g [Populus trichocarpa]
 gb|ERP61262.1| hypothetical protein POPTR_0005s15740g [Populus trichocarpa]
Length=399

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT FEIEVKPEDTV +VKK+IE VQG++VYPA+Q MLI+QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENVQGADVYPAAQQMLIYQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMM  308
            ++KVAEN+F+VVM+
Sbjct  61   ESKVAENSFIVVML  74


 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D+YGQAASNLVAG+NLE  IQQILDMGGG+ +RETVVRALRAA+NN
Sbjct  158  DMYGQAASNLVAGSNLEATIQQILDMGGGSWNRETVVRALRAAFNN  203



>ref|XP_010553920.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Tarenaya hassleriana]
Length=379

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI VKTLKGT FEIEVKPED V DVKK+IETVQG+NVYPA+Q +LIHQGKVL D TTLE
Sbjct  1    MKISVKTLKGTSFEIEVKPEDKVTDVKKTIETVQGANVYPAAQQILIHQGKVLNDDTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NK+AE  F+V+M+
Sbjct  61   ENKIAEKGFIVIML  74


 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAGN LE  +QQILDMGGG+ DR+TVVRALRAAYNN
Sbjct  135  DVYGQAASNLVAGNKLESTVQQILDMGGGSWDRDTVVRALRAAYNN  180



>ref|XP_010553921.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Tarenaya hassleriana]
Length=378

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI VKTLKGT FEIEVKPED V DVKK+IETVQG+NVYPA+Q +LIHQGKVL D TTLE
Sbjct  1    MKISVKTLKGTSFEIEVKPEDKVTDVKKTIETVQGANVYPAAQQILIHQGKVLNDDTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NK+AE  F+V+M+
Sbjct  61   ENKIAEKGFIVIML  74


 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAGN LE  +QQILDMGGG+ DR+TVVRALRAAYNN
Sbjct  134  DVYGQAASNLVAGNKLESTVQQILDMGGGSWDRDTVVRALRAAYNN  179



>ref|XP_002315945.2| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
 gb|EEF02116.2| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
Length=396

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG+ F+IEVKP DTVADVKK+IET QG++VYPA Q MLI+QGKVLKD TTL 
Sbjct  1    MKIFVKTLKGSTFDIEVKPGDTVADVKKNIETAQGASVYPAEQQMLIYQGKVLKDDTTLG  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74


 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/45 (91%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +3

Query  510  VYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            VYGQAASNLVAGNNLEGA+QQILDMGGG+ DR+TVVRALRAAYNN
Sbjct  152  VYGQAASNLVAGNNLEGAVQQILDMGGGSWDRDTVVRALRAAYNN  196



>ref|XP_011007998.1| PREDICTED: ubiquitin receptor RAD23d-like [Populus euphratica]
Length=388

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG+ F+IEVKP DTVADVKK+IET QG++VYPA Q MLI+QGKVLKD TTL 
Sbjct  1    MKIFVKTLKGSTFDIEVKPGDTVADVKKNIETAQGASVYPAEQQMLIYQGKVLKDDTTLG  60

Query  267  DNKVAENNFVVVMM  308
            +NKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74


 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/45 (91%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +3

Query  510  VYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            VYGQAASNLVAGNNLEGA+QQILDMGGG+ DR+TVVRALRAAYNN
Sbjct  144  VYGQAASNLVAGNNLEGAVQQILDMGGGSWDRDTVVRALRAAYNN  188



>ref|XP_011021232.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Populus euphratica]
Length=398

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT FEIEVKPEDTV +VKK+IE  QG++VYPA+Q MLI+QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENAQGADVYPAAQQMLIYQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMM  308
            ++KVAEN+F+VVM+
Sbjct  61   ESKVAENSFIVVML  74


 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D+YGQAASNLVAG+NLE  IQQILDMGGG+ +RETVVRALRAA+NN
Sbjct  157  DMYGQAASNLVAGSNLEATIQQILDMGGGSWNRETVVRALRAAFNN  202



>ref|XP_008341883.1| PREDICTED: ubiquitin receptor RAD23d-like [Malus domestica]
Length=408

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT F IEVKPE+TVADVK  IET QG++VYPA Q MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTNFAIEVKPEETVADVKTIIETAQGADVYPAPQQMLIHQGKVLKDDTTLE  60

Query  267  DNKVAENNFVVVMM  308
             N VAEN+F+V+M+
Sbjct  61   ANNVAENSFIVIML  74


 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG  LE  +QQILDMGGG+ DRETV+RALRAA+NN
Sbjct  143  DVYGQAASNLVAGTTLESTVQQILDMGGGSWDRETVIRALRAAFNN  188



>ref|XP_011021231.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Populus euphratica]
Length=399

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT FEIEVKPEDTV +VKK+IE  QG++VYPA+Q MLI+QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENAQGADVYPAAQQMLIYQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMM  308
            ++KVAEN+F+VVM+
Sbjct  61   ESKVAENSFIVVML  74


 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D+YGQAASNLVAG+NLE  IQQILDMGGG+ +RETVVRALRAA+NN
Sbjct  158  DMYGQAASNLVAGSNLEATIQQILDMGGGSWNRETVVRALRAAFNN  203



