BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF041H09

Length=653
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006346308.1|  PREDICTED: vacuolar-sorting receptor 3-like        313   3e-99   Solanum tuberosum [potatoes]
ref|XP_004230700.1|  PREDICTED: vacuolar-sorting receptor 3             312   7e-99   Solanum lycopersicum
ref|XP_011088070.1|  PREDICTED: vacuolar-sorting receptor 3-like        310   3e-98   Sesamum indicum [beniseed]
gb|EYU37571.1|  hypothetical protein MIMGU_mgv1a002851mg                307   4e-97   Erythranthe guttata [common monkey flower]
ref|XP_009760191.1|  PREDICTED: vacuolar-sorting receptor 3-like        303   1e-95   Nicotiana sylvestris
ref|XP_009598407.1|  PREDICTED: vacuolar-sorting receptor 3-like        303   1e-95   Nicotiana tomentosiformis
emb|CDO97275.1|  unnamed protein product                                303   1e-95   Coffea canephora [robusta coffee]
emb|CAN79862.1|  hypothetical protein VITISV_021998                     300   8e-95   Vitis vinifera
emb|CBI22461.3|  unnamed protein product                                301   1e-94   Vitis vinifera
ref|XP_002264769.1|  PREDICTED: vacuolar-sorting receptor 3             301   2e-94   Vitis vinifera
ref|XP_002527509.1|  zinc finger protein, putative                      299   4e-94   Ricinus communis
ref|XP_008455032.1|  PREDICTED: vacuolar-sorting receptor 3-like        299   6e-94   Cucumis melo [Oriental melon]
gb|KEH44022.1|  vacuolar-sorting receptor-like protein                  296   7e-94   Medicago truncatula
ref|XP_004496877.1|  PREDICTED: vacuolar-sorting receptor 1-like        298   1e-93   Cicer arietinum [garbanzo]
ref|XP_008384516.1|  PREDICTED: vacuolar-sorting receptor 3-like        298   2e-93   
ref|XP_004136938.1|  PREDICTED: vacuolar-sorting receptor 3-like        298   2e-93   Cucumis sativus [cucumbers]
ref|XP_002313909.1|  vacuolar sorting receptor protein BP-80            297   4e-93   Populus trichocarpa [western balsam poplar]
gb|AES62774.2|  vacuolar-sorting receptor-like protein                  296   5e-93   Medicago truncatula
ref|XP_009349164.1|  PREDICTED: vacuolar-sorting receptor 3-like        296   7e-93   Pyrus x bretschneideri [bai li]
ref|XP_008348888.1|  PREDICTED: vacuolar-sorting receptor 3-like        296   8e-93   
ref|XP_010111675.1|  Vacuolar-sorting receptor 3                        296   9e-93   Morus notabilis
gb|KCW63607.1|  hypothetical protein EUGRSUZ_G01233                     295   9e-93   Eucalyptus grandis [rose gum]
ref|XP_004159916.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-sor...    296   1e-92   
ref|XP_010277061.1|  PREDICTED: vacuolar-sorting receptor 3-like        296   1e-92   Nelumbo nucifera [Indian lotus]
ref|XP_003592523.1|  Vacuolar-sorting receptor                          295   1e-92   
gb|KDP44487.1|  hypothetical protein JCGZ_16320                         295   2e-92   Jatropha curcas
ref|XP_009375671.1|  PREDICTED: vacuolar-sorting receptor 3-like        295   2e-92   
ref|XP_008236323.1|  PREDICTED: vacuolar-sorting receptor 3             295   3e-92   Prunus mume [ume]
ref|XP_010065899.1|  PREDICTED: vacuolar-sorting receptor 1-like        295   4e-92   Eucalyptus grandis [rose gum]
gb|KHF97360.1|  Vacuolar-sorting receptor 3 -like protein               294   5e-92   Gossypium arboreum [tree cotton]
gb|KJB79450.1|  hypothetical protein B456_013G050300                    293   1e-91   Gossypium raimondii
ref|XP_007199755.1|  hypothetical protein PRUPE_ppa002822mg             293   1e-91   Prunus persica
ref|XP_010272410.1|  PREDICTED: vacuolar-sorting receptor 3-like        293   2e-91   Nelumbo nucifera [Indian lotus]
gb|KJB12290.1|  hypothetical protein B456_002G010300                    290   2e-91   Gossypium raimondii
gb|KJB12295.1|  hypothetical protein B456_002G010300                    288   2e-91   Gossypium raimondii
ref|XP_007042634.1|  Vaculolar sorting receptor 3 isoform 2             288   3e-91   
gb|KDO57883.1|  hypothetical protein CISIN_1g006786mg                   285   3e-91   Citrus sinensis [apfelsine]
ref|XP_002298772.1|  hypothetical protein POPTR_0001s30160g             291   5e-91   Populus trichocarpa [western balsam poplar]
ref|XP_011030346.1|  PREDICTED: vacuolar-sorting receptor 3-like        291   5e-91   Populus euphratica
ref|XP_011001937.1|  PREDICTED: vacuolar-sorting receptor 3             291   8e-91   Populus euphratica
gb|KJB12294.1|  hypothetical protein B456_002G010300                    288   4e-90   Gossypium raimondii
ref|XP_007042633.1|  Vaculolar sorting receptor 3 isoform 1             289   5e-90   Theobroma cacao [chocolate]
ref|XP_011092498.1|  PREDICTED: vacuolar-sorting receptor 3-like        288   7e-90   Sesamum indicum [beniseed]
ref|XP_003536576.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    288   8e-90   Glycine max [soybeans]
gb|KJB12291.1|  hypothetical protein B456_002G010300                    288   1e-89   Gossypium raimondii
gb|KJB12292.1|  hypothetical protein B456_002G010300                    288   1e-89   Gossypium raimondii
ref|XP_010467255.1|  PREDICTED: vacuolar-sorting receptor 4-like        287   2e-89   Camelina sativa [gold-of-pleasure]
gb|KDO57886.1|  hypothetical protein CISIN_1g006786mg                   285   2e-89   Citrus sinensis [apfelsine]
ref|XP_006409641.1|  hypothetical protein EUTSA_v10022594mg             287   2e-89   Eutrema salsugineum [saltwater cress]
ref|XP_011457866.1|  PREDICTED: vacuolar-sorting receptor 3             287   3e-89   Fragaria vesca subsp. vesca
ref|XP_010687358.1|  PREDICTED: vacuolar-sorting receptor 4-like        287   3e-89   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006409638.1|  hypothetical protein EUTSA_v10022598mg             286   3e-89   Eutrema salsugineum [saltwater cress]
ref|XP_010517675.1|  PREDICTED: vacuolar-sorting receptor 4-like        286   4e-89   Camelina sativa [gold-of-pleasure]
ref|XP_007143116.1|  hypothetical protein PHAVU_007G045100g             286   5e-89   Phaseolus vulgaris [French bean]
ref|XP_007157213.1|  hypothetical protein PHAVU_002G052000g             286   7e-89   Phaseolus vulgaris [French bean]
ref|XP_010488908.1|  PREDICTED: vacuolar-sorting receptor 4             286   7e-89   Camelina sativa [gold-of-pleasure]
gb|KHN06808.1|  Vacuolar-sorting receptor 1                             286   7e-89   Glycine soja [wild soybean]
