BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF041H17

Length=659
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AHJ60264.1|  phenylalanine ammonia-lyase 1                           369   3e-120   Ipomoea purpurea
sp|Q42858.1|PAL2_IPOBA  RecName: Full=Phenylalanine ammonia-lyase       322   7e-102   Ipomoea batatas [batate]
ref|XP_009781653.1|  PREDICTED: phenylalanine ammonia-lyase             318   1e-100   Nicotiana sylvestris
sp|P45733.1|PAL3_TOBAC  RecName: Full=Phenylalanine ammonia-lyase       318   1e-100   Nicotiana tabacum [American tobacco]
gb|AAG49585.1|AF325496_1  phenylalanine ammonia-lyase                   318   2e-100   Ipomoea nil [qian niu]
ref|XP_009625397.1|  PREDICTED: phenylalanine ammonia-lyase             316   2e-99    Nicotiana tomentosiformis
sp|P35513.2|PAL2_TOBAC  RecName: Full=Phenylalanine ammonia-lyase       315   2e-99    Nicotiana tabacum [American tobacco]
gb|ABG75910.1|  phenylalanine ammonia-lyase 1                           313   2e-98    Nicotiana attenuata
dbj|BAA95629.1|  phenylalanine ammonia lyase                            310   3e-97    Catharanthus roseus [chatas]
sp|P14166.1|PAL1_IPOBA  RecName: Full=Phenylalanine ammonia-lyase       307   3e-96    Ipomoea batatas [batate]
gb|AFZ94859.1|  phenylalanine ammonia-lyase                             306   1e-95    Plectranthus scutellarioides
gb|AIY26016.1|  PAL                                                     305   1e-95    Jasminum sambac [Arabian jasmine]
gb|ACF94719.1|  phenylalanine ammonia lyase                             288   9e-95    Robinia pseudoacacia [black locust]
gb|AAO13347.1|  phenylalanine ammonia-lyase2                            303   1e-94    Lactuca sativa [cultivated lettuce]
gb|ABL14039.1|  phenylalanine ammonia lyase                             290   1e-94    Astragalus mongholicus
gb|AEM63670.1|  phenylalanine ammonia lyase 1                           301   4e-94    Platycodon grandiflorus [balloon-flower]
ref|XP_011077338.1|  PREDICTED: phenylalanine ammonia-lyase             301   5e-94    Sesamum indicum [beniseed]
gb|EYU38541.1|  hypothetical protein MIMGU_mgv1a001582mg                302   2e-93    Erythranthe guttata [common monkey flower]
ref|XP_004249558.1|  PREDICTED: phenylalanine ammonia-lyase             300   2e-93    Solanum lycopersicum
gb|ACR56688.1|  phenylalanine ammonia-lyase                             300   3e-93    Scutellaria viscidula [zhan mao huang qin]
gb|ADN32767.1|  phenylalanine ammonia-lyase 1                           299   3e-93    Scutellaria baicalensis [Baikal skullcap]
gb|AAK84225.1|AF401636_1  phenylalanine ammonia-lyase                   298   1e-92    Rehmannia glutinosa [Chinese foxglove]
emb|CBJ23826.1|  phenylalanine ammonia-lyase                            297   2e-92    Melissa officinalis [sweet balm]
ref|XP_011094662.1|  PREDICTED: phenylalanine ammonia-lyase             296   7e-92    Sesamum indicum [beniseed]
ref|XP_004497516.1|  PREDICTED: phenylalanine ammonia-lyase-like        295   1e-91    Cicer arietinum [garbanzo]
gb|ABD73282.1|  phenylalanine ammonia-lyase                             295   1e-91    Salvia miltiorrhiza [Chinese salvia]
gb|AHZ31605.1|  phenylalanine ammonia-lyase                             295   2e-91    Olea europaea
ref|XP_010262867.1|  PREDICTED: phenylalanine ammonia-lyase             295   2e-91    Nelumbo nucifera [Indian lotus]
gb|ADN32768.1|  phenylalanine ammonia-lyase 2                           294   2e-91    Scutellaria baicalensis [Baikal skullcap]
gb|AGW27206.1|  phenylalanine ammonia-lyase 3                           295   2e-91    Salvia miltiorrhiza [Chinese salvia]
gb|AFK43896.1|  unknown                                                 285   3e-91    Medicago truncatula
ref|XP_007162754.1|  hypothetical protein PHAVU_001G1777001g            286   3e-91    Phaseolus vulgaris [French bean]
ref|XP_010253912.1|  PREDICTED: phenylalanine ammonia-lyase             294   3e-91    Nelumbo nucifera [Indian lotus]
gb|ABR14606.1|  phenylalanine ammonia-lyase                             294   3e-91    Salvia miltiorrhiza [Chinese salvia]
ref|XP_002519521.1|  Phenylalanine ammonia-lyase, putative              294   4e-91    Ricinus communis
gb|AFF60415.1|  phenylalanine ammonia lyase                             291   6e-91    Pyrus pyrifolia [sha li]
gb|ABE03772.1|  phenylalanine ammonia-lyase                             293   7e-91    Arnebia euchroma
gb|KDP29132.1|  hypothetical protein JCGZ_16521                         293   8e-91    Jatropha curcas
ref|XP_009629066.1|  PREDICTED: phenylalanine ammonia-lyase             293   8e-91    Nicotiana tomentosiformis
gb|AEH02821.1|  phenylalanine ammonia lyase                             293   9e-91    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ABI33979.1|  phenylalanine ammonia lyase                             293   1e-90    Jatropha curcas
sp|O49835.1|PAL1_LITER  RecName: Full=Phenylalanine ammonia-lyase...    293   1e-90    Lithospermum erythrorhizon
gb|AGY49231.1|  phenylalanine ammonia lyase                             293   1e-90    Ricinus communis
gb|ABG75911.1|  phenylalanine ammonia-lyase 2                           293   1e-90    Nicotiana attenuata
emb|CAL91170.1|  phenylalanine ammonia-lyase 3                          279   1e-90    Cynara cardunculus var. scolymus [artichoke]
gb|AJO53274.1|  phenylalanine ammonia-lyase                             292   2e-90    Pogostemon cablin
sp|O23924.1|PALY_DIGLA  RecName: Full=Phenylalanine ammonia-lyase       292   2e-90    Digitalis lanata [Grecian foxglove]
ref|XP_009766905.1|  PREDICTED: phenylalanine ammonia-lyase             292   2e-90    Nicotiana sylvestris
gb|AEO92028.1|  phenylalanine ammonia-lyase 2                           292   2e-90    Coffea canephora [robusta coffee]
gb|ABQ63094.1|  phenylalanine ammonia-lyase                             291   3e-90    Astragalus membranaceus
gb|AGL50914.1|  phenylalanine ammonia lyase                             291   3e-90    Pyrus communis
ref|XP_009342990.1|  PREDICTED: phenylalanine ammonia-lyase 1           291   3e-90    
gb|AAX84839.1|  phenylalanine ammonia-lyase                             291   4e-90    Astragalus mongholicus
gb|KJB16792.1|  hypothetical protein B456_002G248000                    291   4e-90    Gossypium raimondii
gb|AFG30054.1|  phenylalanine ammonialyase                              291   5e-90    Malus hybrid cultivar
gb|AER12109.1|  PAL                                                     291   5e-90    Gossypium hirsutum [American cotton]
ref|XP_008387584.1|  PREDICTED: phenylalanine ammonia-lyase 1           291   5e-90    
gb|ABD42947.1|  phenylalanine ammonia lyase                             291   5e-90    Acacia auriculiformis x Acacia mangium
gb|AEM63671.1|  phenylalanine ammonia lyase 2                           291   5e-90    Platycodon grandiflorus [balloon-flower]
gb|AIL23235.1|  phenylalanine ammonia-lyase                             291   6e-90    Astragalus chrysochlorus
gb|AEZ67457.1|  phenylalanine ammonia-lyase                             290   7e-90    Perilla frutescens [beefsteak-mint]
gb|ADF59061.1|  phenylalanine ammonia-lyase 1 precursor                 290   8e-90    Pyrus x bretschneideri [bai li]
ref|XP_006354339.1|  PREDICTED: phenylalanine ammonia-lyase-like        290   9e-90    Solanum tuberosum [potatoes]
gb|AEL21617.1|  phenylalanine ammonia lyase 2                           290   1e-89    Coffea arabica [arabica coffee]
sp|O49836.1|PAL2_LITER  RecName: Full=Phenylalanine ammonia-lyase...    290   1e-89    Lithospermum erythrorhizon
ref|XP_006364021.1|  PREDICTED: phenylalanine ammonia-lyase-like        290   2e-89    Solanum tuberosum [potatoes]
dbj|BAA31258.1|  phenylalanine ammonia-lyase                            278   2e-89    Vitis vinifera
sp|P45728.1|PAL2_PETCR  RecName: Full=Phenylalanine ammonia-lyase 2     289   2e-89    Petroselinum crispum
ref|XP_004246649.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    289   2e-89    Solanum lycopersicum
ref|XP_004246650.1|  PREDICTED: phenylalanine ammonia-lyase-like        289   3e-89    
gb|AFP24940.1|  phenylalanine ammonia lyase                             289   3e-89    Prunus salicina [Japanese plum]
gb|AEZ01784.1|  phenylalanine ammonia-lyase                             289   3e-89    Pyrus x bretschneideri [bai li]
ref|XP_004246651.1|  PREDICTED: phenylalanine ammonia-lyase             289   3e-89    
gb|ABB70117.2|  phenylalanine ammonia lyase                             289   3e-89    Pyrus communis
sp|P26600.1|PAL5_SOLLC  RecName: Full=Phenylalanine ammonia-lyase...    289   3e-89    Solanum lycopersicum
gb|AGL81344.1|  phenylalanine ammonia lyase                             289   3e-89    Pyrus communis
sp|O64963.1|PAL1_PRUAV  RecName: Full=Phenylalanine ammonia-lyase 1     289   3e-89    Prunus avium [gean]
ref|XP_007208432.1|  hypothetical protein PRUPE_ppa002099mg             289   3e-89    Prunus persica
gb|AAK15640.1|AF326116_1  phenylalanine ammonia-lyase                   289   3e-89    Agastache rugosa
ref|XP_009794410.1|  PREDICTED: phenylalanine ammonia-lyase-like        288   5e-89    Nicotiana sylvestris
gb|KHG04887.1|  Phenylalanine ammonia-lyase                             288   5e-89    Gossypium arboreum [tree cotton]
ref|XP_008355619.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    288   6e-89    
gb|ACF94716.1|  phenylalanine ammonia lyase                             288   6e-89    Robinia pseudoacacia [black locust]
dbj|BAF36971.1|  phenylalanine ammonia-lyase                            288   8e-89    Lotus japonicus
ref|XP_007027354.1|  PHE ammonia lyase 1                                288   8e-89    Theobroma cacao [chocolate]
sp|O04058.2|PALY_HELAN  RecName: Full=Phenylalanine ammonia-lyase       286   8e-89    Helianthus annuus
gb|ACT53398.1|  phenylalanine ammonia-lyase 1                           288   8e-89    Ageratina adenophora
ref|XP_008369679.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      288   9e-89    
pdb|1W27|A  Chain A, Phenylalanine Ammonia-Lyase (Pal) From Petro...    288   1e-88    Petroselinum crispum
gb|ACF17667.1|  putative phenylalanine ammonia-lyase                    288   1e-88    Capsicum annuum
gb|AIA66448.1|  PAL1                                                    288   1e-88    Capsicum annuum
gb|AHZ30594.1|  phenylalanine ammonia lyase-2                           287   1e-88    Prunus domestica
sp|P24481.1|PAL1_PETCR  RecName: Full=Phenylalanine ammonia-lyase 1     287   1e-88    Petroselinum crispum
gb|KHG18863.1|  Phenylalanine ammonia-lyase                             287   1e-88    Gossypium arboreum [tree cotton]
ref|XP_006364022.1|  PREDICTED: phenylalanine ammonia-lyase-like        287   1e-88    Solanum tuberosum [potatoes]
gb|KJB36583.1|  hypothetical protein B456_006G166000                    287   2e-88    Gossypium raimondii
ref|XP_008243955.1|  PREDICTED: phenylalanine ammonia-lyase 1           287   2e-88    Prunus mume [ume]
dbj|BAE71252.1|  putative phenylalanine ammonia lyase                   287   2e-88    Trifolium pratense [peavine clover]
gb|AAZ29733.1|  phenylalanine ammonia lyase                             287   2e-88    Trifolium pratense [peavine clover]
ref|XP_003521397.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      287   2e-88    
sp|P27991.1|PAL1_SOYBN  RecName: Full=Phenylalanine ammonia-lyase 1     287   2e-88    Glycine max [soybeans]
gb|AIA24411.1|  phenylalanine ammonia-lyase                             286   2e-88    Sinopodophyllum hexandrum [Himalayan mayapple]
dbj|BAC56977.1|  phenylalanine ammonia-lyase                            286   2e-88    Daucus carota [carrots]
gb|KGN52975.1|  hypothetical protein Csa_4G008780                       285   2e-88    
ref|XP_006354336.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    286   3e-88    
ref|XP_006354337.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    286   3e-88    Solanum tuberosum [potatoes]
gb|AGT63063.1|  phenylalanine ammonia-lyase                             286   3e-88    Solanum tuberosum [potatoes]
gb|AHY94892.1|  phenylalanine ammonia lyase                             286   4e-88    Prunella vulgaris
ref|XP_004304440.1|  PREDICTED: phenylalanine ammonia-lyase 1           286   4e-88    Fragaria vesca subsp. vesca
gb|AGU91428.1|  phenylalanine ammonia-lyase                             286   4e-88    Chrysanthemum boreale
ref|XP_004156293.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    286   4e-88    
gb|KGN52973.1|  hypothetical protein Csa_4G008760                       278   4e-88    
ref|XP_004143256.1|  PREDICTED: phenylalanine ammonia-lyase-like        286   5e-88    
gb|AJO53273.1|  phenylalanine ammonia-lyase                             286   5e-88    Pogostemon cablin
ref|XP_002281799.1|  PREDICTED: phenylalanine ammonia-lyase             286   5e-88    Vitis vinifera
ref|XP_003554382.1|  PREDICTED: phenylalanine ammonia-lyase 1-lik...    285   7e-88    
ref|XP_006424540.1|  hypothetical protein CICLE_v10027912mg             285   7e-88    Citrus clementina [clementine]
ref|XP_004143356.1|  PREDICTED: phenylalanine ammonia-lyase-like        285   7e-88    
ref|XP_004143258.1|  PREDICTED: phenylalanine ammonia-lyase-like        285   8e-88    Cucumis sativus [cucumbers]
gb|KGN48164.1|  hypothetical protein Csa_6G445770                       285   8e-88    
gb|KGN52974.1|  hypothetical protein Csa_4G008770                       282   8e-88    
ref|XP_009373523.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    285   8e-88    Pyrus x bretschneideri [bai li]
ref|XP_004234632.2|  PREDICTED: phenylalanine ammonia-lyase             285   1e-87    
ref|XP_003590471.1|  Phenylalanine ammonia-lyase                        285   1e-87    Medicago truncatula
sp|P45729.1|PAL3_PETCR  RecName: Full=Phenylalanine ammonia-lyase 3     285   1e-87    Petroselinum crispum
emb|CBI31445.3|  unnamed protein product                                281   1e-87    Vitis vinifera
emb|CAL91169.1|  phenylalanine ammonia-lyase 3                          285   1e-87    Cynara cardunculus var. scolymus [artichoke]
gb|AGV54597.1|  phenylalanine ammonia-lyase                             285   1e-87    Phaseolus vulgaris [French bean]
gb|KHG29664.1|  Phenylalanine ammonia-lyase                             285   1e-87    Gossypium arboreum [tree cotton]
ref|XP_007162756.1|  hypothetical protein PHAVU_001G177800g             285   2e-87    Phaseolus vulgaris [French bean]
dbj|BAG31930.1|  phenylalanine ammonia-lyase                            284   2e-87    Daucus carota [carrots]
ref|XP_002531677.1|  Phenylalanine ammonia-lyase, putative              284   2e-87    Ricinus communis
emb|CDY18463.1|  BnaA04g21240D                                          271   3e-87    Brassica napus [oilseed rape]
gb|AAR31107.1|  phenylalanine ammonia-lyase                             283   3e-87    Quercus suber [cork oak]
ref|XP_009606373.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     284   3e-87    Nicotiana tomentosiformis
gb|AEV53411.1|  phenylalanine ammonia-lyase 3                           284   3e-87    Populus tomentosa [Chinese white poplar]
emb|CAA44609.1|  phenylalanine ammonia-lyase                            270   3e-87    Arabidopsis thaliana [mouse-ear cress]
gb|AEC11891.1|  PAL1                                                    283   3e-87    Petunia exserta
gb|AAV98199.1|  phenylalanine ammonialyase 1                            283   3e-87    Petunia x hybrida [garden petunia]
ref|XP_008449239.1|  PREDICTED: phenylalanine ammonia-lyase-like        283   4e-87    Cucumis melo [Oriental melon]
gb|AHA42445.1|  phenylalanine ammonia lyase                             279   4e-87    Cannabis sativa
ref|XP_003521396.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      283   4e-87    
ref|XP_004143257.1|  PREDICTED: phenylalanine ammonia-lyase-like        283   4e-87    
ref|XP_006424538.1|  hypothetical protein CICLE_v10027913mg             283   5e-87    Citrus clementina [clementine]
gb|AAL55242.1|AF299330_1  phenylalanine ammonia-lyase                   283   5e-87    Lactuca sativa [cultivated lettuce]
ref|XP_008449237.1|  PREDICTED: phenylalanine ammonia-lyase-like        283   5e-87    Cucumis melo [Oriental melon]
gb|AFN85669.1|  phenylalanine ammonia-lyase                             283   5e-87    Hibiscus cannabinus [bimli-jute]
gb|ABL14040.1|  phenylalanine ammonia lyase                             270   6e-87    Astragalus mongholicus
dbj|BAO01110.1|  phenylalanine ammonia-lyase                            283   6e-87    Vigna radiata [mung bean]
gb|AEX32784.1|  phenylalanine ammonia-lyase                             283   6e-87    Vitis vinifera
ref|XP_002268181.1|  PREDICTED: phenylalanine ammonia-lyase             283   7e-87    Vitis vinifera
gb|AAN52280.1|AF480620_1  phenylalanine ammonia-lyase                   283   7e-87    Populus tremuloides
gb|ACT53399.1|  phenylalanine ammonia-lyase 2                           283   8e-87    Ageratina adenophora
ref|XP_009759945.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     283   8e-87    Nicotiana sylvestris
gb|AIB06732.1|  phenylalanine ammonia lyase                             282   9e-87    Mangifera indica
ref|XP_008454139.1|  PREDICTED: phenylalanine ammonia-lyase-like        282   9e-87    Cucumis melo [Oriental melon]
gb|AER58180.1|  phenylalanine ammonia lyase                             282   9e-87    Cucumis sativus [cucumbers]
ref|XP_004152155.1|  PREDICTED: phenylalanine ammonia-lyase-like        282   1e-86    
ref|XP_008449240.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      282   1e-86    Cucumis melo [Oriental melon]
ref|XP_004152158.1|  PREDICTED: phenylalanine ammonia-lyase-like        282   1e-86    
gb|ABM67591.1|  phenylalanin ammonia-lyase                              282   1e-86    Vitis vinifera
gb|ADO64252.1|  PAL                                                     282   1e-86    Epimedium sagittatum
gb|AFZ78651.1|  phenylalanine ammonia-lyase                             282   1e-86    Populus tomentosa [Chinese white poplar]
gb|AID51445.1|  phenylalanine ammonia-lyase 2                           282   1e-86    Astragalus membranaceus
sp|P35511.1|PAL1_SOLLC  RecName: Full=Phenylalanine ammonia-lyase...    281   1e-86    Solanum lycopersicum
ref|XP_009596642.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     282   1e-86    Nicotiana tomentosiformis
ref|XP_006436446.1|  hypothetical protein CICLE_v10030821mg             282   1e-86    Citrus clementina [clementine]
ref|XP_002268732.1|  PREDICTED: phenylalanine ammonia-lyase             281   2e-86    Vitis vinifera
sp|Q01861.1|PAL1_PEA  RecName: Full=Phenylalanine ammonia-lyase 1       282   2e-86    Pisum sativum [garden pea]
prf||2001451A  Phe ammonia lyase                                        282   2e-86    Pisum sativum [garden pea]
sp|Q42667.1|PALY_CITLI  RecName: Full=Phenylalanine ammonia-lyase       281   2e-86    Citrus limon [lemon]
gb|KDO46246.1|  hypothetical protein CISIN_1g004955mg                   281   2e-86    Citrus sinensis [apfelsine]
ref|XP_010658395.1|  PREDICTED: phenylalanine ammonia-lyase G1          281   2e-86    Vitis vinifera
ref|XP_008449238.1|  PREDICTED: phenylalanine ammonia-lyase             281   2e-86    Cucumis melo [Oriental melon]
ref|XP_002268256.1|  PREDICTED: phenylalanine ammonia-lyase             281   3e-86    Vitis vinifera
dbj|BAJ17655.1|  phenylalanine ammonia lyase                            281   3e-86    Gynura bicolor
ref|XP_003633986.1|  PREDICTED: phenylalanine ammonia-lyase-like        281   3e-86    Vitis vinifera
gb|EYU34451.1|  hypothetical protein MIMGU_mgv1a002104mg                281   3e-86    Erythranthe guttata [common monkey flower]
gb|KGN48162.1|  hypothetical protein Csa_6G445750                       281   3e-86    
ref|XP_004143255.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      281   3e-86    Cucumis sativus [cucumbers]
gb|AEA72280.1|  phenylalanine ammonia-lyase                             280   3e-86    Angelica gigas
ref|XP_006354338.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    281   4e-86    Solanum tuberosum [potatoes]
ref|XP_007009873.1|  Phenylalanine ammonia-lyase 2                      280   5e-86    
gb|KEH24019.1|  phenylalanine ammonia-lyase-like protein                281   5e-86    Medicago truncatula
ref|XP_004246652.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    280   5e-86    
gb|KHG30005.1|  Phenylalanine ammonia-lyase                             280   5e-86    Gossypium arboreum [tree cotton]
gb|ACT21093.1|  phenylalanine ammonia-lyase                             280   6e-86    Camellia oleifera [abura-tsubaki]
gb|AAK60275.1|AF383152_1  phenylalanine ammonia-lyase 2                 280   6e-86    Manihot esculenta [manioc]
emb|CBI26455.3|  unnamed protein product                                280   6e-86    Vitis vinifera
gb|KDP44384.1|  hypothetical protein JCGZ_20064                         280   6e-86    Jatropha curcas
ref|XP_003633987.1|  PREDICTED: phenylalanine ammonia-lyase-like        280   7e-86    Vitis vinifera
dbj|BAF36970.1|  phenylalanine ammonia-lyase                            280   7e-86    Lotus japonicus
ref|XP_010325983.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    280   7e-86    
gb|KJB62426.1|  hypothetical protein B456_009G416300                    280   8e-86    Gossypium raimondii
gb|KJB46525.1|  hypothetical protein B456_007G373600                    280   9e-86    Gossypium raimondii
ref|XP_003635657.2|  PREDICTED: phenylalanine ammonia-lyase-like        280   9e-86    Vitis vinifera
ref|XP_002322884.2|  phenylalanine ammonia-lyase family protein         280   1e-85    Populus trichocarpa [western balsam poplar]
gb|AHA42443.1|  phenylalanine ammonia lyase                             280   1e-85    Cannabis sativa
ref|XP_002312013.1|  phenylalanine ammonia-lyase family protein         279   1e-85    Populus trichocarpa [western balsam poplar]
gb|AFZ78650.1|  phenylalanine ammonia-lyase                             279   1e-85    Populus tomentosa [Chinese white poplar]
gb|AAF40224.1|AF237955_1  phenylalanine ammonia-lyase 2                 280   1e-85    Rubus idaeus [European raspberry]
ref|XP_011031723.1|  PREDICTED: phenylalanine ammonia-lyase G4          279   2e-85    Populus euphratica
ref|XP_006381441.1|  phenylalanine ammonia-lyase family protein         279   2e-85    Populus trichocarpa [western balsam poplar]
ref|XP_010662075.1|  PREDICTED: phenylalanine ammonia-lyase             279   2e-85    Vitis vinifera
gb|AAA34179.2|  phenylalanine ammonia lyase                             279   2e-85    Solanum lycopersicum
gb|ACT32033.1|  phenylalanine ammonia-lyase                             279   2e-85    Glycine soja [wild soybean]
dbj|BAF36968.1|  phenylalanine ammonia-lyase                            278   2e-85    Lotus japonicus
ref|XP_008454138.1|  PREDICTED: phenylalanine ammonia-lyase-like        278   3e-85    Cucumis melo [Oriental melon]
gb|ACS71953.1|  phenylalanine ammonia-lyase                             278   3e-85    Euphorbia pulcherrima
gb|ACM44926.1|  phenylalanine ammonia-lyase                             278   3e-85    Euphorbia pulcherrima
gb|AJO53272.1|  phenylalanine ammonia-lyase                             278   3e-85    Pogostemon cablin
sp|O23865.1|PAL1_DAUCA  RecName: Full=Phenylalanine ammonia-lyase 1     278   3e-85    Daucus carota [carrots]
ref|XP_004156289.1|  PREDICTED: phenylalanine ammonia-lyase-like        278   3e-85    
gb|AEX32790.1|  phenylalanine ammonia-lyase                             278   3e-85    Vitis vinifera
dbj|BAF36967.1|  phenylalanine ammonia-lyase                            278   4e-85    Lotus japonicus
sp|P45732.1|PALY_STYHU  RecName: Full=Phenylalanine ammonia-lyase       278   4e-85    Stylosanthes humilis [alfafinha do nordeste]
emb|CAN77065.1|  hypothetical protein VITISV_009233                     278   4e-85    Vitis vinifera
sp|P45730.1|PALY_POPTR  RecName: Full=Phenylalanine ammonia-lyase       278   4e-85    Populus trichocarpa [western balsam poplar]
ref|XP_004143259.1|  PREDICTED: phenylalanine ammonia-lyase-like        278   5e-85    
gb|ACC63889.1|  phenylalanine ammonia-lyase                             278   5e-85    Populus trichocarpa [western balsam poplar]
ref|XP_008454137.1|  PREDICTED: phenylalanine ammonia-lyase-like        278   5e-85    Cucumis melo [Oriental melon]
ref|XP_002315308.1|  phenylalanine ammonia-lyase family protein         278   6e-85    Populus trichocarpa [western balsam poplar]
gb|AJR20994.1|  phenylalanine ammonia-lyase                             278   6e-85    Populus szechuanica
ref|XP_008449236.1|  PREDICTED: phenylalanine ammonia-lyase-like        277   6e-85    Cucumis melo [Oriental melon]
gb|ADD12041.1|  phenylalanine ammonia lyase                             277   7e-85    Cistanche deserticola
gb|KEH24018.1|  phenylalanine ammonia-lyase-like protein                278   7e-85    Medicago truncatula
gb|AAN52279.1|AF480619_1  phenylalanine ammonia-lyase                   277   1e-84    Populus tremuloides
ref|XP_011041025.1|  PREDICTED: phenylalanine ammonia-lyase G2B         277   1e-84    Populus euphratica
ref|XP_003633985.1|  PREDICTED: phenylalanine ammonia-lyase-like        277   1e-84    Vitis vinifera
ref|XP_011048535.1|  PREDICTED: phenylalanine ammonia-lyase-like        277   1e-84    Populus euphratica
gb|AGH13333.1|  phenylalanine ammonia-lyase                             276   1e-84    Rhus chinensis
ref|NP_001236956.1|  phenylalanine ammonia-lyase 2                      276   2e-84    
emb|CAL91037.1|  phenylalanine ammonia-lyase 1                          276   2e-84    Cynara cardunculus var. scolymus [artichoke]
gb|AFU90757.1|  phenylalanine ammonia-lyase                             276   2e-84    Epimedium sagittatum
ref|XP_003542541.1|  PREDICTED: phenylalanine ammonia-lyase class...    276   2e-84    
gb|AFJ80777.1|  phenylalanine ammonia-lyase                             276   2e-84    Camellia japonica [common camellia]
ref|XP_002267953.1|  PREDICTED: phenylalanine ammonia-lyase             276   2e-84    Vitis vinifera
sp|P45734.1|PALY_TRISU  RecName: Full=Phenylalanine ammonia-lyase       276   3e-84    Trifolium subterraneum
sp|Q43052.1|PAL2_POPKI  RecName: Full=Phenylalanine ammonia-lyase...    276   3e-84    Populus sieboldii x Populus grandidentata
gb|AEJ88223.1|  phenylalanine ammonia lyase                             276   3e-84    Prunus persica
gb|AAZ29735.1|  phenylalanine ammonia lyase                             276   3e-84    Trifolium pratense [peavine clover]
gb|ACE95170.1|  phenylalanine ammonia-lyase                             276   3e-84    Populus tomentosa [Chinese white poplar]
sp|Q9M568.1|PAL1_RUBID  RecName: Full=Phenylalanine ammonia-lyase...    275   3e-84    Rubus idaeus [European raspberry]
ref|XP_007144370.1|  hypothetical protein PHAVU_007G150500g             275   4e-84    Phaseolus vulgaris [French bean]
gb|ACM62741.1|  phenylalanine ammonia-lyase                             275   4e-84    Garcinia mangostana [mangosteen]
gb|AGE10589.1|  phenylalanine amononia-lyase                            275   5e-84    Lonicera japonica [Japanese honeysuckle]
ref|XP_004493977.1|  PREDICTED: phenylalanine ammonia-lyase-like        275   5e-84    Cicer arietinum [garbanzo]
ref|XP_006488063.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      275   7e-84    Citrus sinensis [apfelsine]
gb|ACR15762.1|  phenylalanine ammonia-lyase                             275   7e-84    Litchi chinensis [litchi]
gb|ABI93975.1|  putative phenylalanine ammonia-lyase                    271   7e-84    Rhizophora mangle
sp|P31425.1|PAL1_SOLTU  RecName: Full=Phenylalanine ammonia-lyase 1     275   8e-84    Solanum tuberosum [potatoes]
dbj|BAA21643.1|  phenylalanine ammonia-lyase                            275   8e-84    Populus sieboldii x Populus grandidentata
ref|XP_011010447.1|  PREDICTED: phenylalanine ammonia-lyase             275   9e-84    Populus euphratica
gb|AFZ78653.1|  phenylalanine ammonia-lyase                             275   9e-84    Populus tomentosa [Chinese white poplar]
sp|P31426.1|PAL2_SOLTU  RecName: Full=Phenylalanine ammonia-lyase 2     271   1e-83    Solanum tuberosum [potatoes]
gb|AAK60274.1|AF383151_1  phenylalanine ammonia-lyase 1                 273   1e-83    Manihot esculenta [manioc]
gb|AAZ29732.1|  phenylalanine ammonia lyase                             274   2e-83    Trifolium pratense [peavine clover]
gb|AAK62030.1|  phenylalanine ammonia-lyase 1                           274   2e-83    Manihot esculenta [manioc]
gb|AAZ29734.1|  phenylalanine ammonia lyase                             274   2e-83    Trifolium pratense [peavine clover]
sp|P45726.1|PALY_CAMSI  RecName: Full=Phenylalanine ammonia-lyase       273   2e-83    Camellia sinensis [black tea]
gb|AAQ74878.1|  phenylalanine ammonia lyase                             273   2e-83    Populus trichocarpa x Populus deltoides
gb|ABN79671.2|  phenylalanine ammonia-lyase                             273   2e-83    Rudbeckia hirta
gb|AAW78932.1|  phenylalanine-ammonia lyase                             272   6e-83    Rhodiola sachalinensis
ref|XP_010553331.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      272   7e-83    Tarenaya hassleriana [spider flower]
gb|AGE10591.1|  phenylalanine amononia-lyase                            272   7e-83    Lonicera japonica [Japanese honeysuckle]
sp|Q04593.1|PAL2_PEA  RecName: Full=Phenylalanine ammonia-lyase 2       272   7e-83    Pisum sativum [garden pea]
gb|ADY02661.1|  phenylalanine ammonia lyase                             271   8e-83    Parrya nudicaulis
gb|ADY02660.1|  phenylalanine ammonia lyase                             271   1e-82    Parrya nudicaulis
dbj|BAF36974.1|  phenylalanine ammonia-lyase                            271   1e-82    Lotus japonicus
emb|CDO99754.1|  unnamed protein product                                270   1e-82    Coffea canephora [robusta coffee]
gb|ADY02662.1|  phenylalanine ammonia lyase                             271   1e-82    Parrya nudicaulis
ref|XP_010528074.1|  PREDICTED: phenylalanine ammonia-lyase 1           271   1e-82    Tarenaya hassleriana [spider flower]
ref|XP_008233304.1|  PREDICTED: phenylalanine ammonia-lyase 1           271   1e-82    Prunus mume [ume]
ref|XP_004145752.1|  PREDICTED: phenylalanine ammonia-lyase-like        271   2e-82    Cucumis sativus [cucumbers]
sp|P19142.1|PAL2_PHAVU  RecName: Full=Phenylalanine ammonia-lyase...    271   2e-82    Phaseolus vulgaris [French bean]
prf||2006271A  Phe ammonia lyase                                        271   2e-82    Trifolium subterraneum
gb|ACA30407.1|  phenylalanine ammonia-lyase                             271   2e-82    Stylosanthes guianensis [stylo]
ref|XP_006481493.1|  PREDICTED: phenylalanine ammonia-lyase-like        271   2e-82    Citrus sinensis [apfelsine]
gb|AAW51923.2|  phenylalanine ammonia-lyase 2                           271   3e-82    Rhizophora mangle
ref|NP_181241.1|  phenylalanine ammonia-lyase 1                         271   3e-82    
gb|AAC18870.1|  phenylalanine ammonia lyase                             271   3e-82    
gb|AEE81750.1|  phenylalanine ammonia lyase                             270   4e-82    
gb|AAM12956.1|  phenylalanine ammonia-lyase                             270   4e-82    
gb|ABC69916.1|  phenylalanine ammonia-lyase                             270   5e-82    
gb|AEO92029.1|  phenylalanine ammonia-lyase 3                           270   5e-82    
gb|ABY89690.1|  phenylalanine ammonialyase 1 protein                    270   5e-82    
gb|AAU08174.1|  phenylalanine ammonia-lyase                             270   5e-82    
ref|XP_009141625.1|  PREDICTED: phenylalanine ammonia-lyase 1           270   5e-82    
ref|XP_006428758.1|  hypothetical protein CICLE_v10011134mg             271   5e-82    
gb|AFP49806.1|  phenylalanine ammonialyase 1                            270   6e-82    
gb|AEL21616.1|  phenylalanine ammonia lyase 1                           270   6e-82    
gb|ADN32766.1|  phenylalanine ammonia-lyase                             270   7e-82    
gb|AFI71896.1|  phenylalanine ammonia-lyase                             270   7e-82    
gb|KJB73539.1|  hypothetical protein B456_011G238400                    269   8e-82    
ref|XP_004173912.1|  PREDICTED: phenylalanine ammonia-lyase-like        256   8e-82    
ref|XP_008785254.1|  PREDICTED: phenylalanine ammonia-lyase-like        269   9e-82    
gb|KHG26972.1|  Phenylalanine ammonia-lyase                             269   9e-82    
gb|AID16077.1|  phenylalanine ammonium lyase                            269   1e-81    
ref|XP_009143533.1|  PREDICTED: phenylalanine ammonia-lyase 1           269   1e-81    
emb|CAB42793.1|  phenylalanine-ammonia lyase                            269   1e-81    
ref|XP_011041027.1|  PREDICTED: phenylalanine ammonia-lyase G2B-l...    268   1e-81    
gb|KDO50673.1|  hypothetical protein CISIN_1g005031mg                   269   1e-81    
ref|XP_010107520.1|  Phenylalanine ammonia-lyase                        269   2e-81    
gb|ABY89691.1|  phenylalanine ammonialyase 2 protein                    269   2e-81    
ref|XP_006428759.1|  hypothetical protein CICLE_v10011175mg             268   2e-81    
ref|XP_002881488.1|  hypothetical protein ARALYDRAFT_482690             269   2e-81    
gb|AAC18871.1|  phenylalanine ammonia lyase                             268   2e-81    
ref|NP_190894.1|  phenylalanine ammonia-lyase 2                         268   2e-81    
gb|ADA81868.1|  phenylalanine ammonia-lyase                             268   2e-81    
ref|XP_006293761.1|  hypothetical protein CARUB_v10022721mg             268   2e-81    
gb|AFG26322.1|  phenylalanine ammonia-lyase                             268   2e-81    
ref|XP_010516949.1|  PREDICTED: phenylalanine ammonia-lyase 1           268   3e-81    
gb|ABC69917.1|  phenylalanine ammonia-lyase                             268   3e-81    
gb|AFP86474.1|  phenylalanine ammonia-lyase                             268   3e-81    
gb|AFP49807.1|  phenylalanine ammonialyase 4                            268   4e-81    
ref|XP_010505261.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      268   4e-81    
ref|XP_010529727.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      268   4e-81    
gb|KFK36594.1|  hypothetical protein AALP_AA4G144000                    268   4e-81    
ref|XP_008463969.1|  PREDICTED: phenylalanine ammonia-lyase-like        267   5e-81    
ref|XP_010509401.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      268   5e-81    
ref|XP_002877909.1|  phenylalanine ammonia-lyase 2                      267   6e-81    
gb|ADT63058.1|  phenylalanine ammonia-lyase                             267   6e-81    
dbj|BAF36972.1|  phenylalanine ammonia-lyase                            266   6e-81    
ref|XP_009103852.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      267   7e-81    
ref|XP_002285277.1|  PREDICTED: phenylalanine ammonia-lyase             266   1e-80    
ref|XP_010515816.1|  PREDICTED: phenylalanine ammonia-lyase 2           266   1e-80    
emb|CDY66761.1|  BnaCnng52250D                                          261   1e-80    
emb|CDX76219.1|  BnaA04g04830D                                          261   1e-80    
ref|XP_009392118.1|  PREDICTED: phenylalanine ammonia-lyase-like        266   1e-80    
dbj|BAG70992.1|  phenylalanine ammonia-lyase                            266   2e-80    
gb|ACG56648.1|  phenylalanine ammonia lyase                             265   2e-80    
ref|XP_007220629.1|  hypothetical protein PRUPE_ppa002328mg             263   2e-80    
sp|P27990.1|PALY_MEDSA  RecName: Full=Phenylalanine ammonia-lyase       266   3e-80    
gb|ACG56647.1|  phenylalanine ammonia lyase                             265   3e-80    
ref|XP_003556238.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      265   3e-80    
ref|XP_008449235.1|  PREDICTED: phenylalanine ammonia-lyase-like        265   3e-80    
ref|XP_010504083.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      265   4e-80    
ref|XP_006410883.1|  hypothetical protein EUTSA_v10016314mg             265   4e-80    
gb|KCW65428.1|  hypothetical protein EUGRSUZ_G02848                     265   4e-80    
ref|XP_010067315.1|  PREDICTED: phenylalanine ammonia-lyase             265   4e-80    
gb|ADQ39192.1|  phenylalanine ammonia lyase 6                           265   5e-80    
ref|XP_010426963.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      265   6e-80    
gb|ACZ44834.1|  phenylalanine ammonia-lyase                             264   7e-80    
ref|XP_006290660.1|  hypothetical protein CARUB_v10016752mg             264   7e-80    
ref|XP_008366650.1|  PREDICTED: phenylalanine ammonia-lyase 1           264   8e-80    
ref|XP_007220630.1|  hypothetical protein PRUPE_ppa002328mg             263   9e-80    
gb|ABF50788.1|  phenylalanine ammonia-lyase                             264   9e-80    
gb|ADF59062.1|  phenylalanine ammonia-lyase 2 precursor                 264   1e-79    
gb|AHB18375.1|  phenylalanine ammonia-lyase 3                           262   1e-79    
gb|ADI40166.1|  phenylalanine ammonia-lyase                             264   1e-79    
emb|CAN61378.1|  hypothetical protein VITISV_032212                     263   1e-79    
ref|XP_004307376.1|  PREDICTED: phenylalanine ammonia-lyase 1           263   2e-79    
emb|CAB42794.1|  phenylalanine-ammonia lyase                            263   3e-79    
ref|XP_010067318.1|  PREDICTED: phenylalanine ammonia-lyase             262   4e-79    
dbj|BAL49995.1|  phenylalanine ammonia-lyase                            262   6e-79    
gb|AAX22053.1|  phenylalanine ammonia-lyase                             262   6e-79    
ref|XP_010032174.1|  PREDICTED: phenylalanine ammonia-lyase-like        262   6e-79    
gb|AID51446.1|  phenylalanine ammonia-lyase 3                           262   6e-79    
gb|AAX22055.1|  phenylalanine ammonia-lyase                             262   7e-79    
gb|AAN32866.1|AF460203_1  phenylalanine ammonia-lyase 1                 261   1e-78    
gb|KFK38414.1|  hypothetical protein AALP_AA3G110100                    261   1e-78    
gb|ADL09136.1|  phenylanlanine ammonia-lyase                            261   1e-78    
dbj|BAF36976.1|  phenylalanine ammonia-lyase                            261   1e-78    
gb|KFK38413.1|  hypothetical protein AALP_AA3G110100                    261   2e-78    
ref|XP_006403711.1|  hypothetical protein EUTSA_v10010153mg             261   2e-78    
ref|XP_010067317.1|  PREDICTED: phenylalanine ammonia-lyase-like        260   2e-78    
ref|XP_010067316.1|  PREDICTED: phenylalanine ammonia-lyase             260   2e-78    
ref|XP_004143260.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    257   3e-78    
gb|KFK34576.1|  hypothetical protein AALP_AA5G163700                    259   8e-78    
gb|ADA72014.1|  phenylalanine ammonia-lyase                             258   1e-77    
ref|XP_003591877.1|  Phenylalanine ammonia-lyase                        259   1e-77    
ref|XP_007143727.1|  hypothetical protein PHAVU_007G096300g             258   1e-77    
ref|XP_002882662.1|  hypothetical protein ARALYDRAFT_897210             258   1e-77    
ref|XP_010067319.1|  PREDICTED: phenylalanine ammonia-lyase-like        258   1e-77    
ref|XP_011077265.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    258   1e-77    
ref|NP_187645.1|  phenylalanine ammonia-lyase 4                         258   2e-77    
gb|AIZ76766.1|  PAL2                                                    251   2e-77    
gb|ACM61988.1|  phenylalanine ammonia-lyase                             258   2e-77    
ref|XP_004239660.1|  PREDICTED: phenylalanine ammonia-lyase-like        258   2e-77    
gb|KGN48167.1|  hypothetical protein Csa_6G446290                       257   3e-77    
ref|XP_006297083.1|  hypothetical protein CARUB_v10013086mg             257   3e-77    
ref|XP_006345786.1|  PREDICTED: phenylalanine ammonia-lyase-like        257   3e-77    
gb|ADQ28104.1|  phenylalanine ammonia-lyase                             257   4e-77    
gb|ADC34597.1|  phenylalanine ammonia-lyase                             257   4e-77    
gb|AHG06396.1|  phenylalanine ammonia lyase 2                           257   4e-77    
ref|XP_010543544.1|  PREDICTED: phenylalanine ammonia-lyase 4           257   4e-77    
ref|XP_008805217.1|  PREDICTED: phenylalanine ammonia-lyase             256   5e-77    
ref|XP_010935894.1|  PREDICTED: phenylalanine ammonia-lyase             256   6e-77    
ref|XP_010482945.1|  PREDICTED: phenylalanine ammonia-lyase 4-like      256   6e-77    
ref|XP_002529414.1|  Phenylalanine ammonia-lyase, putative              256   7e-77    
ref|XP_006589419.1|  PREDICTED: phenylalanine ammonia-lyase 2-lik...    256   7e-77    
gb|ACT68010.1|  phenylalanine ammonia-lyase                             256   1e-76    
ref|XP_009146849.1|  PREDICTED: phenylalanine ammonia-lyase 4           255   1e-76    
dbj|BAM28968.1|  phenylalanine ammonia lyase                            255   1e-76    
ref|XP_009384657.1|  PREDICTED: phenylalanine ammonia-lyase-like        255   2e-76    
emb|CDY00922.1|  BnaC05g42780D                                          255   2e-76    
ref|XP_006358655.1|  PREDICTED: phenylalanine ammonia-lyase-like        255   2e-76    
ref|XP_002315309.2|  hypothetical protein POPTR_0010s23110g             255   2e-76    
ref|XP_010684079.1|  PREDICTED: phenylalanine ammonia-lyase             255   2e-76    
emb|CDY08611.1|  BnaA05g28470D                                          255   2e-76    
gb|KHN09507.1|  Phenylalanine ammonia-lyase 1                           255   2e-76    
gb|ACZ51372.1|  phenylalanine ammonia-lyase                             254   3e-76    
ref|XP_008645952.1|  PREDICTED: phenylalanine ammonia-lyase             254   3e-76    
ref|XP_009116020.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    254   4e-76    
ref|XP_009401948.1|  PREDICTED: phenylalanine ammonia-lyase-like        254   4e-76    
ref|XP_004953157.1|  PREDICTED: phenylalanine ammonia-lyase-like        254   5e-76    
ref|XP_004953155.1|  PREDICTED: phenylalanine ammonia-lyase-like        253   8e-76    
ref|XP_004953156.1|  PREDICTED: phenylalanine ammonia-lyase-like        253   8e-76    
gb|AGE10590.1|  phenylalanine amononia-lyase                            253   9e-76    
ref|NP_001266106.1|  phenylalanine ammonia-lyase 2                      253   1e-75    
gb|EMT29667.1|  Phenylalanine ammonia-lyase                             241   1e-75    
ref|XP_006407581.1|  hypothetical protein EUTSA_v10020168mg             253   2e-75    
ref|XP_006407580.1|  hypothetical protein EUTSA_v10020168mg             253   2e-75    
ref|NP_001168086.1|  phenylalanine ammonia-lyase                        253   2e-75    
ref|XP_010112228.1|  Phenylalanine ammonia-lyase                        252   2e-75    
gb|AHB18376.1|  phenylalanine ammonia-lyase 4                           251   3e-75    
ref|XP_006647543.1|  PREDICTED: phenylalanine ammonia-lyase-like        251   5e-75    
ref|XP_010107518.1|  Phenylalanine ammonia-lyase                        253   5e-75    
ref|XP_009399473.1|  PREDICTED: phenylalanine ammonia-lyase             251   7e-75    
ref|XP_009413725.1|  PREDICTED: phenylalanine ammonia-lyase-like        251   7e-75    
gb|EPS61109.1|  phenylalanine ammonia-lyase                             249   1e-74    
gb|EYU39613.1|  hypothetical protein MIMGU_mgv1a019971mg                250   1e-74    
ref|XP_004976241.1|  PREDICTED: phenylalanine ammonia-lyase-like        250   2e-74    
ref|XP_011041026.1|  PREDICTED: phenylalanine ammonia-lyase G2B-l...    249   5e-74    
ref|XP_010906526.1|  PREDICTED: phenylalanine ammonia-lyase-like        248   7e-74    
ref|XP_010934327.1|  PREDICTED: phenylalanine ammonia-lyase-like        248   7e-74    
sp|Q42609.1|PALY_BROFI  RecName: Full=Phenylalanine ammonia-lyase       247   2e-73    
gb|ACZ36441.1|  phenylalanine ammonialyase                              247   2e-73    
gb|AAR19393.1|  phenylalanine ammonia-lyase                             246   2e-73    
ref|XP_007016787.1|  PHE ammonia lyase 1                                247   3e-73    
ref|NP_001047482.1|  Os02g0626400                                       246   4e-73    
gb|ADP88940.1|  phenylalanine ammonia-lyase                             229   4e-73    
dbj|BAF96940.1|  phenylalanine ammonia lyase                            239   4e-73    
gb|AIC66437.1|  phenylalanine ammonia lyase                             246   4e-73    
ref|XP_007143725.1|  hypothetical protein PHAVU_007G096100g             246   5e-73    
gb|ADA72013.1|  phenylalanine ammonia-lyase                             246   7e-73    
gb|AGZ95691.1|  phenylalanine ammonia-lyase                             244   1e-72    
emb|CAA89007.1|  phenylalanine ammonia-lyase                            241   2e-72    
ref|XP_002454200.1|  hypothetical protein SORBIDRAFT_04g026530          244   2e-72    
ref|XP_004953154.1|  PREDICTED: phenylalanine ammonia-lyase-like        243   5e-72    
ref|XP_004167356.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    243   6e-72    
ref|XP_002452479.1|  hypothetical protein SORBIDRAFT_04g026560          243   8e-72    
gb|AHG06397.1|  phenylalanine ammonia lyase 62                          241   2e-71    
ref|XP_004491627.1|  PREDICTED: phenylalanine ammonia-lyase class...    241   2e-71    
gb|AAP34199.1|  phenylalanine ammonia-lyase                             241   4e-71    
ref|XP_006846821.1|  hypothetical protein AMTR_s00148p00088930          241   4e-71    
dbj|BAJ88975.1|  predicted protein                                      241   5e-71    
gb|ADO24189.1|  phenylalanine ammonia-lyase                             240   6e-71    
ref|XP_002454199.1|  hypothetical protein SORBIDRAFT_04g026520          240   1e-70    
ref|XP_003618076.1|  Phenylalanine ammonia-lyase                        239   2e-70    
dbj|BAM28964.1|  phenylalanine ammonia lyase                            239   2e-70    
ref|XP_004171092.1|  PREDICTED: phenylalanine ammonia-lyase-like        238   3e-70    
gb|AAR24505.1|  phenylalanine ammonia-lyase                             239   3e-70    
dbj|BAM28963.1|  phenylalanine ammonia lyase                            239   3e-70    
gb|KEH39353.1|  phenylalanine ammonia-lyase-like protein                238   4e-70    
ref|XP_006354305.1|  PREDICTED: phenylalanine ammonia-lyase-like        237   5e-70    
ref|XP_008456500.1|  PREDICTED: phenylalanine ammonia-lyase G4          238   7e-70    
gb|EMT28134.1|  Phenylalanine ammonia-lyase                             238   7e-70    
ref|XP_004149916.1|  PREDICTED: phenylalanine ammonia-lyase-like        238   8e-70    
ref|XP_003575400.1|  PREDICTED: phenylalanine ammonia-lyase-like        237   1e-69    
gb|ACM47229.1|  phenylalanine ammonia-lyase                             237   1e-69    
gb|ACM45574.1|  phenylalanine ammonia-lyase                             236   2e-69    
gb|KJB46526.1|  hypothetical protein B456_007G373700                    236   2e-69    
ref|NP_001055608.1|  Os05g0427400                                       236   2e-69    
gb|ACM45590.1|  phenylalanine ammonia-lyase                             236   3e-69    
ref|NP_001047483.2|  Os02g0626600                                       235   4e-69    
gb|KGN48166.1|  hypothetical protein Csa_6G446280                       221   4e-69    
gb|EAY86765.1|  hypothetical protein OsI_08145                          235   6e-69    
gb|ACN35880.1|  unknown                                                 235   8e-69    
gb|ACM45573.1|  phenylalanine ammonia-lyase                             234   9e-69    
gb|AFW63064.1|  hypothetical protein ZEAMMB73_624679                    230   9e-69    
ref|NP_001147922.1|  phenylalanine ammonia-lyase                        234   1e-68    
sp|P45731.1|PAL1_POPKI  RecName: Full=Phenylalanine ammonia-lyase G1    234   1e-68    
gb|ACN62413.1|  phenylalanine ammonia-lyase                             234   1e-68    
gb|ACM45589.1|  phenylalanine ammonia-lyase                             234   1e-68    
ref|XP_002871081.1|  phenyl alanine ammonia-lyase 3                     234   1e-68    
gb|ACZ44833.1|  phenylalanine ammonia-lyase                             234   1e-68    
emb|CDX67566.1|  BnaA07g16060D                                          229   2e-68    
gb|ACM16588.1|  phenylalanine ammonia-lyase                             234   2e-68    
dbj|BAM28966.1|  phenylalanine ammonia lyase                            234   2e-68    
ref|XP_010464706.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    233   3e-68    
gb|ADE08261.1|  phenylalanine ammonia-lyase 4                           233   3e-68    
gb|AIL25287.1|  phenylalanine ammonia lyase                             217   3e-68    
sp|A2X7F7.1|PAL2_ORYSI  RecName: Full=Phenylalanine ammonia-lyase       233   3e-68    
ref|XP_006647544.1|  PREDICTED: phenylalanine ammonia-lyase-like        233   4e-68    
ref|NP_001047484.1|  Os02g0627100                                       233   4e-68    
ref|XP_003575365.1|  PREDICTED: phenylalanine ammonia-lyase             233   4e-68    
sp|Q43210.1|PALY_WHEAT  RecName: Full=Phenylalanine ammonia-lyase       233   4e-68    
gb|AAX97448.1|  putative phenylalanine ammonia-lyase                    234   4e-68    
ref|NP_001151482.1|  phenylalanine ammonia-lyase                        233   5e-68    
ref|XP_003575404.1|  PREDICTED: phenylalanine ammonia-lyase-like        233   5e-68    
gb|ACF86361.1|  unknown                                                 233   6e-68    
gb|KGN48161.1|  hypothetical protein Csa_6G445740                       229   6e-68    
ref|XP_004953153.1|  PREDICTED: phenylalanine/tyrosine ammonia-ly...    232   8e-68    
gb|ACM41719.1|  phenylalanine ammonia-lyase                             232   9e-68    
gb|EMT28136.1|  Phenylalanine ammonia-lyase                             232   1e-67    
emb|CAB97358.1|  phenylalanine ammonia-lyase                            221   2e-67    
ref|XP_008678828.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    231   2e-67    
gb|AGC23439.1|  phenylalanine ammonia-lyase                             231   2e-67    
dbj|BAM28967.1|  phenylalanine ammonia lyase                            231   2e-67    