>ref|XP_002312393.1| hypothetical protein POPTR_0008s11840g [Populus trichocarpa]
 gb|EEE89760.1| hypothetical protein POPTR_0008s11840g [Populus trichocarpa]
Length=333

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            M+IFVKTLKG+ F+IEVKPEDTVADVKK IET QG  VYPA Q MLIHQ KVLKD TTL+
Sbjct  1    MRIFVKTLKGSTFDIEVKPEDTVADVKKKIETAQGVAVYPAEQQMLIHQAKVLKDNTTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NK+ EN+FVV+M+
Sbjct  61   ENKIVENSFVVIML  74


 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +3

Query  510  VYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            VYGQAAS+LVAG+NLE A+QQILDMGGGT DR+TVVRALRAAYNN
Sbjct  91   VYGQAASSLVAGSNLEVAVQQILDMGGGTWDRDTVVRALRAAYNN  135



>ref|XP_009399729.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=392

 Score =   119 bits (297),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG+ FEI+V PEDTVADVKK+IET QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGSNFEIDVNPEDTVADVKKNIETSQGKTVYPAEQQMLIHQGKILKDDTTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NKV EN+F+V+M+
Sbjct  61   ENKVFENSFLVIML  74


 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D YGQAASNLVAG+ LE  IQQILDMGGGT +R+TVVRALRAAYNN
Sbjct  147  DSYGQAASNLVAGSTLEQTIQQILDMGGGTWERDTVVRALRAAYNN  192



>ref|XP_011021237.1| PREDICTED: ubiquitin receptor RAD23c isoform X5 [Populus euphratica]
Length=364

 Score =   118 bits (296),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT FEIEVKPEDTV +VKK+IE  QG++VYPA+Q MLI+QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENAQGADVYPAAQQMLIYQGKVLKDDTTLD  60

Query  267  DNKVAENNFVVVMM  308
            ++KVAEN+F+VVM+
Sbjct  61   ESKVAENSFIVVML  74


 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D+YGQAASNLVAG+NLE  IQQILDMGGG+ +RETVVRALRAA+NN
Sbjct  123  DMYGQAASNLVAGSNLEATIQQILDMGGGSWNRETVVRALRAAFNN  168



>ref|XP_009399730.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=391

 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG+ FEI+V PEDTVADVKK+IET QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGSNFEIDVNPEDTVADVKKNIETSQGKTVYPAEQQMLIHQGKILKDDTTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NKV EN+F+V+M+
Sbjct  61   ENKVFENSFLVIML  74


 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D YGQAASNLVAG+ LE  IQQILDMGGGT +R+TVVRALRAAYNN
Sbjct  147  DSYGQAASNLVAGSTLEQTIQQILDMGGGTWERDTVVRALRAAYNN  192



>gb|KJB80001.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
Length=320

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKGT+F+IEVKPED VADVKK+IETVQG++VYPASQ MLI++GKVLKD TTL 
Sbjct  1    MKVSVKTLKGTHFDIEVKPEDAVADVKKNIETVQGTDVYPASQQMLIYKGKVLKDDTTLA  60

Query  267  DNKVAENNFVVVMM  308
            +N V EN+F+V+M+
Sbjct  61   ENSVTENSFIVIML  74


 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/46 (91%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG+NLEG IQQILDMGGGT DR+TVVRALRAAYNN
Sbjct  138  DVYGQAASNLVAGSNLEGTIQQILDMGGGTWDRDTVVRALRAAYNN  183



>ref|XP_006655985.1| PREDICTED: ubiquitin receptor RAD23c-like [Oryza brachyantha]
Length=409

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT FEIE  PE +VA+VKK IET QG NVYPA Q MLIHQGK+LKD TTLE
Sbjct  1    MKLFVKTLKGTNFEIEASPEASVAEVKKIIETTQGQNVYPADQQMLIHQGKILKDDTTLE  60

Query  267  DNKVAENNFVVVMM  308
             NKVAEN+F+V+M+
Sbjct  61   GNKVAENSFLVIML  74


 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVY QAASNLV+G+NLE  IQQILDMGGGT +R+ VVRALRAAYNN
Sbjct  147  DVYSQAASNLVSGSNLEETIQQILDMGGGTWERDMVVRALRAAYNN  192



>gb|KJB80000.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
Length=382

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKGT+F+IEVKPED VADVKK+IETVQG++VYPASQ MLI++GKVLKD TTL 
Sbjct  1    MKVSVKTLKGTHFDIEVKPEDAVADVKKNIETVQGTDVYPASQQMLIYKGKVLKDDTTLA  60

Query  267  DNKVAENNFVVVMM  308
            +N V EN+F+V+M+
Sbjct  61   ENSVTENSFIVIML  74


 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/46 (91%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG+NLEG IQQILDMGGGT DR+TVVRALRAAYNN
Sbjct  136  DVYGQAASNLVAGSNLEGTIQQILDMGGGTWDRDTVVRALRAAYNN  181



>gb|EPS71284.1| hypothetical protein M569_03474, partial [Genlisea aurea]
Length=389

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 64/74 (86%), Gaps = 2/74 (3%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT+FEIEVKPEDTV+DVK  IET QG   YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVSDVKTIIETAQGE--YPAAQQMLIHQGKVLKDATTLE  58