gb|KFK39977.1|  hypothetical protein AALP_AA3G313900                    286   8e-89   Arabis alpina [alpine rockcress]
ref|XP_006300216.1|  hypothetical protein CARUB_v10016452mg             286   8e-89   Capsella rubella
ref|XP_002885935.1|  VSR-2                                              285   8e-89   
ref|NP_179081.1|  vacuolar-sorting receptor 3                           285   1e-88   Arabidopsis thaliana [mouse-ear cress]
ref|NP_179079.1|  vacuolar-sorting receptor 4                           285   1e-88   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002883854.1|  hypothetical protein ARALYDRAFT_899691             285   1e-88   
ref|XP_010547949.1|  PREDICTED: vacuolar-sorting receptor 3-like        285   1e-88   Tarenaya hassleriana [spider flower]
gb|KDO57884.1|  hypothetical protein CISIN_1g006786mg                   285   1e-88   Citrus sinensis [apfelsine]
ref|XP_006422827.1|  hypothetical protein CICLE_v10028015mg             285   1e-88   Citrus clementina [clementine]
gb|KDO57885.1|  hypothetical protein CISIN_1g006786mg                   285   2e-88   Citrus sinensis [apfelsine]
ref|XP_010547948.1|  PREDICTED: vacuolar-sorting receptor 3             285   2e-88   Tarenaya hassleriana [spider flower]
ref|XP_010488909.1|  PREDICTED: vacuolar-sorting receptor 3             285   2e-88   Camelina sativa [gold-of-pleasure]
gb|KHN42313.1|  Vacuolar-sorting receptor 1                             284   4e-88   Glycine soja [wild soybean]
ref|XP_003555992.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    284   4e-88   Glycine max [soybeans]
gb|EPS57970.1|  hypothetical protein M569_16845                         283   4e-88   Genlisea aurea
ref|XP_006486921.1|  PREDICTED: vacuolar-sorting receptor 3-like        284   4e-88   Citrus sinensis [apfelsine]
gb|KFK39979.1|  hypothetical protein AALP_AA3G314200                    283   5e-88   Arabis alpina [alpine rockcress]
gb|KJB32253.1|  hypothetical protein B456_005G231800                    281   6e-88   Gossypium raimondii
emb|CDY37219.1|  BnaA09g08400D                                          283   8e-88   Brassica napus [oilseed rape]
ref|XP_009136249.1|  PREDICTED: vacuolar-sorting receptor 3             283   8e-88   Brassica rapa
ref|XP_010517715.1|  PREDICTED: vacuolar-sorting receptor 3-like ...    283   8e-88   Camelina sativa [gold-of-pleasure]
gb|KHN05603.1|  Vacuolar-sorting receptor 1                             282   2e-87   Glycine soja [wild soybean]
ref|XP_003538018.1|  PREDICTED: vacuolar-sorting receptor 1-like        282   2e-87   Glycine max [soybeans]
ref|XP_006297095.1|  hypothetical protein CARUB_v10013097mg             284   2e-87   
ref|XP_010467256.1|  PREDICTED: vacuolar-sorting receptor 3-like        282   2e-87   Camelina sativa [gold-of-pleasure]
ref|XP_004511312.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    281   3e-87   Cicer arietinum [garbanzo]
emb|CDY65441.1|  BnaCnng47180D                                          281   3e-87   Brassica napus [oilseed rape]
gb|KHN30433.1|  Vacuolar-sorting receptor 1                             281   4e-87   Glycine soja [wild soybean]
ref|XP_003517598.2|  PREDICTED: vacuolar-sorting receptor 1-like ...    281   4e-87   Glycine max [soybeans]
ref|XP_004173121.1|  PREDICTED: vacuolar-sorting receptor 3-like        278   4e-87   
gb|KJB32254.1|  hypothetical protein B456_005G231800                    280   5e-87   Gossypium raimondii
ref|XP_004511311.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    281   5e-87   
emb|CDX81459.1|  BnaC09g08700D                                          281   6e-87   
ref|XP_010517708.1|  PREDICTED: vacuolar-sorting receptor 3-like ...    280   1e-86   Camelina sativa [gold-of-pleasure]
ref|XP_006849341.1|  hypothetical protein AMTR_s00164p00059220          280   1e-86   
gb|KJB32252.1|  hypothetical protein B456_005G231800                    280   1e-86   Gossypium raimondii
ref|XP_009123210.1|  PREDICTED: vacuolar-sorting receptor 3-like        280   1e-86   Brassica rapa
gb|AAB72112.1|  vacuolar sorting receptor homolog                       279   2e-86   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004152276.1|  PREDICTED: vacuolar-sorting receptor 3-like        278   4e-86   Cucumis sativus [cucumbers]
ref|XP_008454393.1|  PREDICTED: vacuolar-sorting receptor 4-like ...    277   2e-85   Cucumis melo [Oriental melon]
ref|XP_008454392.1|  PREDICTED: vacuolar-sorting receptor 4-like ...    277   2e-85   Cucumis melo [Oriental melon]
sp|P93484.1|VSR1_PEA  RecName: Full=Vacuolar-sorting receptor 1; ...    272   1e-83   Pisum sativum [garden pea]
ref|XP_009404782.1|  PREDICTED: vacuolar-sorting receptor 4-like        272   2e-83   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003610620.1|  Vacuolar-sorting receptor                          271   3e-83   
ref|XP_002968618.1|  hypothetical protein SELMODRAFT_440462             270   7e-83   Selaginella moellendorffii
ref|XP_002975863.1|  hypothetical protein SELMODRAFT_175218             270   8e-83   
ref|XP_008787225.1|  PREDICTED: vacuolar-sorting receptor 3-like        268   1e-82   
gb|ABR17683.1|  unknown                                                 268   3e-82   Picea sitchensis
ref|XP_004983263.1|  PREDICTED: vacuolar-sorting receptor 3-like        268   4e-82   Setaria italica
gb|AFW68896.1|  hypothetical protein ZEAMMB73_054159                    266   5e-82   
ref|NP_001064400.1|  Os10g0346600                                       268   5e-82   
gb|AFW68893.1|  hypothetical protein ZEAMMB73_054159                    266   6e-82   
gb|ACG44286.1|  vacuolar sorting receptor 3 precursor                   266   7e-82   Zea mays [maize]
gb|AAN05373.1|  Putative vacuolar sorting receptor protein              268   8e-82   Oryza sativa Japonica Group [Japonica rice]
gb|AFW68895.1|  hypothetical protein ZEAMMB73_054159                    266   2e-81   
gb|AFW68894.1|  hypothetical protein ZEAMMB73_054159                    266   3e-81   
ref|NP_001130741.1|  uncharacterized protein LOC100191845 precursor     266   3e-81   Zea mays [maize]
gb|ACN30885.1|  unknown                                                 266   4e-81   Zea mays [maize]
ref|XP_010942821.1|  PREDICTED: vacuolar-sorting receptor 1-like        265   5e-81   Elaeis guineensis
ref|XP_006661708.1|  PREDICTED: vacuolar-sorting receptor 3-like        265   7e-81   Oryza brachyantha