>gb|AHJ60264.1| phenylalanine ammonia-lyase 1 [Ipomoea purpurea]
Length=707

 Score =   369 bits (948),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 177/180 (98%), Positives = 179/180 (99%), Gaps = 0/180 (0%)
 Frame = +1

Query  118  MEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  297
            MEGAIENGH+NDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ
Sbjct  1    MEGAIENGHTNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  60

Query  298  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  477
            VAAIAARDNAVKVELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA
Sbjct  61   VAAIAARDNAVKVELSEAARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  120

Query  478  LQQELIRFLNAGIFGTGTGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            LQQELIRFLNAGIFGTGTGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN+N
Sbjct  121  LQQELIRFLNAGIFGTGTGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNN  180



>sp|Q42858.1|PAL2_IPOBA RecName: Full=Phenylalanine ammonia-lyase [Ipomoea batatas]
 dbj|BAA11459.1| phenylalanine ammonia-lyase [Ipomoea batatas]
Length=708

 Score =   322 bits (824),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 164/182 (90%), Gaps = 3/182 (2%)
 Frame = +1

Query  118  MEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  297
            MEGAI NGH+NDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  +
Sbjct  1    MEGAIANGHTNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTSLR  60

Query  298  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  477
               IAARDNA K   S    A  ++SSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA
Sbjct  61   SPPIAARDNASKWS-SPRLPARRESSSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  119

Query  478  LQQELIRFLNAGIFGTGTG--HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  651
            LQQELIRFLNAGIFGTGTG  HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN
Sbjct  120  LQQELIRFLNAGIFGTGTGASHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  179

Query  652  HN  657
            HN
Sbjct  180  HN  181



>ref|XP_009781653.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana sylvestris]
Length=712

 Score =   318 bits (816),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 167/185 (90%), Gaps = 5/185 (3%)
 Frame = +1

Query  118  MEGAIENGHSN-DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  294
            M G  +NGH   DFC+KVDPLNWEMAADSLKGSHLDEVK+MVAEFR P VK+GG+TLTVA
Sbjct  1    MAGVAQNGHQEMDFCVKVDPLNWEMAADSLKGSHLDEVKKMVAEFRKPVVKLGGETLTVA  60

Query  295  QVAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  468
            QVAAIAA+DNA  VKVELSEGARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTKN
Sbjct  61   QVAAIAAKDNAKTVKVELSEGARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKN  120

Query  469  GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  642
            G ALQ+ELIRFLNAG+FG GT   HTLP S TRAAMLVRINTLLQGYSGIRFEILEAITK
Sbjct  121  GGALQKELIRFLNAGVFGNGTESCHTLPQSGTRAAMLVRINTLLQGYSGIRFEILEAITK  180

Query  643  LLNHN  657
            LLNHN
Sbjct  181  LLNHN  185



>sp|P45733.1|PAL3_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 emb|CAA55075.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=712

 Score =   318 bits (816),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 167/185 (90%), Gaps = 5/185 (3%)
 Frame = +1

Query  118  MEGAIENGHSN-DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  294
            M G  +NGH   DFC+KVDPLNWEMAADSLKGSHLDEVK+MVAEFR P VK+GG+TLTVA
Sbjct  1    MAGVAQNGHQEMDFCVKVDPLNWEMAADSLKGSHLDEVKKMVAEFRKPVVKLGGETLTVA  60

Query  295  QVAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  468
            QVAAIAA+DNA  VKVELSEGARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTKN
Sbjct  61   QVAAIAAKDNAKTVKVELSEGARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKN  120

Query  469  GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  642
            G ALQ+ELIRFLNAG+FG GT   HTLP S TRAAMLVRINTLLQGYSGIRFEILEAITK
Sbjct  121  GGALQKELIRFLNAGVFGNGTESCHTLPQSGTRAAMLVRINTLLQGYSGIRFEILEAITK  180

Query  643  LLNHN  657
            LLNHN
Sbjct  181  LLNHN  185



>gb|AAG49585.1|AF325496_1 phenylalanine ammonia-lyase [Ipomoea nil]
Length=711

 Score =   318 bits (815),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 163/176 (93%), Gaps = 2/176 (1%)
 Frame = +1

Query  136  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  315
            NGH N FC+KVDPLNWE+AADSL+GSHLDEVK MVAEFR PAVK+GG+TLTVAQVAAIA+
Sbjct  9    NGHQNGFCVKVDPLNWEVAADSLRGSHLDEVKVMVAEFRKPAVKLGGETLTVAQVAAIAS  68

Query  316  RDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  495
            RDNAV VELSE +RAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELI
Sbjct  69   RDNAVTVELSEESRAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQKELI  128

Query  496  RFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            RFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  129  RFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  184



>ref|XP_009625397.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana tomentosiformis]
Length=712

 Score =   316 bits (809),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 165/185 (89%), Gaps = 5/185 (3%)
 Frame = +1

Query  118  MEGAIENGHSN-DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  294
            M G  +NGH   DFC+KVDPLNWEMAADSLKGSHLDEVK+MVAEFR P VK+GG+TLTVA
Sbjct  1    MAGVAQNGHQEMDFCMKVDPLNWEMAADSLKGSHLDEVKKMVAEFRKPVVKLGGETLTVA  60

Query  295  QVAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  468
            QVAAIAA+DN   VKVELSEGARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTKN
Sbjct  61   QVAAIAAKDNVKTVKVELSEGARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKN  120

Query  469  GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  642
            G ALQ+ELIRFLNAG+FG GT   HTLP S TRAAMLVRINTLLQGYSGIRFEILEAITK
Sbjct  121  GGALQKELIRFLNAGVFGNGTESCHTLPQSGTRAAMLVRINTLLQGYSGIRFEILEAITK  180

Query  643  LLNHN  657
            LLNHN
Sbjct  181  LLNHN  185



>sp|P35513.2|PAL2_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 dbj|BAA22947.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
 dbj|BAA22963.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=712

 Score =   315 bits (808),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 165/185 (89%), Gaps = 5/185 (3%)
 Frame = +1

Query  118  MEGAIENGHSN-DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  294
            M G  +NGH   DFC+KVDPLNWEMAADSLKGSHLDEVK+MVAEFR P VK+GG+TLTVA
Sbjct  1    MAGVAQNGHQEMDFCMKVDPLNWEMAADSLKGSHLDEVKKMVAEFRKPVVKLGGETLTVA  60

Query  295  QVAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  468
            QVAAIAA+DN   VKVELSEGARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTKN
Sbjct  61   QVAAIAAKDNVKTVKVELSEGARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKN  120

Query  469  GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  642
            G ALQ+ELIRFLNAG+FG GT   HTLP S TRAAMLVRINTLLQGYSGIRFEILEAITK
Sbjct  121  GGALQKELIRFLNAGVFGNGTESCHTLPQSGTRAAMLVRINTLLQGYSGIRFEILEAITK  180

Query  643  LLNHN  657
            LLNHN
Sbjct  181  LLNHN  185



>gb|ABG75910.1| phenylalanine ammonia-lyase 1 [Nicotiana attenuata]
Length=712

 Score =   313 bits (801),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/185 (84%), Positives = 165/185 (89%), Gaps = 5/185 (3%)
 Frame = +1

Query  118  MEGAIENGHSN-DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  294
            M G  +NGH   DFC+KVDPLNWEMAADSLKGSHLDEVK MVAE+R P VK+GG+TLTVA
Sbjct  1    MAGVAQNGHQEMDFCVKVDPLNWEMAADSLKGSHLDEVKIMVAEYRKPVVKLGGETLTVA  60

Query  295  QVAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  468
            QVAAIAA+DNA  V VELSEGARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTKN
Sbjct  61   QVAAIAAKDNAKTVTVELSEGARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKN  120

Query  469  GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  642
            G ALQ+ELIRFLNAG+FG GT   HTLP S TRAAMLVRINTLLQGYSGIRFEILEAITK
Sbjct  121  GGALQKELIRFLNAGVFGNGTESCHTLPQSGTRAAMLVRINTLLQGYSGIRFEILEAITK  180

Query  643  LLNHN  657
            LLNHN
Sbjct  181  LLNHN  185



>dbj|BAA95629.1| phenylalanine ammonia lyase [Catharanthus roseus]
Length=716

 Score =   310 bits (794),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 164/186 (88%), Gaps = 9/186 (5%)
 Frame = +1

Query  124  GAIENGHSN-----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  288
            G+ ENGH N     DFC+K DPLNW MAADSLKGSHLDEVKRMVAEFR P VK+GG+TLT
Sbjct  5    GSTENGHINNGEVLDFCLK-DPLNWGMAADSLKGSHLDEVKRMVAEFRKPVVKLGGETLT  63

Query  289  VAQVAAIAARD-NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  465
            ++QVAAIAARD NAVKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK
Sbjct  64   ISQVAAIAARDYNAVKVELSEDARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTK  123

Query  466  NGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  639
             G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT
Sbjct  124  QGGALQKELIRFLNAGIFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  183

Query  640  KLLNHN  657
            K LNHN
Sbjct  184  KFLNHN  189



>sp|P14166.1|PAL1_IPOBA RecName: Full=Phenylalanine ammonia-lyase [Ipomoea batatas]
 gb|AAA33389.1| phenylalanine ammonia-lyase [Ipomoea batatas]
Length=707

 Score =   307 bits (787),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 160/178 (90%), Gaps = 5/178 (3%)
 Frame = +1

Query  139  GHSNDFCIK---VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAI  309
             + N FCIK   VDPLNWEMAA+SL+GSHLDEVKRMVAEFR PAVK+GG+TLTVAQVA I
Sbjct  2    ANQNGFCIKKQQVDPLNWEMAAESLRGSHLDEVKRMVAEFRKPAVKLGGETLTVAQVARI  61

Query  310  AARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQE  489
            A+RDNAV VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G ALQ+E
Sbjct  62   ASRDNAVAVELSEEARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQKE  121

Query  490  LIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            LIRFLNAGIFG  T   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  122  LIRFLNAGIFGNATESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  179



>gb|AFZ94859.1| phenylalanine ammonia-lyase [Solenostemon scutellarioides]
Length=711

 Score =   306 bits (783),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 161/184 (88%), Gaps = 4/184 (2%)
 Frame = +1

Query  118  MEGAIENGH-SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  291
            M  A ENGH SN FC+K  DPLNW  AA++L+GSHLDEVK+MV EFR PAVK+GG+TLT+
Sbjct  1    MAAATENGHQSNGFCVKQNDPLNWAAAAEALQGSHLDEVKKMVEEFRKPAVKLGGETLTI  60

Query  292  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  471
            AQVAAIAARDNAV VELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G
Sbjct  61   AQVAAIAARDNAVAVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQG  120

Query  472  HALQQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  645
             ALQ ELIRFLNAGIFG G  T HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK 
Sbjct  121  GALQTELIRFLNAGIFGKGTETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKF  180

Query  646  LNHN  657
            LNHN
Sbjct  181  LNHN  184



>gb|AIY26016.1| PAL [Jasminum sambac]
Length=712

 Score =   305 bits (782),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 162/186 (87%), Gaps = 7/186 (4%)
 Frame = +1

Query  118  MEGAIENGHSN----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  285
            ME A++N  SN    DFC+K DPLNW MAA++LKGSHLDEVKRMV EFR P VK+GG+TL
Sbjct  1    MEIALQNSDSNGKSMDFCVK-DPLNWGMAAEALKGSHLDEVKRMVEEFRKPVVKLGGETL  59

Query  286  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  465
            TV+QVAAIAARDNAV VELSE AR GVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK
Sbjct  60   TVSQVAAIAARDNAVTVELSETARGGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTK  119

Query  466  NGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  639
             G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT
Sbjct  120  QGGALQKELIRFLNAGIFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  179

Query  640  KLLNHN  657
            K LNHN
Sbjct  180  KFLNHN  185



>gb|ACF94719.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=210

 Score =   288 bits (736),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 157/189 (83%), Gaps = 7/189 (4%)
 Frame = +1

Query  112  TTMEGAIENGHSNDFCIKV-----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGG  276
            T +      G +   C+K      DPLNW +AA+S+KGSHLDEVKRMV E+RNP V+IGG
Sbjct  4    TRVSNGYHQGQNGSLCLKSNNTSSDPLNWGVAAESMKGSHLDEVKRMVEEYRNPVVRIGG  63

Query  277  QTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  456
            +TLT++QVAAIA RD    +ELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR
Sbjct  64   ETLTISQVAAIATRDQDASLELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  123

Query  457  RTKNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILE  630
            RTK G ALQ+ELIRFLNAGIFG G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILE
Sbjct  124  RTKQGGALQKELIRFLNAGIFGNGAVSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILE  183

Query  631  AITKLLNHN  657
            AITKLLN+N
Sbjct  184  AITKLLNNN  192



>gb|AAO13347.1| phenylalanine ammonia-lyase2 [Lactuca sativa]
Length=713

 Score =   303 bits (776),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 159/178 (89%), Gaps = 3/178 (2%)
 Frame = +1

Query  133  ENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIA  312
            +NG   +FC+K DPLNW MAA+SLKGSHLDEVKRMVAEFR P V++GG+TLTV+QVAAIA
Sbjct  12   QNGERAEFCVKGDPLNWGMAAESLKGSHLDEVKRMVAEFRKPVVRLGGETLTVSQVAAIA  71

Query  313  ARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQE  489
            A DNA VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+E
Sbjct  72   ASDNAGVKVELSETARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKEGGALQKE  131

Query  490  LIRFLNAGIFGTGTG--HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            LIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LNHN
Sbjct  132  LIRFLNAGIFGNGTESTHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHN  189



>gb|ABL14039.1| phenylalanine ammonia lyase, partial [Astragalus mongholicus]
Length=274

 Score =   290 bits (741),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 159/191 (83%), Gaps = 11/191 (6%)
 Frame = +1

Query  118  MEGAIENGHSN------DFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKI  270
            ME    NGH++      + CI     DPLNW +AA++LKGS LDEVKRMV E+RNP VKI
Sbjct  1    MEAVGANGHASSTANEAELCISKAGGDPLNWAVAAEALKGSLLDEVKRMVEEYRNPVVKI  60

Query  271  GGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  450
            GG+TLT++QVA IA+ D  VKVELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS
Sbjct  61   GGETLTISQVAGIASHDGGVKVELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  120

Query  451  HRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEI  624
            HRRTK G ALQ+E IRFLNAGIFG GT   +TLPHSATRAAMLVRINTLLQGYSGIRFEI
Sbjct  121  HRRTKQGGALQKEFIRFLNAGIFGNGTESNYTLPHSATRAAMLVRINTLLQGYSGIRFEI  180

Query  625  LEAITKLLNHN  657
            LEAITKLLNHN
Sbjct  181  LEAITKLLNHN  191



>gb|AEM63670.1| phenylalanine ammonia lyase 1 [Platycodon grandiflorus]
Length=710

 Score =   301 bits (772),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 159/181 (88%), Gaps = 6/181 (3%)
 Frame = +1

Query  130  IENGHSND---FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  300
            IENG  N+   FCIK DPLNW + A+SLKGSHL+EVKRMVAEFR P VK+GG+TLTV+QV
Sbjct  6    IENGQVNEAIEFCIK-DPLNWGVTAESLKGSHLNEVKRMVAEFRKPVVKLGGETLTVSQV  64

Query  301  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  480
            A IAARDN VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G AL
Sbjct  65   AGIAARDNGVKVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGAL  124

Query  481  QQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH  654
            Q+ELIRFLNAGIFG GT   HTLPHSATRAAMLVR+NTLLQGYSGIRFEILEAITK LNH
Sbjct  125  QKELIRFLNAGIFGNGTESSHTLPHSATRAAMLVRVNTLLQGYSGIRFEILEAITKFLNH  184

Query  655  N  657
            N
Sbjct  185  N  185



>ref|XP_011077338.1| PREDICTED: phenylalanine ammonia-lyase [Sesamum indicum]
Length=712

 Score =   301 bits (771),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 161/185 (87%), Gaps = 5/185 (3%)
 Frame = +1

Query  118  MEGAIENGH-SNDFCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  288
            M  A ENGH SN FC++   DPLNW  AA++LKGSHLDEVKRMV EFR P VK+GG+TLT
Sbjct  1    MAAATENGHHSNGFCVQKQKDPLNWGAAAEALKGSHLDEVKRMVEEFRKPVVKLGGETLT  60

Query  289  VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  468
            ++QVAAIA+RDNAV VEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK 
Sbjct  61   ISQVAAIASRDNAVAVELAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQ  120

Query  469  GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  642
            G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK
Sbjct  121  GGALQKELIRFLNAGIFGQGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  180

Query  643  LLNHN  657
             LNHN
Sbjct  181  FLNHN  185



>gb|EYU38541.1| hypothetical protein MIMGU_mgv1a001582mg [Erythranthe guttata]
Length=790

 Score =   302 bits (773),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 162/183 (89%), Gaps = 6/183 (3%)
 Frame = +1

Query  127  AIENGH---SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  294
            A ENGH    N FC++  DPLNW MAA+SLKGSHLDEVKRMVAEFR P VK+GG+TLT++
Sbjct  82   AAENGHHAAGNGFCVQQNDPLNWGMAAESLKGSHLDEVKRMVAEFRKPVVKLGGETLTIS  141

Query  295  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  474
            QVAAIAARDNAV VEL+E ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G 
Sbjct  142  QVAAIAARDNAVAVELNESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGG  201

Query  475  ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  648
            ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK L
Sbjct  202  ALQKELIRFLNAGIFGNGTESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFL  261

Query  649  NHN  657
            N+N
Sbjct  262  NNN  264



>ref|XP_004249558.1| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=711

 Score =   300 bits (767),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 160/184 (87%), Gaps = 4/184 (2%)
 Frame = +1

Query  118  MEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  297
            M G I      DFCIKVDPLNWEMAA+SL+GSHLDEVK+MVAEFR P VK+GG+TLTVAQ
Sbjct  1    MAGVINGQQDLDFCIKVDPLNWEMAAESLRGSHLDEVKKMVAEFRKPVVKLGGETLTVAQ  60