Query  267  DNKVAENNFVVVMM  308
            +N VAE +FVV+M+
Sbjct  59   ENNVAEKSFVVIML  72


 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVY QAASNLVAGNNLEG IQQILDMGGGT DR++VVRALRAA+NN
Sbjct  143  DVYSQAASNLVAGNNLEGTIQQILDMGGGTWDRDSVVRALRAAFNN  188



>gb|KJB79998.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
 gb|KJB79999.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
Length=384

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKGT+F+IEVKPED VADVKK+IETVQG++VYPASQ MLI++GKVLKD TTL 
Sbjct  1    MKVSVKTLKGTHFDIEVKPEDAVADVKKNIETVQGTDVYPASQQMLIYKGKVLKDDTTLA  60

Query  267  DNKVAENNFVVVMM  308
            +N V EN+F+V+M+
Sbjct  61   ENSVTENSFIVIML  74


 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/46 (91%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG+NLEG IQQILDMGGGT DR+TVVRALRAAYNN
Sbjct  138  DVYGQAASNLVAGSNLEGTIQQILDMGGGTWDRDTVVRALRAAYNN  183



>ref|XP_011022053.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Populus 
euphratica]
Length=324

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI VKTLKG+ F+IEV+PEDTVADVKK+IET QG  VYPA Q MLIHQ KVLKD TTL+
Sbjct  1    MKILVKTLKGSTFDIEVRPEDTVADVKKNIETAQGVAVYPAEQQMLIHQAKVLKDNTTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NK+ EN+FVV+M+
Sbjct  61   ENKIVENSFVVIML  74


 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +3

Query  510  VYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            VY QAAS+LVAGNNLE A+QQILDMGGGT DR+TVVRALRAAYNN
Sbjct  136  VYDQAASSLVAGNNLEVAVQQILDMGGGTWDRDTVVRALRAAYNN  180



>emb|CAA72741.1| RAD23, isoform I [Daucus carota]
Length=382

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI+VKTLKG+ FEI+V P+D+VADVK+SIET QG+ VYPA+Q MLI+QGKVLKDGTTL 
Sbjct  1    MKIYVKTLKGSQFEIQVNPDDSVADVKRSIETAQGAAVYPAAQQMLIYQGKVLKDGTTLL  60

Query  267  DNKVAENNFVVVMM  308
            +N VAEN+F+V+M+
Sbjct  61   ENNVAENSFIVIML  74


 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            +VY  AAS LVAG+NLEGAIQQILDMGGGT DR+TV+R +RAA+NN
Sbjct  143  NVYDSAASLLVAGSNLEGAIQQILDMGGGTWDRDTVIRIVRAAFNN  188



>ref|XP_007046250.1| Rad23 UV excision repair protein family isoform 2 [Theobroma 
cacao]
 gb|EOY02082.1| Rad23 UV excision repair protein family isoform 2 [Theobroma 
cacao]
Length=340

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG++F++EVK ED V+DVKK+IETVQG++VYPA+Q MLIH+GKVLKD TTL 
Sbjct  1    MKIFVKTLKGSHFDVEVKAEDVVSDVKKNIETVQGADVYPAAQQMLIHKGKVLKDDTTLA  60

Query  267  DNKVAENNFVVVMM  308
            +N V EN+F+V+M+
Sbjct  61   ENSVTENSFIVIML  74


 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/46 (89%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG++LEGAIQQILDMGGGT DR+ VVRALRAAYNN
Sbjct  138  DVYGQAASNLVAGSHLEGAIQQILDMGGGTWDRDIVVRALRAAYNN  183



>ref|XP_009391404.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=409

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT FEI+VKPEDTVA VK+ IET QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGTNFEIDVKPEDTVAAVKRYIETSQGKTVYPAEQQMLIHQGKILKDDTTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NKV E+ F+V+M+
Sbjct  61   ENKVCESTFLVIML  74


 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D YGQAASNLVAGN LE  IQQILDMGGGT  R+TVVRALRAAYNN
Sbjct  165  DAYGQAASNLVAGNTLEQTIQQILDMGGGTWARDTVVRALRAAYNN  210



>ref|XP_009391405.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=408

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT FEI+VKPEDTVA VK+ IET QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGTNFEIDVKPEDTVAAVKRYIETSQGKTVYPAEQQMLIHQGKILKDDTTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NKV E+ F+V+M+
Sbjct  61   ENKVCESTFLVIML  74


 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            D YGQAASNLVAGN LE  IQQILDMGGGT  R+TVVRALRAAYNN
Sbjct  164  DAYGQAASNLVAGNTLEQTIQQILDMGGGTWARDTVVRALRAAYNN  209



>ref|XP_011022044.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Populus 
euphratica]
Length=378

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI VKTLKG+ F+IEV+PEDTVADVKK+IET QG  VYPA Q MLIHQ KVLKD TTL+
Sbjct  1    MKILVKTLKGSTFDIEVRPEDTVADVKKNIETAQGVAVYPAEQQMLIHQAKVLKDNTTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NK+ EN+FVV+M+
Sbjct  61   ENKIVENSFVVIML  74