ref|XP_009421105.1|  PREDICTED: vacuolar-sorting receptor 3-like        265   1e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010938945.1|  PREDICTED: vacuolar-sorting receptor 3-like        264   2e-80   Elaeis guineensis
ref|NP_001169650.1|  hypothetical protein precursor                     260   5e-80   
emb|CDX93144.1|  BnaA03g38660D                                          262   6e-80   
ref|XP_002309184.1|  vacuolar sorting receptor family protein           262   8e-80   Populus trichocarpa [western balsam poplar]
ref|XP_009384326.1|  PREDICTED: vacuolar-sorting receptor 1-like        261   1e-79   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE52644.1|  hypothetical protein OsJ_35003                          260   2e-79   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010253066.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    259   2e-79   Nelumbo nucifera [Indian lotus]
ref|XP_009410512.1|  PREDICTED: vacuolar-sorting receptor 1             261   2e-79   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC68730.1|  hypothetical protein OsI_37233                          260   4e-79   Oryza sativa Indica Group [Indian rice]
ref|XP_008805693.1|  PREDICTED: vacuolar-sorting receptor 3-like        260   4e-79   Phoenix dactylifera
gb|EEC67546.1|  hypothetical protein OsI_34875                          260   4e-79   Oryza sativa Indica Group [Indian rice]
ref|XP_008677615.1|  PREDICTED: uncharacterized protein LOC100383...    260   4e-79   
gb|EEE51529.1|  hypothetical protein OsJ_32728                          260   5e-79   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010253065.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    260   5e-79   Nelumbo nucifera [Indian lotus]
tpg|DAA39323.1|  TPA: hypothetical protein ZEAMMB73_720222              260   5e-79   
ref|XP_008669942.1|  PREDICTED: vacuolar-sorting receptor 1-like        260   5e-79   Zea mays [maize]
ref|XP_010922756.1|  PREDICTED: vacuolar-sorting receptor 1-like        259   5e-79   
ref|XP_002450144.1|  hypothetical protein SORBIDRAFT_05g001160          259   8e-79   Sorghum bicolor [broomcorn]
ref|XP_008788526.1|  PREDICTED: vacuolar-sorting receptor 1-like        259   9e-79   Phoenix dactylifera
ref|XP_004977384.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    259   1e-78   
ref|XP_004978527.1|  PREDICTED: vacuolar-sorting receptor 1-like        259   1e-78   
ref|XP_003623631.1|  Vacuolar sorting receptor                          259   1e-78   Medicago truncatula
gb|KJB71518.1|  hypothetical protein B456_011G126800                    257   2e-78   Gossypium raimondii
gb|EMT19677.1|  Vacuolar-sorting receptor 1                             258   2e-78   
gb|KGN58683.1|  hypothetical protein Csa_3G728010                       256   2e-78   Cucumis sativus [cucumbers]
ref|XP_003573873.1|  PREDICTED: vacuolar-sorting receptor 1-like        258   2e-78   Brachypodium distachyon [annual false brome]
ref|NP_001065992.1|  Os12g0116000                                       260   2e-78   
ref|XP_006842496.1|  hypothetical protein AMTR_s00077p00095230          258   3e-78   Amborella trichopoda
gb|KDO64109.1|  hypothetical protein CISIN_1g0100101mg                  251   3e-78   Citrus sinensis [apfelsine]
pir||T00044  vacuolar sorting receptor protein homolog PV72 - cuc...    258   3e-78
ref|XP_011019003.1|  PREDICTED: vacuolar-sorting receptor 1-like        258   4e-78   Populus euphratica
ref|XP_007140077.1|  hypothetical protein PHAVU_008G082200g             257   5e-78   Phaseolus vulgaris [French bean]
ref|XP_004137673.1|  PREDICTED: vacuolar-sorting receptor 1-like        257   6e-78   Cucumis sativus [cucumbers]
gb|KJB71519.1|  hypothetical protein B456_011G126800                    257   6e-78   Gossypium raimondii
gb|KHG14060.1|  Vacuolar-sorting receptor 1 -like protein               257   6e-78   Gossypium arboreum [tree cotton]
ref|NP_180588.1|  vacuolar-sorting receptor 2                           257   6e-78   Arabidopsis thaliana [mouse-ear cress]
gb|KDO64107.1|  hypothetical protein CISIN_1g0100101mg                  251   8e-78   Citrus sinensis [apfelsine]
gb|KDO64106.1|  hypothetical protein CISIN_1g0100101mg                  251   8e-78   Citrus sinensis [apfelsine]
ref|NP_001189637.1|  vacuolar-sorting receptor 2                        257   8e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009388213.1|  PREDICTED: vacuolar-sorting receptor 1-like        254   1e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010252051.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    256   1e-77   Nelumbo nucifera [Indian lotus]
ref|XP_003579018.1|  PREDICTED: vacuolar-sorting receptor 1             256   2e-77   Brachypodium distachyon [annual false brome]
ref|XP_008442315.1|  PREDICTED: vacuolar-sorting receptor 1             256   2e-77   Cucumis melo [Oriental melon]
ref|XP_010529936.1|  PREDICTED: vacuolar-sorting receptor 1 isofo...    256   2e-77   Tarenaya hassleriana [spider flower]
ref|XP_010529937.1|  PREDICTED: vacuolar-sorting receptor 1 isofo...    256   2e-77   Tarenaya hassleriana [spider flower]
ref|XP_006296113.1|  hypothetical protein CARUB_v10025264mg             255   2e-77   
emb|CAN66483.1|  hypothetical protein VITISV_015390                     255   3e-77   Vitis vinifera
ref|XP_006398566.1|  hypothetical protein EUTSA_v10015537mg             255   4e-77   
ref|XP_008792241.1|  PREDICTED: vacuolar-sorting receptor 1-like        254   5e-77   Phoenix dactylifera
ref|XP_002267833.2|  PREDICTED: vacuolar-sorting receptor 1             254   5e-77   Vitis vinifera
ref|XP_010510382.1|  PREDICTED: vacuolar-sorting receptor 2-like        254   6e-77   Camelina sativa [gold-of-pleasure]
ref|XP_010931377.1|  PREDICTED: vacuolar-sorting receptor 1-like        254   6e-77   Elaeis guineensis
ref|XP_010414284.1|  PREDICTED: vacuolar-sorting receptor 2             254   6e-77   Camelina sativa [gold-of-pleasure]
ref|XP_009801642.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    254   8e-77   Nicotiana sylvestris
ref|XP_007033523.1|  Vacuolar sorting receptor isoform 3                251   9e-77   
ref|XP_009801640.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    254   1e-76   Nicotiana sylvestris
ref|XP_011002594.1|  PREDICTED: vacuolar-sorting receptor 1-like        254   1e-76   Populus euphratica
gb|EMT24279.1|  Vacuolar-sorting receptor 1                             254   1e-76   