Query  298  VAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  471
            VA++AA+ N   VKVEL E ARAGVKASSDWVM SM+ GTDSYGVTTGFGATSHRRTKNG
Sbjct  61   VASVAAKVNVENVKVELCEDARAGVKASSDWVMESMSKGTDSYGVTTGFGATSHRRTKNG  120

Query  472  HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  645
             ALQ+ELIRFLNAG+FG GT   HTLP S+TRAAMLVRINTLLQGYSGIRFEILEAITKL
Sbjct  121  GALQKELIRFLNAGVFGNGTESCHTLPQSSTRAAMLVRINTLLQGYSGIRFEILEAITKL  180

Query  646  LNHN  657
            +NHN
Sbjct  181  INHN  184



>gb|ACR56688.1| phenylalanine ammonia-lyase [Scutellaria viscidula]
Length=711

 Score =   300 bits (767),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 148/184 (80%), Positives = 162/184 (88%), Gaps = 4/184 (2%)
 Frame = +1

Query  118  MEGAIENGH-SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  291
            M  A+E  H SN FC+++ DPLNW  AA++LKGSHLDEVKRMV EFRNP VKIGG+ LT+
Sbjct  1    MAPAVEVSHRSNGFCVQLSDPLNWGAAAEALKGSHLDEVKRMVEEFRNPVVKIGGENLTI  60

Query  292  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  471
            AQVAAIA+RDNAV VEL+E ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G
Sbjct  61   AQVAAIASRDNAVAVELAESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQG  120

Query  472  HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  645
             ALQ+ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEA+TK 
Sbjct  121  GALQKELIRFLNAGIFGKGTEGCHTLPHTATRAAMLVRINTLLQGYSGIRFEILEALTKF  180

Query  646  LNHN  657
            LNHN
Sbjct  181  LNHN  184



>gb|ADN32767.1| phenylalanine ammonia-lyase 1 [Scutellaria baicalensis]
Length=711

 Score =   299 bits (766),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 148/184 (80%), Positives = 162/184 (88%), Gaps = 4/184 (2%)
 Frame = +1

Query  118  MEGAIENGH-SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  291
            M  A+E  H SN FC+++ DPLNW  AA++LKGSHLDEVKRMV EFRNP VKIGG+ LT+
Sbjct  1    MAPAVEVSHRSNGFCVQLSDPLNWGAAAEALKGSHLDEVKRMVEEFRNPVVKIGGENLTI  60

Query  292  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  471
            AQVAAIA+RDNAV VEL+E ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G
Sbjct  61   AQVAAIASRDNAVAVELAESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQG  120

Query  472  HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  645
             ALQ+ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEA+TK 
Sbjct  121  GALQKELIRFLNAGIFGKGTEGCHTLPHTATRAAMLVRINTLLQGYSGIRFEILEALTKF  180

Query  646  LNHN  657
            LNHN
Sbjct  181  LNHN  184



>gb|AAK84225.1|AF401636_1 phenylalanine ammonia-lyase [Rehmannia glutinosa]
Length=708

 Score =   298 bits (762),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 159/182 (87%), Gaps = 6/182 (3%)
 Frame = +1

Query  130  IENGH--SNDFCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  297
            +ENGH  SN  C++   DPLNW  AA+SLKGSHLDEVKRMV EFR PAVK+GG++LT+AQ
Sbjct  1    MENGHHHSNGLCVETTRDPLNWVAAAESLKGSHLDEVKRMVEEFRKPAVKLGGESLTIAQ  60

Query  298  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  477
            VAAIAARDNAV VEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G A
Sbjct  61   VAAIAARDNAVAVELAETARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGA  120

Query  478  LQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  651
            LQ+ELIRFLNAGIFG GT   H LPHSATRAAMLVRINTLLQGYSGIRFEILEA+TK LN
Sbjct  121  LQKELIRFLNAGIFGNGTESNHALPHSATRAAMLVRINTLLQGYSGIRFEILEALTKFLN  180

Query  652  HN  657
            HN
Sbjct  181  HN  182



>emb|CBJ23826.1| phenylalanine ammonia-lyase [Melissa officinalis]
Length=709

 Score =   297 bits (761),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 158/180 (88%), Gaps = 5/180 (3%)
 Frame = +1

Query  133  ENGH--SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  303
            ENGH  SN FC+K  DPLNW  AA+SLKGSHLDEVKRMV EFR P VK+GG+TLT++QVA
Sbjct  3    ENGHHDSNGFCVKQNDPLNWVAAAESLKGSHLDEVKRMVEEFRKPVVKLGGETLTISQVA  62

Query  304  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  483
            AIAA+DNAV VEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ
Sbjct  63   AIAAKDNAVAVELAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQ  122

Query  484  QELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            +ELIRFLNAGIFG G  T HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITK LN N
Sbjct  123  KELIRFLNAGIFGNGTETNHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKFLNQN  182



>ref|XP_011094662.1| PREDICTED: phenylalanine ammonia-lyase [Sesamum indicum]
Length=711

 Score =   296 bits (757),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 160/184 (87%), Gaps = 4/184 (2%)
 Frame = +1

Query  118  MEGAIENGH-SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  291
            M  ++EN H SN FC++  DPLNW +AA++LKGSHLDEVK+MVAEFR P VK+GG+TLT+
Sbjct  1    MAPSLENDHHSNGFCVQQKDPLNWGVAAEALKGSHLDEVKKMVAEFRKPVVKLGGETLTI  60

Query  292  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  471
            +QVAAIAARDN V VEL+E AR GVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G
Sbjct  61   SQVAAIAARDNGVAVELAEAARGGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQG  120

Query  472  HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  645
             ALQ+ELIRFLNAGIFG  T   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK 
Sbjct  121  GALQKELIRFLNAGIFGNATESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKF  180

Query  646  LNHN  657
            LNHN
Sbjct  181  LNHN  184



>ref|XP_004497516.1| PREDICTED: phenylalanine ammonia-lyase-like [Cicer arietinum]
Length=715

 Score =   295 bits (756),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 162/186 (87%), Gaps = 6/186 (3%)
 Frame = +1

Query  118  MEGAIENGHSND-FCIK---VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  285
            MEGA+ NGH+   FC+     DPLNW +AADS+KGSHLDEVKRMV E+RNP V+IGG+TL
Sbjct  3    MEGALSNGHAQPTFCLTKTLPDPLNWGVAADSMKGSHLDEVKRMVEEYRNPIVRIGGETL  62

Query  286  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  465
            T+AQVA IA+ D+ V+VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK
Sbjct  63   TIAQVAGIASHDSGVRVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTK  122

Query  466  NGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  639
             G ALQ+ELIRFLNAGIFG GT    TLPH+ATRAAMLVRINTLLQGYSGIRFEILEAIT
Sbjct  123  QGGALQKELIRFLNAGIFGNGTESNCTLPHTATRAAMLVRINTLLQGYSGIRFEILEAIT  182

Query  640  KLLNHN  657
            KLLN+N
Sbjct  183  KLLNNN  188



>gb|ABD73282.1| phenylalanine ammonia-lyase [Salvia miltiorrhiza]
Length=711

 Score =   295 bits (755),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 147/183 (80%), Positives = 159/183 (87%), Gaps = 6/183 (3%)
 Frame = +1

Query  127  AIENGH---SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  294
            A ENGH   SN FC+K  DPLNW  AA+SLKGSHLDEVKRMV EFR P VK+GG+TLT++
Sbjct  2    AAENGHHEESNGFCVKQNDPLNWVAAAESLKGSHLDEVKRMVEEFRKPVVKLGGETLTIS  61

Query  295  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  474
            QVAAIAA+DNAV VEL+E +RAGVKASSDWVM SM+ GTDSYGVTTGFGATSHRRTK G 
Sbjct  62   QVAAIAAKDNAVAVELAESSRAGVKASSDWVMESMSKGTDSYGVTTGFGATSHRRTKQGG  121

Query  475  ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  648
            ALQ+ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITK L
Sbjct  122  ALQKELIRFLNAGIFGNGTESNHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKFL  181

Query  649  NHN  657
            N N
Sbjct  182  NEN  184



>gb|AHZ31605.1| phenylalanine ammonia-lyase [Olea europaea]
 gb|AHZ31606.1| phenylalanine ammonia-lyase [Olea europaea]
Length=713

 Score =   295 bits (754),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 159/182 (87%), Gaps = 7/182 (4%)
 Frame = +1

Query  130  IENGHSN----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  297
            +ENGHS+    +FCI+ DPLNW  AA+SLKGSHLDE+KRMV EFR P VK+GG+TLT++Q
Sbjct  6    VENGHSSGKLLNFCIE-DPLNWGTAAESLKGSHLDELKRMVEEFRKPVVKLGGETLTISQ  64

Query  298  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  477
            VAAIA+RDNAVKVEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G A
Sbjct  65   VAAIASRDNAVKVELAEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGA  124

Query  478  LQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  651
            LQ+ELIRFLNAGIFG GT     LPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN
Sbjct  125  LQKELIRFLNAGIFGNGTESSQALPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLN  184

Query  652  HN  657
             N
Sbjct  185  SN  186



>ref|XP_010262867.1| PREDICTED: phenylalanine ammonia-lyase [Nelumbo nucifera]
Length=715

 Score =   295 bits (754),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 154/176 (88%), Gaps = 2/176 (1%)
 Frame = +1

Query  136  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  315
            NG    FC++ DPLNW+MAA+SLKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAIA 
Sbjct  13   NGSIKSFCVQQDPLNWQMAAESLKGSHLDEVKRMVQEYRKPVVKLGGETLTISQVAAIAT  72

Query  316  RDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  495
             D  VKVEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELI
Sbjct  73   HDAGVKVELAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELI  132

Query  496  RFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            RFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN+N
Sbjct  133  RFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNNN  188



>gb|ADN32768.1| phenylalanine ammonia-lyase 2 [Scutellaria baicalensis]
Length=708

 Score =   294 bits (753),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 157/181 (87%), Gaps = 5/181 (3%)
 Frame = +1

Query  130  IENGHSND--FCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  300
            +ENGH N   FC+K  DPLNW  AA++L+GSHLDEVKRMVAEFR P VK+GG+TLT++QV
Sbjct  1    MENGHKNGNGFCVKQNDPLNWGAAAEALQGSHLDEVKRMVAEFRKPVVKLGGETLTISQV  60

Query  301  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  480
            AAIAARDN V VEL+E AR GVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G AL
Sbjct  61   AAIAARDNGVVVELAEAARPGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGAL  120

Query  481  QQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH  654
            Q+ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILE ITK LNH
Sbjct  121  QKELIRFLNAGIFGKGTESEHTLPHTATRAAMLVRINTLLQGYSGIRFEILETITKFLNH  180

Query  655  N  657
            N
Sbjct  181  N  181



>gb|AGW27206.1| phenylalanine ammonia-lyase 3 [Salvia miltiorrhiza]
Length=760

 Score =   295 bits (756),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 147/188 (78%), Positives = 163/188 (87%), Gaps = 5/188 (3%)
 Frame = +1

Query  106  FNTTMEGAIENGHS-NDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQ  279
            F T++  A ENGHS N FC+K  DPLNW  AA++L+GSHLD VKRMV EFR PAVK+GG+
Sbjct  47   FTTSIMAA-ENGHSENGFCVKQSDPLNWAAAAEALQGSHLDAVKRMVEEFRKPAVKLGGE  105

Query  280  TLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRR  459
            TLT+AQVAAIA+RDNAV VEL+E ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRR
Sbjct  106  TLTIAQVAAIASRDNAVAVELAESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRR  165

Query  460  TKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEA  633
            TK G ALQ+ELIRFLNAGIFG GT   HTLPHS+TRAAMLVRINTL+QGYSGIRFEILEA
Sbjct  166  TKQGGALQKELIRFLNAGIFGNGTESNHTLPHSSTRAAMLVRINTLMQGYSGIRFEILEA  225

Query  634  ITKLLNHN  657
            + K LNHN
Sbjct  226  LAKFLNHN  233



>gb|AFK43896.1| unknown [Medicago truncatula]
Length=374

 Score =   285 bits (728),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 158/186 (85%), Gaps = 7/186 (4%)
 Frame = +1

Query  118  MEGAIENGH-SNDFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  285
            MEG I NGH    FC+     DPLNW  AA+SL GSHLDEVKRMV E+RNP VKIGG+TL
Sbjct  1    MEG-ITNGHVEATFCLSKNGGDPLNWGAAAESLTGSHLDEVKRMVEEYRNPLVKIGGETL  59

Query  286  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  465
            T+AQVA IA+ D+ V+VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK
Sbjct  60   TIAQVAGIASHDSGVRVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTK  119

Query  466  NGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  639
             G ALQ+ELIRFLNAGIFG GT    TLPH+ATRAAMLVRINTLLQGYSGIRFEILEAIT
Sbjct  120  QGGALQKELIRFLNAGIFGNGTESNCTLPHTATRAAMLVRINTLLQGYSGIRFEILEAIT  179

Query  640  KLLNHN  657
            KLLN+N
Sbjct  180  KLLNNN  185



>ref|XP_007162754.1| hypothetical protein PHAVU_001G1777001g, partial [Phaseolus vulgaris]
 gb|ESW34748.1| hypothetical protein PHAVU_001G1777001g, partial [Phaseolus vulgaris]
Length=411

 Score =   286 bits (731),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 156/183 (85%), Gaps = 7/183 (4%)
 Frame = +1

Query  130  IENGHSN-DFCIK----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  294
            + N H N  FC+      DPLNW  AA++LKGSHLDEVKRMVAE+R P V++GG+TLT+A
Sbjct  6    LTNAHQNCSFCLPSAKTTDPLNWGTAAEALKGSHLDEVKRMVAEYRQPLVRLGGETLTIA  65

Query  295  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  474
            QVAA++  D  V+VELSE AR GVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK G 
Sbjct  66   QVAAVSGHDQGVRVELSESAREGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKQGG  125

Query  475  ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  648
            ALQ+ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILE+ITKLL
Sbjct  126  ALQKELIRFLNAGIFGNGTESSHTLPHTATRAAMLVRINTLLQGYSGIRFEILESITKLL  185

Query  649  NHN  657
            N+N
Sbjct  186  NNN  188



>ref|XP_010253912.1| PREDICTED: phenylalanine ammonia-lyase [Nelumbo nucifera]
Length=713

 Score =   294 bits (753),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 157/186 (84%), Gaps = 6/186 (3%)
 Frame = +1

Query  118  MEGAIENGHSN----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  285
            ME A EN + N     FCI+ DPLNWE AA+SLKGSHLDEVKRMV EFR P V++GGQTL
Sbjct  1    MEFAQENCNGNGSLKSFCIQQDPLNWEKAAESLKGSHLDEVKRMVQEFRKPVVRLGGQTL  60

Query  286  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  465
            T++QVAAIA  D  VKV LSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK
Sbjct  61   TISQVAAIATHDAGVKVVLSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTK  120

Query  466  NGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  639
             G ALQ+ELIRFLNAGIFG G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT
Sbjct  121  QGGALQKELIRFLNAGIFGNGVESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  180

Query  640  KLLNHN  657
            KLLN N
Sbjct  181  KLLNSN  186



>gb|ABR14606.1| phenylalanine ammonia-lyase [Salvia miltiorrhiza]
Length=711

 Score =   294 bits (752),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 147/183 (80%), Positives = 158/183 (86%), Gaps = 6/183 (3%)
 Frame = +1

Query  127  AIENGH---SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  294
            A ENGH   SN FC+K  DPLNW  AA+SLKGSHLDEVKRMV EFR P VK+GG+TLT++
Sbjct  2    AAENGHHEESNGFCVKQNDPLNWVAAAESLKGSHLDEVKRMVEEFRKPVVKLGGETLTIS  61

Query  295  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  474
            QVAAIAA+DNAV VEL E +RAGVKASSDWVM SM+ GTDSYGVTTGFGATSHRRTK G 
Sbjct  62   QVAAIAAKDNAVAVELVESSRAGVKASSDWVMESMSKGTDSYGVTTGFGATSHRRTKQGG  121

Query  475  ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  648
            ALQ+ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITK L
Sbjct  122  ALQKELIRFLNAGIFGNGTESNHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKFL  181

Query  649  NHN  657
            N N
Sbjct  182  NEN  184



>ref|XP_002519521.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
 gb|EEF42935.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
Length=714

 Score =   294 bits (752),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 160/187 (86%), Gaps = 7/187 (4%)
 Frame = +1

Query  118  MEGAIENGHSND----FC-IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  282
            M    ENG  ND    FC +  DPL+W +AA+S+KGSHLDEVK+MVAE+R P VK+GG+T
Sbjct  1    MAAMAENGSKNDSLESFCNMGRDPLSWGLAAESMKGSHLDEVKKMVAEYRKPFVKLGGET  60

Query  283  LTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  462
            LTVAQVAAIA+ D  VKVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRT
Sbjct  61   LTVAQVAAIASHDCGVKVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRT  120

Query  463  KNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  636
            K G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI
Sbjct  121  KQGGALQKELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  180

Query  637  TKLLNHN  657
            TKLLNHN
Sbjct  181  TKLLNHN  187



>gb|AFF60415.1| phenylalanine ammonia lyase, partial [Pyrus pyrifolia]
Length=639

 Score =   291 bits (746),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 151/170 (89%), Gaps = 2/170 (1%)
 Frame = +1

Query  154  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  333
             CIK DPLNW +AADSLKGSHLDEVKRMVAE+R P VK+GG++LT++QVAAIA  D  VK
Sbjct  4    LCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQVAAIATHDTGVK  63

Query  334  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  513
            VELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  64   VELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAG  123

Query  514  IFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            +FG+ T  GHTLPH ATRAAMLVRINTLLQGYSGIRFEILEAITK LN+N
Sbjct  124  VFGSATESGHTLPHQATRAAMLVRINTLLQGYSGIRFEILEAITKFLNNN  173



>gb|ABE03772.1| phenylalanine ammonia-lyase [Arnebia euchroma]
Length=709

 Score =   293 bits (750),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 160/184 (87%), Gaps = 5/184 (3%)
 Frame = +1

Query  118  MEGAIE--NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  291
            ME  +E  NG S +FC++ DPLNWEMAA+S+KGSHLDEVKRMVAEFR P V++ G+TLT+
Sbjct  1    METIVEKGNGKSMEFCMQ-DPLNWEMAAESMKGSHLDEVKRMVAEFRKPVVQLAGKTLTI  59

Query  292  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  471
             QVA+IAA D+ VKVEL+E AR GVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G
Sbjct  60   GQVASIAAHDDGVKVELAEAAREGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQG  119

Query  472  HALQQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  645
             ALQ+ELIRFL+AGIFG G  T HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK 
Sbjct  120  GALQKELIRFLDAGIFGNGTETSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKF  179

Query  646  LNHN  657
            LN N
Sbjct  180  LNSN  183



>gb|KDP29132.1| hypothetical protein JCGZ_16521 [Jatropha curcas]
Length=713

 Score =   293 bits (750),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 159/186 (85%), Gaps = 6/186 (3%)
 Frame = +1

Query  118  MEGAIENGHSND----FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  285
            M   I NGH N      CI  DPL+W +AA+S+KGSHLDEVK+MV+E+R P VK+GG+TL
Sbjct  1    MATIIGNGHQNGSLEGLCITRDPLSWGVAAESMKGSHLDEVKKMVSEYRKPLVKLGGETL  60

Query  286  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  465
            TVAQVAAIA+ D  VKVEL+E ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK
Sbjct  61   TVAQVAAIASHDAGVKVELAESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTK  120

Query  466  NGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  639
             G ALQ+ELIRFLNAGIFG G  T HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT
Sbjct  121  QGAALQRELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  180

Query  640  KLLNHN  657
            KLLNHN
Sbjct  181  KLLNHN  186



>ref|XP_009629066.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana tomentosiformis]
 sp|P25872.1|PAL1_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 gb|AAA34122.1| phenylalanine ammonia lyase [Nicotiana tabacum]
 dbj|BAA22948.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=715

 Score =   293 bits (750),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 160/185 (86%), Gaps = 11/185 (6%)
 Frame = +1

Query  136  NGHSN-----DFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  297
            NGH N     + C K  DPLNWEMAA+SL+GSHLDEVK+MV+EFR P VK+GG++LTVAQ
Sbjct  4    NGHVNGGENFELCKKSADPLNWEMAAESLRGSHLDEVKKMVSEFRKPMVKLGGESLTVAQ  63

Query  298  VAAIAARD---NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  468
            VAAIA RD   N VKVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTKN
Sbjct  64   VAAIAVRDKSANGVKVELSEEARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKN  123

Query  469  GHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  642
            G ALQ+ELIRFLNAG+FG G  T HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK
Sbjct  124  GGALQKELIRFLNAGVFGNGTETSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  183

Query  643  LLNHN  657
            L+N N
Sbjct  184  LINSN  188



>gb|AEH02821.1| phenylalanine ammonia lyase [Chrysanthemum x morifolium]
Length=717

 Score =   293 bits (750),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 157/177 (89%), Gaps = 4/177 (2%)
 Frame = +1

Query  136  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  315
            NGH ND CIK DPLNW +AA++L GSHL+EVK+MV EF+NP VKIGG+TLTV+QVA IAA
Sbjct  15   NGHINDLCIK-DPLNWGVAAEALTGSHLNEVKKMVKEFKNPIVKIGGETLTVSQVAGIAA  73

Query  316  RDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQEL  492
             DNA VKVELSE ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRTKNG ALQ+EL
Sbjct  74   SDNASVKVELSESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGGALQKEL  133

Query  493  IRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            IRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN+N
Sbjct  134  IRFLNAGIFGNGTEASHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNNN  190



>gb|ABI33979.1| phenylalanine ammonia lyase [Jatropha curcas]
Length=713

 Score =   293 bits (749),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 159/186 (85%), Gaps = 6/186 (3%)
 Frame = +1

Query  118  MEGAIENGHSND----FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  285
            M   I NGH N      CI  DPL+W +AA+S+KGSHLDEVK+MV+E+R P VK+GG+TL
Sbjct  1    MATIIGNGHQNGSLEGLCITRDPLSWGVAAESMKGSHLDEVKKMVSEYRKPLVKLGGETL  60

Query  286  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  465
            TVAQVAAIA+ D  VKVEL+E ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK
Sbjct  61   TVAQVAAIASHDAGVKVELAESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTK  120

Query  466  NGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  639
             G ALQ+ELIRFLNAGIFG G  T HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT
Sbjct  121  QGAALQRELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  180

Query  640  KLLNHN  657
            KLLNHN
Sbjct  181  KLLNHN  186



>sp|O49835.1|PAL1_LITER RecName: Full=Phenylalanine ammonia-lyase 1; Short=PAL-1 [Lithospermum 
erythrorhizon]
 dbj|BAA24928.1| phenylalanine ammonia-lyase [Lithospermum erythrorhizon]
Length=710

 Score =   293 bits (749),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 159/184 (86%), Gaps = 5/184 (3%)
 Frame = +1

Query  118  MEGAIENGHSN--DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  291
            ME  +ENG+    +FC+K DPLNWEMA++S+KGSHLDEVK MVAEFR P V++ G+TLT+
Sbjct  1    METIVENGNGKTMEFCMK-DPLNWEMASESMKGSHLDEVKNMVAEFRKPVVQLAGKTLTI  59

Query  292  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  471
             QVAAIAARD+ V VEL+E AR GVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G
Sbjct  60   GQVAAIAARDDGVTVELAEAAREGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQG  119

Query  472  HALQQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  645
             ALQ+ELIRFLNAGIFG G  T HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK 
Sbjct  120  GALQKELIRFLNAGIFGNGTETSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKF  179

Query  646  LNHN  657
            LN N
Sbjct  180  LNTN  183



>gb|AGY49231.1| phenylalanine ammonia lyase [Ricinus communis]
Length=714

 Score =   293 bits (749),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 159/187 (85%), Gaps = 7/187 (4%)
 Frame = +1

Query  118  MEGAIENGHSND----FC-IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  282
            M    ENG  ND    FC    DPL+W +AA+S+KGSHLDEVK+MVAE+R P VK+GG+T
Sbjct  1    MAAMAENGSKNDSLESFCNTGRDPLSWGLAAESMKGSHLDEVKKMVAEYRKPFVKLGGET  60

Query  283  LTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  462
            LTVAQVAAIA+ D  VKVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRT
Sbjct  61   LTVAQVAAIASHDCGVKVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRT  120

Query  463  KNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  636
            K G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI
Sbjct  121  KQGGALQKELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  180

Query  637  TKLLNHN  657
            TKLLNHN
Sbjct  181  TKLLNHN  187



>gb|ABG75911.1| phenylalanine ammonia-lyase 2 [Nicotiana attenuata]
Length=717

 Score =   293 bits (749),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 161/187 (86%), Gaps = 13/187 (7%)
 Frame = +1

Query  136  NGHSN---DF--CIK---VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  291
            NGH N   DF  C K    DPLNWEMA++SL+GSHLDEVK+MV+EFR P VK+GG+TLTV
Sbjct  4    NGHVNGGEDFELCKKSSATDPLNWEMASESLRGSHLDEVKKMVSEFRKPMVKLGGETLTV  63

Query  292  AQVAAIAARD---NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  462
            AQVAAIA RD   N VKVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRT
Sbjct  64   AQVAAIAVRDKSANGVKVELSEDARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRT  123

Query  463  KNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  636
            KNG ALQ+ELIRFLNAG+FG G  T HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI
Sbjct  124  KNGGALQKELIRFLNAGVFGNGTETNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  183

Query  637  TKLLNHN  657
            TKL+N N
Sbjct  184  TKLINSN  190



>emb|CAL91170.1| phenylalanine ammonia-lyase 3 [Cynara cardunculus var. scolymus]
Length=264

 Score =   279 bits (713),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 154/179 (86%), Gaps = 5/179 (3%)
 Frame = +1

Query  136  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  315
            NG + DFCI  DPLNW +AA+++ GSHLDEVKRMVAEFR P VK+GG+TLTV+QVA IAA
Sbjct  9    NGVATDFCINKDPLNWGVAAEAMTGSHLDEVKRMVAEFRKPVVKLGGETLTVSQVAGIAA  68

Query  316  RDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQE  489
              ++  VKVELSE ARAGVKASSDWVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+E
Sbjct  69   AGDSSVVKVELSEAARAGVKASSDWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKE  128

Query  490  LI-RFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            LI RFLNAGIFG G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN N
Sbjct  129  LIRRFLNAGIFGNGSESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNTN  187



>gb|AJO53274.1| phenylalanine ammonia-lyase [Pogostemon cablin]
Length=715

 Score =   292 bits (748),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 147/188 (78%), Positives = 159/188 (85%), Gaps = 8/188 (4%)
 Frame = +1

Query  118  MEGAIENGHSND----FCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQ  279
            M  A ENGH N     FC+K   DPLNW  AA++LKGSHL+EVKRMV EFR P VK+GG+
Sbjct  1    MAAATENGHRNGAVNGFCVKAQGDPLNWGAAAEALKGSHLEEVKRMVEEFRKPVVKLGGE  60

Query  280  TLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRR  459
            +LT++QVAAIAARDNAV VEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRR
Sbjct  61   SLTISQVAAIAARDNAVAVELAEPARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRR  120

Query  460  TKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEA  633
            TK G ALQ+ELIR LNAGIFG+GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEA
Sbjct  121  TKQGGALQKELIRSLNAGIFGSGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEA  180

Query  634  ITKLLNHN  657
            ITK LN N
Sbjct  181  ITKFLNKN  188



>sp|O23924.1|PALY_DIGLA RecName: Full=Phenylalanine ammonia-lyase [Digitalis lanata]
 emb|CAA05251.1| phenylalanine ammonia lyase [Digitalis lanata]
Length=713

 Score =   292 bits (747),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 157/185 (85%), Gaps = 5/185 (3%)
 Frame = +1

Query  118  MEGAIENGH--SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  288
            M   +ENGH  +N FC+K  DPLNW  AA+ LKGSHLDEVKRMV EFR   VK+GG+TLT
Sbjct  1    MAAVVENGHHGNNGFCVKQNDPLNWVAAAEELKGSHLDEVKRMVEEFRKTVVKLGGETLT  60

Query  289  VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  468
            ++QVAAIAARDN V V+L+E +RAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK 
Sbjct  61   ISQVAAIAARDNEVAVQLAESSRAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQ  120

Query  469  GHALQQELIRFLNAGIFGTGTG--HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  642
            G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILE ITK
Sbjct  121  GGALQKELIRFLNAGIFGNGTESTHTLPHSATRAAMLVRINTLLQGYSGIRFEILETITK  180

Query  643  LLNHN  657
             LNHN
Sbjct  181  FLNHN  185



>ref|XP_009766905.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana sylvestris]
 gb|ACJ66297.1| phenylalanine ammonia-lyase 4 [Nicotiana tabacum]
 gb|ACJ66298.1| phenylalanine ammonia-lyase 4 [Nicotiana tabacum]
Length=717

 Score =   292 bits (747),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 159/187 (85%), Gaps = 13/187 (7%)
 Frame = +1

Query  136  NGHSN-----DFCIK---VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  291
            NGH N     + C K    DPLNWEMAA+SL+GSHLDEVK+MV+EFR P VK+GG+TLTV
Sbjct  4    NGHVNGGENFELCKKSSATDPLNWEMAAESLRGSHLDEVKKMVSEFRKPMVKLGGETLTV  63

Query  292  AQVAAIAARD---NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  462
            AQVAAIA RD   N VKVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRT
Sbjct  64   AQVAAIAVRDKSANGVKVELSEEARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRT  123

Query  463  KNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  636
            KNG ALQ+ELIRFLNAG+FG G  T HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI
Sbjct  124  KNGGALQKELIRFLNAGVFGNGTETSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  183

Query  637  TKLLNHN  657
             KL+N N
Sbjct  184  AKLINSN  190



>gb|AEO92028.1| phenylalanine ammonia-lyase 2 [Coffea canephora]
 gb|AEO94540.1| phenylalanine ammonia-lyase 2 [Coffea canephora]
Length=711

 Score =   292 bits (747),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 157/184 (85%), Gaps = 8/184 (4%)
 Frame = +1

Query  130  IENGHS-----NDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  294
            +ENGH      ++FC+K DPLNW +AA+SL GSHLDEVKRMVAEFR P VK GG++LTVA
Sbjct  1    MENGHDECVKVSEFCLKSDPLNWGVAAESLMGSHLDEVKRMVAEFRKPVVKFGGESLTVA  60

Query  295  QVAAIAAR-DNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  471
            QVAAIAA+ D  VKVEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRT  G
Sbjct  61   QVAAIAAKGDQGVKVELAEDARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTNQG  120

Query  472  HALQQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  645
             ALQ+ELIRFLNAGIFG G  T HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  
Sbjct  121  GALQKELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITTF  180

Query  646  LNHN  657
            LNHN
Sbjct  181  LNHN  184



>gb|ABQ63094.1| phenylalanine ammonia-lyase [Astragalus membranaceus]
Length=718

 Score =   291 bits (746),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 162/191 (85%), Gaps = 11/191 (6%)
 Frame = +1

Query  118  MEGAIENGH-SN-----DFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKI  270
            MEG   NGH SN     ++CI     DPLNW +AA++LKGSHLDEVKRMV E+RNP VKI
Sbjct  1    MEGEGANGHVSNHVTEAEYCISKAGGDPLNWGVAAEALKGSHLDEVKRMVEEYRNPVVKI  60

Query  271  GGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  450
            GG+TLT+AQVA IA+ D  VKVELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS
Sbjct  61   GGETLTIAQVAGIASHDGGVKVELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  120

Query  451  HRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEI  624
            HRRTK G ALQ+ELIRFLNAGIFG GT    TLPH+ATRAAMLVRINTLLQGYSGIRFEI
Sbjct  121  HRRTKQGGALQKELIRFLNAGIFGNGTESNCTLPHTATRAAMLVRINTLLQGYSGIRFEI  180

Query  625  LEAITKLLNHN  657
            LEAITKLLN+N
Sbjct  181  LEAITKLLNNN  191



>gb|AGL50914.1| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   291 bits (746),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 156/183 (85%), Gaps = 8/183 (4%)
 Frame = +1

Query  133  ENGHSND------FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  294
            +NGH  +       CIK DPLNW +AADSLKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  11   KNGHHQNGAVESPLCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  70

Query  295  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  474
            QVAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTK G 
Sbjct  71   QVAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKQGA  130

Query  475  ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  648
            ALQ+ELIRFLNAG+FG+ T  GHTLPH ATRAAMLVRINTLLQGYSGIRFEILEAITK L
Sbjct  131  ALQKELIRFLNAGVFGSATESGHTLPHQATRAAMLVRINTLLQGYSGIRFEILEAITKFL  190

Query  649  NHN  657
            N+N
Sbjct  191  NNN  193



>ref|XP_009342990.1| PREDICTED: phenylalanine ammonia-lyase 1 [Pyrus x bretschneideri]
Length=720

 Score =   291 bits (746),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 156/183 (85%), Gaps = 8/183 (4%)
 Frame = +1

Query  133  ENGHSND------FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  294
            +NGH  +       CIK DPLNW +AADSLKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  11   KNGHHQNGAVESPLCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  70

Query  295  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  474
            QVAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTK G 
Sbjct  71   QVAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKQGA  130

Query  475  ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  648
            ALQ+ELIRFLNAG+FG+ T  GHTLPH ATRAAMLVRINTLLQGYSGIRFEILEAITK L
Sbjct  131  ALQKELIRFLNAGVFGSATESGHTLPHQATRAAMLVRINTLLQGYSGIRFEILEAITKFL  190

Query  649  NHN  657
            N+N
Sbjct  191  NNN  193



>gb|AAX84839.1| phenylalanine ammonia-lyase [Astragalus mongholicus]
Length=718

 Score =   291 bits (745),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 161/191 (84%), Gaps = 11/191 (6%)
 Frame = +1

Query  118  MEGAIENGH-SN-----DFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKI  270
            MEG   NGH SN     +FCI     DPLNW  AA++LKGSHLDEVKRMV E+RNP VKI
Sbjct  1    MEGEGANGHVSNHATEAEFCISKTGGDPLNWGAAAEALKGSHLDEVKRMVEEYRNPVVKI  60

Query  271  GGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  450
            GG+TLT+AQVA IA+ D  VKVELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS
Sbjct  61   GGETLTIAQVAGIASHDGGVKVELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  120

Query  451  HRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEI  624
            HRRT+ G ALQ+ELIRFLNAGIFG GT    TLPH+ATRAAMLVRINTLLQGYSGIRFEI
Sbjct  121  HRRTRQGGALQKELIRFLNAGIFGNGTESNCTLPHTATRAAMLVRINTLLQGYSGIRFEI  180

Query  625  LEAITKLLNHN  657
            LEAITKLLN+N
Sbjct  181  LEAITKLLNNN  191



>gb|KJB16792.1| hypothetical protein B456_002G248000 [Gossypium raimondii]
Length=721

 Score =   291 bits (745),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 157/184 (85%), Gaps = 10/184 (5%)
 Frame = +1

Query  136  NGHSNDFC--------IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  291
            NGH   FC        + VDPLNW +AA+SLKGSHLDEVKRMVAEFR P VK+GG+TLT+
Sbjct  11   NGHLQSFCSTTNGGVGVLVDPLNWGVAAESLKGSHLDEVKRMVAEFRKPLVKLGGETLTI  70

Query  292  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  471
            +QVAAIA RD  VKVELSE ARAGVKAS+DWV++ MN GTDSYGVTTGFGATSHRRTK G
Sbjct  71   SQVAAIATRDLGVKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTKQG  130

Query  472  HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  645
             ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL
Sbjct  131  AALQKELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  190