 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +3

Query  510  VYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            VY QAAS+LVAGNNLE A+QQILDMGGGT DR+TVVRALRAAYNN
Sbjct  136  VYDQAASSLVAGNNLEVAVQQILDMGGGTWDRDTVVRALRAAYNN  180



>ref|XP_004304134.1| PREDICTED: ubiquitin receptor RAD23d-like [Fragaria vesca subsp. 
vesca]
Length=390

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT FEIEV+P+  VADVK+ IE  QG++VYPAS+ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTNFEIEVEPKQLVADVKQVIEKAQGADVYPASKQMLIHQGKVLKDATTLE  60

Query  267  DNKVAENNFVVVMM  308
            +N+VAEN+F+V+M+
Sbjct  61   ENQVAENSFIVIML  74


 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAGNNLE  +QQILDMGGG+ DR+TV+RALRAA+NN
Sbjct  137  DVYGQAASNLVAGNNLEVIVQQILDMGGGSWDRDTVLRALRAAFNN  182



>ref|XP_010681566.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X4 [Beta vulgaris 
subsp. vulgaris]
Length=373

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI+VK LKG +F+IEVKP+DTV DVKK+IE+V+G+N++PAS  MLI+QGKVL DGTTLE
Sbjct  4    MKIYVKNLKGKHFQIEVKPQDTVLDVKKNIESVKGANLFPASHQMLIYQGKVLIDGTTLE  63

Query  267  DNKVAENNFVVVMM  308
             NKVAEN+F+V+M+
Sbjct  64   HNKVAENSFIVIML  77


 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  519  QAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            + A +LVAGN LE  IQ ILD+GGG  DRETV+RALRAA NN
Sbjct  184  KTAPDLVAGNGLENTIQHILDIGGGIWDRETVLRALRAASNN  225



>ref|XP_010681568.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X6 [Beta vulgaris 
subsp. vulgaris]
Length=354

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI+VK LKG +F+IEVKP+DTV DVKK+IE+V+G+N++PAS  MLI+QGKVL DGTTLE
Sbjct  4    MKIYVKNLKGKHFQIEVKPQDTVLDVKKNIESVKGANLFPASHQMLIYQGKVLIDGTTLE  63

Query  267  DNKVAENNFVVVMM  308
             NKVAEN+F+V+M+
Sbjct  64   HNKVAENSFIVIML  77


 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  519  QAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            + A +LVAGN LE  IQ ILD+GGG  DRETV+RALRAA NN
Sbjct  165  KTAPDLVAGNGLENTIQHILDIGGGIWDRETVLRALRAASNN  206



>ref|XP_010681565.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X3 [Beta vulgaris 
subsp. vulgaris]
Length=376

 Score =   116 bits (290),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI+VK LKG +F+IEVKP+DTV DVKK+IE+V+G+N++PAS  MLI+QGKVL DGTTLE
Sbjct  4    MKIYVKNLKGKHFQIEVKPQDTVLDVKKNIESVKGANLFPASHQMLIYQGKVLIDGTTLE  63

Query  267  DNKVAENNFVVVMM  308
             NKVAEN+F+V+M+
Sbjct  64   HNKVAENSFIVIML  77


 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  519  QAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            + A +LVAGN LE  IQ ILD+GGG  DRETV+RALRAA NN
Sbjct  187  KTAPDLVAGNGLENTIQHILDIGGGIWDRETVLRALRAASNN  228



>ref|NP_001057334.1| Os06g0264300 [Oryza sativa Japonica Group]
 dbj|BAD54365.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAD54370.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAF19248.1| Os06g0264300 [Oryza sativa Japonica Group]
 gb|EAZ36555.1| hypothetical protein OsJ_20893 [Oryza sativa Japonica Group]
 dbj|BAG88004.1| unnamed protein product [Oryza sativa Japonica Group]
Length=413

 Score =   116 bits (290),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT FEIE  PE +VA+VK+ IE+ QG NVYPA Q MLIHQGK+LKD TTLE
Sbjct  1    MKLFVKTLKGTNFEIEASPEASVAEVKRIIESTQGQNVYPADQQMLIHQGKILKDDTTLE  60

Query  267  DNKVAENNFVVVMM  308
             NKVAEN+F+V+M+
Sbjct  61   GNKVAENSFLVIML  74


 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVY QAASNLV+G+NLE  IQQILDMGGGT +R+ VVRALRAAYNN
Sbjct  150  DVYSQAASNLVSGSNLEQTIQQILDMGGGTWERDMVVRALRAAYNN  195



>gb|EAZ00429.1| hypothetical protein OsI_22453 [Oryza sativa Indica Group]
Length=413

 Score =   116 bits (290),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT FEIE  PE +VA+VK+ IE+ QG NVYPA Q MLIHQGK+LKD TTLE
Sbjct  1    MKLFVKTLKGTNFEIEASPEASVAEVKRIIESTQGQNVYPADQQMLIHQGKILKDDTTLE  60

Query  267  DNKVAENNFVVVMM  308
             NKVAEN+F+V+M+
Sbjct  61   GNKVAENSFLVIML  74


 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVY QAASNLV+G+NLE  IQQILDMGGGT +R+ VVRALRAAYNN
Sbjct  150  DVYSQAASNLVSGSNLEQTIQQILDMGGGTWERDMVVRALRAAYNN  195