dbj|BAK03786.1|  predicted protein                                      255   1e-76   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006290748.1|  hypothetical protein CARUB_v10016844mg             253   2e-76   Capsella rubella
ref|XP_002881098.1|  hypothetical protein ARALYDRAFT_481940             253   2e-76   Arabidopsis lyrata subsp. lyrata
ref|XP_006362349.1|  PREDICTED: vacuolar-sorting receptor 1-like        253   2e-76   Solanum tuberosum [potatoes]
dbj|BAB64531.1|  vacuolar sorting receptor                              253   2e-76   Vigna mungo [urad dal]
ref|XP_010469873.1|  PREDICTED: vacuolar-sorting receptor 2-like        253   3e-76   Camelina sativa [gold-of-pleasure]
ref|XP_002528694.1|  Vacuolar sorting receptor 1 precursor, putative    253   3e-76   Ricinus communis
ref|XP_010327707.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    252   4e-76   Solanum lycopersicum
ref|XP_011095146.1|  PREDICTED: vacuolar-sorting receptor 1-like        252   4e-76   Sesamum indicum [beniseed]
ref|XP_010327706.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    252   4e-76   Solanum lycopersicum
gb|KHN40635.1|  Vacuolar-sorting receptor 1                             252   5e-76   Glycine soja [wild soybean]
ref|XP_003552313.1|  PREDICTED: vacuolar-sorting receptor 1-like        252   5e-76   Glycine max [soybeans]
dbj|BAK00302.1|  predicted protein                                      252   5e-76   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB29888.1|  hypothetical protein B456_005G122400                    251   7e-76   Gossypium raimondii
gb|KJB29887.1|  hypothetical protein B456_005G122400                    251   8e-76   Gossypium raimondii
gb|KJB29886.1|  hypothetical protein B456_005G122400                    251   9e-76   Gossypium raimondii
ref|XP_007033521.1|  Vacuolar sorting receptor isoform 1                251   1e-75   
ref|XP_006429591.1|  hypothetical protein CICLE_v10011298mg             251   1e-75   Citrus clementina [clementine]
ref|XP_006664280.1|  PREDICTED: vacuolar-sorting receptor 1-like        252   2e-75   Oryza brachyantha
ref|XP_003534638.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    251   2e-75   Glycine max [soybeans]
ref|XP_006663158.1|  PREDICTED: vacuolar-sorting receptor 1-like        251   2e-75   Oryza brachyantha
emb|CDP06387.1|  unnamed protein product                                251   2e-75   Coffea canephora [robusta coffee]
gb|KDP21863.1|  hypothetical protein JCGZ_00650                         250   2e-75   Jatropha curcas
ref|XP_004302536.1|  PREDICTED: vacuolar-sorting receptor 1-like        250   2e-75   Fragaria vesca subsp. vesca
ref|XP_009143376.1|  PREDICTED: vacuolar-sorting receptor 1-like        250   2e-75   Brassica rapa
gb|KHG23770.1|  Vacuolar-sorting receptor 1 -like protein               250   2e-75   Gossypium arboreum [tree cotton]
ref|XP_009611966.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    250   2e-75   Nicotiana tomentosiformis
emb|CDX91478.1|  BnaC04g06720D                                          250   3e-75   
ref|XP_009611965.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    250   3e-75   Nicotiana tomentosiformis
ref|XP_010543160.1|  PREDICTED: vacuolar-sorting receptor 2             250   3e-75   Tarenaya hassleriana [spider flower]
emb|CDY04821.1|  BnaAnng00030D                                          249   5e-75   
ref|XP_006341299.1|  PREDICTED: vacuolar-sorting receptor 1 isofo...    248   6e-75   Solanum tuberosum [potatoes]
ref|XP_004510100.1|  PREDICTED: vacuolar-sorting receptor 1-like        249   6e-75   Cicer arietinum [garbanzo]
gb|KFK24686.1|  hypothetical protein AALP_AA8G011700                    249   8e-75   Arabis alpina [alpine rockcress]
emb|CDY60753.1|  BnaA05g34780D                                          249   9e-75   Brassica napus [oilseed rape]
ref|XP_003626680.1|  Vacuolar sorting receptor                          249   1e-74   Medicago truncatula
ref|XP_009611473.1|  PREDICTED: vacuolar-sorting receptor 1-like        248   1e-74   Nicotiana tomentosiformis
ref|XP_009775401.1|  PREDICTED: vacuolar-sorting receptor 1-like        248   1e-74   Nicotiana sylvestris
ref|XP_004492565.1|  PREDICTED: vacuolar-sorting receptor 1-like        248   2e-74   Cicer arietinum [garbanzo]
gb|EYU42029.1|  hypothetical protein MIMGU_mgv1a002928mg                248   2e-74   Erythranthe guttata [common monkey flower]
ref|XP_011086922.1|  PREDICTED: vacuolar-sorting receptor 1-like        248   2e-74   Sesamum indicum [beniseed]
ref|XP_008244809.1|  PREDICTED: vacuolar-sorting receptor 1-like        247   3e-74   Prunus mume [ume]
ref|XP_010683480.1|  PREDICTED: vacuolar-sorting receptor 1-like        247   5e-74   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS72005.1|  hypothetical protein M569_02753                         245   5e-74   Genlisea aurea
ref|XP_008370265.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    246   7e-74   
ref|XP_008370266.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    246   7e-74   
ref|XP_010093546.1|  Vacuolar-sorting receptor 1                        246   8e-74   Morus notabilis
gb|EYU35791.1|  hypothetical protein MIMGU_mgv1a002876mg                246   1e-73   Erythranthe guttata [common monkey flower]
ref|XP_006411071.1|  hypothetical protein EUTSA_v10016384mg             246   1e-73   Eutrema salsugineum [saltwater cress]
ref|NP_001275302.1|  vacuolar sorting receptor protein PV72-like ...    245   2e-73   Solanum tuberosum [potatoes]
ref|XP_007207200.1|  hypothetical protein PRUPE_ppa002877mg             245   2e-73   Prunus persica
ref|XP_010043186.1|  PREDICTED: vacuolar-sorting receptor 1-like        245   2e-73   Eucalyptus grandis [rose gum]
gb|EEC82690.1|  hypothetical protein OsI_27347                          245   3e-73   Oryza sativa Indica Group [Indian rice]
ref|NP_001060643.1|  Os07g0680000                                       245   3e-73   
ref|XP_006658133.1|  PREDICTED: vacuolar-sorting receptor 1-like        243   1e-72   Oryza brachyantha
emb|CDY38157.1|  BnaA07g02260D                                          236   1e-72   Brassica napus [oilseed rape]
ref|XP_004959891.1|  PREDICTED: vacuolar-sorting receptor 1-like        243   2e-72   
ref|XP_004246285.1|  PREDICTED: vacuolar-sorting receptor 1-like        242   3e-72   Solanum lycopersicum
gb|EMS62484.1|  Vacuolar-sorting receptor 1                             246   3e-72   Triticum urartu