Query  646  LNHN  657
            LN+N
Sbjct  191  LNNN  194



>gb|AFG30054.1| phenylalanine ammonialyase [Malus hybrid cultivar]
Length=720

 Score =   291 bits (745),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 155/180 (86%), Gaps = 6/180 (3%)
 Frame = +1

Query  124  GAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  303
            GA+E+      CIK DPLNW +AADSLKGSHLDEVKRMVAE+R P VK+GG++LT++QVA
Sbjct  18   GAVES----PLCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQVA  73

Query  304  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  483
            AIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTK G ALQ
Sbjct  74   AIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKQGAALQ  133

Query  484  QELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            +ELIRFLNAG+FG+ T  GHTLPH ATRAAMLVRINTLLQGYSGIRFEILEAITK LN N
Sbjct  134  KELIRFLNAGVFGSATESGHTLPHQATRAAMLVRINTLLQGYSGIRFEILEAITKFLNSN  193



>gb|AER12109.1| PAL [Gossypium hirsutum]
Length=721

 Score =   291 bits (745),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 157/184 (85%), Gaps = 10/184 (5%)
 Frame = +1

Query  136  NGHSNDFC--------IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  291
            NGH   FC        + VDPLNW +AA+SLKGSHLDEVKRMVAEFR P VK+GG+TLT+
Sbjct  11   NGHLQSFCSTTNGGVGVLVDPLNWGVAAESLKGSHLDEVKRMVAEFRKPLVKLGGETLTI  70

Query  292  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  471
            +QVAAIA RD  VKVELSE ARAGVKAS+DWV++ MN GTDSYGVTTGFGATSHRRTK G
Sbjct  71   SQVAAIATRDLGVKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTKQG  130

Query  472  HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  645
             ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL
Sbjct  131  AALQKELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  190

Query  646  LNHN  657
            LN+N
Sbjct  191  LNNN  194



>ref|XP_008387584.1| PREDICTED: phenylalanine ammonia-lyase 1 [Malus domestica]
Length=720

 Score =   291 bits (745),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 155/180 (86%), Gaps = 6/180 (3%)
 Frame = +1

Query  124  GAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  303
            GA+E+      CIK DPLNW +AADSLKGSHLDEVKRMVAE+R P VK+GG++LT++QVA
Sbjct  18   GAVES----PLCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQVA  73

Query  304  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  483
            AIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTK G ALQ
Sbjct  74   AIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKQGAALQ  133

Query  484  QELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            +ELIRFLNAG+FG+ T  GHTLPH ATRAAMLVRINTLLQGYSGIRFEILEAITK LN N
Sbjct  134  KELIRFLNAGVFGSATESGHTLPHQATRAAMLVRINTLLQGYSGIRFEILEAITKFLNSN  193



>gb|ABD42947.1| phenylalanine ammonia lyase [Acacia auriculiformis x Acacia mangium]
Length=714

 Score =   291 bits (744),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 154/178 (87%), Gaps = 7/178 (4%)
 Frame = +1

Query  145  SNDFCIK-----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAI  309
            ++ FC+       DPLNW +AA+SLKGSHLDEVKRMV EFR P V++GG+TLT++QVAAI
Sbjct  11   ADSFCLSGGVAAADPLNWGVAAESLKGSHLDEVKRMVEEFRKPVVRLGGETLTISQVAAI  70

Query  310  AARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQE  489
            AA D  VKVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G ALQ+E
Sbjct  71   AAHDQGVKVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGAALQKE  130

Query  490  LIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            LIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LNHN
Sbjct  131  LIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHN  188



>gb|AEM63671.1| phenylalanine ammonia lyase 2 [Platycodon grandiflorus]
Length=708

 Score =   291 bits (744),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 157/181 (87%), Gaps = 5/181 (3%)
 Frame = +1

Query  127  AIENGHSND--FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  300
            A  NGHS +  FC++ DPLNW  AA+ LKGSHLDEVK+MV EFR P V++GG+TLT+AQV
Sbjct  2    AYSNGHSKNGGFCVE-DPLNWGKAAEGLKGSHLDEVKKMVEEFRKPVVQLGGKTLTIAQV  60

Query  301  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  480
            AAIA  D+ VKVELSE ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATSHRRTK G AL
Sbjct  61   AAIATHDSGVKVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTKEGGAL  120

Query  481  QQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH  654
            Q+ELIRFLNAGIFG GT   HTLPHS TRA+MLVRINTLLQGYSGIRFEILEAIT+ LNH
Sbjct  121  QKELIRFLNAGIFGNGTESSHTLPHSTTRASMLVRINTLLQGYSGIRFEILEAITEFLNH  180

Query  655  N  657
            N
Sbjct  181  N  181



>gb|AIL23235.1| phenylalanine ammonia-lyase [Astragalus chrysochlorus]
Length=719

 Score =   291 bits (744),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 162/191 (85%), Gaps = 11/191 (6%)
 Frame = +1

Query  118  MEGAIENGH-SN-----DFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKI  270
            MEG   NGH SN     +FCI     DPLNW +AA+++KGSHLDEVKRMV ++RNP VKI
Sbjct  1    MEGEGANGHVSNNVTEAEFCITKTGGDPLNWGVAAEAMKGSHLDEVKRMVEQYRNPVVKI  60

Query  271  GGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  450
            GG+TLTVAQVA IA+ D  VKVELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS
Sbjct  61   GGETLTVAQVAGIASHDGGVKVELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  120

Query  451  HRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEI  624
            HRRTK G ALQ+ELIRFLNAGIFG GT    TLPH+ATRAAMLVRINTLLQGYSGIRFEI
Sbjct  121  HRRTKQGGALQKELIRFLNAGIFGNGTESNCTLPHTATRAAMLVRINTLLQGYSGIRFEI  180

Query  625  LEAITKLLNHN  657
            LEAITKLLN+N
Sbjct  181  LEAITKLLNNN  191



>gb|AEZ67457.1| phenylalanine ammonia-lyase [Perilla frutescens]
Length=711

 Score =   290 bits (743),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 149/165 (90%), Gaps = 2/165 (1%)
 Frame = +1

Query  169  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  348
            DPLNW MAA+SLKG HLDEVKRMV EFR P VK+GG+TLT++QVAAIAARDNAV VEL+E
Sbjct  20   DPLNWVMAAESLKGIHLDEVKRMVEEFRKPVVKLGGETLTISQVAAIAARDNAVAVELAE  79

Query  349  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  528
             ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG G
Sbjct  80   SARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNG  139

Query  529  T--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            T   HTLPHSATRAAMLVRINTLLQGYSGIRFEI+EAITK LNHN
Sbjct  140  TESNHTLPHSATRAAMLVRINTLLQGYSGIRFEIMEAITKFLNHN  184



>gb|ADF59061.1| phenylalanine ammonia-lyase 1 precursor [Pyrus x bretschneideri]
Length=719

 Score =   290 bits (743),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 154/182 (85%), Gaps = 7/182 (4%)
 Frame = +1

Query  133  ENGHSN-----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  297
            +NGH N       CIK DPLNW + ADSLKGSHLDEVKRMVAE+R P VK+GG++LT++Q
Sbjct  11   QNGHQNRVSESPLCIKKDPLNWGLVADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQ  70

Query  298  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  477
            VAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRT  G A
Sbjct  71   VAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTNKGAA  130

Query  478  LQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  651
            LQ+ELIRFLNAG+FG+ T  GHTLPH ATRAAMLVRINTLLQGYSGIRFEILEAITK LN
Sbjct  131  LQKELIRFLNAGVFGSATESGHTLPHQATRAAMLVRINTLLQGYSGIRFEILEAITKFLN  190

Query  652  HN  657
            +N
Sbjct  191  NN  192



>ref|XP_006354339.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=722

 Score =   290 bits (743),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 149/195 (76%), Positives = 161/195 (83%), Gaps = 15/195 (8%)
 Frame = +1

Query  118  MEGAIENGHSN------DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVK  267
            M    +NGH N      + C K     DPLNWEMAADSL+GSHLDEVK+MVAEFR P VK
Sbjct  1    MASIAQNGHVNGEVVAMELCKKSINVDDPLNWEMAADSLRGSHLDEVKKMVAEFRKPIVK  60

Query  268  IGGQTLTVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGF  438
            +GG+TLTVAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGF
Sbjct  61   LGGETLTVAQVASIANADNKSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGF  120

Query  439  GATSHRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGI  612
            GATSHRRTKNG ALQ+ELIRFLNAG+FG GT   HTLPHSATRAAMLVRINTLLQGYSGI
Sbjct  121  GATSHRRTKNGGALQKELIRFLNAGVFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGI  180

Query  613  RFEILEAITKLLNHN  657
            RFEILEAITKL+N N
Sbjct  181  RFEILEAITKLINSN  195



>gb|AEL21617.1| phenylalanine ammonia lyase 2 [Coffea arabica]
Length=711

 Score =   290 bits (742),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 157/184 (85%), Gaps = 8/184 (4%)
 Frame = +1

Query  130  IENGHS-----NDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  294
            +ENGH      ++FC+K DPLNW +AA+SL GSHLDEVKRMVAEFR P VK+GG++LTVA
Sbjct  1    MENGHDEGVKVSEFCLKSDPLNWGVAAESLMGSHLDEVKRMVAEFRKPVVKLGGESLTVA  60

Query  295  QVAAIAAR-DNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  471
            QVAAIAA+ D  VKVEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRT  G
Sbjct  61   QVAAIAAKGDQGVKVELAEDARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTNQG  120

Query  472  HALQQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  645
             ALQ+ELIRFLNAGIFG G  T H LPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  
Sbjct  121  GALQKELIRFLNAGIFGNGTETCHMLPHSATRAAMLVRINTLLQGYSGIRFEILEAITTF  180

Query  646  LNHN  657
            LNHN
Sbjct  181  LNHN  184



>sp|O49836.1|PAL2_LITER RecName: Full=Phenylalanine ammonia-lyase 2; Short=PAL-2 [Lithospermum 
erythrorhizon]
 dbj|BAA24929.1| phenylalanine ammonia-lyase [Lithospermum erythrorhizon]
Length=705

 Score =   290 bits (742),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 157/179 (88%), Gaps = 4/179 (2%)
 Frame = +1

Query  130  IENGHSN-DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAA  306
            +ENG+   +FC+K DPLNW MAA+S+KGSHLDEVK+MVAEFR P V++ G+TLT+AQVAA
Sbjct  1    MENGNGKMEFCMK-DPLNWGMAAESMKGSHLDEVKKMVAEFRKPVVQLAGKTLTIAQVAA  59

Query  307  IAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQ  486
            IAARD+ V VEL+E AR GVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+
Sbjct  60   IAARDDGVTVELAEAAREGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQK  119

Query  487  ELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            ELIRFLNAGIFG G  T HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN N
Sbjct  120  ELIRFLNAGIFGNGTETSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNTN  178



>ref|XP_006364021.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=723

 Score =   290 bits (741),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 159/190 (84%), Gaps = 15/190 (8%)
 Frame = +1

Query  133  ENGHSN--------DFCIK--VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  282
            +NGH N        D C K   DPLNWEMAADSL+GSHLDEVK+MV EFR P VK+GG+T
Sbjct  7    QNGHINGEVEEVAMDLCKKSNYDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGET  66

Query  283  LTVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  453
            LTVAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSH
Sbjct  67   LTVAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSH  126

Query  454  RRTKNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEIL  627
            RRTKNG ALQ+ELIRFLNAG+FG G  T HTLPHSATRAAMLVRINTLLQGYSGIRFEIL
Sbjct  127  RRTKNGGALQKELIRFLNAGVFGNGTETSHTLPHSATRAAMLVRINTLLQGYSGIRFEIL  186

Query  628  EAITKLLNHN  657
            EAITKL+N N
Sbjct  187  EAITKLINSN  196



>dbj|BAA31258.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=319

 Score =   278 bits (711),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 150/172 (87%), Gaps = 3/172 (2%)
 Frame = +1

Query  148  NDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNA  327
              FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  
Sbjct  13   ESFCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGD  71

Query  328  VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLN  507
            V VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELI+FLN
Sbjct  72   VGVELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIKFLN  131

Query  508  AGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            AGIFG G  + HTLPHS TRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  132  AGIFGNGRESCHTLPHSTTRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  183



>sp|P45728.1|PAL2_PETCR RecName: Full=Phenylalanine ammonia-lyase 2 [Petroselinum crispum]
 emb|CAA57056.1| phenylalanine ammonia-lyase 2 [Petroselinum crispum]
Length=716

 Score =   289 bits (740),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 160/184 (87%), Gaps = 6/184 (3%)
 Frame = +1

Query  124  GAIENGHSN----DFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  288
            GAI NGH N    DFC+K  DPL W +AA+++ GSHLDEVK+MVAE+R P VK+GG+TLT
Sbjct  6    GAITNGHVNGNGMDFCMKTEDPLYWGIAAEAMTGSHLDEVKKMVAEYRKPVVKLGGETLT  65

Query  289  VAQVAAIAARD-NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  465
            ++QVAAI+ARD + V VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK
Sbjct  66   ISQVAAISARDGSGVTVELSEAARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTK  125

Query  466  NGHALQQELIRFLNAGIFGTGTGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  645
             G ALQ+ELIRFLNAGIFG G+ +TLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK 
Sbjct  126  QGGALQKELIRFLNAGIFGNGSDNTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKF  185

Query  646  LNHN  657
            LN N
Sbjct  186  LNQN  189



>ref|XP_004246649.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X1 [Solanum 
lycopersicum]
Length=721

 Score =   289 bits (740),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 159/189 (84%), Gaps = 13/189 (7%)
 Frame = +1

Query  130  IENGHSN----DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  285
            ++NGH N    D C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK+GG+TL
Sbjct  6    VQNGHVNGEAMDLCKKSINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGETL  65

Query  286  TVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  456
            TVAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHR
Sbjct  66   TVAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHR  125

Query  457  RTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILE  630
            RTKNG ALQ+ELIRFLNAG+FG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILE
Sbjct  126  RTKNGGALQKELIRFLNAGVFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEILE  185

Query  631  AITKLLNHN  657
            AITKL+N N
Sbjct  186  AITKLINSN  194



>ref|XP_004246650.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum lycopersicum]
Length=721

 Score =   289 bits (740),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 159/189 (84%), Gaps = 13/189 (7%)
 Frame = +1

Query  130  IENGHSN----DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  285
            ++NGH N    D C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK+GG+TL
Sbjct  6    VQNGHVNGEAMDLCKKSINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGETL  65

Query  286  TVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  456
            TVAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHR
Sbjct  66   TVAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHR  125

Query  457  RTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILE  630
            RTKNG ALQ+ELIRFLNAG+FG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILE
Sbjct  126  RTKNGGALQKELIRFLNAGVFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEILE  185

Query  631  AITKLLNHN  657
            AITKL+N N
Sbjct  186  AITKLINSN  194



>gb|AFP24940.1| phenylalanine ammonia lyase [Prunus salicina]
Length=717

 Score =   289 bits (740),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 158/183 (86%), Gaps = 8/183 (4%)
 Frame = +1

Query  133  ENGHSN------DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  294
            +NGH N      + CIK DPLNW +AA++LKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  8    QNGHQNGSLESSELCIKKDPLNWGVAAETLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  67

Query  295  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  474
            QVAAIA  D+ VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G 
Sbjct  68   QVAAIATHDSGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGA  127

Query  475  ALQQELIRFLNAGIFGT--GTGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  648
            ALQ+ELIRFLNAG+FG+   +GHTLPH ATRAAMLVRINTLLQGYSGIRFEILE ITK L
Sbjct  128  ALQKELIRFLNAGVFGSTKESGHTLPHQATRAAMLVRINTLLQGYSGIRFEILEVITKFL  187

Query  649  NHN  657
            N+N
Sbjct  188  NNN  190



>gb|AEZ01784.1| phenylalanine ammonia-lyase [Pyrus x bretschneideri]
Length=719

 Score =   289 bits (740),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 153/182 (84%), Gaps = 7/182 (4%)
 Frame = +1

Query  133  ENGHSN-----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  297
            +NGH N       CIK DPLNW + ADSLKGSHLDEVKRMVAE+R P VK+GG++LT++Q
Sbjct  11   QNGHQNGVSESPLCIKKDPLNWGLVADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQ  70

Query  298  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  477
            VAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRT  G A
Sbjct  71   VAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTNKGAA  130

Query  478  LQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  651
            LQ+ELIRFLNAG+FG+ T  GHTLPH ATRAAMLVRINT LQGYSGIRFEILEAITK LN
Sbjct  131  LQKELIRFLNAGVFGSATESGHTLPHQATRAAMLVRINTFLQGYSGIRFEILEAITKFLN  190

Query  652  HN  657
            +N
Sbjct  191  NN  192



>ref|XP_004246651.1| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=721

 Score =   289 bits (740),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 159/189 (84%), Gaps = 13/189 (7%)
 Frame = +1

Query  130  IENGHSN----DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  285
            ++NGH N    D C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK+GG+TL
Sbjct  6    VQNGHVNGEAMDLCKKSINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGETL  65

Query  286  TVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  456
            TVAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHR
Sbjct  66   TVAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHR  125

Query  457  RTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILE  630
            RTKNG ALQ+ELIRFLNAG+FG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILE
Sbjct  126  RTKNGGALQKELIRFLNAGVFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEILE  185

Query  631  AITKLLNHN  657
            AITKL+N N
Sbjct  186  AITKLINSN  194



>gb|ABB70117.2| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   289 bits (739),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 155/183 (85%), Gaps = 8/183 (4%)
 Frame = +1

Query  133  ENGHSND------FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  294
            +NGH  +       CIK DPLNW +AADSLKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  11   KNGHHQNGAVESPLCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  70

Query  295  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  474
            QVAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRT  G 
Sbjct  71   QVAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTNKGA  130

Query  475  ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  648
            ALQ+ELIRFLNAG+FG+ T  GHTLPH ATRAAMLVRINTLLQGYSGIRFEILEAITK L
Sbjct  131  ALQKELIRFLNAGVFGSATESGHTLPHQATRAAMLVRINTLLQGYSGIRFEILEAITKFL  190

Query  649  NHN  657
            N+N
Sbjct  191  NNN  193



>sp|P26600.1|PAL5_SOLLC RecName: Full=Phenylalanine ammonia-lyase; Short=PAL [Solanum 
lycopersicum]
 gb|AAA34176.1| phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=721

 Score =   289 bits (739),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 159/189 (84%), Gaps = 13/189 (7%)
 Frame = +1

Query  130  IENGHSN----DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  285
            ++NGH N    D C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK+GG+TL
Sbjct  6    VQNGHVNGEAMDLCKKSINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGETL  65

Query  286  TVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  456
            TVAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHR
Sbjct  66   TVAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHR  125

Query  457  RTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILE  630
            RTKNG ALQ+ELIRFLNAG+FG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILE
Sbjct  126  RTKNGGALQKELIRFLNAGVFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEILE  185

Query  631  AITKLLNHN  657
            AITKL+N N
Sbjct  186  AITKLINSN  194



>gb|AGL81344.1| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   289 bits (739),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 155/183 (85%), Gaps = 8/183 (4%)
 Frame = +1

Query  133  ENGHSND------FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  294
            +NGH  +       CIK DPLNW +AADSLKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  11   KNGHHQNGAVESPLCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  70

Query  295  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  474
            QVAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRT  G 
Sbjct  71   QVAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTNKGA  130

Query  475  ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  648
            ALQ+ELIRFLNAG+FG+ T  GHTLPH ATRAAMLVRINTLLQGYSGIRFEILEAITK L
Sbjct  131  ALQKELIRFLNAGVFGSATESGHTLPHQATRAAMLVRINTLLQGYSGIRFEILEAITKFL  190

Query  649  NHN  657
            N+N
Sbjct  191  NNN  193



>sp|O64963.1|PAL1_PRUAV RecName: Full=Phenylalanine ammonia-lyase 1 [Prunus avium]
 gb|AAC78457.1| phenylalanine ammonia-lyase [Prunus avium]
Length=717

 Score =   289 bits (739),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 158/183 (86%), Gaps = 8/183 (4%)
 Frame = +1

Query  133  ENGHSN------DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  294
            +NGH N      + CIK DPLNW +AA++LKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  8    QNGHKNGSVELPELCIKKDPLNWGVAAETLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  67

Query  295  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  474
            QVAAIA  D+ VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G 
Sbjct  68   QVAAIATHDSGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGA  127

Query  475  ALQQELIRFLNAGIFGT--GTGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  648
            ALQ+ELIRFLNAG+FG+   +GHTLPH ATRAAMLVRINTLLQGYSGIRFEILE ITK L
Sbjct  128  ALQKELIRFLNAGVFGSTKESGHTLPHQATRAAMLVRINTLLQGYSGIRFEILEVITKFL  187

Query  649  NHN  657
            N+N
Sbjct  188  NNN  190



>ref|XP_007208432.1| hypothetical protein PRUPE_ppa002099mg [Prunus persica]
 gb|EMJ09631.1| hypothetical protein PRUPE_ppa002099mg [Prunus persica]
Length=717

 Score =   289 bits (739),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 158/183 (86%), Gaps = 8/183 (4%)
 Frame = +1

Query  133  ENGHSN------DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  294
            +NGH N      + CIK DPLNW +AA++LKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  8    QNGHQNRSLESSELCIKKDPLNWGVAAETLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  67

Query  295  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  474
            QVAAIA  D+ VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G 
Sbjct  68   QVAAIATHDSGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGA  127

Query  475  ALQQELIRFLNAGIFGT--GTGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  648
            ALQ+ELIRFLNAG+FG+   +GHTLPH ATRAAMLVRINTLLQGYSGIRFEILE ITK L
Sbjct  128  ALQKELIRFLNAGVFGSTKESGHTLPHQATRAAMLVRINTLLQGYSGIRFEILEVITKFL  187

Query  649  NHN  657
            N+N
Sbjct  188  NNN  190



>gb|AAK15640.1|AF326116_1 phenylalanine ammonia-lyase [Agastache rugosa]
Length=716

 Score =   289 bits (739),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 157/180 (87%), Gaps = 6/180 (3%)
 Frame = +1

Query  136  NGH---SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  303
            NGH   +N FC+K  DPLNW  AA+SLKGSHL+EVKRMV EFR P VK+GG+TLT++QVA
Sbjct  10   NGHNNGANGFCVKQNDPLNWAAAAESLKGSHLEEVKRMVEEFRKPVVKLGGETLTISQVA  69

Query  304  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  483
            AIAA+DNAV VEL+E ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G ALQ
Sbjct  70   AIAAKDNAVAVELAESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGALQ  129

Query  484  QELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            +ELIRFLNAGIFG  T   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITK LN N
Sbjct  130  KELIRFLNAGIFGNATESNHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKFLNQN  189



>ref|XP_009794410.1| PREDICTED: phenylalanine ammonia-lyase-like [Nicotiana sylvestris]
Length=717

 Score =   288 bits (738),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 156/182 (86%), Gaps = 8/182 (4%)
 Frame = +1

Query  136  NGHSN-DFCIK----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  300
            NGHS+ +FCIK     DPLNW MAA +L GSHLDEVK+MV EFR PAV++GG+TLTVAQV
Sbjct  9    NGHSSQEFCIKGHQQEDPLNWNMAAAALSGSHLDEVKKMVEEFRKPAVRLGGETLTVAQV  68

Query  301  AAIAARD-NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  477
            AAIA R    VKVELSEGARAGVKASSDWVM  MN GTDSYGVTTGFGATSHRRTK G A
Sbjct  69   AAIAGRSGTEVKVELSEGARAGVKASSDWVMEGMNKGTDSYGVTTGFGATSHRRTKQGAA  128

Query  478  LQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  651
            LQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN
Sbjct  129  LQKELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  188

Query  652  HN  657
             N
Sbjct  189  SN  190



>gb|KHG04887.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=728

 Score =   288 bits (738),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 156/184 (85%), Gaps = 10/184 (5%)
 Frame = +1

Query  136  NGHSNDFC--------IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  291
            NGH   FC        + VDPLNW +AA+SLKGSHLDEVKRMVAEFR P VK+GG+TLT+
Sbjct  18   NGHLQSFCSATNGGVGVVVDPLNWGVAAESLKGSHLDEVKRMVAEFRKPLVKLGGETLTI  77

Query  292  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  471
            +QVAAIA RD  VKVELSE A AGVKAS+DWV++ MN GTDSYGVTTGFGATSHRRTK G
Sbjct  78   SQVAAIATRDLGVKVELSEDAMAGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTKQG  137

Query  472  HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  645
             ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL
Sbjct  138  AALQKELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  197

Query  646  LNHN  657
            LN+N
Sbjct  198  LNNN  201



>ref|XP_008355619.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase 1-like 
[Malus domestica]
Length=720

 Score =   288 bits (737),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 154/183 (84%), Gaps = 8/183 (4%)
 Frame = +1

Query  133  ENGH------SNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  294
            +NGH       +  CIK DPLNW + ADSLKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  11   QNGHHQNGVSESQLCIKKDPLNWGLVADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  70

Query  295  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  474
            QVAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRT  G 
Sbjct  71   QVAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTNKGA  130

Query  475  ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  648
            ALQ+ELIRFLNAG+FG+ T  GHTLPH ATRAAMLVRINTLLQGYSGIRFEILEAITK L
Sbjct  131  ALQKELIRFLNAGVFGSATESGHTLPHQATRAAMLVRINTLLQGYSGIRFEILEAITKFL  190

Query  649  NHN  657
            N+N
Sbjct  191  NNN  193



>gb|ACF94716.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=719

 Score =   288 bits (737),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 154/175 (88%), Gaps = 7/175 (4%)
 Frame = +1

Query  154  FCIKV-----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAAR  318
             C+K      DPLNW +AA+S+KGSHLDEVKRMV E+RNP V+IGG+TLT++QVAAIA R
Sbjct  18   LCLKSNNTSSDPLNWGVAAESMKGSHLDEVKRMVEEYRNPVVRIGGETLTISQVAAIATR  77

Query  319  DNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIR  498
            D  V +ELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK G ALQ+ELIR
Sbjct  78   DQDVSLELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKQGGALQKELIR  137

Query  499  FLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            FLNAGIFG G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN+N
Sbjct  138  FLNAGIFGNGAVSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNN  192



>dbj|BAF36971.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=717

 Score =   288 bits (737),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 156/181 (86%), Gaps = 6/181 (3%)
 Frame = +1

Query  133  ENGHSNDFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  300
            E+ +S+ FC       DPL+W +AADS+KGSHLDEVKRMVAE+R P VK+GG+TLT+AQV
Sbjct  10   ESLNSSIFCTAAKAGSDPLSWGVAADSMKGSHLDEVKRMVAEYRKPVVKLGGETLTIAQV  69

Query  301  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  480
            AAIAA D  V VEL E ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG+AL
Sbjct  70   AAIAANDQGVSVELCESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGNAL  129

Query  481  QQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH  654
            Q ELIRFLNAGIFG G  T HTLP  ATRAAMLVRINTLLQGYSGIRFEILEAITKL+N+
Sbjct  130  QLELIRFLNAGIFGNGTETSHTLPQPATRAAMLVRINTLLQGYSGIRFEILEAITKLINN  189

Query  655  N  657
            N
Sbjct  190  N  190



>ref|XP_007027354.1| PHE ammonia lyase 1 [Theobroma cacao]
 gb|EOY07856.1| PHE ammonia lyase 1 [Theobroma cacao]
Length=722

 Score =   288 bits (737),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 158/195 (81%), Gaps = 15/195 (8%)
 Frame = +1

Query  118  MEGAIENGHSN----DFCIK---------VDPLNWEMAADSLKGSHLDEVKRMVAEFRNP  258
            ME   +NG  N     FC           VDPLNW   A+SLKGSHLDEVKRMVAE+R P
Sbjct  1    METIAQNGRQNGSLESFCTTASTATKGAVVDPLNWGATAESLKGSHLDEVKRMVAEYRKP  60

Query  259  AVKIGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGF  438
            +VK+GG+TLT++QVAAIA RD  VKVELSE ARAGVKAS+DWV++ MN GTDSYGVTTGF
Sbjct  61   SVKLGGETLTISQVAAIATRDLGVKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGF  120

Query  439  GATSHRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGI  612
            GATSHRRTK G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGI
Sbjct  121  GATSHRRTKQGAALQKELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGI  180

Query  613  RFEILEAITKLLNHN  657
            RFEILEAITKLLNHN
Sbjct  181  RFEILEAITKLLNHN  195



>sp|O04058.2|PALY_HELAN RecName: Full=Phenylalanine ammonia-lyase [Helianthus annuus]
 emb|CAA73065.1| phenylalanine ammonia lyase [Helianthus annuus]
Length=667

 Score =   286 bits (733),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 155/178 (87%), Gaps = 5/178 (3%)
 Frame = +1

Query  136  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  315
            NG +N FCIK DPLNW +AA++L GSHLDEVK+MV EFR P VK+GG+TLTV+QVA I+A
Sbjct  8    NGSANGFCIK-DPLNWGVAAEALTGSHLDEVKKMVGEFRKPVVKLGGETLTVSQVAGISA  66

Query  316  --RDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQE  489
                N VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTKNG ALQ+E
Sbjct  67   AGDGNMVKVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGGALQKE  126

Query  490  LIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            LIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN+N
Sbjct  127  LIRFLNAGIFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNNN  184



>gb|ACT53398.1| phenylalanine ammonia-lyase 1 [Ageratina adenophora]
Length=715

 Score =   288 bits (736),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 161/187 (86%), Gaps = 9/187 (5%)
 Frame = +1

Query  124  GAIE-NGHSN---DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  291
            G+IE NG  N    FC+K DPLNW + A+SLKGSHLDEVKRMV EFRNP VK+GG+TLTV
Sbjct  2    GSIEFNGDQNIDNYFCVKGDPLNWGVVAESLKGSHLDEVKRMVTEFRNPVVKLGGETLTV  61

Query  292  AQVAAIA--ARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  462
            +QVAAIA  A D++ +KVELSE AR GVKASS+WVM SMN GTDSYGVTTGFGATSHRRT
Sbjct  62   SQVAAIAVAATDSSNIKVELSESAREGVKASSEWVMESMNKGTDSYGVTTGFGATSHRRT  121

Query  463  KNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  636
            K G ALQ+ELIRFLNAGIFG+GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI
Sbjct  122  KEGGALQKELIRFLNAGIFGSGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  181

Query  637  TKLLNHN  657
            TK LNHN
Sbjct  182  TKFLNHN  188



>ref|XP_008369679.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Malus domestica]
Length=720

 Score =   288 bits (736),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 154/183 (84%), Gaps = 8/183 (4%)
 Frame = +1

Query  133  ENGH------SNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  294
            +NGH       +  CIK DPLNW + ADSLKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  11   QNGHHQNGVSESQLCIKKDPLNWGLVADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  70

Query  295  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  474
            QVAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRT  G 
Sbjct  71   QVAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTNKGA  130

Query  475  ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  648
            ALQ+ELIRFLNAG+FG+ T  GHTLPH ATRAAMLVRINTLLQGYSGIRFEILEAITK L
Sbjct  131  ALQKELIRFLNAGVFGSATESGHTLPHQATRAAMLVRINTLLQGYSGIRFEILEAITKFL  190

Query  649  NHN  657
            N+N
Sbjct  191  NNN  193



>pdb|1W27|A Chain A, Phenylalanine Ammonia-Lyase (Pal) From Petroselinum 
Crispum
 pdb|1W27|B Chain B, Phenylalanine Ammonia-Lyase (Pal) From Petroselinum 
Crispum
Length=714

 Score =   288 bits (736),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 159/184 (86%), Gaps = 6/184 (3%)
 Frame = +1

Query  124  GAIENGHSN----DFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  288
            GA  NGH N    DFC+K  DPL W +AA+++ GSHLDEVK+MVAE+R P VK+GG+TLT
Sbjct  6    GATTNGHVNGNGMDFCMKTEDPLYWGIAAEAMTGSHLDEVKKMVAEYRKPVVKLGGETLT  65

Query  289  VAQVAAIAARD-NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  465
            ++QVAAI+ARD + V VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK
Sbjct  66   ISQVAAISARDGSGVTVELSEAARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTK  125

Query  466  NGHALQQELIRFLNAGIFGTGTGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  645
             G ALQ+ELIRFLNAGIFG G+ +TLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK 
Sbjct  126  QGGALQKELIRFLNAGIFGNGSDNTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKF  185

Query  646  LNHN  657
            LN N
Sbjct  186  LNQN  189



>gb|ACF17667.1| putative phenylalanine ammonia-lyase [Capsicum annuum]
Length=717

 Score =   288 bits (736),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 154/176 (88%), Gaps = 7/176 (4%)
 Frame = +1

Query  151  DFCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDN  324
            D C K   DPLNWEMAA+SLKGSHLDEVK+MV EFR P VK+GG+TLTVAQVA+IA  DN
Sbjct  15   DLCNKSIHDPLNWEMAAESLKGSHLDEVKKMVDEFRKPIVKLGGETLTVAQVASIANADN  74

Query  325  ---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  495
                VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTKNG ALQ+ELI
Sbjct  75   KTCGVKVELSESARAGVKASSDWVMDSMCKGTDSYGVTTGFGATSHRRTKNGGALQKELI  134

Query  496  RFLNAGIFGTGTG--HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            RFLNAG+FG GTG  HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N N
Sbjct  135  RFLNAGVFGNGTGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSN  190



>gb|AIA66448.1| PAL1 [Capsicum annuum]
Length=717

 Score =   288 bits (736),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 154/176 (88%), Gaps = 7/176 (4%)
 Frame = +1

Query  151  DFCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDN  324
            D C K   DPLNWEMAA+SLKGSHLDEVK+MV EFR P VK+GG+TLTVAQVA+IA  DN
Sbjct  15   DLCNKSIHDPLNWEMAAESLKGSHLDEVKKMVDEFRKPIVKLGGETLTVAQVASIANADN  74

Query  325  ---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  495
                VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTKNG ALQ+ELI
Sbjct  75   KTCGVKVELSESARAGVKASSDWVMDSMCKGTDSYGVTTGFGATSHRRTKNGGALQKELI  134

Query  496  RFLNAGIFGTGTG--HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            RFLNAG+FG GTG  HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N N
Sbjct  135  RFLNAGVFGNGTGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSN  190



>gb|AHZ30594.1| phenylalanine ammonia lyase-2, partial [Prunus domestica]
Length=701

 Score =   287 bits (734),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 155/174 (89%), Gaps = 2/174 (1%)
 Frame = +1

Query  142  HSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARD  321
             S++ CIK DPLNW +AA++LKGSHLDEVKRMVAE+R P VK+GG++LT++QVAAIA  D
Sbjct  4    ESSELCIKKDPLNWGVAAETLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQVAAIATHD  63

Query  322  NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRF  501
            + VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRF
Sbjct  64   SGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGAALQKELIRF  123

Query  502  LNAGIFGT--GTGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            LNAG+FG+   +GHTLPH ATRAAMLVRINTLLQGYSGIRFEILE ITK LN+N
Sbjct  124  LNAGVFGSTKESGHTLPHQATRAAMLVRINTLLQGYSGIRFEILEVITKFLNNN  177



>sp|P24481.1|PAL1_PETCR RecName: Full=Phenylalanine ammonia-lyase 1 [Petroselinum crispum]
 emb|CAA68938.1| PAL1 protein [Petroselinum crispum]
Length=716

 Score =   287 bits (735),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 159/184 (86%), Gaps = 6/184 (3%)
 Frame = +1

Query  124  GAIENGHSN----DFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  288
            GA  NGH N    DFC+K  DPL W +AA+++ GSHLDEVK+MVAE+R P VK+GG+TLT
Sbjct  6    GATTNGHVNGNGMDFCMKTEDPLYWGIAAEAMTGSHLDEVKKMVAEYRKPVVKLGGETLT  65

Query  289  VAQVAAIAARD-NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  465
            ++QVAAI+ARD + V VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK
Sbjct  66   ISQVAAISARDGSGVTVELSEAARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTK  125