>ref|XP_010681564.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=392

 Score =   116 bits (290),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI+VK LKG +F+IEVKP+DTV DVKK+IE+V+G+N++PAS  MLI+QGKVL DGTTLE
Sbjct  4    MKIYVKNLKGKHFQIEVKPQDTVLDVKKNIESVKGANLFPASHQMLIYQGKVLIDGTTLE  63

Query  267  DNKVAENNFVVVMM  308
             NKVAEN+F+V+M+
Sbjct  64   HNKVAENSFIVIML  77


 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  519  QAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            + A +LVAGN LE  IQ ILD+GGG  DRETV+RALRAA NN
Sbjct  203  KTAPDLVAGNGLENTIQHILDIGGGIWDRETVLRALRAASNN  244



>ref|XP_010681567.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X5 [Beta vulgaris 
subsp. vulgaris]
Length=357

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI+VK LKG +F+IEVKP+DTV DVKK+IE+V+G+N++PAS  MLI+QGKVL DGTTLE
Sbjct  4    MKIYVKNLKGKHFQIEVKPQDTVLDVKKNIESVKGANLFPASHQMLIYQGKVLIDGTTLE  63

Query  267  DNKVAENNFVVVMM  308
             NKVAEN+F+V+M+
Sbjct  64   HNKVAENSFIVIML  77


 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  519  QAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            + A +LVAGN LE  IQ ILD+GGG  DRETV+RALRAA NN
Sbjct  168  KTAPDLVAGNGLENTIQHILDIGGGIWDRETVLRALRAASNN  209



>ref|XP_010681563.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=395

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI+VK LKG +F+IEVKP+DTV DVKK+IE+V+G+N++PAS  MLI+QGKVL DGTTLE
Sbjct  4    MKIYVKNLKGKHFQIEVKPQDTVLDVKKNIESVKGANLFPASHQMLIYQGKVLIDGTTLE  63

Query  267  DNKVAENNFVVVMM  308
             NKVAEN+F+V+M+
Sbjct  64   HNKVAENSFIVIML  77


 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  519  QAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            + A +LVAGN LE  IQ ILD+GGG  DRETV+RALRAA NN
Sbjct  206  KTAPDLVAGNGLENTIQHILDIGGGIWDRETVLRALRAASNN  247



>ref|XP_009357056.1| PREDICTED: ubiquitin receptor RAD23d [Pyrus x bretschneideri]
Length=391

 Score =   115 bits (289),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK++VKTLKGT FEIEVK E+TVADVK  IET QG++VYPA Q MLIHQGKVLKD TTLE
Sbjct  1    MKVYVKTLKGTNFEIEVKLEETVADVKTIIETAQGADVYPAPQQMLIHQGKVLKDDTTLE  60

Query  267  DNKVAENNFVVVMM  308
             N VAEN+F+V+M+
Sbjct  61   QNNVAENSFIVIML  74


 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG  LE  +QQILDMGGG+ DRETVVRALRAA+NN
Sbjct  145  DVYGQAASNLVAGTTLESTVQQILDMGGGSWDRETVVRALRAAFNN  190



>ref|XP_007046249.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
 gb|EOY02081.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
Length=385

 Score =   115 bits (289),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKG++F++EVK ED V+DVKK+IETVQG++VYPA+Q MLIH+GKVLKD TTL 
Sbjct  1    MKIFVKTLKGSHFDVEVKAEDVVSDVKKNIETVQGADVYPAAQQMLIHKGKVLKDDTTLA  60

Query  267  DNKVAENNFVVVMM  308
            +N V EN+F+V+M+
Sbjct  61   ENSVTENSFIVIML  74


 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/46 (89%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG++LEGAIQQILDMGGGT DR+ VVRALRAAYNN
Sbjct  138  DVYGQAASNLVAGSHLEGAIQQILDMGGGTWDRDIVVRALRAAYNN  183



>ref|XP_003551850.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Glycine 
max]
 gb|KHN17319.1| Putative DNA repair protein RAD23-4 [Glycine soja]
Length=375

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI VKTLKGT+F ++V P+DTVA VKK+IET QG++VYPA+Q MLIHQGKVL D TTLE
Sbjct  1    MKINVKTLKGTHFVLQVNPQDTVAVVKKNIETAQGADVYPAAQQMLIHQGKVLNDATTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKV ENNFVV+M+
Sbjct  61   ENKVVENNFVVIML  74


 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +3

Query  510  VYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            +Y  AASNL+AG+NLE  IQQIL+MGGG  DR+TV  AL AA+NN
Sbjct  135  IYDHAASNLMAGSNLETTIQQILEMGGGNWDRDTVTGALHAAFNN  179



>gb|KJB79994.1| hypothetical protein B456_013G076500 [Gossypium raimondii]
Length=384

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKGT+F+IEVKPED VADVKK+IETVQG++VYPA+Q MLI++GKVLKD TTL 
Sbjct  1    MKVSVKTLKGTHFDIEVKPEDAVADVKKNIETVQGADVYPAAQQMLIYKGKVLKDDTTLA  60