ref|XP_003529053.2|  PREDICTED: vacuolar-sorting receptor 1-like        242   3e-72   Glycine max [soybeans]
ref|NP_001169232.1|  hypothetical protein precursor                     241   9e-72   Zea mays [maize]
ref|XP_009372030.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    240   1e-71   Pyrus x bretschneideri [bai li]
ref|XP_009372028.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    240   1e-71   Pyrus x bretschneideri [bai li]
ref|XP_007134557.1|  hypothetical protein PHAVU_010G057200g             239   3e-71   Phaseolus vulgaris [French bean]
ref|XP_002463394.1|  hypothetical protein SORBIDRAFT_02g043010          238   9e-71   Sorghum bicolor [broomcorn]
ref|XP_009125765.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-sor...    238   1e-70   Brassica rapa
emb|CDX73599.1|  BnaC08g24040D                                          237   2e-70   
ref|XP_008655380.1|  PREDICTED: vacuolar-sorting receptor 1-like        233   2e-70   
ref|XP_009115984.1|  PREDICTED: vacuolar-sorting receptor 1             237   3e-70   Brassica rapa
ref|XP_006650048.1|  PREDICTED: vacuolar-sorting receptor 1-like        237   3e-70   Oryza brachyantha
ref|XP_008388357.1|  PREDICTED: vacuolar-sorting receptor 1-like        237   3e-70   
gb|KHN42141.1|  Vacuolar-sorting receptor 2                             237   3e-70   Glycine soja [wild soybean]
ref|XP_003521852.1|  PREDICTED: vacuolar-sorting receptor 1-like        237   3e-70   Glycine max [soybeans]
gb|EMS51356.1|  Vacuolar-sorting receptor 1                             237   4e-70   Triticum urartu
dbj|BAK05589.1|  predicted protein                                      239   4e-70   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX78128.1|  BnaA09g33230D                                          236   5e-70   
ref|XP_010228654.1|  PREDICTED: vacuolar-sorting receptor 1-like        236   1e-69   Brachypodium distachyon [annual false brome]
ref|XP_002967764.1|  hypothetical protein SELMODRAFT_169577             236   1e-69   Selaginella moellendorffii
gb|AAN60346.1|  unknown                                                 224   1e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002992389.1|  hypothetical protein SELMODRAFT_269926             235   1e-69   
gb|AAF80450.1|AF161719_1  vacuolar targeting receptor bp-80             235   1e-69   Triticum aestivum [Canadian hard winter wheat]
gb|EMT18407.1|  Vacuolar-sorting receptor 1                             234   1e-69   
ref|XP_001751750.1|  predicted protein                                  235   2e-69   
gb|AAB72111.1|  vacuolar sorting receptor homolog                       234   3e-69   Arabidopsis thaliana [mouse-ear cress]
ref|NP_190853.1|  vacuolar-sorting receptor 1                           234   3e-69   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA45229.1|  TPA: hypothetical protein ZEAMMB73_518849              234   3e-69   
ref|XP_010426913.1|  PREDICTED: vacuolar-sorting receptor 1-like        234   4e-69   Camelina sativa [gold-of-pleasure]
gb|KDP43132.1|  hypothetical protein JCGZ_26665                         234   5e-69   Jatropha curcas
ref|XP_010233902.1|  PREDICTED: vacuolar-sorting receptor 1-like        234   7e-69   Brachypodium distachyon [annual false brome]
ref|XP_002467906.1|  hypothetical protein SORBIDRAFT_01g036170          233   8e-69   Sorghum bicolor [broomcorn]
ref|XP_002876170.1|  hypothetical protein ARALYDRAFT_906663             233   1e-68   Arabidopsis lyrata subsp. lyrata
ref|XP_010504032.1|  PREDICTED: vacuolar-sorting receptor 1             232   2e-68   Camelina sativa [gold-of-pleasure]
ref|XP_006403761.1|  hypothetical protein EUTSA_v10010181mg             232   2e-68   Eutrema salsugineum [saltwater cress]
gb|ABR17707.1|  unknown                                                 231   3e-68   Picea sitchensis
gb|AAK82551.1|  AT3g52850/F8J2_20                                       231   3e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006403762.1|  hypothetical protein EUTSA_v10010181mg             232   4e-68   
gb|KFK34530.1|  hypothetical protein AALP_AA5G158000                    230   1e-67   Arabis alpina [alpine rockcress]
ref|XP_008660179.1|  PREDICTED: vacuolar-sorting receptor 1             230   1e-67   
ref|XP_001765481.1|  predicted protein                                  229   2e-67   
ref|XP_010515761.1|  PREDICTED: vacuolar-sorting receptor 1-like        229   2e-67   
emb|CDY13344.1|  BnaC06g14130D                                          229   2e-67   Brassica napus [oilseed rape]
ref|XP_001759820.1|  predicted protein                                  228   4e-67   
emb|CDX67539.1|  BnaA07g15790D                                          228   4e-67   
ref|XP_009125234.1|  PREDICTED: vacuolar-sorting receptor 1-like        228   5e-67   
ref|XP_010036004.1|  PREDICTED: vacuolar-sorting receptor 1-like        228   5e-67   
ref|XP_001785165.1|  predicted protein                                  228   9e-67   
ref|XP_001759928.1|  predicted protein                                  226   1e-66   
ref|XP_010260770.1|  PREDICTED: vacuolar-sorting receptor 7             227   2e-66   
ref|XP_001776090.1|  predicted protein                                  227   2e-66   
ref|NP_001050034.1|  Os03g0335300                                       226   2e-66   
ref|XP_004984466.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    225   7e-66   
gb|EPS73119.1|  hypothetical protein M569_01632                         225   8e-66   
ref|XP_011008227.1|  PREDICTED: vacuolar-sorting receptor 6-like        225   8e-66   
ref|XP_004984464.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    225   1e-65   
ref|XP_004984465.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    225   1e-65   
ref|XP_002297915.2|  hypothetical protein POPTR_0001s12220g             225   1e-65   
ref|XP_004984463.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    225   2e-65   
ref|XP_001777810.1|  predicted protein                                  224   2e-65   
ref|XP_004293795.1|  PREDICTED: vacuolar-sorting receptor 6             224   2e-65   
ref|XP_002304606.1|  vacuolar sorting receptor family protein           224   3e-65   
gb|KDO77204.1|  hypothetical protein CISIN_1g0067882mg                  218   3e-65   
ref|XP_006853456.1|  hypothetical protein AMTR_s00032p00189440          223   4e-65   