Query  466  NGHALQQELIRFLNAGIFGTGTGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  645
             G ALQ+ELIRFLNAGIFG G+ +TLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK 
Sbjct  126  QGGALQKELIRFLNAGIFGNGSDNTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKF  185

Query  646  LNHN  657
            LN N
Sbjct  186  LNQN  189



>gb|KHG18863.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=720

 Score =   287 bits (735),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 159/193 (82%), Gaps = 13/193 (7%)
 Frame = +1

Query  118  MEGAIENGHSN----DFCIK-------VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAV  264
            ME   +NGH       FC         +DPLNW +AA+SLKGSHLDEVKRMVAE+RNP V
Sbjct  1    METITQNGHHKGSLESFCTASKGAGGAIDPLNWGVAAESLKGSHLDEVKRMVAEYRNPLV  60

Query  265  KIGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGA  444
            K+GG+TLT++QVAAIA RD  VKVELSE ARAGVKAS+DWV++ MN GTDSYGVTTGFGA
Sbjct  61   KLGGETLTISQVAAIATRDLGVKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGFGA  120

Query  445  TSHRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRF  618
            TSHRRTK G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRF
Sbjct  121  TSHRRTKQGAALQKELIRFLNAGIFGHGTESCHTLPHSATRAAMLVRINTLLQGYSGIRF  180

Query  619  EILEAITKLLNHN  657
            EILEAITKL+N N
Sbjct  181  EILEAITKLINSN  193



>ref|XP_006364022.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=723

 Score =   287 bits (735),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 154/176 (88%), Gaps = 7/176 (4%)
 Frame = +1

Query  151  DFCIK--VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDN  324
            D C K   DPLNWEMAADSL+GSHLDEVK+MV EFR P VK+GG+TLTVAQVA+IA  DN
Sbjct  21   DLCKKSNYDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGETLTVAQVASIANVDN  80

Query  325  ---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  495
                VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTKNG ALQ+ELI
Sbjct  81   KSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKNGGALQKELI  140

Query  496  RFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            RFLNAG+FG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N N
Sbjct  141  RFLNAGVFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSN  196



>gb|KJB36583.1| hypothetical protein B456_006G166000 [Gossypium raimondii]
Length=720

 Score =   287 bits (735),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 159/193 (82%), Gaps = 13/193 (7%)
 Frame = +1

Query  118  MEGAIENGHSN----DFCIK-------VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAV  264
            ME   +NGH       FC         VDPLNW +AA+SLKGSHLDEVKRMVAE+RNP V
Sbjct  1    METITQNGHHKGSLESFCTASKGAGGAVDPLNWGVAAESLKGSHLDEVKRMVAEYRNPLV  60

Query  265  KIGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGA  444
            K+GG+TLT++QVAAIA RD  VKVELSE ARAGVKAS+DWV++ MN GTDSYGVTTGFGA
Sbjct  61   KLGGETLTISQVAAIATRDLGVKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGFGA  120

Query  445  TSHRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRF  618
            TSHRRTK G ALQ+ELIRFLNAG+FG GT   HTLPHSATRAAMLVRINTLLQGYSGIRF
Sbjct  121  TSHRRTKQGAALQKELIRFLNAGVFGHGTESCHTLPHSATRAAMLVRINTLLQGYSGIRF  180

Query  619  EILEAITKLLNHN  657
            EILEAITKL+N N
Sbjct  181  EILEAITKLINSN  193



>ref|XP_008243955.1| PREDICTED: phenylalanine ammonia-lyase 1 [Prunus mume]
Length=717

 Score =   287 bits (735),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 158/183 (86%), Gaps = 8/183 (4%)
 Frame = +1

Query  133  ENGHSN------DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  294
            +NGH N      + CIK DPLNW +AA++LKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  8    QNGHQNGSLESSELCIKKDPLNWGVAAETLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  67

Query  295  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  474
            QVAAIA  D+ VKVELSE A+AGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G 
Sbjct  68   QVAAIATHDSGVKVELSESAQAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGA  127

Query  475  ALQQELIRFLNAGIFGT--GTGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  648
            ALQ+ELIRFLNAG+FG+   +GHTLPH ATRAAMLVRINTLLQGYSGIRFEILE ITK L
Sbjct  128  ALQKELIRFLNAGVFGSTKESGHTLPHQATRAAMLVRINTLLQGYSGIRFEILEVITKFL  187

Query  649  NHN  657
            N+N
Sbjct  188  NNN  190



>dbj|BAE71252.1| putative phenylalanine ammonia lyase [Trifolium pratense]
Length=712

 Score =   287 bits (734),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 159/186 (85%), Gaps = 7/186 (4%)
 Frame = +1

Query  118  MEGAIENGHSN-DFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  285
            MEG I NGH+   FC+     DPLNW  AA+SL GSHLDEVKRMV E+RNP VKIGG TL
Sbjct  1    MEG-ITNGHAEATFCVTKSVGDPLNWGAAAESLTGSHLDEVKRMVEEYRNPLVKIGGATL  59

Query  286  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  465
            T+AQVA IA+ D+ V+VELSE ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATSHRRTK
Sbjct  60   TIAQVAGIASHDSGVRVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTK  119

Query  466  NGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  639
             G ALQ+ELIRFLNAGIFG GT    TLPH+ATRAAMLVRINTLLQGYSGIRFEILEAIT
Sbjct  120  QGGALQKELIRFLNAGIFGNGTESNCTLPHTATRAAMLVRINTLLQGYSGIRFEILEAIT  179

Query  640  KLLNHN  657
            KLLN+N
Sbjct  180  KLLNNN  185



>gb|AAZ29733.1| phenylalanine ammonia lyase [Trifolium pratense]
Length=712

 Score =   287 bits (734),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 159/186 (85%), Gaps = 7/186 (4%)
 Frame = +1

Query  118  MEGAIENGHSN-DFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  285
            MEG I NGH+   FC+     DPLNW  AA+SL GSHLDEVKRMV E+RNP VKIGG TL
Sbjct  1    MEG-ITNGHAEATFCVTKSVGDPLNWGAAAESLTGSHLDEVKRMVEEYRNPLVKIGGATL  59

Query  286  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  465
            T+AQVA IA+ D+ V+VELSE ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATSHRRTK
Sbjct  60   TIAQVAGIASHDSGVRVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTK  119

Query  466  NGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  639
             G ALQ+ELIRFLNAGIFG GT    TLPH+ATRAAMLVRINTLLQGYSGIRFEILEAIT
Sbjct  120  QGGALQKELIRFLNAGIFGNGTESNCTLPHTATRAAMLVRINTLLQGYSGIRFEILEAIT  179

Query  640  KLLNHN  657
            KLLN+N
Sbjct  180  KLLNNN  185



>ref|XP_003521397.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Glycine max]
Length=713

 Score =   287 bits (734),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 156/182 (86%), Gaps = 8/182 (4%)
 Frame = +1

Query  136  NGHSN-DFCIKV-----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  297
            NGH N  FC+       DPLNW  AA+++KGSHLDEVKRMVAE+R P V++GG+TLT+AQ
Sbjct  5    NGHQNGSFCLSTAKGSSDPLNWGAAAEAMKGSHLDEVKRMVAEYRKPVVRLGGETLTIAQ  64

Query  298  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  477
            VAA+A  D+ V VELSE AR GVKASS+WVMNSMNNGTDSYGVTTGFGATSHRRTK G A
Sbjct  65   VAAVAGHDHGVAVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHRRTKQGGA  124

Query  478  LQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  651
            LQ+ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKLLN
Sbjct  125  LQKELIRFLNAGIFGNGTESSHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  184

Query  652  HN  657
            +N
Sbjct  185  NN  186



>sp|P27991.1|PAL1_SOYBN RecName: Full=Phenylalanine ammonia-lyase 1 [Glycine max]
 emb|CAA37129.1| phenylalanine ammonia-lyase [Glycine max]
Length=713

 Score =   287 bits (734),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 156/182 (86%), Gaps = 8/182 (4%)
 Frame = +1

Query  136  NGHSN-DFCIKV-----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  297
            NGH N  FC+       DPLNW  AA+++KGSHLDEVKRMVAE+R P V++GG+TLT+AQ
Sbjct  5    NGHQNGSFCLSTAKGNNDPLNWGAAAEAMKGSHLDEVKRMVAEYRKPVVRLGGETLTIAQ  64

Query  298  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  477
            VAA+A  D+ V VELSE AR GVKASS+WVMNSMNNGTDSYGVTTGFGATSHRRTK G A
Sbjct  65   VAAVAGHDHGVAVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHRRTKQGGA  124

Query  478  LQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  651
            LQ+ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKLLN
Sbjct  125  LQKELIRFLNAGIFGNGTESSHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  184

Query  652  HN  657
            +N
Sbjct  185  NN  186



>gb|AIA24411.1| phenylalanine ammonia-lyase [Sinopodophyllum hexandrum]
Length=709

 Score =   286 bits (733),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 151/170 (89%), Gaps = 2/170 (1%)
 Frame = +1

Query  154  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  333
            FCIK DPLNW MAAD+LKGSHLDEVK+MV E+R   V++GG+TLT++QVAA+A+ D  VK
Sbjct  15   FCIKEDPLNWGMAADALKGSHLDEVKKMVKEYRQGVVRLGGETLTISQVAAVASHDQGVK  74

Query  334  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  513
            VEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  75   VELNESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  134

Query  514  IFGTGTG--HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            +FG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEA+TK L+HN
Sbjct  135  VFGNGTESTHTLPHSATRAAMLVRINTLLQGYSGIRFEILEALTKFLDHN  184



>dbj|BAC56977.1| phenylalanine ammonia-lyase [Daucus carota]
Length=715

 Score =   286 bits (733),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 160/180 (89%), Gaps = 5/180 (3%)
 Frame = +1

Query  133  ENGHSNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAI  309
            ENG+  D C+K  DPL+W +AA++LKGSHL+EVKRMVAE+R P VK+GG+TLT++QVAAI
Sbjct  9    ENGNGVDLCMKKEDPLSWGVAAEALKGSHLEEVKRMVAEYRKPVVKLGGETLTISQVAAI  68

Query  310  AARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQ  486
            +ARD++ VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+
Sbjct  69   SARDDSGVKVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQK  128

Query  487  ELIRFLNAGIFGTGT---GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            ELIRFLNAGIFG+G     +TLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LNHN
Sbjct  129  ELIRFLNAGIFGSGAEAGNNTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHN  188



>gb|KGN52975.1| hypothetical protein Csa_4G008780 [Cucumis sativus]
Length=646

 Score =   285 bits (729),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 152/180 (84%), Gaps = 3/180 (2%)
 Frame = +1

Query  127  AIENGHSNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  303
            A +NG    FC    DPLNW +AADS+KGSHLDEVKRMV E+R P VK+GGQTLT++QVA
Sbjct  7    ANQNGSMESFCSSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGQTLTISQVA  66

Query  304  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  483
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRT  G ALQ
Sbjct  67   AIATRDNDVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQ  126

Query  484  QELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            +ELIRFLN+GIFG G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT LLNHN
Sbjct  127  KELIRFLNSGIFGNGSESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITNLLNHN  186



>ref|XP_006354336.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X1 [Solanum 
tuberosum]
Length=719

 Score =   286 bits (733),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 159/190 (84%), Gaps = 15/190 (8%)
 Frame = +1

Query  133  ENGHSN------DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  282
            +NGH N      + C K     DPLNWEMAADSL+GSHLDEVK+MV EFR P VK+GG+T
Sbjct  3    QNGHINGEVVAMELCKKSINVHDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGET  62

Query  283  LTVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  453
            LTVAQVA+IA  DN    VKVELSE +RAGVKASSDWVM+SM+ GTDSYGVTTGFGATSH
Sbjct  63   LTVAQVASIANADNKSNGVKVELSESSRAGVKASSDWVMDSMSKGTDSYGVTTGFGATSH  122

Query  454  RRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEIL  627
            RRTKNG ALQ+ELIRFLNAG+FG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEIL
Sbjct  123  RRTKNGGALQKELIRFLNAGVFGNGTELSHTLPHSATRAAMLVRINTLLQGYSGIRFEIL  182

Query  628  EAITKLLNHN  657
            EAITKL+N N
Sbjct  183  EAITKLINSN  192



>ref|XP_006354337.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X2 [Solanum 
tuberosum]
Length=719

 Score =   286 bits (733),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 159/190 (84%), Gaps = 15/190 (8%)
 Frame = +1

Query  133  ENGHSN------DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  282
            +NGH N      + C K     DPLNWEMAADSL+GSHLDEVK+MV EFR P VK+GG+T
Sbjct  3    QNGHINGEVVAMELCKKSINVHDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGET  62

Query  283  LTVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  453
            LTVAQVA+IA  DN    VKVELSE +RAGVKASSDWVM+SM+ GTDSYGVTTGFGATSH
Sbjct  63   LTVAQVASIANADNKSNGVKVELSESSRAGVKASSDWVMDSMSKGTDSYGVTTGFGATSH  122

Query  454  RRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEIL  627
            RRTKNG ALQ+ELIRFLNAG+FG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEIL
Sbjct  123  RRTKNGGALQKELIRFLNAGVFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEIL  182

Query  628  EAITKLLNHN  657
            EAITKL+N N
Sbjct  183  EAITKLINSN  192



>gb|AGT63063.1| phenylalanine ammonia-lyase [Solanum tuberosum]
Length=722

 Score =   286 bits (732),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 147/195 (75%), Positives = 160/195 (82%), Gaps = 15/195 (8%)
 Frame = +1

Query  118  MEGAIENGHSN------DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVK  267
            M    +NGH N      + C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK
Sbjct  1    MASIAQNGHVNGEVVAMELCKKSINVDDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVK  60

Query  268  IGGQTLTVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGF  438
            +GG+TLTVAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGF
Sbjct  61   LGGETLTVAQVASIANADNKSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGF  120

Query  439  GATSHRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGI  612
            GATSHRRTKNG ALQ+ELIRFLNAG+FG GT   HTLPHSATRAAMLVRINTLLQGYSGI
Sbjct  121  GATSHRRTKNGGALQKELIRFLNAGVFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGI  180

Query  613  RFEILEAITKLLNHN  657
            RFEILEAITKL+N N
Sbjct  181  RFEILEAITKLINSN  195



>gb|AHY94892.1| phenylalanine ammonia lyase [Prunella vulgaris]
Length=710

 Score =   286 bits (732),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 157/182 (86%), Gaps = 5/182 (3%)
 Frame = +1

Query  127  AIENGH--SNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  297
            A ENGH  SN FC+K  DPLNW  AA+S+ GSHL EVKRMV EFR P V++GG+TLT++Q
Sbjct  2    AAENGHHASNGFCVKQSDPLNWGAAAESMSGSHLQEVKRMVEEFRKPVVRLGGETLTISQ  61

Query  298  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  477
            VAAIAA+DNAV VEL+E ARAGVKASSDWVM+SM+ GT SYGVTTGFGATSHRRTK G A
Sbjct  62   VAAIAAKDNAVAVELAESARAGVKASSDWVMDSMSKGTVSYGVTTGFGATSHRRTKQGGA  121

Query  478  LQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  651
            LQ+ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITK LN
Sbjct  122  LQKELIRFLNAGIFGNGTESSHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKFLN  181

Query  652  HN  657
             N
Sbjct  182  TN  183



>ref|XP_004304440.1| PREDICTED: phenylalanine ammonia-lyase 1 [Fragaria vesca subsp. 
vesca]
Length=724

 Score =   286 bits (732),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 155/191 (81%), Gaps = 8/191 (4%)
 Frame = +1

Query  109  NTTMEGAIENGHSNDFCIKV-------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVK  267
            N   +  I+NG  +  C+K        DPLNW  AA+S+ GSHLDEVKRMVAE+R P VK
Sbjct  7    NGYHQNGIQNGSLDILCVKTESLKAVSDPLNWGAAAESMTGSHLDEVKRMVAEYRKPVVK  66

Query  268  IGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGAT  447
            +GG+TLT+AQVAAIA  D+ VKVEL E ARAGVKASSDWVM+SMN GTDSYGVTTGFGAT
Sbjct  67   LGGKTLTIAQVAAIANHDSGVKVELDESARAGVKASSDWVMDSMNKGTDSYGVTTGFGAT  126

Query  448  SHRRTKNGHALQQELIRFLNAGIFGTGT-GHTLPHSATRAAMLVRINTLLQGYSGIRFEI  624
            SHRRTK G ALQ+ELIRFLNAG+FG GT  HTLPH  TRAAMLVRINTLLQGYSGIRFEI
Sbjct  127  SHRRTKQGAALQKELIRFLNAGVFGKGTESHTLPHPTTRAAMLVRINTLLQGYSGIRFEI  186

Query  625  LEAITKLLNHN  657
            LEAITK LNHN
Sbjct  187  LEAITKFLNHN  197



>gb|AGU91428.1| phenylalanine ammonia-lyase [Chrysanthemum boreale]
Length=709

 Score =   286 bits (731),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 159/183 (87%), Gaps = 8/183 (4%)
 Frame = +1

Query  130  IENGHSN----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  297
            ++NGH+N    + CIK DPLNW +AA++L GSHLDEVK+MVAEFR P VK+GG+TLTV+Q
Sbjct  1    MDNGHANGVAKELCIK-DPLNWGVAAEALTGSHLDEVKKMVAEFRKPVVKLGGETLTVSQ  59

Query  298  VAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  474
            VA IAA +NA VKVEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRTKNG 
Sbjct  60   VAGIAASENAGVKVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGG  119

Query  475  ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  648
            ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK L
Sbjct  120  ALQKELIRFLNAGIFGNGTESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFL  179

Query  649  NHN  657
            N N
Sbjct  180  NTN  182



>ref|XP_004156293.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase-like 
[Cucumis sativus]
Length=712

 Score =   286 bits (731),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 154/180 (86%), Gaps = 8/180 (4%)
 Frame = +1

Query  142  HSND---FCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  303
             +ND   FC      DPLNW +AADSLKGSHLDEVKRMV E+R P VK+GG+TLT++QVA
Sbjct  6    QTNDDSSFCTNTTHPDPLNWGLAADSLKGSHLDEVKRMVQEYRRPLVKLGGETLTISQVA  65

Query  304  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  483
            AIA RD  V VELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ
Sbjct  66   AIATRDTDVIVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQ  125

Query  484  QELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            +ELIRFLNAGIFG+G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN+N
Sbjct  126  KELIRFLNAGIFGSGAESDHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNN  185



>gb|KGN52973.1| hypothetical protein Csa_4G008760 [Cucumis sativus]
Length=438

 Score =   278 bits (712),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 151/180 (84%), Gaps = 3/180 (2%)
 Frame = +1

Query  127  AIENGHSNDFC-IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  303
            A +NG     C    DPLNW +AA+S+KGSHLDEVKRMV E+R P VK+GG+TLT++QVA
Sbjct  7    ANQNGSVETLCNTHQDPLNWGLAAESMKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVA  66

Query  304  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  483
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRT  G ALQ
Sbjct  67   AIATRDNDVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQ  126

Query  484  QELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            +ELIRFLN+GIFG G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT LLNHN
Sbjct  127  KELIRFLNSGIFGNGSESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITNLLNHN  186



>ref|XP_004143256.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=712

 Score =   286 bits (731),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 154/180 (86%), Gaps = 8/180 (4%)
 Frame = +1

Query  142  HSND---FCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  303
             +ND   FC      DPLNW +AADSLKGSHLDEVKRMV E+R P VK+GG+TLT++QVA
Sbjct  6    QTNDDSSFCTNTTHPDPLNWGLAADSLKGSHLDEVKRMVQEYRRPLVKLGGETLTISQVA  65

Query  304  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  483
            AIA RD  V VELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ
Sbjct  66   AIATRDTDVIVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQ  125

Query  484  QELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            +ELIRFLNAGIFG+G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN+N
Sbjct  126  KELIRFLNAGIFGSGAESDHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNN  185



>gb|AJO53273.1| phenylalanine ammonia-lyase [Pogostemon cablin]
Length=711

 Score =   286 bits (731),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 161/184 (88%), Gaps = 4/184 (2%)
 Frame = +1

Query  118  MEGAIENGH-SNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  291
            M  A+ENGH SN  C+K  DPLNW  AADSLKGSHLDEVK+MV EFR   VK+GG+TLT+
Sbjct  1    MAPAVENGHFSNGLCVKQSDPLNWGAAADSLKGSHLDEVKKMVEEFRKSVVKLGGETLTI  60

Query  292  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  471
            AQVAAIAARDNAV VEL+E ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G
Sbjct  61   AQVAAIAARDNAVAVELAEAARAGVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRTKQG  120

Query  472  HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  645
             ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK 
Sbjct  121  GALQKELIRFLNAGIFGKGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKF  180

Query  646  LNHN  657
            LNHN
Sbjct  181  LNHN  184



>ref|XP_002281799.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   286 bits (731),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 150/170 (88%), Gaps = 3/170 (2%)
 Frame = +1

Query  154  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  333
            FC+  DPLNW +AA+ LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15   FCVS-DPLNWGVAAEELKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREEDVT  73

Query  334  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  513
            VELSE AR GVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74   VELSEAAREGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKEGGALQKELIRFLNAG  133

Query  514  IFGTGTG--HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            IFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  134  IFGNGTDSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  183



>ref|XP_003554382.1| PREDICTED: phenylalanine ammonia-lyase 1-like isoform 1 [Glycine 
max]
Length=712

 Score =   285 bits (730),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 156/181 (86%), Gaps = 7/181 (4%)
 Frame = +1

Query  136  NGHSN-DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  300
            NGH N  FC+      DPLNW  AA+++KGSHLDEVKRMV+E+R P V++GG+TLT+AQV
Sbjct  5    NGHQNGSFCLSSTKGSDPLNWGAAAEAMKGSHLDEVKRMVSEYRKPVVRLGGETLTIAQV  64

Query  301  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  480
            AA+A  D+ V VELSE AR GVKASS+WVMNSMNNGTDSYGVTTGFGATSHRRTK G AL
Sbjct  65   AAVAGHDHGVTVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHRRTKQGGAL  124

Query  481  QQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH  654
            Q+ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKLLN+
Sbjct  125  QKELIRFLNAGIFGNGTESSHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNN  184

Query  655  N  657
            N
Sbjct  185  N  185



>ref|XP_006424540.1| hypothetical protein CICLE_v10027912mg [Citrus clementina]
 gb|ESR37780.1| hypothetical protein CICLE_v10027912mg [Citrus clementina]
Length=714

 Score =   285 bits (730),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 152/176 (86%), Gaps = 2/176 (1%)
 Frame = +1

Query  136  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  315
            N  S   C  +DPLNW  A++SLKGSHLDEVKRMV+E+R P V++GG+TLT+AQVAA+A+
Sbjct  12   NIPSGKLCTNIDPLNWVSASESLKGSHLDEVKRMVSEYRKPVVRLGGETLTIAQVAAVAS  71

Query  316  RDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  495
            RD+ V VEL+E ARAGVKASSDWVM SMNNGTDSYGVTTGFGATSHRRTK G ALQ+ELI
Sbjct  72   RDDGVTVELNEEARAGVKASSDWVMESMNNGTDSYGVTTGFGATSHRRTKQGAALQKELI  131

Query  496  RFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            RFLNAGIFG GT   H LPH+ATRAAMLVRINTLLQGYSGIRFEILEAITK LN N
Sbjct  132  RFLNAGIFGKGTESCHMLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKFLNRN  187



>ref|XP_004143356.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 ref|XP_004156338.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=717

 Score =   285 bits (730),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 154/181 (85%), Gaps = 4/181 (2%)
 Frame = +1

Query  127  AIENGHSNDFCIK--VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  300
            A +NG    FC    VDPLNW +AA++LKGSHLDEVKRMV E+R P VK+GG+TLT++QV
Sbjct  10   AHQNGSMESFCTSHVVDPLNWGVAAEALKGSHLDEVKRMVDEYRRPVVKLGGETLTISQV  69

Query  301  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  480
            AAIA RDN V V+L+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G AL
Sbjct  70   AAIATRDNDVVVKLAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGAL  129

Query  481  QQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH  654
            Q+ELIRFLNAGIFG G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT LLN 
Sbjct  130  QKELIRFLNAGIFGNGAESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITNLLNE  189

Query  655  N  657
            N
Sbjct  190  N  190



>ref|XP_004143258.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 ref|XP_004156291.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 gb|KGN48163.1| hypothetical protein Csa_6G445760 [Cucumis sativus]
Length=713

 Score =   285 bits (730),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 154/178 (87%), Gaps = 3/178 (2%)
 Frame = +1

Query  133  ENGHSNDFCI-KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAI  309
            +NG     CI   DPLNW +AA+SLKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAI
Sbjct  9    KNGSVESLCIGSNDPLNWGVAAESLKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAI  68

Query  310  AARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQE  489
            A RD  V VELSE +RAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+E
Sbjct  69   ATRDTDVIVELSESSRAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKE  128

Query  490  LIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            LIRFLNAGIFG+G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN+N
Sbjct  129  LIRFLNAGIFGSGAESDHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNN  186



>gb|KGN48164.1| hypothetical protein Csa_6G445770 [Cucumis sativus]
Length=717

 Score =   285 bits (730),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 154/181 (85%), Gaps = 4/181 (2%)
 Frame = +1

Query  127  AIENGHSNDFCIK--VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  300
            A +NG    FC    VDPLNW +AA++LKGSHLDEVKRMV E+R P VK+GG+TLT++QV
Sbjct  10   AHQNGSMESFCTSHVVDPLNWGVAAEALKGSHLDEVKRMVDEYRRPVVKLGGETLTISQV  69

Query  301  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  480
            AAIA RDN V V+L+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G AL
Sbjct  70   AAIATRDNDVVVKLAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGAL  129

Query  481  QQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH  654
            Q+ELIRFLNAGIFG G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT LLN 
Sbjct  130  QKELIRFLNAGIFGNGAESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITNLLNE  189

Query  655  N  657
            N
Sbjct  190  N  190



>gb|KGN52974.1| hypothetical protein Csa_4G008770 [Cucumis sativus]
Length=592

 Score =   282 bits (722),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 151/180 (84%), Gaps = 3/180 (2%)
 Frame = +1

Query  127  AIENGHSNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  303
            A +NG     C    DPLNW +AADS+KGSHLDEVKRMV E+R P VK+GGQTLT++QVA
Sbjct  7    ANQNGSMESLCSSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGQTLTISQVA  66

Query  304  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  483
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRT  G ALQ
Sbjct  67   AIATRDNDVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQ  126

Query  484  QELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            +ELIRFLN+GIFG G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT LLNHN
Sbjct  127  KELIRFLNSGIFGNGSESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITNLLNHN  186



>ref|XP_009373523.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase 1-like 
[Pyrus x bretschneideri]
Length=719

 Score =   285 bits (730),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 152/182 (84%), Gaps = 7/182 (4%)
 Frame = +1

Query  133  ENGHSN-----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  297
            +NGH N       CIK  PLNW + ADSLKGSHLDEVKRMVAE+R P VK+GG++LT++Q
Sbjct  11   QNGHQNGVSESPLCIKKAPLNWGLVADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQ  70

Query  298  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  477
            VAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGV TGFGATSHRRT  G A
Sbjct  71   VAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVPTGFGATSHRRTNKGAA  130

Query  478  LQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  651
            LQ+ELIRFLNAG+FG+ T  GHTLPH ATRAAMLVRINTLLQGYSGIRFEILEAITK LN
Sbjct  131  LQKELIRFLNAGVFGSATESGHTLPHQATRAAMLVRINTLLQGYSGIRFEILEAITKFLN  190

Query  652  HN  657
            +N
Sbjct  191  NN  192



>ref|XP_004234632.2| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=720

 Score =   285 bits (729),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 158/187 (84%), Gaps = 12/187 (6%)
 Frame = +1

Query  133  ENGHSN-----DFCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  291
            +NGH N     D C K   DPLNWEMAADSL+GSHLDEVK+MV EFR P VK+GG+TL+V
Sbjct  7    QNGHINGEVAMDLCKKSINDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGETLSV  66

Query  292  AQVAAIAARD---NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  462
            AQVA+IA  D   N VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVT GFGATSHRRT
Sbjct  67   AQVASIANVDDKSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTAGFGATSHRRT  126

Query  463  KNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  636
            KNG ALQ+ELIRFLNAG+FG G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI
Sbjct  127  KNGGALQKELIRFLNAGVFGNGIESFHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  186

Query  637  TKLLNHN  657
            TKL+N N
Sbjct  187  TKLINSN  193



>ref|XP_003590471.1| Phenylalanine ammonia-lyase [Medicago truncatula]
 gb|AES60722.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=712

 Score =   285 bits (729),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 158/186 (85%), Gaps = 7/186 (4%)
 Frame = +1

Query  118  MEGAIENGH-SNDFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  285
            MEG I NGH    FC+     DPLNW  AA+SL GSHLDEVKRMV E+RNP VKIGG+TL
Sbjct  1    MEG-ITNGHVEATFCLSKNGGDPLNWGAAAESLTGSHLDEVKRMVEEYRNPLVKIGGETL  59

Query  286  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  465
            T+AQVA IA+ D+ V+VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK
Sbjct  60   TIAQVAGIASHDSGVRVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTK  119

Query  466  NGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  639
             G ALQ+ELIRFLNAGIFG GT    TLPH+ATRAAMLVRINTLLQGYSGIRFEILEAIT
Sbjct  120  QGGALQKELIRFLNAGIFGNGTESNCTLPHTATRAAMLVRINTLLQGYSGIRFEILEAIT  179

Query  640  KLLNHN  657
            KLLN+N
Sbjct  180  KLLNNN  185



>sp|P45729.1|PAL3_PETCR RecName: Full=Phenylalanine ammonia-lyase 3 [Petroselinum crispum]
 emb|CAA57057.1| phenylalanine ammonia-lyase 3 [Petroselinum crispum]
Length=718

 Score =   285 bits (728),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 160/183 (87%), Gaps = 9/183 (5%)
 Frame = +1

Query  136  NGHSN----DFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  300
            NGH+N    D C+K  DPLNW +AA++L GSHLDEVKRMVAE+R P VK+ G+TLT++QV
Sbjct  9    NGHANGNGLDLCMKKEDPLNWGVAAEALTGSHLDEVKRMVAEYRKPVVKLEGETLTISQV  68

Query  301  AAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  477
            AAI+ARD++ VKVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G A
Sbjct  69   AAISARDDSGVKVELSEEARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGA  128

Query  478  LQQELIRFLNAGIFGTGT---GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  648
            LQ+ELIRFLNAGIFG+G     +TLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK L
Sbjct  129  LQKELIRFLNAGIFGSGAEAGNNTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFL  188

Query  649  NHN  657
            NHN
Sbjct  189  NHN  191



>emb|CBI31445.3| unnamed protein product [Vitis vinifera]
Length=578

 Score =   281 bits (719),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 148/165 (90%), Gaps = 2/165 (1%)
 Frame = +1

Query  169  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  348
            DPLNW MAA+SLKGSHLDEVKRMV E+R   V++GG+TLT++QVAA+A+RD  V VELSE
Sbjct  32   DPLNWNMAAESLKGSHLDEVKRMVEEYRRQVVQLGGETLTISQVAAVASRDTGVTVELSE  91

Query  349  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  528
             AR GVKASSDWVM+SMNNGTDSYGVTTGFGATSHRRTK G ALQ ELIRFLNAGIFG G
Sbjct  92   EAREGVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTKQGGALQMELIRFLNAGIFGNG  151

Query  529  T--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            T   HTLPHSATRA+MLVRINTLLQGYSGIRFEILEAITKL+NHN
Sbjct  152  TESCHTLPHSATRASMLVRINTLLQGYSGIRFEILEAITKLINHN  196



>emb|CAL91169.1| phenylalanine ammonia-lyase 3 [Cynara cardunculus var. scolymus]
Length=713

 Score =   285 bits (728),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 154/178 (87%), Gaps = 4/178 (2%)
 Frame = +1

Query  136  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  315
            NG + DFCI  DPLNW +AA+++ GSHLDEVKRMVAEFR P VK+GG+TLTV+QVA IAA
Sbjct  9    NGVATDFCINKDPLNWGVAAEAMTGSHLDEVKRMVAEFRKPVVKLGGETLTVSQVAGIAA  68

Query  316  RDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQE  489
              ++  VKVELSE ARAGVKASSDWVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+E
Sbjct  69   AGDSSVVKVELSEAARAGVKASSDWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKE  128

Query  490  LIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            LIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN N
Sbjct  129  LIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNTN  186



>gb|AGV54597.1| phenylalanine ammonia-lyase [Phaseolus vulgaris]
Length=714

 Score =   285 bits (728),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 155/182 (85%), Gaps = 6/182 (3%)
 Frame = +1

Query  130  IENGHSNDFCIK----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  297
            + N  +  FC+      DPLNW  AA++LKGSHLDEVKRMVAE+R P V++GG+TLT+AQ
Sbjct  6    LTNAQNGSFCLPSAKTTDPLNWGTAAEALKGSHLDEVKRMVAEYRQPLVRLGGETLTIAQ  65

Query  298  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  477
            VAA++  D  V+VELSE AR GVKASS+WVMNSMNNGTDSYGVTTGFGATSHRRTK G A
Sbjct  66   VAAVSGHDQGVRVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHRRTKQGGA  125

Query  478  LQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  651
            LQ+ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILE+ITKLLN
Sbjct  126  LQKELIRFLNAGIFGNGTESSHTLPHTATRAAMLVRINTLLQGYSGIRFEILESITKLLN  185

Query  652  HN  657
            +N
Sbjct  186  NN  187



>gb|KHG29664.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=721

 Score =   285 bits (728),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 151/166 (91%), Gaps = 2/166 (1%)
 Frame = +1

Query  166  VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELS  345
            VDPLNW +AA+SL+GSHLDEVKRMVAE+R P VK+GG+TLT++QVAAIA RD  VKVELS
Sbjct  29   VDPLNWGVAAESLQGSHLDEVKRMVAEYRRPLVKLGGETLTISQVAAIATRDLGVKVELS  88

Query  346  EGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGT  525
            E ARAGVKAS+DWV++ MN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG 
Sbjct  89   EDARAGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFGN  148

Query  526  G--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  149  GIESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  194



>ref|XP_007162756.1| hypothetical protein PHAVU_001G177800g [Phaseolus vulgaris]
 gb|ESW34750.1| hypothetical protein PHAVU_001G177800g [Phaseolus vulgaris]
Length=714

 Score =   285 bits (728),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 155/182 (85%), Gaps = 6/182 (3%)
 Frame = +1

Query  130  IENGHSNDFCIK----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  297
            + N  +  FC+      DPLNW  AA++LKGSHLDEVKRMVAE+R P V++GG+TLT+AQ
Sbjct  6    LTNAQNGSFCLPSAKTTDPLNWGTAAEALKGSHLDEVKRMVAEYRQPLVRLGGETLTIAQ  65

Query  298  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  477
            VAA++  D  V+VELSE AR GVKASS+WVMNSMNNGTDSYGVTTGFGATSHRRTK G A
Sbjct  66   VAAVSGHDQGVRVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHRRTKQGGA  125

Query  478  LQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  651
            LQ+ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILE+ITKLLN
Sbjct  126  LQKELIRFLNAGIFGNGTESSHTLPHTATRAAMLVRINTLLQGYSGIRFEILESITKLLN  185

Query  652  HN  657
            +N
Sbjct  186  NN  187



>dbj|BAG31930.1| phenylalanine ammonia-lyase [Daucus carota]
Length=715

 Score =   284 bits (727),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 159/180 (88%), Gaps = 5/180 (3%)
 Frame = +1

Query  133  ENGHSNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAI  309
            ENG+  D C+K  DPL+W +AA++L GSHL+EVKRMVAE+R P VK+GG+TLT++QVAAI
Sbjct  9    ENGNGVDLCMKKEDPLSWGVAAEALTGSHLEEVKRMVAEYRKPVVKLGGETLTISQVAAI  68