Query  267  DNKVAENNFVVVMM  308
            ++ V EN+F+V+M+
Sbjct  61   ESSVTENSFIVIML  74


 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/46 (91%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG+NLEG IQQILDMGGGT DR+TVVRALRAAYNN
Sbjct  138  DVYGQAASNLVAGSNLEGTIQQILDMGGGTWDRDTVVRALRAAYNN  183



>gb|KJB79995.1| hypothetical protein B456_013G076600 [Gossypium raimondii]
Length=384

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKGT+F+IEVKPED VADVKK+IETVQG++VYPA+Q MLI +GKVLKD TTL 
Sbjct  1    MKVSVKTLKGTHFDIEVKPEDAVADVKKNIETVQGADVYPAAQQMLIFKGKVLKDDTTLA  60

Query  267  DNKVAENNFVVVMM  308
            +N V EN+F+V+M+
Sbjct  61   ENSVNENSFIVIML  74


 Score = 87.0 bits (214),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQ ASNLVAG+N EG IQQILDMGGGT DR+TVVRALRAAYNN
Sbjct  138  DVYGQTASNLVAGSNFEGTIQQILDMGGGTWDRDTVVRALRAAYNN  183



>ref|XP_004489115.1| PREDICTED: putative DNA repair protein RAD23-4-like [Cicer arietinum]
Length=377

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI VKTLKGT+FEI+V  +DTV DVKK+IE VQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKINVKTLKGTHFEIQVNLQDTVGDVKKNIEAVQGVDVYPAAQQMLIHQGKVLKDDTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +N+VAEN+FVV+M+
Sbjct  61   ENQVAENSFVVIML  74


 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +3

Query  513  YGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            YGQA SNL+AG+NLE  IQQIL+MGGG+ DR+TV+RALRAAYNN
Sbjct  140  YGQAESNLIAGSNLESTIQQILEMGGGSWDRDTVIRALRAAYNN  183



>gb|AFK37901.1| unknown [Medicago truncatula]
Length=215

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI VKTLKGT+FEI+V   DTV DVKK+IE  QG+ VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKINVKTLKGTHFEIQVNLHDTVGDVKKNIEGAQGAAVYPAAQQMLIHQGKVLKDETTLE  60

Query  267  DNKVAENNFVVVMM  308
            +N+VAEN+F+V+M+
Sbjct  61   ENQVAENSFIVIML  74


 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  528  SNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            SNL+AG+ LE  IQQIL+MGGG+ DR+TV+RALRAAYNN
Sbjct  137  SNLIAGSTLEPTIQQILEMGGGSWDRDTVIRALRAAYNN  175



>gb|KFK33251.1| hypothetical protein AALP_AA6G350300 [Arabis alpina]
Length=392

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 65/74 (88%), Gaps = 1/74 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT FEIEVKP DTV+DVKK+IET+ G + YPA+Q MLIHQGK+L D +TLE
Sbjct  1    MKIFVKTLKGTNFEIEVKPVDTVSDVKKAIETLHGEH-YPAAQQMLIHQGKILNDASTLE  59

Query  267  DNKVAENNFVVVMM  308
            +N VAEN+F+V+M+
Sbjct  60   ENNVAENSFIVIML  73


 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG NLE  +QQILDMGGG+ DR+TV+RALRAA+NN
Sbjct  147  DVYGQAASNLVAGTNLESTVQQILDMGGGSWDRDTVIRALRAAFNN  192



>ref|XP_003563980.1| PREDICTED: ubiquitin receptor RAD23d-like [Brachypodium distachyon]
Length=413

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTLKGT FEIE  PE +VA+VK+ IE  QG NVYPA Q MLIHQGK+LKD TTLE
Sbjct  1    MKLFVKTLKGTNFEIEASPEASVAEVKRIIEGAQGQNVYPADQQMLIHQGKILKDDTTLE  60

Query  267  DNKVAENNFVVVMM  308
             N VAEN+F+V+M+
Sbjct  61   GNNVAENSFLVIML  74


 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVY QAASNLV+G +LE  +Q ILDMGGGT +R+ VVRALRAAYNN
Sbjct  153  DVYSQAASNLVSGGSLEQTVQHILDMGGGTWERDMVVRALRAAYNN  198



>ref|XP_010435751.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Camelina 
sativa]
Length=374

 Score =   112 bits (281),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 65/74 (88%), Gaps = 1/74 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTL GT FEIEVKP DTV+DVK++IETVQG+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSDVKQAIETVQGAQ-YPAAKQMLIHQGKVLKDETTLE  59

Query  267  DNKVAENNFVVVMM  308
            +N V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73


 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG  LE  +QQILDMGGG+ DR+TVVRALRAA+NN
Sbjct  133  DVYGQAASNLVAGTVLESTVQQILDMGGGSWDRDTVVRALRAAFNN  178



>ref|XP_010450905.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Camelina sativa]
Length=381

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 65/74 (88%), Gaps = 1/74 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTL GT FEIEVKP DTV+DVK++IETVQG+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSDVKQAIETVQGAQ-YPAAKQMLIHQGKVLKDETTLE  59

Query  267  DNKVAENNFVVVMM  308
            +N V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73


 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG  LE  +QQILDMGGG+ DR+TVVRALRAA+NN
Sbjct  137  DVYGQAASNLVAGTVLESTVQQILDMGGGSWDRDTVVRALRAAFNN  182