ref|XP_002275462.3|  PREDICTED: vacuolar-sorting receptor 6-like        223   5e-65   
ref|XP_007040993.1|  Vacuolar sorting receptor 7                        223   5e-65   
gb|EYU23258.1|  hypothetical protein MIMGU_mgv1a0227552mg               213   8e-65   
gb|KDO77203.1|  hypothetical protein CISIN_1g0067882mg                  218   1e-64   
ref|XP_011022310.1|  PREDICTED: vacuolar-sorting receptor 6             222   2e-64   
ref|XP_006363163.1|  PREDICTED: vacuolar-sorting receptor 6-like        221   2e-64   
ref|XP_008372129.1|  PREDICTED: vacuolar-sorting receptor 7-like        211   3e-64   
gb|KDO77202.1|  hypothetical protein CISIN_1g0067882mg                  218   3e-64   
ref|XP_004232618.1|  PREDICTED: vacuolar-sorting receptor 6-like        221   3e-64   
ref|XP_006448589.1|  hypothetical protein CICLE_v10014573mg             221   4e-64   
ref|XP_006468586.1|  PREDICTED: vacuolar-sorting receptor 6-like        220   6e-64   
ref|XP_006448590.1|  hypothetical protein CICLE_v10014573mg             220   6e-64   
ref|XP_006448592.1|  hypothetical protein CICLE_v10014573mg             220   7e-64   
ref|XP_009616647.1|  PREDICTED: vacuolar-sorting receptor 6-like        220   7e-64   
emb|CBI27239.3|  unnamed protein product                                224   1e-63   
ref|XP_010941716.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    218   2e-63   
gb|AGV54776.1|  vacuolar-sorting receptor                               218   2e-63   
gb|KDO77200.1|  hypothetical protein CISIN_1g0067882mg                  218   3e-63   
ref|XP_009387954.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    216   3e-63   
ref|XP_009794444.1|  PREDICTED: vacuolar-sorting receptor 6-like        218   4e-63   
ref|XP_010941715.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    218   6e-63   
ref|XP_008802338.1|  PREDICTED: vacuolar-sorting receptor 6-like        217   9e-63   
ref|XP_009340258.1|  PREDICTED: vacuolar-sorting receptor 6-like        216   2e-62   
ref|XP_009387953.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    216   2e-62   
ref|XP_008383256.1|  PREDICTED: vacuolar-sorting receptor 6-like        216   3e-62   
ref|XP_007212810.1|  hypothetical protein PRUPE_ppa002849mg             215   4e-62   
gb|KJB48042.1|  hypothetical protein B456_008G051500                    212   6e-62   
ref|XP_009363270.1|  PREDICTED: vacuolar-sorting receptor 6-like        214   9e-62   
ref|XP_003534862.1|  PREDICTED: vacuolar-sorting receptor 6-like        213   2e-61   
ref|XP_003563336.1|  PREDICTED: vacuolar-sorting receptor 6             213   3e-61   
ref|XP_002437414.1|  hypothetical protein SORBIDRAFT_10g026544          213   3e-61   
ref|XP_003546387.1|  PREDICTED: vacuolar-sorting receptor 6-like        213   3e-61   
gb|KCW75576.1|  hypothetical protein EUGRSUZ_E04321                     209   4e-61   
ref|XP_004965628.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    213   5e-61   
ref|XP_004965629.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    213   5e-61   
gb|KJB48041.1|  hypothetical protein B456_008G051500                    212   6e-61   
gb|KJB48040.1|  hypothetical protein B456_008G051500                    212   7e-61   
ref|XP_009368555.1|  PREDICTED: vacuolar-sorting receptor 7-like        211   1e-60   
ref|XP_008225932.1|  PREDICTED: vacuolar-sorting receptor 7             211   1e-60   
ref|XP_008805925.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    211   1e-60   
ref|XP_009408244.1|  PREDICTED: vacuolar-sorting receptor 7             211   2e-60   
ref|XP_011096860.1|  PREDICTED: vacuolar-sorting receptor 6             211   3e-60   
gb|KHG13712.1|  Vacuolar-sorting receptor 6 -like protein               211   3e-60   
gb|EYU43627.1|  hypothetical protein MIMGU_mgv1a002747mg                210   5e-60   
gb|EEC81131.1|  hypothetical protein OsI_24020                          209   6e-60   
ref|NP_001058298.1|  Os06g0664300                                       209   6e-60   
gb|KCW75573.1|  hypothetical protein EUGRSUZ_E04321                     209   6e-60   
ref|XP_010058066.1|  PREDICTED: vacuolar-sorting receptor 6             209   8e-60   
ref|XP_010914289.1|  PREDICTED: vacuolar-sorting receptor 6             209   8e-60   
gb|ACN28195.1|  unknown                                                 208   2e-59   
gb|AFW87686.1|  vacuolar sorting receptor 7                             208   2e-59   
dbj|BAK00261.1|  predicted protein                                      209   2e-59   
ref|NP_001152485.1|  vacuolar sorting receptor 7 precursor              208   2e-59   
ref|XP_010684292.1|  PREDICTED: vacuolar-sorting receptor 7-like        208   2e-59   
gb|KFK28654.1|  hypothetical protein AALP_AA7G027800                    207   3e-59   
emb|CDY50060.1|  BnaCnng18670D                                          207   4e-59   
ref|XP_009133482.1|  PREDICTED: vacuolar-sorting receptor 7             207   4e-59   
emb|CDP18160.1|  unnamed protein product                                207   7e-59   
ref|XP_008439432.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    206   7e-59   
ref|XP_004134519.1|  PREDICTED: vacuolar-sorting receptor 6-like        207   7e-59   
ref|XP_007138862.1|  hypothetical protein PHAVU_009G243800g             206   8e-59   
ref|XP_008439431.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    206   9e-59   
emb|CDY02347.1|  BnaA09g25550D                                          206   1e-58   
emb|CDY43178.1|  BnaCnng11060D                                          206   1e-58   
ref|XP_009115026.1|  PREDICTED: vacuolar-sorting receptor 6             206   1e-58   
dbj|BAJ88964.1|  predicted protein                                      206   1e-58   
ref|XP_008371928.1|  PREDICTED: vacuolar-sorting receptor 6-like        206   1e-58   
ref|XP_006413899.1|  hypothetical protein EUTSA_v10024676mg             206   1e-58   
ref|XP_006415395.1|  hypothetical protein EUTSA_v10007059mg             206   1e-58   
emb|CDX78975.1|  BnaA01g10420D                                          206   2e-58   
emb|CAA16619.1|  vacuolar sorting receptor-like protein                 205   2e-58   
ref|NP_193744.1|  vacuolar-sorting receptor 7                           205   2e-58   
gb|KFK41675.1|  hypothetical protein AALP_AA2G158300                    205   2e-58   
ref|XP_009393260.1|  PREDICTED: vacuolar-sorting receptor 6             205   2e-58   