Query  310  AARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQ  486
            +ARD++ VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+
Sbjct  69   SARDDSGVKVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQK  128

Query  487  ELIRFLNAGIFGTGT---GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            ELIRFLNAGIFG+G     +TLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LNHN
Sbjct  129  ELIRFLNAGIFGSGAEAGNNTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHN  188



>ref|XP_002531677.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
 gb|EEF30696.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
Length=719

 Score =   284 bits (727),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 149/174 (86%), Gaps = 6/174 (3%)
 Frame = +1

Query  154  FCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARD  321
            FC       DPLNW M ADSLKGSHLDEVKRMV E+R P V++GG+TLT+AQV AIA RD
Sbjct  19   FCTATAGHHDPLNWGMLADSLKGSHLDEVKRMVDEYRRPVVRLGGETLTIAQVTAIANRD  78

Query  322  NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRF  501
              +KVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRF
Sbjct  79   AGIKVELSEDARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQRELIRF  138

Query  502  LNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            LNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK +NHN
Sbjct  139  LNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFINHN  192



>emb|CDY18463.1| BnaA04g21240D [Brassica napus]
Length=263

 Score =   271 bits (692),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 144/172 (84%), Gaps = 2/172 (1%)
 Frame = +1

Query  148  NDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNA  327
            N   +  DPLNW  AA+ +KGSHLDEVKRMV EFR P V +GG+TLT+ QVAAI+   N 
Sbjct  24   NATVVGADPLNWGAAAEQMKGSHLDEVKRMVKEFRRPVVNLGGETLTIGQVAAISTLGNG  83

Query  328  VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLN  507
            VKVELSE ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLN
Sbjct  84   VKVELSETARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLN  143

Query  508  AGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            AGIFG+   T HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  LN+N
Sbjct  144  AGIFGSTKETSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITSFLNNN  195



>gb|AAR31107.1| phenylalanine ammonia-lyase [Quercus suber]
Length=709

 Score =   283 bits (725),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 154/182 (85%), Gaps = 2/182 (1%)
 Frame = +1

Query  118  MEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  297
            ME    NG S + C   DPLNW +AA+ LKGSHLDEVKRMV EFR P VK GG++LT+AQ
Sbjct  1    MEYCNGNGSSVNSCKSSDPLNWGLAAEGLKGSHLDEVKRMVDEFRKPLVKPGGKSLTIAQ  60

Query  298  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  477
            VAAIA++D A+KVEL+E ARAGVKASSDWVM SM+ G DSYGVTTGFGATSHRRTK G A
Sbjct  61   VAAIASQDGAIKVELAEEARAGVKASSDWVMGSMDKGKDSYGVTTGFGATSHRRTKQGGA  120

Query  478  LQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  651
            LQ+ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEI+EAITK LN
Sbjct  121  LQRELIRFLNAGIFGNGTESCHTLPHTATRAAMLVRINTLLQGYSGIRFEIMEAITKFLN  180

Query  652  HN  657
            HN
Sbjct  181  HN  182



>ref|XP_009606373.1| PREDICTED: phenylalanine ammonia-lyase G4-like [Nicotiana tomentosiformis]
Length=717

 Score =   284 bits (726),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 154/182 (85%), Gaps = 8/182 (4%)
 Frame = +1

Query  136  NGHSN-DFCIK----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  300
            NGHS+ + CIK     DPLNW MAA +L GSHLDEVK+MV EFR PAV++GG+TLTVAQV
Sbjct  9    NGHSDQELCIKGHQQEDPLNWNMAAAALSGSHLDEVKKMVEEFRKPAVRLGGETLTVAQV  68

Query  301  AAIAARD-NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  477
            AAIA R    V VELSEGARAGVKASSDWVM  MN GTDSYGVTTGFGATSHRRTK G A
Sbjct  69   AAIAGRSGTEVTVELSEGARAGVKASSDWVMEGMNKGTDSYGVTTGFGATSHRRTKQGAA  128

Query  478  LQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  651
            LQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN
Sbjct  129  LQKELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  188

Query  652  HN  657
             N
Sbjct  189  SN  190



>gb|AEV53411.1| phenylalanine ammonia-lyase 3 [Populus tomentosa]
 gb|AFZ78652.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=715

 Score =   284 bits (726),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 160/188 (85%), Gaps = 8/188 (4%)
 Frame = +1

Query  118  MEGAIENGHSN----DFCI-KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  282
            ME   +NGH N      CI ++DPL+W +AA+++KGSHLDEVKRMVA++R P VK+GG+T
Sbjct  1    METVTKNGHQNGSLESLCINQLDPLSWGVAAEAMKGSHLDEVKRMVADYRKPVVKLGGET  60

Query  283  LTVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRR  459
            LT+AQVA+IA  D   VKVELSE AR GVKASSDWVM+SM+ GTDSYGVTTGFGATSHRR
Sbjct  61   LTIAQVASIAGHDTGDVKVELSESARPGVKASSDWVMDSMDKGTDSYGVTTGFGATSHRR  120

Query  460  TKNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEA  633
            TK G ALQ+ELIRFLNAGIFG G  T HTLPHSATRAAMLVRINTLLQGYSGIRFEILEA
Sbjct  121  TKQGGALQRELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEA  180

Query  634  ITKLLNHN  657
            ITKLLN+N
Sbjct  181  ITKLLNNN  188



>emb|CAA44609.1| phenylalanine ammonia-lyase [Arabidopsis thaliana]
Length=240

 Score =   270 bits (689),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 133/165 (81%), Positives = 144/165 (87%), Gaps = 2/165 (1%)
 Frame = +1

Query  169  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  348
            DPLNW  AA+ +KGSHLDEVKRMVAEFR P V +GG+TLT+ QVAAI+   N+VKVELSE
Sbjct  34   DPLNWGAAAEQMKGSHLDEVKRMVAEFRKPVVNLGGETLTIGQVAAISTIGNSVKVELSE  93

Query  349  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  528
             ARAGV ASSDWVM SMN GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLNAGIFG+ 
Sbjct  94   TARAGVNASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFGST  153

Query  529  --TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
              T HTLPHSATRAAMLVRINTLLQG+SGIRFEILEAIT  LN+N
Sbjct  154  KETSHTLPHSATRAAMLVRINTLLQGFSGIRFEILEAITSFLNNN  198



>gb|AEC11891.1| PAL1 [Petunia exserta]
 gb|AEC11892.1| PAL1 [Petunia axillaris]
Length=718

 Score =   283 bits (725),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 160/191 (84%), Gaps = 11/191 (6%)
 Frame = +1

Query  118  MEGAIEN--GH-SNDFCIK-----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIG  273
            ME A EN  GH S D C+K     +DPLNW MAAD+LKGSHLDEVKRMV EFR P V++G
Sbjct  1    MEYANENCNGHASQDICVKGHDQQLDPLNWNMAADALKGSHLDEVKRMVKEFRKPVVRLG  60

Query  274  GQTLTVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  450
            G+TLTVAQVAAIA++    V V+LSE +RAGVKASSDWV+  M NGTDSYGVTTGFGATS
Sbjct  61   GETLTVAQVAAIASQSGTDVTVQLSEASRAGVKASSDWVLQGMINGTDSYGVTTGFGATS  120

Query  451  HRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEI  624
            HRRTK G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEI
Sbjct  121  HRRTKEGAALQKELIRFLNAGIFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEI  180

Query  625  LEAITKLLNHN  657
            LEAITKLLN+N
Sbjct  181  LEAITKLLNNN  191



>gb|AAV98199.1| phenylalanine ammonialyase 1 [Petunia x hybrida]
Length=718

 Score =   283 bits (725),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 160/191 (84%), Gaps = 11/191 (6%)
 Frame = +1

Query  118  MEGAIEN--GH-SNDFCIK-----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIG  273
            ME A EN  GH S D C+K     +DPLNW MAAD+LKGSHLDEVKRMV EFR P V++G
Sbjct  1    MEYANENCNGHASQDICVKGHDQQLDPLNWNMAADALKGSHLDEVKRMVKEFRKPVVRLG  60

Query  274  GQTLTVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  450
            G+TLTVAQVAAIA++    V V+LSE +RAGVKASSDWV+  M NGTDSYGVTTGFGATS
Sbjct  61   GETLTVAQVAAIASQSGTDVTVQLSEASRAGVKASSDWVLQGMINGTDSYGVTTGFGATS  120

Query  451  HRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEI  624
            HRRTK G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEI
Sbjct  121  HRRTKEGAALQKELIRFLNAGIFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEI  180

Query  625  LEAITKLLNHN  657
            LEAITKLLN+N
Sbjct  181  LEAITKLLNNN  191



>ref|XP_008449239.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=711

 Score =   283 bits (725),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 148/165 (90%), Gaps = 2/165 (1%)
 Frame = +1

Query  169  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  348
            DPLNW +AADSLKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAIA RD  V VELSE
Sbjct  20   DPLNWGLAADSLKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAIATRDTDVIVELSE  79

Query  349  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  528
             ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG+G
Sbjct  80   SARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGSG  139

Query  529  --TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
              + H LPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN+N
Sbjct  140  AESNHILPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNN  184



>gb|AHA42445.1| phenylalanine ammonia lyase, partial [Cannabis sativa]
Length=528

 Score =   279 bits (713),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 150/170 (88%), Gaps = 3/170 (2%)
 Frame = +1

Query  154  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  333
            FC+K DPLNW +AA+S+ GSHLDEVKRMVAE+R P V +GG+TLT++QVAAIAA D  VK
Sbjct  12   FCVKGDPLNWGLAAESMSGSHLDEVKRMVAEYRKPVVGLGGETLTISQVAAIAAAD-GVK  70

Query  334  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  513
            VELSE  RAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLNAG
Sbjct  71   VELSESPRAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAG  130

Query  514  IFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            IFG GT   HTLPHS+TRA +LVRINTLLQGYSGIRFEILEA+ KLLN+N
Sbjct  131  IFGHGTESCHTLPHSSTRAGLLVRINTLLQGYSGIRFEILEAMAKLLNNN  180



>ref|XP_003521396.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Glycine max]
Length=716

 Score =   283 bits (725),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 155/184 (84%), Gaps = 8/184 (4%)
 Frame = +1

Query  130  IENGHSN-DFCIKV-----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  291
            I NG  N  FC+       DPLNW  AA+++KGSHLDEVKRMVAE+R P V++GG+TLT+
Sbjct  6    ITNGSQNGSFCLSTTKGSSDPLNWGAAAEAMKGSHLDEVKRMVAEYRKPVVRLGGETLTI  65

Query  292  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  471
            AQVAA+A  D  V VELSE AR GVKASS+WVMNSMNNGTDSYGVTTGFGATSHRRTK G
Sbjct  66   AQVAAVAGHDLGVAVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHRRTKQG  125

Query  472  HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  645
             ALQ+ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKL
Sbjct  126  GALQKELIRFLNAGIFGNGTESSHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKL  185

Query  646  LNHN  657
            LN+N
Sbjct  186  LNNN  189



>ref|XP_004143257.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 ref|XP_004156292.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=710

 Score =   283 bits (724),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 154/178 (87%), Gaps = 4/178 (2%)
 Frame = +1

Query  136  NGHSND-FC-IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAI  309
            NGH  D  C    DPLNW +AA+SLKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAI
Sbjct  6    NGHIEDNLCHTHSDPLNWGVAAESLKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAI  65

Query  310  AARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQE  489
            A RD+ V VELSE AR GVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+E
Sbjct  66   ATRDSDVIVELSESARVGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKEGGALQKE  125

Query  490  LIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            LIRFLNAGIFG+G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN+N
Sbjct  126  LIRFLNAGIFGSGAESDHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNN  183



>ref|XP_006424538.1| hypothetical protein CICLE_v10027913mg [Citrus clementina]
 gb|ESR37778.1| hypothetical protein CICLE_v10027913mg [Citrus clementina]
Length=714

 Score =   283 bits (724),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 151/174 (87%), Gaps = 2/174 (1%)
 Frame = +1

Query  136  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  315
            N  S   C  +DPLNW  A++SLKGSHLDEVKRMV+E+R P V++GG+TLT+AQVAA+A+
Sbjct  12   NIPSGKLCTNIDPLNWVSASESLKGSHLDEVKRMVSEYRKPVVRLGGETLTIAQVAAVAS  71

Query  316  RDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  495
            RD+ V VEL+E ARAGVKASSDWVM SMNNGTDSYGVTTGFGATSHRRTK G ALQ+ELI
Sbjct  72   RDDGVTVELNEEARAGVKASSDWVMESMNNGTDSYGVTTGFGATSHRRTKQGAALQKELI  131

Query  496  RFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  651
            RFLNAGIFG GT   H LPH+ATRAAMLVRINTLLQGYSGIRFEILEAITK LN
Sbjct  132  RFLNAGIFGKGTESCHMLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKFLN  185



>gb|AAL55242.1|AF299330_1 phenylalanine ammonia-lyase [Lactuca sativa]
Length=711

 Score =   283 bits (724),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 156/178 (88%), Gaps = 5/178 (3%)
 Frame = +1

Query  136  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  315
            NG  N+ CIK DPLNW +AA++L GSHLDEVK+MVAEFR P VK+GG+TLTV+QVA IAA
Sbjct  8    NGVVNELCIK-DPLNWGVAAEALTGSHLDEVKKMVAEFRKPVVKLGGETLTVSQVAGIAA  66

Query  316  RDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQE  489
             +++  VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+E
Sbjct  67   ANDSDTVKVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKE  126

Query  490  LIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            LIRFLNAGIFG G  T HTLPHSATRAAM+VRINTLLQGYSGIRFEILEAITK LN+N
Sbjct  127  LIRFLNAGIFGNGTETSHTLPHSATRAAMIVRINTLLQGYSGIRFEILEAITKFLNNN  184



>ref|XP_008449237.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=717

 Score =   283 bits (724),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 154/181 (85%), Gaps = 4/181 (2%)
 Frame = +1

Query  127  AIENGHSNDFCIK--VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  300
            A +NG    FC    VDPLNW +AA++LKGSHLDEVKRMV E+R P VK+GG+TLT++QV
Sbjct  10   AHQNGSMESFCTSHVVDPLNWGVAAEALKGSHLDEVKRMVDEYRRPVVKLGGETLTISQV  69

Query  301  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  480
            AAIA RD+ V V+L+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G AL
Sbjct  70   AAIATRDSDVVVKLAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGAL  129

Query  481  QQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH  654
            Q+ELIRFLNAGIFG G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT LLN 
Sbjct  130  QKELIRFLNAGIFGNGAESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITNLLNE  189

Query  655  N  657
            N
Sbjct  190  N  190



>gb|AFN85669.1| phenylalanine ammonia-lyase [Hibiscus cannabinus]
Length=715

 Score =   283 bits (724),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 149/165 (90%), Gaps = 2/165 (1%)
 Frame = +1

Query  166  VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELS  345
            VDPLNW +AA+SLKGSHLDEVKRMVAE+R P VK+GG+TLT++QVAAIA RD  VKVELS
Sbjct  23   VDPLNWGVAAESLKGSHLDEVKRMVAEYRRPLVKLGGETLTISQVAAIATRDLGVKVELS  82

Query  346  EGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGT  525
            E ARAGVKAS+DWV++ MN GTDSYGVTTGFGATSHRRT  G ALQ+ELIRFLNAGIFG 
Sbjct  83   EDARAGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTNQGAALQKELIRFLNAGIFGN  142

Query  526  GT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH  654
            GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH
Sbjct  143  GTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH  187



>gb|ABL14040.1| phenylalanine ammonia lyase, partial [Astragalus mongholicus]
Length=274

 Score =   270 bits (690),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 155/188 (82%), Gaps = 9/188 (5%)
 Frame = +1

Query  115  TMEGAIENG--HSND--FCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIG  273
            T EGA  N   H+N+  FCI+    DP NW +AA++LKGSHLDEVKRMV E+R P V+IG
Sbjct  2    TGEGANGNAKNHANEVEFCIRETRGDPFNWGVAAEALKGSHLDEVKRMVEEYRKPVVRIG  61

Query  274  GQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  453
            G+TLT++QVAAIA  D  VKV+LSE AR GVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  62   GETLTISQVAAIAGHDQGVKVDLSESARDGVKASSDWVMESMNKGTDSYGVTTGFGATSH  121

Query  454  RRTKNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEIL  627
            RRTK G ALQ+ELIRFLNAGIFG G  T  TLP++ATRAAMLVRINTLLQGYSGIRFEIL
Sbjct  122  RRTKQGGALQKELIRFLNAGIFGNGTETSCTLPNTATRAAMLVRINTLLQGYSGIRFEIL  181

Query  628  EAITKLLN  651
            EAITK LN
Sbjct  182  EAITKPLN  189



>dbj|BAO01110.1| phenylalanine ammonia-lyase [Vigna radiata]
Length=715

 Score =   283 bits (724),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 156/183 (85%), Gaps = 7/183 (4%)
 Frame = +1

Query  130  IENGHSN-DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  294
            + NG+ N  FC       DPLNW  AA++LKGSHLDEVKRMVAE+R P V++GG+TLT+A
Sbjct  6    LTNGNQNGSFCFTSTKTSDPLNWGTAAEALKGSHLDEVKRMVAEYRQPLVRLGGETLTIA  65

Query  295  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  474
            QVA ++A D  V+VELSE AR GVKASS+WVMNSMNNGTDSYGVTTGFGATSHRRTK G 
Sbjct  66   QVAGVSAHDQGVRVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHRRTKQGG  125

Query  475  ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  648
            ALQ+ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKLL
Sbjct  126  ALQKELIRFLNAGIFGNGTESCHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLL  185

Query  649  NHN  657
            N+N
Sbjct  186  NNN  188



>gb|AEX32784.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   283 bits (723),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 151/170 (89%), Gaps = 3/170 (2%)
 Frame = +1

Query  154  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  333
            FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15   FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGDVS  73

Query  334  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  513
            VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74   VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  133

Query  514  IFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            IFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  134  IFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  183



>ref|XP_002268181.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
 ref|XP_010662070.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   283 bits (723),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 151/170 (89%), Gaps = 3/170 (2%)
 Frame = +1

Query  154  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  333
            FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15   FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPLVRLGGETLTISQVAAIAGREGDVS  73

Query  334  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  513
            VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74   VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  133

Query  514  IFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            IFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  134  IFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  183



>gb|AAN52280.1|AF480620_1 phenylalanine ammonia-lyase [Populus tremuloides]
Length=711

 Score =   283 bits (723),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 147/165 (89%), Gaps = 2/165 (1%)
 Frame = +1

Query  169  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  348
            DPLNW MAA+SLKGSHLDEVKRM+ E+R P VK+GG+TLT+ QV AIA+RD  VKVELSE
Sbjct  20   DPLNWGMAAESLKGSHLDEVKRMIDEYRKPVVKLGGETLTIGQVTAIASRDIGVKVELSE  79

Query  349  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  528
             AR GVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G  LQ+ELIRFLNAGIFG G
Sbjct  80   EARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNG  139

Query  529  TG--HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            T   HTLPHSA+RAAMLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  140  TESTHTLPHSASRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  184



>gb|ACT53399.1| phenylalanine ammonia-lyase 2 [Ageratina adenophora]
Length=720

 Score =   283 bits (723),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 153/179 (85%), Gaps = 6/179 (3%)
 Frame = +1

Query  136  NGHSND-FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIA  312
            NG  ND FCIK DPLNW  AA  L GSHLDEVK+MVAEFR P VK+GG+TLTVAQVA IA
Sbjct  16   NGVVNDPFCIK-DPLNWGAAAAELTGSHLDEVKKMVAEFRKPVVKLGGETLTVAQVAGIA  74

Query  313  ARD--NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQ  486
            A D  +AVKVELSE ARAGV ASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+
Sbjct  75   AADGGSAVKVELSEAARAGVAASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQK  134

Query  487  ELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN+N
Sbjct  135  ELIRFLNAGIFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNNN  193



>ref|XP_009759945.1| PREDICTED: phenylalanine ammonia-lyase G4-like [Nicotiana sylvestris]
Length=718

 Score =   283 bits (723),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 154/183 (84%), Gaps = 9/183 (5%)
 Frame = +1

Query  136  NGH--SNDFCIK----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  297
            NGH  S +FCIK     DPLNW MAAD+LKGSHLDEVK+MV EFR P V++GG+TLT+ Q
Sbjct  9    NGHNASQEFCIKGHEQQDPLNWNMAADALKGSHLDEVKKMVEEFRKPVVRLGGETLTIGQ  68

Query  298  VAAIAARD-NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  474
            VAAIA R    V VEL+E ARAGVKASSDWV+  M NGTDSYGVTTGFGATSHRRTK G 
Sbjct  69   VAAIAGRSGTEVMVELAEAARAGVKASSDWVIEGMKNGTDSYGVTTGFGATSHRRTKQGA  128

Query  475  ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  648
            ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL
Sbjct  129  ALQKELIRFLNAGIFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  188

Query  649  NHN  657
            N+N
Sbjct  189  NNN  191



>gb|AIB06732.1| phenylalanine ammonia lyase [Mangifera indica]
Length=707

 Score =   282 bits (722),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 147/165 (89%), Gaps = 2/165 (1%)
 Frame = +1

Query  169  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  348
            DPLNW  AA+SLKGSHLDEVKRMV EFR P VK+GG+TLT+ QV AIA+ D+ V+VELSE
Sbjct  16   DPLNWNFAAESLKGSHLDEVKRMVEEFRKPVVKLGGETLTIGQVTAIASHDSGVRVELSE  75

Query  349  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  528
             ARAGV+ASSDWVM SM NGTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG+G
Sbjct  76   TARAGVQASSDWVMESMKNGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGSG  135

Query  529  T--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            T   HTLPHSATRAAMLVRINTLLQGYSGIRF+ILEAITK LNHN
Sbjct  136  TESCHTLPHSATRAAMLVRINTLLQGYSGIRFDILEAITKFLNHN  180



>ref|XP_008454139.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=708

 Score =   282 bits (722),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 152/180 (84%), Gaps = 3/180 (2%)
 Frame = +1

Query  127  AIENGHSNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  303
            A +NG S   C+   DPLNW +AA+S+KGSHLDEVKRMV E+R P VK+GG+TLT++QVA
Sbjct  2    ACQNGSSESLCMNGQDPLNWGLAAESMKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVA  61

Query  304  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  483
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRT  G ALQ
Sbjct  62   AIATRDNDVVVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQ  121

Query  484  QELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            +ELIRFLN+GIFG G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  LLNHN
Sbjct  122  KELIRFLNSGIFGNGSESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIANLLNHN  181



>gb|AER58180.1| phenylalanine ammonia lyase [Cucumis sativus]
Length=713

 Score =   282 bits (722),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 151/180 (84%), Gaps = 3/180 (2%)
 Frame = +1

Query  127  AIENGHSNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  303
            A +NG     C    DPLNW +AADS+KGSHLDEVKRMV E+R P VK+GGQTLT++QVA
Sbjct  7    ANQNGSMESLCSSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGQTLTISQVA  66

Query  304  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  483
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRT  G ALQ
Sbjct  67   AIATRDNDVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQ  126

Query  484  QELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            +ELIRFLN+GIFG G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT LLNHN
Sbjct  127  KELIRFLNSGIFGNGSESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITNLLNHN  186



>ref|XP_004152155.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=713

 Score =   282 bits (722),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 151/180 (84%), Gaps = 3/180 (2%)
 Frame = +1

Query  127  AIENGHSNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  303
            A +NG     C    DPLNW +AADS+KGSHLDEVKRMV E+R P VK+GGQTLT++QVA
Sbjct  7    ANQNGSMESLCSSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGQTLTISQVA  66

Query  304  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  483
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRT  G ALQ
Sbjct  67   AIATRDNDVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQ  126

Query  484  QELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            +ELIRFLN+GIFG G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT LLNHN
Sbjct  127  KELIRFLNSGIFGNGSESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITNLLNHN  186



>ref|XP_008449240.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Cucumis melo]
Length=714

 Score =   282 bits (722),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 157/185 (85%), Gaps = 10/185 (5%)
 Frame = +1

Query  133  ENGHSN--DFCIKV------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  288
            E+G+ N  +FCI        DPLNW  AA+SLKGSHL+EVKRMV E+R P VK+GG+TLT
Sbjct  3    ESGYQNGVEFCIGARSNSNNDPLNWGAAAESLKGSHLEEVKRMVEEYRRPVVKLGGETLT  62

Query  289  VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  468
            ++QVAAIA+RD+ V VELSE AR GV+ASS WVM+SMN GTDSYGVTTGFGATSHRRTK 
Sbjct  63   ISQVAAIASRDSGVVVELSESARGGVEASSKWVMDSMNQGTDSYGVTTGFGATSHRRTKE  122

Query  469  GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  642
            G ALQ+ELIRFLNAG+FG GT   HTLPHS+TRAAMLVRINTLLQGYSGIRFEILEAITK
Sbjct  123  GGALQRELIRFLNAGVFGRGTESSHTLPHSSTRAAMLVRINTLLQGYSGIRFEILEAITK  182

Query  643  LLNHN  657
            LLNHN
Sbjct  183  LLNHN  187



>ref|XP_004152158.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=713

 Score =   282 bits (722),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 151/180 (84%), Gaps = 3/180 (2%)
 Frame = +1

Query  127  AIENGHSNDFC-IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  303
            A +NG     C    DPLNW +AADS+KGSHLDEVKRMV E+R P VK+GGQTLT++QVA
Sbjct  7    ANQNGSVETLCNTHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGQTLTISQVA  66

Query  304  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  483
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRT  G ALQ
Sbjct  67   AIATRDNDVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQ  126

Query  484  QELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            +ELIRFLN+GIFG G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT LLNHN
Sbjct  127  KELIRFLNSGIFGNGSESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITNLLNHN  186



>gb|ABM67591.1| phenylalanin ammonia-lyase [Vitis vinifera]
Length=710

 Score =   282 bits (721),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 151/170 (89%), Gaps = 3/170 (2%)
 Frame = +1

Query  154  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  333
            FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15   FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGDVG  73

Query  334  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  513
            VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74   VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  133

Query  514  IFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            IFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  134  IFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  183



>gb|ADO64252.1| PAL [Epimedium sagittatum]
Length=708

 Score =   282 bits (721),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 154/180 (86%), Gaps = 2/180 (1%)
 Frame = +1

Query  124  GAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  303
            G++   +S   C+  DPLNW MAA+S+KGSHLDEVKRMV E+R   V++GG++LT++QVA
Sbjct  2    GSLVQENSIALCLNKDPLNWNMAAESMKGSHLDEVKRMVEEYRKGVVRLGGESLTISQVA  61

Query  304  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  483
            AIA+ D  V VEL+E +RAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G ALQ
Sbjct  62   AIASHDQGVMVELNESSRAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQ  121

Query  484  QELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            +ELIRFLNAG+FG G  T HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LNHN
Sbjct  122  KELIRFLNAGVFGNGTETSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHN  181



>gb|AFZ78651.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=711

 Score =   282 bits (721),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 147/165 (89%), Gaps = 2/165 (1%)
 Frame = +1

Query  169  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  348
            DPLNW MAA+SLKGSHLDEVKRM+ E+R P +K+GG+TLT+ QV AIA+RD  VKVELSE
Sbjct  20   DPLNWGMAAESLKGSHLDEVKRMIDEYRKPVIKLGGETLTIGQVTAIASRDVGVKVELSE  79

Query  349  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  528
             AR GVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G  LQ+ELIRFLNAGIFG G
Sbjct  80   EARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNG  139

Query  529  TG--HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            T   HTLPHSA+RAAMLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  140  TESTHTLPHSASRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  184



>gb|AID51445.1| phenylalanine ammonia-lyase 2 [Astragalus membranaceus]
Length=718

 Score =   282 bits (722),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 157/183 (86%), Gaps = 9/183 (5%)
 Frame = +1

Query  136  NGHSNDFCIK------VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  297
            N +   FC+K       DPLNW +AA+S+KGSHLDEVKRMV E+R P V++GG+TLT++Q
Sbjct  9    NFNGGSFCLKNSTINASDPLNWGVAAESMKGSHLDEVKRMVEEYRTPVVRLGGETLTISQ  68

Query  298  VAAIA-ARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  474
            VAAIA A D+ V+VELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK G 
Sbjct  69   VAAIAGAYDDGVRVELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKQGG  128

Query  475  ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  648
            ALQ+ELIRFLNAGIFG GT   HTLP +ATRAAMLVRINTLLQGYSGIRFEILEAITKLL
Sbjct  129  ALQKELIRFLNAGIFGNGTESSHTLPQTATRAAMLVRINTLLQGYSGIRFEILEAITKLL  188

Query  649  NHN  657
            N+N
Sbjct  189  NNN  191



>sp|P35511.1|PAL1_SOLLC RecName: Full=Phenylalanine ammonia-lyase; Short=PAL [Solanum 
lycopersicum]
Length=704

 Score =   281 bits (720),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 153/176 (87%), Gaps = 7/176 (4%)
 Frame = +1

Query  151  DFCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARD-  321
            D C K   DPLNWEMAADSL+GSHLDEVK+MV EFR P VK+GG+TL+VAQVA+IA  D 
Sbjct  2    DLCKKSINDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGETLSVAQVASIANVDD  61

Query  322  --NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  495
              N VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVT GFGATSHRRTKNG ALQ+ELI
Sbjct  62   KSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTAGFGATSHRRTKNGGALQKELI  121

Query  496  RFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            RFLNAG+FG G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N N
Sbjct  122  RFLNAGVFGNGIESFHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSN  177



>ref|XP_009596642.1| PREDICTED: phenylalanine ammonia-lyase G4-like [Nicotiana tomentosiformis]
Length=719

 Score =   282 bits (721),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 155/184 (84%), Gaps = 10/184 (5%)
 Frame = +1

Query  136  NGHSN---DFCIK----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  294
            NGH+N   + CIK     DPLNW MAAD+LKGSHLDEVK+MV EFR P V++GG+TLT+A
Sbjct  9    NGHNNASQELCIKGNEQQDPLNWNMAADALKGSHLDEVKKMVEEFRKPVVQLGGETLTIA  68

Query  295  QVAAIAARD-NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  471
            QVAAIA R    V VEL+E ARAGVKASSDWV+  M NGTDSYGVTTGFGATSHRRTK G
Sbjct  69   QVAAIAGRSGTEVMVELAEAARAGVKASSDWVIEGMKNGTDSYGVTTGFGATSHRRTKQG  128

Query  472  HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  645
             ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL
Sbjct  129  AALQKELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  188

Query  646  LNHN  657
            LN+N
Sbjct  189  LNNN  192



>ref|XP_006436446.1| hypothetical protein CICLE_v10030821mg [Citrus clementina]
 ref|XP_006485648.1| PREDICTED: phenylalanine ammonia-lyase-like [Citrus sinensis]
 gb|ESR49686.1| hypothetical protein CICLE_v10030821mg [Citrus clementina]
Length=722

 Score =   282 bits (721),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 152/185 (82%), Gaps = 11/185 (6%)
 Frame = +1

Query  136  NGHSND---------FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  288
            NG +ND          C   DPLNW +AADSLKGSHLDEVKRMV E+R P VK+GG++LT
Sbjct  9    NGINNDRNGGTSSLGLCTGTDPLNWTVAADSLKGSHLDEVKRMVDEYRRPVVKLGGESLT  68

Query  289  VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  468
            + QV AIAA D+ VKVEL+E ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTK 
Sbjct  69   IGQVTAIAAHDSGVKVELAEAARAGVKASSDWVMDSMMKGTDSYGVTTGFGATSHRRTKQ  128

Query  469  GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  642
            G ALQ+ELIRFLN+GIFG GT   HTLPHSATRAAMLVR+NTLLQGYSGIRFEILE ITK
Sbjct  129  GGALQKELIRFLNSGIFGNGTESSHTLPHSATRAAMLVRVNTLLQGYSGIRFEILETITK  188

Query  643  LLNHN  657
             LNHN
Sbjct  189  FLNHN  193



>ref|XP_002268732.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   281 bits (720),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 151/170 (89%), Gaps = 3/170 (2%)
 Frame = +1

Query  154  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  333
            FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15   FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGDVS  73

Query  334  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  513
            VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74   VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  133

Query  514  IFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            IFG G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  134  IFGNGRESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  183



>sp|Q01861.1|PAL1_PEA RecName: Full=Phenylalanine ammonia-lyase 1 [Pisum sativum]
 dbj|BAA00885.1| phenylalanine ammonia-lyase [Pisum sativum]
 dbj|BAA00886.1| phenylalanine ammonia-lyase [Pisum sativum]
Length=723

 Score =   282 bits (721),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 156/180 (87%), Gaps = 3/180 (2%)
 Frame = +1

Query  127  AIENGHSNDFCI-KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  303
             + N  +N+  +   DPLNW +AA+++KGSHLDEVKRMV E+R P V++GG+TLT++QVA
Sbjct  18   CVTNAKNNNMKVNSADPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLGGETLTISQVA  77

Query  304  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  483
            AIAA D+ VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ
Sbjct  78   AIAAHDHGVKVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQ  137

Query  484  QELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            +ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKL+N+N
Sbjct  138  KELIRFLNAGIFGNGTESSHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLINNN  197



>prf||2001451A Phe ammonia lyase
Length=723

 Score =   282 bits (721),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 156/180 (87%), Gaps = 3/180 (2%)
 Frame = +1

Query  127  AIENGHSNDFCI-KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  303
             + N  +N+  +   DPLNW +AA+++KGSHLDEVKRMV E+R P V++GG+TLT++QVA
Sbjct  18   CVTNAKNNNMKVNSADPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLGGETLTISQVA  77

Query  304  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  483
            AIAA D+ VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ
Sbjct  78   AIAAHDHGVKVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQ  137

Query  484  QELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            +ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKL+N+N
Sbjct  138  KELIRFLNAGIFGNGTESSHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLINNN  197



>sp|Q42667.1|PALY_CITLI RecName: Full=Phenylalanine ammonia-lyase [Citrus limon]
 gb|AAB67733.1| phenylalanine ammonia-lyase [Citrus limon]
Length=722

 Score =   281 bits (720),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 147/170 (86%), Gaps = 2/170 (1%)
 Frame = +1

Query  154  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  333
             C   DPLNW +AADSLKGSHLDEVKRM+ E+R P VK+GG++LT+ QV AIAA D+ VK
Sbjct  24   LCTGTDPLNWTVAADSLKGSHLDEVKRMIDEYRRPVVKLGGESLTIGQVTAIAAHDSGVK  83

Query  334  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  513
            VEL+E ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLN+G
Sbjct  84   VELAEAARAGVKASSDWVMDSMMKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNSG  143

Query  514  IFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            IFG GT   HTLPHSATRAAMLVR+NTLLQGYSGIRFEILE ITK LNHN
Sbjct  144  IFGNGTESSHTLPHSATRAAMLVRVNTLLQGYSGIRFEILETITKFLNHN  193



>gb|KDO46246.1| hypothetical protein CISIN_1g004955mg [Citrus sinensis]
Length=722

 Score =   281 bits (720),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 151/185 (82%), Gaps = 11/185 (6%)
 Frame = +1

Query  136  NGHSND---------FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  288
            NG  ND          C   DPLNW +AADSLKGSHLDEVKRM+ E+R P VK+GG++LT
Sbjct  9    NGIKNDRNGGTSSLGLCTGTDPLNWTVAADSLKGSHLDEVKRMIDEYRRPVVKLGGESLT  68

Query  289  VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  468
            + QV AIAA D+ VKVEL+E ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTK 
Sbjct  69   IGQVTAIAAHDSGVKVELAEAARAGVKASSDWVMDSMMKGTDSYGVTTGFGATSHRRTKQ  128

Query  469  GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  642
            G ALQ+ELIRFLN+GIFG GT   HTLPHSATRAAMLVR+NTLLQGYSGIRFEILE ITK
Sbjct  129  GGALQKELIRFLNSGIFGNGTESSHTLPHSATRAAMLVRVNTLLQGYSGIRFEILETITK  188