>ref|XP_010450906.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Camelina sativa]
Length=379

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 65/74 (88%), Gaps = 1/74 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+FVKTL GT FEIEVKP DTV+DVK++IETVQG+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSDVKQAIETVQGAQ-YPAAKQMLIHQGKVLKDETTLE  59

Query  267  DNKVAENNFVVVMM  308
            +N V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73


 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG  LE  +QQILDMGGG+ DR+TVVRALRAA+NN
Sbjct  135  DVYGQAASNLVAGTVLESTVQQILDMGGGSWDRDTVVRALRAAFNN  180



>gb|KEH21499.1| RAD23 UV excision repair family protein [Medicago truncatula]
Length=370

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI VKTLKGT+FEI+V   DTV DVKK+IE  QG+ VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKINVKTLKGTHFEIQVNLHDTVGDVKKNIEGAQGAAVYPAAQQMLIHQGKVLKDETTLE  60

Query  267  DNKVAENNFVVVMM  308
            +N+VAEN+F+V+M+
Sbjct  61   ENQVAENSFIVIML  74


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  528  SNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            SNL+AG+ LE  IQQIL+MGGG+ DR+TV+RALRAAYNN
Sbjct  137  SNLIAGSTLEPTIQQILEMGGGSWDRDTVIRALRAAYNN  175



>ref|XP_002870839.1| hypothetical protein ARALYDRAFT_494129 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47098.1| hypothetical protein ARALYDRAFT_494129 [Arabidopsis lyrata subsp. 
lyrata]
Length=377

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTL GT FEIEVKP DTV+DVKK+IETV+G+  YPA + MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLSGTNFEIEVKPADTVSDVKKAIETVKGAE-YPAVKQMLIHQGKVLKDETTLE  59

Query  267  DNKVAENNFVVVMM  308
            +N V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73


 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG  LE  +QQILDMGGG+ DR+TVVRALRAA+NN
Sbjct  133  DVYGQAASNLVAGTTLESTVQQILDMGGGSWDRDTVVRALRAAFNN  178



>gb|AFK37577.1| unknown [Lotus japonicus]
Length=376

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI VKTLKGT+F+I+V  +D+VADVKK+IE  QG+ VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKINVKTLKGTHFQIQVNLQDSVADVKKTIEVAQGAGVYPAAQQMLIHQGKVLKDDTTLE  60

Query  267  DNKVAENNFVVVMM  308
            +N VAE++FVV+M+
Sbjct  61   ENNVAEDSFVVIML  74


 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +3

Query  510  VYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            VYGQAASNL+AG+N++  +QQIL+MGGG+ DR+TV+RALRAAYNN
Sbjct  141  VYGQAASNLIAGSNVDPTVQQILEMGGGSWDRDTVIRALRAAYNN  185



>emb|CDY01661.1| BnaC04g30910D [Brassica napus]
Length=378

 Score =   110 bits (275),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 62/74 (84%), Gaps = 1/74 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT FEIEV P DT++D K+ IET QG+  YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTNFEIEVNPADTISDTKRRIETHQGAQ-YPAAQQMLIHQGKVLKDETTLE  59

Query  267  DNKVAENNFVVVMM  308
            +N V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73


 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAGN LE  +QQILDMGGG+ DR+TVVRALRAA+NN
Sbjct  136  DVYGQAASNLVAGNTLESTVQQILDMGGGSWDRDTVVRALRAAFNN  181



>ref|XP_009139789.1| PREDICTED: ubiquitin receptor RAD23d [Brassica rapa]
Length=378

 Score =   110 bits (275),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 62/74 (84%), Gaps = 1/74 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT FEIEV P DT++D K+ IET QG+  YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTNFEIEVNPADTISDTKRRIETHQGAQ-YPAAQQMLIHQGKVLKDETTLE  59

Query  267  DNKVAENNFVVVMM  308
            +N V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73


 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAGN LE  +QQILDMGGG+ DR+TVVRALRAA+NN
Sbjct  136  DVYGQAASNLVAGNTLESTVQQILDMGGGSWDRDTVVRALRAAFNN  181



>ref|XP_003578094.1| PREDICTED: probable ubiquitin receptor RAD23 [Brachypodium distachyon]
Length=395

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG+ F+IEV P D V+DVKK IE+ QG NVYPA Q MLIHQG VLKD TTLE
Sbjct  1    MKVSVKTLKGSSFQIEVNPADKVSDVKKLIESSQGQNVYPADQQMLIHQGTVLKDDTTLE  60

Query  267  DNKVAENNFVVVMM  308
            ++KV ENNF+V+M+
Sbjct  61   ESKVLENNFLVIML  74


 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            + YGQAASNLVAG NLE  IQ IL+MGGGT DR+TV+RALRAA+NN
Sbjct  149  ETYGQAASNLVAGGNLEATIQSILEMGGGTWDRDTVLRALRAAFNN  194



>gb|EMS61794.1| putative DNA repair protein RAD23 [Triticum urartu]
Length=424

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKGT FEIE  PE +V +VK+ IE+ QG NVYPA QLM+I+QGK+LKD TTLE
Sbjct  1    MKLNVKTLKGTSFEIEATPESSVGEVKRIIESAQGQNVYPADQLMIIYQGKILKDDTTLE  60