ref|NP_001190777.1|  vacuolar-sorting receptor 7                        205   2e-58   
gb|AFK35926.1|  unknown                                                 195   2e-58   
ref|XP_002869948.1|  hypothetical protein ARALYDRAFT_492857             204   4e-58   
dbj|BAJ97179.1|  predicted protein                                      204   5e-58   
dbj|BAJ91572.1|  predicted protein                                      205   5e-58   
ref|XP_010439615.1|  PREDICTED: vacuolar-sorting receptor 7-like        203   2e-57   
ref|XP_010434318.1|  PREDICTED: vacuolar-sorting receptor 7             203   2e-57   
ref|XP_010100622.1|  Vacuolar-sorting receptor 6                        203   2e-57   
ref|XP_003581645.1|  PREDICTED: vacuolar-sorting receptor 7-like        203   2e-57   
ref|XP_006306993.1|  hypothetical protein CARUB_v10008569mg             202   3e-57   
ref|XP_002890913.1|  hypothetical protein ARALYDRAFT_313733             202   3e-57   
gb|AAM96969.1|  vacuolar sorting receptor-like protein                  202   3e-57   
gb|ACS91931.1|  vacuolar sorting receptor protein                       200   6e-57   
pdb|4TJV|A  Chain A, Crystal Structure Of Protease-associated Dom...    189   6e-57   
ref|XP_004487890.1|  PREDICTED: vacuolar-sorting receptor 6-like        201   1e-56   
ref|NP_174375.1|  vacuolar sorting receptor 6                           201   1e-56   
gb|AAF98196.1|AC000107_19  F17F8.23                                     201   1e-56   
gb|KEH37345.1|  vacuolar-sorting receptor                               200   2e-56   
ref|XP_010449220.1|  PREDICTED: vacuolar-sorting receptor 7-like        200   3e-56   
gb|EEC66779.1|  hypothetical protein OsI_33169                          190   3e-56   
ref|XP_010039169.1|  PREDICTED: vacuolar-sorting receptor 1-like        188   3e-56   
ref|XP_010499644.1|  PREDICTED: vacuolar-sorting receptor 6-like        199   4e-56   
ref|XP_010460907.1|  PREDICTED: vacuolar-sorting receptor 6-like        199   4e-56   
ref|XP_010478532.1|  PREDICTED: vacuolar-sorting receptor 6             199   4e-56   
ref|XP_010519023.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-sor...    197   1e-55   
ref|XP_010537030.1|  PREDICTED: vacuolar-sorting receptor 7             197   3e-55   
ref|XP_006656342.1|  PREDICTED: vacuolar-sorting receptor 6-like        197   3e-55   
gb|EMS63262.1|  Vacuolar-sorting receptor 1                             198   5e-55   
ref|XP_006283299.1|  hypothetical protein CARUB_v10004337mg             196   1e-54   
gb|EMT02959.1|  Vacuolar-sorting receptor 4                             194   1e-54   
gb|AIY30334.1|  vacuolar-sorting receptor 3 protein                     181   1e-53   
gb|KJB38063.1|  hypothetical protein B456_006G235500                    189   3e-53   
gb|EPS72755.1|  hypothetical protein M569_02000                         189   5e-53   
ref|XP_002447079.1|  hypothetical protein SORBIDRAFT_06g028180          190   1e-52   
ref|XP_006374052.1|  hypothetical protein POPTR_0016s14430g             185   2e-51   
emb|CAE03573.2|  OSJNBa0085I10.18                                       184   1e-50   
ref|NP_001053838.1|  Os04g0611400                                       184   1e-50   
gb|EMT28757.1|  hypothetical protein F775_13214                         178   7e-50   
ref|NP_181040.1|  vacuolar-sorting receptor 5                           180   5e-49   
ref|XP_010509684.1|  PREDICTED: vacuolar-sorting receptor 5             179   6e-49   
ref|NP_001176319.1|  Os11g0116550                                       172   6e-49   
gb|KFK36399.1|  hypothetical protein AALP_AA4G119300                    182   9e-49   
ref|XP_004976775.1|  PREDICTED: vacuolar-sorting receptor 6-like        176   8e-48   
ref|XP_009141412.1|  PREDICTED: vacuolar-sorting receptor 5             175   2e-47   
ref|XP_002879526.1|  hypothetical protein ARALYDRAFT_321210             174   4e-47   
ref|XP_010504984.1|  PREDICTED: vacuolar-sorting receptor 5-like ...    174   4e-47   
ref|XP_010504983.1|  PREDICTED: vacuolar-sorting receptor 5-like ...    174   6e-47   
emb|CDY64650.1|  BnaAnng19540D                                          174   8e-47   
gb|EMS68622.1|  hypothetical protein TRIUR3_18779                       173   2e-46   
ref|XP_010516663.1|  PREDICTED: vacuolar-sorting receptor 5-like        172   2e-46   
emb|CDY43647.1|  BnaA04g20440D                                          172   4e-46   
ref|XP_006410651.1|  hypothetical protein EUTSA_v10016381mg             171   7e-46   
ref|XP_006295863.1|  hypothetical protein CARUB_v10024993mg             169   3e-45   
gb|EEE61664.1|  hypothetical protein OsJ_16123                          167   1e-44   
ref|XP_011001696.1|  PREDICTED: vacuolar-sorting receptor 1-like        166   2e-44   
ref|XP_005643138.1|  hypothetical protein COCSUDRAFT_26335              166   5e-44   
ref|XP_003064631.1|  predicted protein                                  165   2e-43   
emb|CDP17487.1|  unnamed protein product                                160   2e-42   
ref|XP_002501193.1|  predicted protein                                  155   2e-40   
ref|XP_002489189.1|  hypothetical protein SORBIDRAFT_0013s004030        152   2e-40   
ref|XP_007513418.1|  predicted protein                                  154   6e-40   
ref|XP_002501531.1|  predicted protein                                  150   3e-38   
ref|XP_001419041.1|  predicted protein                                  149   3e-38   
ref|XP_005848603.1|  hypothetical protein CHLNCDRAFT_144100             149   7e-38   
gb|KHN26599.1|  Vacuolar-sorting receptor 6                             148   8e-38   
ref|XP_003080572.1|  vacuolar sorting receptor, putative (ISS)          148   2e-37   
emb|CEG01308.1|  EGF-type aspartate/asparagine hydroxylation site       148   3e-37   
gb|EMT30552.1|  hypothetical protein F775_21497                         146   3e-37   
ref|XP_003057973.1|  predicted protein                                  147   7e-37   
gb|EEE67817.1|  hypothetical protein OsJ_25571                          143   3e-36   
ref|XP_011401748.1|  Vacuolar-sorting receptor 1                        141   1e-35   
emb|CAC38995.1|  putative EGF receptor-like protein                     137   2e-35   
gb|KDD75638.1|  hypothetical protein H632_c577p0                        127   2e-30   
ref|XP_010252052.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    124   1e-29   