Query  643  LLNHN  657
             LNHN
Sbjct  189  FLNHN  193



>ref|XP_010658395.1| PREDICTED: phenylalanine ammonia-lyase G1 [Vitis vinifera]
Length=723

 Score =   281 bits (720),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 148/165 (90%), Gaps = 2/165 (1%)
 Frame = +1

Query  169  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  348
            DPLNW MAA+SLKGSHLDEVKRMV E+R   V++GG+TLT++QVAA+A+RD  V VELSE
Sbjct  32   DPLNWNMAAESLKGSHLDEVKRMVEEYRRQVVQLGGETLTISQVAAVASRDTGVTVELSE  91

Query  349  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  528
             AR GVKASSDWVM+SMNNGTDSYGVTTGFGATSHRRTK G ALQ ELIRFLNAGIFG G
Sbjct  92   EAREGVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTKQGGALQMELIRFLNAGIFGNG  151

Query  529  T--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            T   HTLPHSATRA+MLVRINTLLQGYSGIRFEILEAITKL+NHN
Sbjct  152  TESCHTLPHSATRASMLVRINTLLQGYSGIRFEILEAITKLINHN  196



>ref|XP_008449238.1| PREDICTED: phenylalanine ammonia-lyase [Cucumis melo]
Length=708

 Score =   281 bits (719),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 149/165 (90%), Gaps = 2/165 (1%)
 Frame = +1

Query  169  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  348
            DPLNW +AA++LKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAIA RD  V VELSE
Sbjct  17   DPLNWGVAAEALKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAIATRDTDVIVELSE  76

Query  349  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  528
             ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG+G
Sbjct  77   SARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGSG  136

Query  529  --TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
              + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN+N
Sbjct  137  AESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNN  181



>ref|XP_002268256.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   281 bits (719),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 151/170 (89%), Gaps = 3/170 (2%)
 Frame = +1

Query  154  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  333
            FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15   FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGDVG  73

Query  334  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  513
            VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74   VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  133

Query  514  IFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            IFG G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  134  IFGNGRESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  183



>dbj|BAJ17655.1| phenylalanine ammonia lyase [Gynura bicolor]
Length=726

 Score =   281 bits (720),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 154/176 (88%), Gaps = 5/176 (3%)
 Frame = +1

Query  142  HSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARD  321
            H +D CIK D LNW +AA++L GSHLDEVK+MVAEFRNP VKIGG+TLTV+QVA IAA  
Sbjct  25   HVHDLCIK-DTLNWGVAAEALTGSHLDEVKKMVAEFRNPVVKIGGETLTVSQVAGIAAAS  83

Query  322  NA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  495
            ++  VKVELSE ARAGVKASSDWVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELI
Sbjct  84   DSSTVKVELSEAARAGVKASSDWVMESMDKGTDSYGVTTGFGATSHRRTKQGGALQKELI  143

Query  496  RFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            RFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN+N
Sbjct  144  RFLNAGIFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNNN  199



>ref|XP_003633986.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   281 bits (719),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 151/170 (89%), Gaps = 3/170 (2%)
 Frame = +1

Query  154  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  333
            FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15   FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGDVG  73

Query  334  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  513
            VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74   VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  133

Query  514  IFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            IFG G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  134  IFGNGRESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  183



>gb|EYU34451.1| hypothetical protein MIMGU_mgv1a002104mg [Erythranthe guttata]
Length=714

 Score =   281 bits (719),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 158/182 (87%), Gaps = 5/182 (3%)
 Frame = +1

Query  127  AIENGH--SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  297
            A ENGH  SN +C+K  DPLNW +AA+ LKGSHLDEVKRMV EFR P V +GG+TLT+AQ
Sbjct  6    ATENGHHNSNGYCVKQKDPLNWGLAAEGLKGSHLDEVKRMVEEFRKPVVNLGGKTLTIAQ  65

Query  298  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  477
            VAAIAA DNAV VEL+E ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G A
Sbjct  66   VAAIAATDNAVAVELAEAARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGA  125

Query  478  LQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  651
            LQ+ELIRFLNAGIFG GT   H LPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN
Sbjct  126  LQKELIRFLNAGIFGNGTESSHMLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLN  185

Query  652  HN  657
            HN
Sbjct  186  HN  187



>gb|KGN48162.1| hypothetical protein Csa_6G445750 [Cucumis sativus]
Length=708

 Score =   281 bits (718),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 149/165 (90%), Gaps = 2/165 (1%)
 Frame = +1

Query  169  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  348
            DPLNW +AA+SLKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAIA RD+ V VELSE
Sbjct  17   DPLNWGVAAESLKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAIATRDSDVIVELSE  76

Query  349  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  528
             AR GVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG+G
Sbjct  77   SARVGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGSG  136

Query  529  --TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
              + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN+N
Sbjct  137  AESDHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNN  181



>ref|XP_004143255.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Cucumis sativus]
 gb|KGN48160.1| Phenylalanine ammonia-lyase [Cucumis sativus]
Length=714

 Score =   281 bits (718),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 155/185 (84%), Gaps = 10/185 (5%)
 Frame = +1

Query  133  ENGHSN--DFCI------KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  288
            E GH N  +FCI        DPLNW  AA+SLKGSHL+EVKRMV E+R P VK+GG+TLT
Sbjct  3    ELGHQNGVEFCIGGRNNINNDPLNWGAAAESLKGSHLEEVKRMVEEYRRPVVKLGGETLT  62

Query  289  VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  468
            ++QVAAIA+RD+ V VELSE AR GV+ASS WVM+SMN GTDSYGVTTGFGATSHRRTK 
Sbjct  63   ISQVAAIASRDSGVVVELSESARGGVEASSKWVMDSMNQGTDSYGVTTGFGATSHRRTKE  122

Query  469  GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  642
            G ALQ+ELIRFLNAG+FG GT   HTLPH ATRAAMLVRINTLLQGYSGIRFEILEAITK
Sbjct  123  GGALQRELIRFLNAGVFGNGTESSHTLPHLATRAAMLVRINTLLQGYSGIRFEILEAITK  182

Query  643  LLNHN  657
            LLNHN
Sbjct  183  LLNHN  187



>gb|AEA72280.1| phenylalanine ammonia-lyase, partial [Angelica gigas]
Length=699

 Score =   280 bits (717),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 153/171 (89%), Gaps = 2/171 (1%)
 Frame = +1

Query  151  DFCI-KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARD-N  324
            D CI K DPL+W +AA+++ GSHLDEVK+MVAE+R P VK+GG+TLT++QVAAI+ARD +
Sbjct  2    DLCINKEDPLSWGIAAEAMTGSHLDEVKKMVAEYRKPVVKLGGETLTISQVAAISARDGS  61

Query  325  AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFL  504
             V VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFL
Sbjct  62   GVTVELSEAARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFL  121

Query  505  NAGIFGTGTGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            NAGIFG G+ +TLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN N
Sbjct  122  NAGIFGNGSDNTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNQN  172



>ref|XP_006354338.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X3 [Solanum 
tuberosum]
Length=723

 Score =   281 bits (718),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 158/190 (83%), Gaps = 15/190 (8%)
 Frame = +1

Query  133  ENGHSN------DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  282
            +NGH N      + C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK+ G+T
Sbjct  7    QNGHVNGEVVAMELCKKSINVHDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLEGET  66

Query  283  LTVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  453
            LTVAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFG TSH
Sbjct  67   LTVAQVASIANADNKSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGDTSH  126

Query  454  RRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEIL  627
            RRTKNG+ALQ++LIRFLNAG+FG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEIL
Sbjct  127  RRTKNGNALQKDLIRFLNAGVFGNGTELSHTLPHSATRAAMLVRINTLLQGYSGIRFEIL  186

Query  628  EAITKLLNHN  657
            EAITKL+N N
Sbjct  187  EAITKLINSN  196



>ref|XP_007009873.1| Phenylalanine ammonia-lyase 2 [Theobroma cacao]
 gb|EOY18683.1| Phenylalanine ammonia-lyase 2 [Theobroma cacao]
Length=713

 Score =   280 bits (717),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 139/173 (80%), Positives = 148/173 (86%), Gaps = 3/173 (2%)
 Frame = +1

Query  145  SNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDN  324
            S  FCI  DPLNW  +A+SLKGSHLDEVKRMV EFR P V++GG+TLT+AQVAAIA RD 
Sbjct  15   SPGFCI-TDPLNWGASAESLKGSHLDEVKRMVEEFRKPVVRLGGETLTIAQVAAIANRDA  73

Query  325  AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFL  504
             VKVELSE AR  VKASSDWVM  MN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFL
Sbjct  74   GVKVELSEAARPAVKASSDWVMEGMNRGTDSYGVTTGFGATSHRRTKQGAALQKELIRFL  133

Query  505  NAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            NAG+FG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKLLN N
Sbjct  134  NAGVFGQGTESCHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNVN  186



>gb|KEH24019.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=724

 Score =   281 bits (718),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 139/195 (71%), Positives = 161/195 (83%), Gaps = 14/195 (7%)
 Frame = +1

Query  115  TMEGAIENGHSND-FCI-----------KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNP  258
            T+  AI    +N+ FC+           + DPLNW +AA+++KGSH+DEVKRMV E+R P
Sbjct  3    TISAAITKNSANESFCLIHAKNNNMKVNEADPLNWGVAAEAMKGSHIDEVKRMVEEYRKP  62

Query  259  AVKIGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGF  438
             V++GG+TLT++QVAAIAA D+ V+VELSE ARAGV+ASSDWVM SMN GTDSYGVTTGF
Sbjct  63   VVRLGGETLTISQVAAIAAHDHGVQVELSESARAGVEASSDWVMESMNKGTDSYGVTTGF  122

Query  439  GATSHRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGI  612
            GATSHRRTK G ALQ+ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGI
Sbjct  123  GATSHRRTKQGGALQKELIRFLNAGIFGNGTESNHTLPHTATRAAMLVRINTLLQGYSGI  182

Query  613  RFEILEAITKLLNHN  657
            RFEILEAITKLLN+N
Sbjct  183  RFEILEAITKLLNNN  197



>ref|XP_004246652.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X2 [Solanum 
lycopersicum]
Length=719

 Score =   280 bits (717),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 142/195 (73%), Positives = 158/195 (81%), Gaps = 15/195 (8%)
 Frame = +1

Query  118  MEGAIENGHSN------DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVK  267
            M   + NGH+N      D C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK
Sbjct  1    MASIVPNGHANGKVVAMDLCKKSIIVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVK  60

Query  268  IGGQTLTVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGF  438
            +GG+TLT+AQVA+IA  DN    VKVELSE +RAGVKASSDWVM+SM+ GTDSYGVTTGF
Sbjct  61   LGGETLTIAQVASIANVDNKSNGVKVELSESSRAGVKASSDWVMDSMSKGTDSYGVTTGF  120

Query  439  GATSHRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGI  612
            G TSHRRT NG ALQ++LIRFLNAG+ G GT   HTLPHSATRAAMLVRINTLLQGYSGI
Sbjct  121  GDTSHRRTTNGSALQKDLIRFLNAGVLGNGTESSHTLPHSATRAAMLVRINTLLQGYSGI  180

Query  613  RFEILEAITKLLNHN  657
            RFEILEAITKL+N N
Sbjct  181  RFEILEAITKLINSN  195



>gb|KHG30005.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=718

 Score =   280 bits (717),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 155/191 (81%), Gaps = 11/191 (6%)
 Frame = +1

Query  118  MEGAIENGHSNDFC---------IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKI  270
            M    +NG  + FC            DPLNW + A+SLKGSHLDEVKRMV E+R P VK+
Sbjct  1    MAAITQNGSFDSFCTTTANGSTAFAADPLNWGIVAESLKGSHLDEVKRMVMEYRKPLVKL  60

Query  271  GGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  450
            GG+TLT++QVAAIAA D+ VKVELS+ ARA VKAS+DWV++ MN GTDSYGVTTGFGATS
Sbjct  61   GGETLTISQVAAIAAHDSGVKVELSDDARAAVKASADWVLDGMNKGTDSYGVTTGFGATS  120

Query  451  HRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEI  624
            HRRTK G ALQ+ELIRFLNAGIFG GT   +TLPHSATRAAMLVRINTLLQGYSGIRFEI
Sbjct  121  HRRTKQGAALQKELIRFLNAGIFGNGTESCNTLPHSATRAAMLVRINTLLQGYSGIRFEI  180

Query  625  LEAITKLLNHN  657
            LEAITKLLNHN
Sbjct  181  LEAITKLLNHN  191



>gb|ACT21093.1| phenylalanine ammonia-lyase [Camellia oleifera]
Length=706

 Score =   280 bits (716),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 157/182 (86%), Gaps = 5/182 (3%)
 Frame = +1

Query  118  MEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  297
            ME   ENG+ N   IK DPL+WE+AADS+KGSHLDEVKRMV EFR PA+++GG+TLT++Q
Sbjct  1    MEFCHENGNGNGHVIK-DPLSWELAADSMKGSHLDEVKRMVREFRQPAIRLGGETLTISQ  59

Query  298  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  477
            VAA+AA    + VELSE ARA V+ASS+WVM SMN GTDSYGVTTGFGATSHRRTK G A
Sbjct  60   VAAVAA--GCLPVELSEAARAAVQASSEWVMESMNKGTDSYGVTTGFGATSHRRTKQGGA  117

Query  478  LQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  651
            LQ+ELIRFLNAGIFG GT   HTLPHS+TRAAMLVRINTLLQGYSGIRFEILEA+TKL+N
Sbjct  118  LQKELIRFLNAGIFGNGTESCHTLPHSSTRAAMLVRINTLLQGYSGIRFEILEALTKLIN  177

Query  652  HN  657
            HN
Sbjct  178  HN  179



>gb|AAK60275.1|AF383152_1 phenylalanine ammonia-lyase 2 [Manihot esculenta]
Length=712

 Score =   280 bits (716),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 156/181 (86%), Gaps = 7/181 (4%)
 Frame = +1

Query  133  ENGHSN----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  300
            +NGH N      C   DPLNW +AA+S+ GSHLDEVK+MVAEFR P VK+GG+TLTVAQV
Sbjct  6    QNGHQNGSLDSLCTARDPLNWGLAAESMSGSHLDEVKKMVAEFRKPLVKLGGETLTVAQV  65

Query  301  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  480
            AAIA R++ ++VEL+E ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G AL
Sbjct  66   AAIA-RESGLQVELAESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGAL  124

Query  481  QQELIRFLNAGIFG--TGTGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH  654
            Q+ELIRFLNAGIFG  T + HTL HSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH
Sbjct  125  QRELIRFLNAGIFGNKTESCHTLSHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH  184

Query  655  N  657
            N
Sbjct  185  N  185



>emb|CBI26455.3| unnamed protein product [Vitis vinifera]
Length=679

 Score =   280 bits (715),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 150/170 (88%), Gaps = 3/170 (2%)
 Frame = +1

Query  154  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  333
            FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  39   FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGDVS  97

Query  334  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  513
            VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  98   VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  157

Query  514  IFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            IFG G  + HTLPHS TRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  158  IFGNGRESCHTLPHSTTRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  207



>gb|KDP44384.1| hypothetical protein JCGZ_20064 [Jatropha curcas]
Length=712

 Score =   280 bits (716),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 145/165 (88%), Gaps = 2/165 (1%)
 Frame = +1

Query  169  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  348
            DPLNW   A+SLKGSHLDEVKRM+ E+R P VK+GG+TLT+AQV AIA RD  VKVELSE
Sbjct  21   DPLNWGAVAESLKGSHLDEVKRMINEYRKPVVKLGGETLTIAQVTAIANRDAGVKVELSE  80

Query  349  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  528
             ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG G
Sbjct  81   AARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQRELIRFLNAGIFGNG  140

Query  529  --TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
              T H LPHSATRAAMLVRINTLLQGYSGIRFEILEAITK +NHN
Sbjct  141  TETCHILPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFINHN  185



>ref|XP_003633987.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   280 bits (716),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 150/170 (88%), Gaps = 3/170 (2%)
 Frame = +1

Query  154  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  333
            FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15   FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGDVS  73

Query  334  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  513
            VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74   VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  133

Query  514  IFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            IFG G  + HTLPHS TRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  134  IFGNGRESCHTLPHSTTRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  183



>dbj|BAF36970.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=704

 Score =   280 bits (716),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 149/165 (90%), Gaps = 2/165 (1%)
 Frame = +1

Query  169  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  348
            DPL+W +AA+S+KGSHL+EVKRMVAE+R P VK+GG+TLT+AQVAAIAA +  V VEL E
Sbjct  13   DPLSWGVAAESMKGSHLNEVKRMVAEYRKPVVKLGGETLTIAQVAAIAANEQGVSVELCE  72

Query  349  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  528
             ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG+ALQ ELIRFLNAGIFG G
Sbjct  73   SARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGNALQLELIRFLNAGIFGNG  132

Query  529  T--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            T   HTLP  ATRAAMLVRINTLLQGYSGIRFEILEAITKL+N+N
Sbjct  133  TESTHTLPQPATRAAMLVRINTLLQGYSGIRFEILEAITKLINNN  177



>ref|XP_010325983.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X3 [Solanum 
lycopersicum]
Length=718

 Score =   280 bits (716),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 157/189 (83%), Gaps = 13/189 (7%)
 Frame = +1

Query  130  IENGHSN----DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  285
            ++NGH N    D C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK+GG+TL
Sbjct  6    VQNGHVNGEAMDLCKKSINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGETL  65

Query  286  TVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  456
            T+AQVA+IA  DN    VKVELSE +RAGVKASSDWVM+SM+ GTDSYGVTTGFG TSHR
Sbjct  66   TIAQVASIANVDNKSNGVKVELSESSRAGVKASSDWVMDSMSKGTDSYGVTTGFGDTSHR  125

Query  457  RTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILE  630
            RT NG ALQ++LIRFLNAG+ G GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILE
Sbjct  126  RTTNGSALQKDLIRFLNAGVLGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEILE  185

Query  631  AITKLLNHN  657
            AITKL+N N
Sbjct  186  AITKLINSN  194



>gb|KJB62426.1| hypothetical protein B456_009G416300 [Gossypium raimondii]
Length=721

 Score =   280 bits (716),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 149/166 (90%), Gaps = 2/166 (1%)
 Frame = +1

Query  166  VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELS  345
            VDPLNW +AA SL+GSHLDEVKRMVAE+R   VK+GG+TLT++QVAAIA RD  VKVELS
Sbjct  29   VDPLNWGVAAKSLQGSHLDEVKRMVAEYRRSLVKLGGETLTISQVAAIATRDLGVKVELS  88

Query  346  EGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGT  525
            E ARAGVKAS+DWV++ MN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG 
Sbjct  89   EDARAGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFGN  148

Query  526  G--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  149  GIESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  194



>gb|KJB46525.1| hypothetical protein B456_007G373600 [Gossypium raimondii]
Length=718

 Score =   280 bits (716),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 155/191 (81%), Gaps = 11/191 (6%)
 Frame = +1

Query  118  MEGAIENGHSNDFC---------IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKI  270
            M    +NG  + FC            DPLNW + A+SLKGSHLDEVKRMV E+R P VK+
Sbjct  1    MAAITQNGSLDSFCTTTANGSTAFAADPLNWGVVAESLKGSHLDEVKRMVMEYRKPLVKL  60

Query  271  GGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  450
            GG+TLT++QVAAIAA D+ VKVELS+ ARA VKAS+DWV++ MN GTDSYGVTTGFGATS
Sbjct  61   GGETLTISQVAAIAAHDSGVKVELSDDARAAVKASADWVLDGMNKGTDSYGVTTGFGATS  120

Query  451  HRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEI  624
            HRRTK G ALQ+ELIRFLNAGIFG GT   +TLPHSATRAAMLVRINTLLQGYSGIRFEI
Sbjct  121  HRRTKQGAALQKELIRFLNAGIFGNGTESCNTLPHSATRAAMLVRINTLLQGYSGIRFEI  180

Query  625  LEAITKLLNHN  657
            LEAITKLLNHN
Sbjct  181  LEAITKLLNHN  191



>ref|XP_003635657.2| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   280 bits (715),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 150/170 (88%), Gaps = 3/170 (2%)
 Frame = +1

Query  154  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  333
            FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15   FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGDVN  73

Query  334  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  513
            VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74   VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  133

Query  514  IFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            IFG G  + HTLPHS TRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  134  IFGNGRESCHTLPHSTTRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  183



>ref|XP_002322884.2| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63887.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEF04645.2| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=715

 Score =   280 bits (715),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 160/188 (85%), Gaps = 8/188 (4%)
 Frame = +1

Query  118  MEGAIENGHSN----DFCI-KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  282
            ME   +NG+ N      C+ ++DPL+W +AA+++KGSHLDEVKRMVA++R P VK+GG+T
Sbjct  1    METVTKNGYQNGSLESLCVNQLDPLSWGVAAEAMKGSHLDEVKRMVADYRKPVVKLGGET  60

Query  283  LTVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRR  459
            LT+AQVA+IA  D   VKVELSE AR GVKASSDWVM+SM+ GTDSYGVTTGFGATSHRR
Sbjct  61   LTIAQVASIAGHDTGDVKVELSESARPGVKASSDWVMDSMDKGTDSYGVTTGFGATSHRR  120

Query  460  TKNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEA  633
            TK G ALQ+ELIRFLNAGIFG G  T HTLPHSATRAAMLVRINTLLQGYSGIRFEILEA
Sbjct  121  TKQGGALQKELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEA  180

Query  634  ITKLLNHN  657
            IT+LLN+N
Sbjct  181  ITRLLNNN  188



>gb|AHA42443.1| phenylalanine ammonia lyase [Cannabis sativa]
Length=707

 Score =   280 bits (715),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 150/170 (88%), Gaps = 3/170 (2%)
 Frame = +1

Query  154  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  333
            FC+K DPLNW +AA+S+ GSHLDEVKRMVAE+R P V +GG+TLT++QVAAIAA D  VK
Sbjct  12   FCVKGDPLNWGLAAESMSGSHLDEVKRMVAEYRKPVVGLGGETLTISQVAAIAAAD-GVK  70

Query  334  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  513
            VELSE  RAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLNAG
Sbjct  71   VELSESPRAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAG  130

Query  514  IFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            IFG GT   HTLPHS+TRA +LVRINTLLQGYSGIRFEILEA+ KLLN+N
Sbjct  131  IFGHGTESCHTLPHSSTRAGLLVRINTLLQGYSGIRFEILEAMAKLLNNN  180



>ref|XP_002312013.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63890.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEE89380.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=711

 Score =   279 bits (714),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 146/165 (88%), Gaps = 2/165 (1%)
 Frame = +1

Query  169  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  348
            DPLNW M A+SLKGSHLDEVKRM+ E+R P VK+GG++LT+ QV AIA+RD  VKVELSE
Sbjct  20   DPLNWGMVAESLKGSHLDEVKRMIDEYRKPVVKLGGESLTIGQVTAIASRDVGVKVELSE  79

Query  349  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  528
             AR GVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G  LQ+ELIRFLNAGIFG G
Sbjct  80   EARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNG  139

Query  529  TG--HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            T   HTLPHSA+RAAMLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  140  TESTHTLPHSASRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  184



>gb|AFZ78650.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=714

 Score =   279 bits (714),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 155/187 (83%), Gaps = 3/187 (2%)
 Frame = +1

Query  106  FNTTMEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  285
              T  +   +NG S   C + DPL+W +AA+++KGSHLDEVKRMVAE+R P V + GQTL
Sbjct  1    METITKNGYQNGSSESLCTQRDPLSWGVAAEAMKGSHLDEVKRMVAEYRKPVVNLAGQTL  60

Query  286  TVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  462
            T+AQVA+IA  D + VKVELSE AR  VKASSDWVM+SM+ GTDSYGVTTGFGATSHRRT
Sbjct  61   TIAQVASIAGHDASNVKVELSESARPRVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRT  120

Query  463  KNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  636
            K G ALQ+ELIRFLNAGIFG G  T HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI
Sbjct  121  KQGGALQKELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  180

Query  637  TKLLNHN  657
            TKLLN+N
Sbjct  181  TKLLNNN  187



>gb|AAF40224.1|AF237955_1 phenylalanine ammonia-lyase 2 [Rubus idaeus]
Length=730

 Score =   280 bits (715),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 157/192 (82%), Gaps = 13/192 (7%)
 Frame = +1

Query  121  EGAIENGHSND-FCIKV----------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVK  267
            +  I+NG  +D  CIK           DPLNW  AA+S+ GSHLDEV+RMVAE+R P VK
Sbjct  12   QNGIQNGSLDDGLCIKTESIKTGYSVSDPLNWGAAAESMTGSHLDEVRRMVAEYRKPVVK  71

Query  268  IGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGAT  447
            +GG+TLT++QVAAIA  D+ VKVEL+E ARAGVKASSDWVM+SMN GTDSYGVTTGFGAT
Sbjct  72   LGGETLTISQVAAIANHDSGVKVELAESARAGVKASSDWVMDSMNKGTDSYGVTTGFGAT  131

Query  448  SHRRTKNGHALQQELIRFLNAGIF--GTGTGHTLPHSATRAAMLVRINTLLQGYSGIRFE  621
            SHRRTK G ALQ+ELIRFLNAG+   GT + HTLPHSATRAAMLVRINTLLQGYSGIRFE
Sbjct  132  SHRRTKQGAALQKELIRFLNAGVLRNGTESAHTLPHSATRAAMLVRINTLLQGYSGIRFE  191

Query  622  ILEAITKLLNHN  657
            ILEAI+K LNHN
Sbjct  192  ILEAISKFLNHN  203



>ref|XP_011031723.1| PREDICTED: phenylalanine ammonia-lyase G4 [Populus euphratica]
Length=711

 Score =   279 bits (714),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 146/165 (88%), Gaps = 2/165 (1%)
 Frame = +1

Query  169  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  348
            DPLNW M A+SLKGSHLDEVKRM+ E+R P VK+GG++LT+ QV AIA+RD  VKVELSE
Sbjct  20   DPLNWGMVAESLKGSHLDEVKRMINEYRKPVVKLGGESLTIGQVTAIASRDVGVKVELSE  79

Query  349  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  528
             AR GVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G  LQ+ELIRFLNAGIFG G
Sbjct  80   EARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNG  139

Query  529  TG--HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            T   HTLPHSA+RAAMLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  140  TESTHTLPHSASRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  184



>ref|XP_006381441.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63888.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|ERP59238.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=714

 Score =   279 bits (714),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 155/187 (83%), Gaps = 3/187 (2%)
 Frame = +1

Query  106  FNTTMEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  285
              T  +   +NG S   C + DPL+W +AA+++KGSHLDEVKRMVAE+R P V + GQTL
Sbjct  1    METITKNGYQNGSSESLCTQRDPLSWGVAAEAMKGSHLDEVKRMVAEYRKPVVNLAGQTL  60

Query  286  TVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  462
            T+AQVA+IA  D + VKVELSE AR  VKASSDWVM+SM+ GTDSYGVTTGFGATSHRRT
Sbjct  61   TIAQVASIAGHDASNVKVELSESARPRVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRT  120

Query  463  KNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  636
            K G ALQ+ELIRFLNAGIFG G  T HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI
Sbjct  121  KQGGALQKELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  180

Query  637  TKLLNHN  657
            TKLLN+N
Sbjct  181  TKLLNNN  187



>ref|XP_010662075.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   279 bits (713),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 149/170 (88%), Gaps = 3/170 (2%)
 Frame = +1

Query  154  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  333
            FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15   FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVQLGGETLTISQVAAIAGREGDVS  73

Query  334  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  513
            VELSE ARAGVKASSDWVM SM  G DSYGVTTGFGATSHRRTK G ALQ+ELIR LNAG
Sbjct  74   VELSETARAGVKASSDWVMESMKKGIDSYGVTTGFGATSHRRTKQGGALQKELIRVLNAG  133

Query  514  IFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            IFG G  + HTLPHSATRAAMLVRIN+LLQGYSGIRFEILEAITKLLNHN
Sbjct  134  IFGNGRESCHTLPHSATRAAMLVRINSLLQGYSGIRFEILEAITKLLNHN  183



>gb|AAA34179.2| phenylalanine ammonia lyase [Solanum lycopersicum]
Length=704

 Score =   279 bits (713),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 152/176 (86%), Gaps = 7/176 (4%)
 Frame = +1

Query  151  DFCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARD-  321
            D C K   DPLNWEMAADSL+ SHLDEVK+MV EFR P VK+GG+TL+VAQVA+IA  D 
Sbjct  2    DLCKKSINDPLNWEMAADSLRQSHLDEVKKMVDEFRKPIVKLGGETLSVAQVASIANVDD  61

Query  322  --NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  495
              N VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVT GFGATSHRRTKNG ALQ+ELI
Sbjct  62   KSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTAGFGATSHRRTKNGGALQKELI  121

Query  496  RFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            RFLNAG+FG G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N N
Sbjct  122  RFLNAGVFGNGIESFHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSN  177



>gb|ACT32033.1| phenylalanine ammonia-lyase [Glycine soja]
Length=712

 Score =   279 bits (713),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 154/181 (85%), Gaps = 7/181 (4%)
 Frame = +1

Query  136  NGHSN-DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  300
            NGH N  FC+      DPLNW  AA+++KGSHLDEVKRMV+E+R P V++GG+TLT+AQV
Sbjct  5    NGHQNGSFCLSSTKGSDPLNWGAAAEAMKGSHLDEVKRMVSEYRKPVVRLGGETLTIAQV  64

Query  301  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  480
            AA+A  D+ V VELSE AR GVKASS+WVMNSMNN TDSYGVTTGFGATSHRRTK G AL
Sbjct  65   AAVAGHDHGVTVELSESAREGVKASSEWVMNSMNNRTDSYGVTTGFGATSHRRTKQGGAL  124

Query  481  QQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH  654
            Q+ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEA TKLLN+
Sbjct  125  QKELIRFLNAGIFGNGTESSHTLPHTATRAAMLVRINTLLQGYSGIRFEILEANTKLLNN  184

Query  655  N  657
            N
Sbjct  185  N  185



>dbj|BAF36968.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=690

 Score =   278 bits (711),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 147/163 (90%), Gaps = 2/163 (1%)
 Frame = +1

Query  175  LNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSEGA  354
            L+W +AA+S+KGSHLDEVKRMVAE+R P VK+GG+TLT+AQVAAIAA D  V VEL E A
Sbjct  1    LSWGVAAESMKGSHLDEVKRMVAEYRKPVVKLGGETLTIAQVAAIAANDQGVSVELCESA  60

Query  355  RAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG--  528
            RAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG+ALQ ELIRFLNAGIFG G  
Sbjct  61   RAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGNALQLELIRFLNAGIFGNGTE  120

Query  529  TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            T HTLP  ATRAAMLVRINTLLQGYSGIRFEILEAITKL+N+N
Sbjct  121  TNHTLPQPATRAAMLVRINTLLQGYSGIRFEILEAITKLINNN  163



>ref|XP_008454138.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=713

 Score =   278 bits (712),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 150/180 (83%), Gaps = 3/180 (2%)
 Frame = +1

Query  127  AIENGHSNDFC-IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  303
            A +NG     C    DPLNW +AADS+KGSHLDEVKRMV E+R P VK+GG+TLT++QVA
Sbjct  7    ANQNGSVESLCNSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVA  66

Query  304  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  483
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRT  G ALQ
Sbjct  67   AIATRDNDVVVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQ  126

Query  484  QELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            +ELIRFLN+GIFG G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  LLNHN
Sbjct  127  KELIRFLNSGIFGNGSESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIANLLNHN  186



>gb|ACS71953.1| phenylalanine ammonia-lyase [Euphorbia pulcherrima]
Length=721

 Score =   278 bits (712),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 157/189 (83%), Gaps = 10/189 (5%)
 Frame = +1

Query  121  EGAIENGHSNDFCIKV------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  282
            +   +NG  N  C         DPL+W +AA+S+KGSHLDEVKRMVAEFR P VK+GG+T
Sbjct  6    QNGFKNGSLNSLCTDSESIRSHDPLSWGLAAESMKGSHLDEVKRMVAEFRKPVVKLGGET  65

Query  283  LTVAQVAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  456
            LTVAQVAAIAA + +  ++VEL+E ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATSHR
Sbjct  66   LTVAQVAAIAASNGSENIRVELAESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHR  125

Query  457  RTKNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILE  630
            RTK G ALQ+ELIRFLNAGIFG G  T H LPHSAT+AAM+VRINTLLQGYSGIRFEILE
Sbjct  126  RTKQGGALQKELIRFLNAGIFGNGTETSHILPHSATKAAMIVRINTLLQGYSGIRFEILE  185

Query  631  AITKLLNHN  657
            AITKLLN N
Sbjct  186  AITKLLNTN  194



>gb|ACM44926.1| phenylalanine ammonia-lyase [Euphorbia pulcherrima]
Length=721

 Score =   278 bits (712),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 157/189 (83%), Gaps = 10/189 (5%)
 Frame = +1

Query  121  EGAIENGHSNDFCIKV------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  282
            +   +NG  N  C         DPL+W +AA+S+KGSHLDEVKRMVAEFR P VK+GG+T
Sbjct  6    QNGFKNGSLNSLCTDSESIRSHDPLSWGLAAESMKGSHLDEVKRMVAEFRKPVVKLGGET  65

Query  283  LTVAQVAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  456
            LTVAQVAAIAA + +  ++VEL+E ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATSHR
Sbjct  66   LTVAQVAAIAASNGSENIRVELAESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHR  125

Query  457  RTKNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILE  630
            RTK G ALQ+ELIRFLNAGIFG G  T H LPHSAT+AAM+VRINTLLQGYSGIRFEILE
Sbjct  126  RTKQGGALQKELIRFLNAGIFGNGTETSHILPHSATKAAMIVRINTLLQGYSGIRFEILE  185

Query  631  AITKLLNHN  657
            AITKLLN N
Sbjct  186  AITKLLNTN  194



>gb|AJO53272.1| phenylalanine ammonia-lyase [Pogostemon cablin]
Length=711

 Score =   278 bits (712),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 155/184 (84%), Gaps = 8/184 (4%)
 Frame = +1

Query  130  IENGHSND-FCIK-----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  291
            +ENG++ D  C++     VDPLNW  AA++L+GSHLDEVKRMV EFR P V++GG+TLT+
Sbjct  1    MENGNNGDGLCVQSRNDVVDPLNWNAAAEALRGSHLDEVKRMVEEFRKPVVRLGGETLTI  60

Query  292  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  471
             QVAA+A R+ AV VEL+E AR GVKASSDWVM SMNNGTDSYGVTTGFGATSHRRTK G
Sbjct  61   GQVAAVATREAAVTVELTETAREGVKASSDWVMESMNNGTDSYGVTTGFGATSHRRTKQG  120

Query  472  HALQQELIRFLNAGIFG--TGTGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  645
             ALQ+ELIRFLNAGIFG  T + H LPHS TRA+MLVRINTLLQGYSGIRFE+LEAITK 
Sbjct  121  GALQKELIRFLNAGIFGNNTESSHMLPHSTTRASMLVRINTLLQGYSGIRFEVLEAITKF  180

Query  646  LNHN  657
            LNHN
Sbjct  181  LNHN  184



>sp|O23865.1|PAL1_DAUCA RecName: Full=Phenylalanine ammonia-lyase 1 [Daucus carota]
 dbj|BAA23367.1| phenylalanine ammonia-lyase [Daucus carota]
Length=708

 Score =   278 bits (711),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 151/172 (88%), Gaps = 4/172 (2%)
 Frame = +1

Query  148  NDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNA  327
            N  C++ DPLNW MAA++L GSHLDEVKRMVAEFR P V++GG+TLTV+QVAAIAA   +
Sbjct  12   NGLCMQKDPLNWGMAAEALTGSHLDEVKRMVAEFRKPMVQLGGETLTVSQVAAIAA--GS  69

Query  328  VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLN  507
            VKVEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLN
Sbjct  70   VKVELAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLN  129