Query  267  DNKVAENNFVVVMM  308
             NKVAEN+F+V+M+
Sbjct  61   ANKVAENSFLVIML  74


 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVY QAASNLV+G +LE  +QQILDMGGGT +R+ VVRALRAAYNN
Sbjct  148  DVYSQAASNLVSGGSLEQTVQQILDMGGGTWERDMVVRALRAAYNN  193



>emb|CDX74522.1| BnaA04g08670D [Brassica napus]
Length=380

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 62/74 (84%), Gaps = 1/74 (1%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKIFVKTLKGT FEIEV P DT++D K+ IE+ QG+  YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTNFEIEVNPADTISDTKRRIESHQGAQ-YPAAQQMLIHQGKVLKDETTLE  59

Query  267  DNKVAENNFVVVMM  308
            +N V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73


 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAGN LE  +QQILDMGGG+ DR+TVVRALRAA+NN
Sbjct  138  DVYGQAASNLVAGNTLESTVQQILDMGGGSWDRDTVVRALRAAFNN  183



>gb|EMS50196.1| putative DNA repair protein RAD23 [Triticum urartu]
Length=610

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKG+ FEIEV P D V+DVKK IET QG NVYPA Q MLI+QG VLKD TTLE
Sbjct  1    MKVSVKTLKGSKFEIEVNPADKVSDVKKLIETSQGQNVYPADQQMLIYQGSVLKDETTLE  60

Query  267  DNKVAENNFVVVMM  308
            +NKV ENNF+V+M+
Sbjct  61   ENKVVENNFLVIML  74


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            + YGQAASNLVAG  LE  IQ IL+MGGGT DR+TV+RALRAA+NN
Sbjct  149  ETYGQAASNLVAGGTLEATIQSILEMGGGTWDRDTVLRALRAAFNN  194



>gb|KCW86330.1| hypothetical protein EUGRSUZ_B03019 [Eucalyptus grandis]
Length=320

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI VKTLKGT FEIEV+P++ V DVKK IE +QG++++PASQ MLIHQGKVLKD TTL+
Sbjct  1    MKINVKTLKGTNFEIEVEPQEAVVDVKKKIEIIQGASMFPASQQMLIHQGKVLKDETTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NK+ E +F+V+M+
Sbjct  61   ENKIVEGSFIVIML  74


 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG+NLEG IQ+IL+MGGGT DR+TVVRALRAA+NN
Sbjct  147  DVYGQAASNLVAGSNLEGTIQEILEMGGGTWDRDTVVRALRAAFNN  192



>dbj|BAJ98767.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=414

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKGT FEIE  PE +V +VK+ IE+ QG NVYPA QLM+I+QGK+LKD TTL+
Sbjct  1    MKLNVKTLKGTSFEIEATPESSVGEVKRIIESAQGQNVYPADQLMIIYQGKILKDDTTLD  60

Query  267  DNKVAENNFVVVMM  308
             NKVAEN+F+V+M+
Sbjct  61   ANKVAENSFLVIML  74


 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVY QAASNLV+G  LE  +QQILDMGGGT +R+ VVRALRAAYNN
Sbjct  153  DVYSQAASNLVSGGILEQTVQQILDMGGGTWERDMVVRALRAAYNN  198



>dbj|BAJ97496.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=420

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MK+ VKTLKGT FEIE  PE +V +VK+ IE+ QG NVYPA QLM+I+QGK+LKD TTL+
Sbjct  1    MKLNVKTLKGTSFEIEATPESSVGEVKRIIESAQGQNVYPADQLMIIYQGKILKDDTTLD  60

Query  267  DNKVAENNFVVVMM  308
             NKVAEN+F+V+M+
Sbjct  61   ANKVAENSFLVIML  74


 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVY QAASNLV+G  LE  +QQILDMGGGT +R+ VVRALRAAYNN
Sbjct  153  DVYSQAASNLVSGGILEQTVQQILDMGGGTWERDMVVRALRAAYNN  198



>ref|XP_010044267.1| PREDICTED: ubiquitin receptor RAD23d-like [Eucalyptus grandis]
 gb|KCW86329.1| hypothetical protein EUGRSUZ_B03019 [Eucalyptus grandis]
Length=401

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  87   MKIFVKTLKGTYFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  266
            MKI VKTLKGT FEIEV+P++ V DVKK IE +QG++++PASQ MLIHQGKVLKD TTL+
Sbjct  1    MKINVKTLKGTNFEIEVEPQEAVVDVKKKIEIIQGASMFPASQQMLIHQGKVLKDETTLD  60

Query  267  DNKVAENNFVVVMM  308
            +NK+ E +F+V+M+
Sbjct  61   ENKIVEGSFIVIML  74


 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +3

Query  507  DVYGQAASNLVAGNNLEGAIQQILDMGGGTXDRETVVRALRAAYNN  644
            DVYGQAASNLVAG+NLEG IQ+IL+MGGGT DR+TVVRALRAA+NN
Sbjct  147  DVYGQAASNLVAGSNLEGTIQEILEMGGGTWDRDTVVRALRAAFNN  192



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 960833956375