Query  508  AGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            AGIFG+G  + + LPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN N
Sbjct  130  AGIFGSGNDSSNILPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNQN  181



>ref|XP_004156289.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=714

 Score =   278 bits (711),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 154/185 (83%), Gaps = 10/185 (5%)
 Frame = +1

Query  133  ENGHSN--DFCI------KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  288
            E GH N  +FCI        DPLNW  AA+SLKGSHL+EVKRMV E+R P VK+GG+TLT
Sbjct  3    ELGHQNGVEFCIGGRNNINNDPLNWGAAAESLKGSHLEEVKRMVEEYRRPVVKLGGETLT  62

Query  289  VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  468
            ++QVAAIA+RD+ V VELSE AR GV+ASS WVM+SMN GTDSYGVTTGFGATSHRRTK 
Sbjct  63   ISQVAAIASRDSGVVVELSESARGGVEASSKWVMDSMNQGTDSYGVTTGFGATSHRRTKE  122

Query  469  GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  642
            G ALQ+ELIRFLNAG+FG GT   HTLPH ATRAAMLVRINTLLQGYSGIRFEILEAI K
Sbjct  123  GGALQRELIRFLNAGVFGNGTESSHTLPHLATRAAMLVRINTLLQGYSGIRFEILEAIIK  182

Query  643  LLNHN  657
            LLNHN
Sbjct  183  LLNHN  187



>gb|AEX32790.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   278 bits (711),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 150/170 (88%), Gaps = 3/170 (2%)
 Frame = +1

Query  154  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  333
            FC+  DPLNW MAA++LK SHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15   FCVS-DPLNWGMAAETLKESHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGDVG  73

Query  334  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  513
            VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74   VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  133

Query  514  IFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            IFG G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  134  IFGNGRESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  183



>dbj|BAF36967.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=730

 Score =   278 bits (712),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 156/194 (80%), Gaps = 19/194 (10%)
 Frame = +1

Query  133  ENGHSNDFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  300
            E+ +S+ FC       DPL+W +AADS+KGSHLDEVKRMVAE+R P VK+GG+TLT+AQV
Sbjct  10   ESLNSSIFCTAAKAGSDPLSWGVAADSMKGSHLDEVKRMVAEYRKPVVKLGGETLTIAQV  69

Query  301  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  480
            AAIAA D  V VEL E ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG+AL
Sbjct  70   AAIAANDQGVSVELCESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGNAL  129

Query  481  QQELI-------------RFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIR  615
            Q ELI             RFLNAGIFG G  T HTLP  ATRAAMLVRINTLLQGYSGIR
Sbjct  130  QLELIRIKVVDVNMFLFFRFLNAGIFGNGTETSHTLPQPATRAAMLVRINTLLQGYSGIR  189

Query  616  FEILEAITKLLNHN  657
            FEILEAITKL+N+N
Sbjct  190  FEILEAITKLINNN  203



>sp|P45732.1|PALY_STYHU RecName: Full=Phenylalanine ammonia-lyase [Stylosanthes humilis]
 gb|AAA99500.1| phenylalanine ammonia lyase [Stylosanthes humilis]
Length=715

 Score =   278 bits (711),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 148/165 (90%), Gaps = 2/165 (1%)
 Frame = +1

Query  169  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  348
            DPLNW  AA++LKGSHLDEVKRMV+E+R P V +GGQTLT++QVAAIAA D  V V+LSE
Sbjct  24   DPLNWAAAAEALKGSHLDEVKRMVSEYRKPLVNLGGQTLTISQVAAIAANDQGVSVQLSE  83

Query  349  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  528
             +RAGVKASSDWVM+SMNNGTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG G
Sbjct  84   ASRAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNG  143

Query  529  --TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
              T  TLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKLLN+N
Sbjct  144  TETNCTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNN  188



>emb|CAN77065.1| hypothetical protein VITISV_009233 [Vitis vinifera]
Length=707

 Score =   278 bits (710),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 148/165 (90%), Gaps = 2/165 (1%)
 Frame = +1

Query  169  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  348
            DPLNW +AA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V VELSE
Sbjct  16   DPLNWGVAAEALKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREXDVSVELSE  75

Query  349  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  528
             ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG G
Sbjct  76   TARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNG  135

Query  529  T--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            T   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  136  TESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  180



>sp|P45730.1|PALY_POPTR RecName: Full=Phenylalanine ammonia-lyase [Populus trichocarpa]
 pir||JQ2265 phenylalanine ammonia-lyase (EC 4.3.1.5) - western balsam poplar 
x cottonwood
 gb|AAA33805.1| phenylalanine ammonia lyase [Populus trichocarpa x Populus deltoides]
Length=715

 Score =   278 bits (711),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 159/188 (85%), Gaps = 8/188 (4%)
 Frame = +1

Query  118  MEGAIENGHSN----DFCI-KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  282
            ME   +NG+ N      C+ + DPL+W +AA+++KGSHLDEVKRMVA++R P VK+GG+T
Sbjct  1    METVTKNGYQNGSLESLCVNQRDPLSWGVAAEAMKGSHLDEVKRMVADYRKPVVKLGGET  60

Query  283  LTVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRR  459
            LT+AQVA+IA  D   VKVELSE AR GVKASSDWVM+SM+ GTDSYGVTTGFGATSHRR
Sbjct  61   LTIAQVASIAGHDTGDVKVELSESARPGVKASSDWVMDSMDKGTDSYGVTTGFGATSHRR  120

Query  460  TKNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEA  633
            TK G ALQ+ELIRFLNAGIFG G  T HTLPHSATRAAMLVRINTLLQGYSGIRFEILEA
Sbjct  121  TKQGGALQKELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEA  180

Query  634  ITKLLNHN  657
            IT+LLN+N
Sbjct  181  ITRLLNNN  188



>ref|XP_004143259.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 ref|XP_004156290.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=705

 Score =   278 bits (710),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 146/165 (88%), Gaps = 2/165 (1%)
 Frame = +1

Query  169  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  348
            DPLNW +AA+SLKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAIA RD  V VELSE
Sbjct  14   DPLNWGVAAESLKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAIATRDFDVTVELSE  73

Query  349  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  528
             ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLNAGIFG G
Sbjct  74   SARAGVKASSDWVMESMKKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGIFGNG  133

Query  529  --TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
              + HTL  SATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  134  AESCHTLSRSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  178



>gb|ACC63889.1| phenylalanine ammonia-lyase [Populus trichocarpa]
Length=711

 Score =   278 bits (710),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 146/165 (88%), Gaps = 2/165 (1%)
 Frame = +1

Query  169  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  348
            DPLNW MAA+SLKGSHLDEVKRM+ E+R P VK+GG+TLT+ QV AIA+RD  V VELSE
Sbjct  20   DPLNWGMAAESLKGSHLDEVKRMIEEYRKPVVKLGGETLTIGQVTAIASRDVGVMVELSE  79

Query  349  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  528
             ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G  LQ+ELIRFLNAGIFG G
Sbjct  80   EARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNG  139

Query  529  T--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            T   HTLP SATRAAMLVRINTLLQGYSGIRFE+LEAITKLLNHN
Sbjct  140  TESSHTLPRSATRAAMLVRINTLLQGYSGIRFEMLEAITKLLNHN  184



>ref|XP_008454137.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=713

 Score =   278 bits (710),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 151/180 (84%), Gaps = 3/180 (2%)
 Frame = +1

Query  127  AIENGHSNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  303
            A +NG +   C    DPLNW +AADS+KGSHLDEVKRMV E+R P VK+GG+TLT++QVA
Sbjct  7    ANQNGSTESLCSSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVA  66

Query  304  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  483
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRT  G ALQ
Sbjct  67   AIATRDNDVVVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQ  126

Query  484  QELIRFLNAGIFG--TGTGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            +ELIRFLN+GIFG  + + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  LLNHN
Sbjct  127  KELIRFLNSGIFGNESESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIANLLNHN  186



>ref|XP_002315308.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63891.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEF01479.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=711

 Score =   278 bits (710),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 146/165 (88%), Gaps = 2/165 (1%)
 Frame = +1

Query  169  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  348
            DPLNW MAA+SLKGSHLDEVKRM+ E+R P VK+GG+TLT+ QV AIA+RD  V VELSE
Sbjct  20   DPLNWGMAAESLKGSHLDEVKRMIEEYRKPVVKLGGETLTIGQVTAIASRDVGVMVELSE  79

Query  349  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  528
             ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G  LQ+ELIRFLNAGIFG G
Sbjct  80   EARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNG  139

Query  529  T--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            T   HTLP SATRAAMLVRINTLLQGYSGIRFE+LEAITKLLNHN
Sbjct  140  TESSHTLPRSATRAAMLVRINTLLQGYSGIRFEMLEAITKLLNHN  184



>gb|AJR20994.1| phenylalanine ammonia-lyase [Populus szechuanica]
Length=711

 Score =   278 bits (710),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 146/165 (88%), Gaps = 2/165 (1%)
 Frame = +1

Query  169  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  348
            DPLNW MAA+SLKGSHLDEVKRM+ E+R P VK+GG+TLT+ QV AIA+RD  V VELSE
Sbjct  20   DPLNWGMAAESLKGSHLDEVKRMIEEYRKPVVKLGGETLTIGQVTAIASRDVGVMVELSE  79

Query  349  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  528
             ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G  LQ+ELIRFLNAGIFG G
Sbjct  80   EARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNG  139

Query  529  T--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            T   HTLP SATRAAMLVRINTLLQGYSGIRFE+LEAITKLLNHN
Sbjct  140  TESSHTLPRSATRAAMLVRINTLLQGYSGIRFEMLEAITKLLNHN  184



>ref|XP_008449236.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=705

 Score =   277 bits (709),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 146/165 (88%), Gaps = 2/165 (1%)
 Frame = +1

Query  169  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  348
            DPLNW +AA+SLKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAIA RD  V VELSE
Sbjct  14   DPLNWGVAAESLKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAIATRDIDVTVELSE  73

Query  349  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  528
             ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG G
Sbjct  74   SARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNG  133

Query  529  --TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
              + HTL  SATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  134  VESSHTLSRSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  178



>gb|ADD12041.1| phenylalanine ammonia lyase [Cistanche deserticola]
 gb|ADD16918.1| phenylalanine ammonia lyase [Cistanche deserticola]
Length=709

 Score =   277 bits (709),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 157/181 (87%), Gaps = 5/181 (3%)
 Frame = +1

Query  130  IENGH-SNDFCIK--VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  300
            +ENGH SN FC+    DPLNW  AA+SLKGSHLDEVKRMV EFR P VK+GG++LT+AQV
Sbjct  1    MENGHHSNVFCVNENKDPLNWAAAAESLKGSHLDEVKRMVEEFRKPVVKLGGESLTIAQV  60

Query  301  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  480
            AAIAARDNAV VEL+E AR GVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G AL
Sbjct  61   AAIAARDNAVAVELAEAARDGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGAL  120

Query  481  QQELIRFLNAGIFG--TGTGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH  654
            Q+ELIRFLNAGIFG  T + HTLP SATRAAMLVRINTLLQGYSGIRFEILEAITK LNH
Sbjct  121  QKELIRFLNAGIFGNVTESSHTLPRSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNH  180

Query  655  N  657
            N
Sbjct  181  N  181



>gb|KEH24018.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=724

 Score =   278 bits (710),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 160/195 (82%), Gaps = 14/195 (7%)
 Frame = +1

Query  115  TMEGAIENGHSND-FCI-----------KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNP  258
            T+  AI    +N+ FC+           + DPLNW +AA+++KGSHLDEVKRMV E+R P
Sbjct  3    TISAAITKNSANESFCLIHAKNNNMKVNEADPLNWGVAAEAMKGSHLDEVKRMVEEYRKP  62

Query  259  AVKIGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGF  438
             V++GG+TLT++QVAAIAA D+ V+VELSE ARAGV+ASSDWVM SMN GTDSYGVTTGF
Sbjct  63   VVRLGGETLTISQVAAIAAHDHGVQVELSESARAGVEASSDWVMESMNKGTDSYGVTTGF  122

Query  439  GATSHRRTKNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGI  612
            GATSHRRTK G ALQ+ELIRFLNAGIFG G  + HTLPH+ATRAAMLVRINTLLQGYSGI
Sbjct  123  GATSHRRTKQGGALQKELIRFLNAGIFGKGSESSHTLPHTATRAAMLVRINTLLQGYSGI  182

Query  613  RFEILEAITKLLNHN  657
            RFEILEAIT LLN+N
Sbjct  183  RFEILEAITNLLNNN  197



>gb|AAN52279.1|AF480619_1 phenylalanine ammonia-lyase [Populus tremuloides]
Length=714

 Score =   277 bits (708),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 154/187 (82%), Gaps = 3/187 (2%)
 Frame = +1

Query  106  FNTTMEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  285
              T  +   +NG S   C + DPL+W +AA+++KGSHLDEVKRMVAE+R P V + GQ L
Sbjct  1    METITKNGYQNGSSESLCTQRDPLSWGVAAEAMKGSHLDEVKRMVAEYRKPVVNLAGQNL  60

Query  286  TVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  462
            T+AQVA+IA  D + VKVELSE AR  VKASSDWVM+SM+ GTDSYGVTTGFGATSHRRT
Sbjct  61   TIAQVASIAGHDASNVKVELSESARPRVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRT  120

Query  463  KNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  636
            K G ALQ+ELIRFLNAGIFG G  T HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI
Sbjct  121  KQGGALQKELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  180

Query  637  TKLLNHN  657
            TKLLN+N
Sbjct  181  TKLLNNN  187



>ref|XP_011041025.1| PREDICTED: phenylalanine ammonia-lyase G2B [Populus euphratica]
Length=711

 Score =   277 bits (708),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 146/165 (88%), Gaps = 2/165 (1%)
 Frame = +1

Query  169  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  348
            DPLNW MAA+SLKGSHLDEVKRM+ E+R P VK+GG+TLT+ QV AIA+RD  V VELSE
Sbjct  20   DPLNWGMAAESLKGSHLDEVKRMIEEYRKPVVKLGGETLTIGQVTAIASRDVGVVVELSE  79

Query  349  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  528
             ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G  LQ+ELIRFLNAGIFG G
Sbjct  80   EARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNG  139

Query  529  T--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            T   HTLP SATRAAMLVRINTLLQGYSGIRFE+LEAITKLLNHN
Sbjct  140  TESSHTLPRSATRAAMLVRINTLLQGYSGIRFEMLEAITKLLNHN  184



>ref|XP_003633985.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   277 bits (708),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 148/165 (90%), Gaps = 2/165 (1%)
 Frame = +1

Query  169  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  348
            DPLNW +AA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V VELSE
Sbjct  19   DPLNWGVAAEALKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREEDVSVELSE  78

Query  349  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  528
             ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG G
Sbjct  79   TARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNG  138

Query  529  --TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
              + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  139  RESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  183



>ref|XP_011048535.1| PREDICTED: phenylalanine ammonia-lyase-like [Populus euphratica]
Length=714

 Score =   277 bits (708),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 154/187 (82%), Gaps = 3/187 (2%)
 Frame = +1

Query  106  FNTTMEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  285
              T  +   +NG S   C + DPL+W +AA+++KGSHLDEVKRMVAE+R P V + GQ L
Sbjct  1    METITKNGYQNGSSESLCTQRDPLSWGVAAEAMKGSHLDEVKRMVAEYRKPVVNLAGQNL  60

Query  286  TVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  462
            T+AQVA+IA  D + VKVELSE AR  VKASSDWVM+SM+ GTDSYGVTTGFGATSHRRT
Sbjct  61   TIAQVASIAGHDASDVKVELSESARPRVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRT  120

Query  463  KNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  636
            K G ALQ+ELIRFLNAGIFG G  T HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI
Sbjct  121  KQGGALQKELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  180

Query  637  TKLLNHN  657
            TKLLN+N
Sbjct  181  TKLLNNN  187



>gb|AGH13333.1| phenylalanine ammonia-lyase [Rhus chinensis]
Length=707

 Score =   276 bits (707),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 144/165 (87%), Gaps = 2/165 (1%)
 Frame = +1

Query  169  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  348
            DPLNW  AA+SLKGSHLDEVKRMV E R P VK+GG+TLT+ QV AIA  D+ ++VELSE
Sbjct  16   DPLNWNFAAESLKGSHLDEVKRMVEESRKPVVKLGGETLTIGQVTAIANHDSGLRVELSE  75

Query  349  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  528
             AR GV+ASSDWVM SMNNGTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG G
Sbjct  76   AARPGVQASSDWVMESMNNGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNG  135

Query  529  T--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            T   HTLPHSATRAAMLVRINTLLQGYSGIRF+ILEAITK LNHN
Sbjct  136  TESCHTLPHSATRAAMLVRINTLLQGYSGIRFDILEAITKFLNHN  180



>ref|NP_001236956.1| phenylalanine ammonia-lyase 2 [Glycine max]
 gb|ACS88364.1| phenylalanine ammonia-lyase 2 [Glycine max]
 gb|ACU30058.1| phenylalanine ammonia-lyase 2 [Glycine max]
Length=717

 Score =   276 bits (707),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 153/185 (83%), Gaps = 11/185 (6%)
 Frame = +1

Query  136  NGHSNDFCIKV---------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  288
            N  + +FC+ V         DPLNW  AA+++ GSHLDEVKRM+ E+R P VK+GG+TLT
Sbjct  6    NAANTNFCVNVSNNGYISANDPLNWGAAAEAMAGSHLDEVKRMLEEYRRPVVKLGGETLT  65

Query  289  VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  468
            ++QVAAIAA D  VKVEL+E +RAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK 
Sbjct  66   ISQVAAIAAHDQGVKVELAESSRAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQ  125

Query  469  GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  642
            G ALQ+ELIRFLNAGIFG GT    TLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITK
Sbjct  126  GAALQKELIRFLNAGIFGNGTESNCTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITK  185

Query  643  LLNHN  657
            LLN+N
Sbjct  186  LLNNN  190



>emb|CAL91037.1| phenylalanine ammonia-lyase 1 [Cynara cardunculus var. scolymus]
Length=694

 Score =   276 bits (706),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 149/167 (89%), Gaps = 4/167 (2%)
 Frame = +1

Query  169  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNA-VKVELS  345
            DPLNW +AA+SLKGSHLDE+KRMVAEFR P V++GG+TLTV+QVAAIAA D+  VKVELS
Sbjct  1    DPLNWGIAAESLKGSHLDEIKRMVAEFRRPIVRLGGETLTVSQVAAIAATDDGGVKVELS  60

Query  346  EGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI-RFLNAGIFG  522
            E +RAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRTK G ALQ+ELI RFLNAGIFG
Sbjct  61   ESSRAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKEGGALQKELIRRFLNAGIFG  120

Query  523  TGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
             GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LNHN
Sbjct  121  NGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHN  167



>gb|AFU90757.1| phenylalanine ammonia-lyase [Epimedium sagittatum]
Length=716

 Score =   276 bits (707),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 152/176 (86%), Gaps = 2/176 (1%)
 Frame = +1

Query  136  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  315
            NG  +  C+K DPLNW +AA+SL+GSHLDEVKRMV EF  P VK+ GQ+LT++QVAA+A 
Sbjct  14   NGSIDGLCMKSDPLNWGLAAESLQGSHLDEVKRMVNEFHKPIVKLEGQSLTISQVAAVAM  73

Query  316  RDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  495
            R + ++VELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELI
Sbjct  74   RADGIEVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGALQKELI  133

Query  496  RFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            RFLNAG+FG GT   HTLP +ATRAAMLVRINTLLQGYSGIRFEI+EAITK LN+N
Sbjct  134  RFLNAGVFGNGTESTHTLPQTATRAAMLVRINTLLQGYSGIRFEIMEAITKFLNNN  189



>ref|XP_003542541.1| PREDICTED: phenylalanine ammonia-lyase class 2-like [Glycine 
max]
Length=716

 Score =   276 bits (707),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 158/192 (82%), Gaps = 15/192 (8%)
 Frame = +1

Query  115  TMEGAIENGHSNDFCIKV---------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVK  267
            T EG   NG++N FC+ V         DPLNW  AA+++ GSHLDEVKRMV E+R P VK
Sbjct  2    TQEG---NGNTN-FCMSVNNNGYISANDPLNWGAAAEAMAGSHLDEVKRMVEEYRRPVVK  57

Query  268  IGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGAT  447
            +GG+TLT++QVAAIAA D  VKVEL+E +RAGVKASSDWVM SM+ GTDSYGVTTGFGAT
Sbjct  58   LGGETLTISQVAAIAAHDQGVKVELAESSRAGVKASSDWVMESMDKGTDSYGVTTGFGAT  117

Query  448  SHRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFE  621
            SHRRTK G ALQ+ELIRFLNAGIFG GT    TLPH+ATRAAMLVRINTLLQGYSGIRFE
Sbjct  118  SHRRTKQGGALQKELIRFLNAGIFGNGTESNCTLPHTATRAAMLVRINTLLQGYSGIRFE  177

Query  622  ILEAITKLLNHN  657
            ILEAITKLLN+N
Sbjct  178  ILEAITKLLNNN  189



>gb|AFJ80777.1| phenylalanine ammonia-lyase [Camellia japonica]
Length=706

 Score =   276 bits (706),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 157/182 (86%), Gaps = 5/182 (3%)
 Frame = +1

Query  118  MEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  297
            ME   ENG+ +   IK DPL+WE+AA+S+KGSHLDEVKRMV EFR PA+++GG+TLT++Q
Sbjct  1    MEFCHENGNGHGHVIK-DPLSWELAAESMKGSHLDEVKRMVREFRQPAIRLGGETLTISQ  59

Query  298  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  477
            VAA+AA    + VELSE ARA V+ASS+WVM SMN GTDSYGVTTGFGATSHRRTK G A
Sbjct  60   VAAVAA--GCLPVELSEAARAAVQASSEWVMESMNKGTDSYGVTTGFGATSHRRTKQGGA  117

Query  478  LQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  651
            LQ+ELIRFLNAGIFG GT   HTLPHS+TRAAMLVRINTLLQGYSGIRFEILEA+TKL+N
Sbjct  118  LQKELIRFLNAGIFGNGTESCHTLPHSSTRAAMLVRINTLLQGYSGIRFEILEALTKLIN  177

Query  652  HN  657
            HN
Sbjct  178  HN  179



>ref|XP_002267953.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   276 bits (706),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 148/165 (90%), Gaps = 2/165 (1%)
 Frame = +1

Query  169  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  348
            DPLNW +AA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V VELSE
Sbjct  19   DPLNWGVAAEALKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREEDVSVELSE  78

Query  349  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  528
             ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG G
Sbjct  79   TARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNG  138

Query  529  T--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            T   HTLP+SATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  139  TESCHTLPYSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  183



>sp|P45734.1|PALY_TRISU RecName: Full=Phenylalanine ammonia-lyase [Trifolium subterraneum]
 gb|AAA17993.1| phenylalanine ammonia-lyase [Trifolium subterraneum]
Length=725

 Score =   276 bits (706),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 154/177 (87%), Gaps = 6/177 (3%)
 Frame = +1

Query  142  HSNDFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIA  312
            H+N   +KV   DPLNW +AA+++KGSHLDEVKRMV E+R P V++GG+TLT++QVAAIA
Sbjct  23   HANANNMKVNAADPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLGGETLTISQVAAIA  82

Query  313  ARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQEL  492
            A D A  VELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+EL
Sbjct  83   AHDGAT-VELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKEL  141

Query  493  IRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            IRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKLLN+N
Sbjct  142  IRFLNAGIFGNGTESNHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNN  198



>sp|Q43052.1|PAL2_POPKI RecName: Full=Phenylalanine ammonia-lyase G2B [Populus sieboldii 
x Populus grandidentata]
 pir||S60042 phenylalanine ammonia-lyase (EC 4.3.1.5) 2b - Japanese aspen 
x large-toothed aspen
 dbj|BAA07860.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=710

 Score =   276 bits (705),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 133/165 (81%), Positives = 146/165 (88%), Gaps = 2/165 (1%)
 Frame = +1

Query  169  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  348
            DPLNW MAA+SLKGSHLDEVKRM+ E+RNP VK+GG+TLT+ QV AIA+RD  V VELSE
Sbjct  20   DPLNWGMAAESLKGSHLDEVKRMIEEYRNPVVKLGGETLTIGQVTAIASRDVGVMVELSE  79

Query  349  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  528
             ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G  LQ+ELIRFLNAGIFG G
Sbjct  80   EARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNG  139

Query  529  T--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            T   HTLP SATRAAMLVR NTLLQGYSGIRFE+LEAITK++NHN
Sbjct  140  TESSHTLPRSATRAAMLVRTNTLLQGYSGIRFEMLEAITKMINHN  184



>gb|AEJ88223.1| phenylalanine ammonia lyase [Prunus persica]
Length=719

 Score =   276 bits (705),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 148/165 (90%), Gaps = 2/165 (1%)
 Frame = +1

Query  169  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  348
            DPLNW MAA+SLKGSHLDEVKRMV E+R P V++GG+TLT+AQVAAIA  D+ V VELSE
Sbjct  28   DPLNWGMAAESLKGSHLDEVKRMVNEYRKPVVRLGGETLTIAQVAAIANHDSGVHVELSE  87

Query  349  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  528
             ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG+ 
Sbjct  88   DARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGALQRELIRFLNAGIFGSS  147

Query  529  TG--HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            T   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITK LN+N
Sbjct  148  TESTHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKFLNNN  192



>gb|AAZ29735.1| phenylalanine ammonia lyase [Trifolium pratense]
Length=725

 Score =   276 bits (706),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 154/177 (87%), Gaps = 6/177 (3%)
 Frame = +1

Query  142  HSNDFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIA  312
            H+N   +KV   DPLNW +AA+++KGSHLDEVKRMV E+R P V++GG+TLT++QVAAIA
Sbjct  23   HANANNMKVNGADPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLGGKTLTISQVAAIA  82

Query  313  ARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQEL  492
            A D A  VELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+EL
Sbjct  83   AHDGAT-VELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKEL  141

Query  493  IRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            IRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKLLN+N
Sbjct  142  IRFLNAGIFGNGTESSHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNN  198



>gb|ACE95170.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=714

 Score =   276 bits (705),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 154/187 (82%), Gaps = 3/187 (2%)
 Frame = +1

Query  106  FNTTMEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  285
              T  +   +NG S   C + DPL+W +AA+++KGSHLDEVKRMVAE+R P V + GQTL
Sbjct  1    METITKNGYQNGSSESLCTQRDPLSWGVAAEAMKGSHLDEVKRMVAEYRKPVVNLAGQTL  60

Query  286  TVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  462
            T+AQVA+IA  D + VKVELSE AR  VKASSDWVM+SM+ GTDSYGVTTGFGATSHRRT
Sbjct  61   TIAQVASIAGHDASNVKVELSESARPRVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRT  120

Query  463  KNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  636
            K G ALQ+ELIRFLNAGIFG G  T HTLPHSATRAAMLVRINTLLQGYSGI FEILEAI
Sbjct  121  KQGGALQKELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGICFEILEAI  180

Query  637  TKLLNHN  657
            TKLLN+N
Sbjct  181  TKLLNNN  187



>sp|Q9M568.1|PAL1_RUBID RecName: Full=Phenylalanine ammonia-lyase 1; AltName: Full=RiPAL1 
[Rubus idaeus]
 gb|AAF40223.1|AF237954_1 phenylalanine ammonia-lyase 1 [Rubus idaeus]
Length=710

 Score =   275 bits (704),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 149/176 (85%), Gaps = 2/176 (1%)
 Frame = +1

Query  136  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  315
            NG    FC   DPLNW MAA+SLKGSH+DE+KRMV+++R P VK+GG+TLT+ QVAAIA+
Sbjct  8    NGAVESFCEGHDPLNWNMAAESLKGSHVDELKRMVSDYRKPVVKLGGETLTIGQVAAIAS  67

Query  316  RDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  495
             D  V+VELSE  RAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTKNG ALQ+ELI
Sbjct  68   HDGGVRVELSEEKRAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKNGGALQRELI  127

Query  496  RFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            RFLNAGIFG+   + H LPH+ATRAAMLVR NTLLQGYSGIRFEILEAITK LN N
Sbjct  128  RFLNAGIFGSSLDSTHKLPHTATRAAMLVRFNTLLQGYSGIRFEILEAITKFLNGN  183



>ref|XP_007144370.1| hypothetical protein PHAVU_007G150500g [Phaseolus vulgaris]
 gb|ESW16364.1| hypothetical protein PHAVU_007G150500g [Phaseolus vulgaris]
Length=712

 Score =   275 bits (704),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 153/184 (83%), Gaps = 8/184 (4%)
 Frame = +1

Query  127  AIENGHSNDFCIKV-----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  291
            A  NG  + FC+       DPLNW  AA++L GSHLDEVKRMVAE+R PAV++GGQTLT+
Sbjct  3    ATPNG-KDAFCVTAANAAGDPLNWAAAAEALSGSHLDEVKRMVAEYRKPAVRLGGQTLTI  61

Query  292  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  471
            AQVAA AA D  +KVEL+E ARA VKASSDWVM SM+ GTDSYGVTTGFGATSHRRTK G
Sbjct  62   AQVAATAAHDQGLKVELAESARACVKASSDWVMESMDKGTDSYGVTTGFGATSHRRTKQG  121

Query  472  HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  645
             ALQ+ELIRFLNAGIFG GT    TLPH+ATRAAMLVR+NTLLQGYSGIRFEILEAITKL
Sbjct  122  GALQKELIRFLNAGIFGNGTESNCTLPHTATRAAMLVRVNTLLQGYSGIRFEILEAITKL  181

Query  646  LNHN  657
            LN+N
Sbjct  182  LNNN  185



>gb|ACM62741.1| phenylalanine ammonia-lyase [Garcinia mangostana]
Length=718

 Score =   275 bits (704),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 157/191 (82%), Gaps = 11/191 (6%)
 Frame = +1

Query  118  MEGAI-ENGHS-NDFC------IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIG  273
            ME  I +NGH  N  C      +  DPLNW   A+SLKGSHL+EVKRMV E+R P VK+G
Sbjct  1    METTITQNGHHMNGLCMNGSAHVNSDPLNWGYLAESLKGSHLEEVKRMVEEYRKPLVKLG  60

Query  274  GQTLTVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  450
            G+TLT+AQVAA+A    A VKVEL+E ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATS
Sbjct  61   GETLTIAQVAAVAGGFEAGVKVELAESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATS  120

Query  451  HRRTKNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEI  624
            HRRTK G ALQ+ELIRFLNAGIFG G  T HTLPHSATRAAMLVRINTLLQGYSGIRFEI
Sbjct  121  HRRTKQGAALQKELIRFLNAGIFGNGTETSHTLPHSATRAAMLVRINTLLQGYSGIRFEI  180

Query  625  LEAITKLLNHN  657
            LEA+TK LN+N
Sbjct  181  LEALTKFLNYN  191



>gb|AGE10589.1| phenylalanine amononia-lyase [Lonicera japonica]
Length=714

 Score =   275 bits (704),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 153/188 (81%), Gaps = 13/188 (7%)
 Frame = +1

Query  130  IENGHSN-----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  294
            +ENGH N       C+K DPLNW +AA+ +KGSHLDEVKRMVAEFRNP VK+GG+ LT++
Sbjct  1    MENGHRNGGXVSXLCVK-DPLNWGVAAEGMKGSHLDEVKRMVAEFRNPVVKLGGEGLTIS  59

Query  295  QVAAIAARDNA-----VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRR  459
            QVAAIA+         VKVEL EGAR  VKASSDWVM SMN GTDSYGVTTGFGATSHRR
Sbjct  60   QVAAIASAGGGETSAGVKVELWEGARERVKASSDWVMESMNKGTDSYGVTTGFGATSHRR  119

Query  460  TKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEA  633
            TK G ALQ+ELIRFLN+GIFG GT   HTLPHSATRAAMLVRINTLLQGYSG RFEILEA
Sbjct  120  TKQGGALQKELIRFLNSGIFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGXRFEILEA  179

Query  634  ITKLLNHN  657
            ITK LNHN
Sbjct  180  ITKFLNHN  187



>ref|XP_004493977.1| PREDICTED: phenylalanine ammonia-lyase-like [Cicer arietinum]
Length=723

 Score =   275 bits (704),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 147/165 (89%), Gaps = 2/165 (1%)
 Frame = +1

Query  169  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  348
            DPLNW +AA+++KGSHLDEVKRMV E+R P V++GG+TLT++QVAAIA  D+ V VELSE
Sbjct  32   DPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLGGETLTISQVAAIATHDHGVTVELSE  91

Query  349  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  528
             +R GVKASSDWVM SMNNGTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG G
Sbjct  92   SSRPGVKASSDWVMESMNNGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNG  151

Query  529  T--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            T   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAIT LLN+N
Sbjct  152  TESNHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITNLLNNN  196



>ref|XP_006488063.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Citrus sinensis]
Length=714

 Score =   275 bits (703),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 148/176 (84%), Gaps = 2/176 (1%)
 Frame = +1

Query  136  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  315
            N  S   C  +DPLNW  A++SLKGSHLDEVKRMV+E+R   V++GG+TLT+AQVAA+A+
Sbjct  12   NIPSGKLCTNIDPLNWVSASESLKGSHLDEVKRMVSEYRKQVVRLGGETLTIAQVAAVAS  71

Query  316  RDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  495
            RD  V VEL+E ARAGVKASSDWVM SMN GTDSYG+TTGFGATSHRRTK G ALQ+ELI
Sbjct  72   RDGGVTVELNEEARAGVKASSDWVMESMNKGTDSYGITTGFGATSHRRTKQGAALQKELI  131

Query  496  RFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
            RFLNAGIFG GT     LPH+ATRAAMLVRINTLLQGYSGIRFEILEAITK LN N
Sbjct  132  RFLNAGIFGKGTESCQMLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKFLNRN  187



>gb|ACR15762.1| phenylalanine ammonia-lyase [Litchi chinensis]
Length=723

 Score =   275 bits (703),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 146/167 (87%), Gaps = 2/167 (1%)
 Frame = +1

Query  163  KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVEL  342
            K DPLNW + A++LKGSHL+EV RMV EFR P VK GG+TLT++QVAAIAA +  VKVEL
Sbjct  33   KQDPLNWGVMAEALKGSHLEEVMRMVEEFRRPVVKFGGETLTISQVAAIAANEAGVKVEL  92

Query  343  SEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFG  522
            SE AR GVKASSDWVM+SMNNGTD YGVTTG GATSHRRTK G ALQ+ELIRFLNAG+FG
Sbjct  93   SESAREGVKASSDWVMDSMNNGTDCYGVTTGSGATSHRRTKQGAALQRELIRFLNAGVFG  152

Query  523  TGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  657
             GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  153  NGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  199



>gb|ABI93975.1| putative phenylalanine ammonia-lyase, partial [Rhizophora mangle]
Length=579

 Score =   271 bits (694),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 153/182 (84%), Gaps = 7/182 (4%)
 Frame = +1

Query  133  ENGHSNDFCI----KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  300
            +NG  +  C     + DPLNW +AA+SLKGSHLDEVKRMVAE+R   VK+GG+TLT+AQV
Sbjct  10   QNGSLDSLCTTKPPRHDPLNWGVAAESLKGSHLDEVKRMVAEYRKHVVKLGGETLTIAQV  69

Query  301  AAIA-ARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  477
            AAI+   D+ + VEL+E ARAGVKASSDWVM+ M  GTDSYGVTTGFGATSHRRTK G A
Sbjct  70   AAISRGVDSGITVELAESARAGVKASSDWVMDGMTKGTDSYGVTTGFGATSHRRTKQGSA  129

Query  478  LQQELIRFLNAGIFGTGTG--HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  651
            LQ+ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKLLN
Sbjct  130  LQRELIRFLNAGIFGHGTDSCHTLPHAATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  189

Query  652  HN  657
            HN
Sbjct  190  HN  191



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1028498319500