gb|EMT00255.1|  hypothetical protein F775_19350                         122   1e-28   
ref|XP_005848848.1|  hypothetical protein CHLNCDRAFT_144184             121   5e-28   
gb|ABZ85676.1|  putative sorting receptor                               115   2e-27   
ref|XP_005643046.1|  hypothetical protein COCSUDRAFT_49231              114   2e-25   
gb|EMS67136.1|  hypothetical protein TRIUR3_12943                       112   4e-25   
emb|CBI32834.3|  unnamed protein product                                104   4e-24   
ref|XP_006653756.1|  PREDICTED: vacuolar-sorting receptor 6-like        106   7e-23   
gb|KJB14245.1|  hypothetical protein B456_002G116200                  94.7    1e-19   
gb|KJB14246.1|  hypothetical protein B456_002G116200                  95.1    2e-19   
ref|XP_009107752.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-sor...  94.0    3e-19   
tpg|DAA39320.1|  TPA: hypothetical protein ZEAMMB73_030788            88.6    2e-18   
emb|CDY22565.1|  BnaC05g24030D                                        85.5    2e-17   
ref|XP_001701186.1|  vacuolar sorting receptor                        87.4    3e-16   
gb|EMT28756.1|  hypothetical protein F775_27608                       82.0    6e-16   
gb|EJY73103.1|  Vacuolar sorting receptor                             85.9    6e-16   
gb|EJK66490.1|  hypothetical protein THAOC_12589                      85.9    7e-16   
ref|XP_002489190.1|  hypothetical protein SORBIDRAFT_0013s004040      82.8    7e-16   
tpg|DAA45230.1|  TPA: hypothetical protein ZEAMMB73_518849            84.3    1e-15   
tpg|DAA45231.1|  TPA: hypothetical protein ZEAMMB73_518849            80.9    2e-15   
ref|XP_002294134.1|  predicted protein                                84.3    3e-15   
gb|KIZ05710.1|  Vacuolar-sorting receptor 2                           80.9    3e-15   
gb|EJK43726.1|  hypothetical protein THAOC_37793                      84.0    3e-15   
ref|XP_003603017.1|  Vacuolar sorting receptor                        78.2    5e-15   
gb|AES73268.2|  vacuolar sorting receptor protein, putative           76.6    1e-14   
ref|XP_002176818.1|  predicted protein                                82.0    2e-14   
ref|XP_002294135.1|  predicted protein                                81.3    3e-14   
emb|CCI44781.1|  unnamed protein product                              80.5    5e-14   
emb|CDW90025.1|  UNKNOWN                                              79.0    1e-13   
ref|XP_002956789.1|  hypothetical protein VOLCADRAFT_119519           79.3    2e-13   
ref|XP_002182623.1|  predicted protein                                78.6    2e-13   
gb|KIZ02215.1|  Vacuolar-sorting receptor 2                           74.3    6e-13   
emb|CCA16097.1|  vacuolarsorting receptor putative                    76.6    1e-12   
emb|CBN77734.1|  conserved unknown protein                            76.3    1e-12   
gb|EMS55782.1|  Vacuolar-sorting receptor 7                           75.5    2e-12   
gb|EAZ37923.1|  hypothetical protein OsJ_22274                        71.2    2e-12   
gb|AIG55531.1|  secreted protein                                      74.3    4e-12   
gb|KHN42446.1|  Vacuolar-sorting receptor 4                           69.7    7e-12   
gb|KDO23286.1|  hypothetical protein SPRG_11600                       73.9    8e-12   
ref|XP_008610541.1|  hypothetical protein SDRG_06538                  73.2    1e-11   
gb|EJY86065.1|  Vacuolar-sorting receptor 1                           72.8    2e-11   
gb|EJY73798.1|  Vacuolar sorting receptor 3                           72.8    2e-11   
ref|XP_002908795.1|  vacuolar-sorting receptor, putative              72.8    2e-11   
gb|ETK79878.1|  hypothetical protein L915_14314                       70.9    8e-11   
gb|ETO68436.1|  hypothetical protein F444_14699                       70.9    8e-11   
gb|ETM39748.1|  hypothetical protein L914_14135                       70.9    8e-11   
ref|XP_008910397.1|  hypothetical protein PPTG_15123                  70.9    8e-11   
gb|ETL86586.1|  hypothetical protein L917_14009                       70.9    8e-11   
ref|XP_009529907.1|  hypothetical protein PHYSODRAFT_506174           70.1    1e-10   
gb|AEW09228.1|  hypothetical protein UMN_755_01                       63.5    4e-10   
ref|XP_002536854.1|  hypothetical protein RCOM_1789310                64.3    4e-10   
emb|CDW89394.1|  vacuolar sorting receptor 3                          67.8    7e-10   
gb|EJY76506.1|  Vacuolar sorting receptor 3                           67.4    1e-09   
gb|AFG69854.1|  hypothetical protein UMN_755_01                       62.0    2e-09   
ref|XP_008873571.1|  hypothetical protein H310_09311                  66.2    3e-09   



>ref|XP_006346308.1| PREDICTED: vacuolar-sorting receptor 3-like [Solanum tuberosum]
Length=630

 Score =   313 bits (801),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 166/214 (78%), Positives = 188/214 (88%), Gaps = 0/214 (0%)
 Frame = +2

Query  11   MGASEKPKAPIllglllltllESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYG  190
            MG S+  KA I LG L L L +S  GRFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYG
Sbjct  1    MGVSKTSKATIFLGFLWLNLFQSVVGRFVVEKNSLRVVSPDDIKGTYDSAIGNFGIPQYG  60

Query  191  GSMTGTVVYPKDNRkgckgfdgfgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGAS  370
            GS+ GTVVYPK+NRKGC+ F+  G SF SK+G++PTFV+VDRGDC FALK WNAQNAGA+
Sbjct  61   GSIPGTVVYPKENRKGCRNFEDSGTSFKSKSGAMPTFVLVDRGDCFFALKVWNAQNAGAA  120

Query  371  AILVADDVEERLITMDSPEEDGSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNL  550
            A+LVADDV+ERLITMDSPE DGSS+ Y+ENITIPSALIEKSF EKLKKAV  GEM++VNL
Sbjct  121  AVLVADDVDERLITMDSPEADGSSAKYIENITIPSALIEKSFAEKLKKAVSAGEMINVNL  180

Query  551  DWREAVPHPDDRVEYELWTNSNDECGYKCDMLMK  652
            DWREAVPHPDDRVEYELWT+SNDECG+KCDMLMK
Sbjct  181  DWREAVPHPDDRVEYELWTSSNDECGFKCDMLMK  214



>ref|XP_004230700.1| PREDICTED: vacuolar-sorting receptor 3 [Solanum lycopersicum]
Length=630

 Score =   312 bits (799),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 166/214 (78%), Positives = 188/214 (88%), Gaps = 0/214 (0%)
 Frame = +2

Query  11   MGASEKPKAPIllglllltllESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYG  190
            MG S+  KA I LG L L L +S  GRFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYG
Sbjct  1    MGVSKTSKATIFLGFLWLNLFQSVVGRFVVEKNSLRVVSPDDIKGTYDSAIGNFGIPQYG  60

Query  191  GSMTGTVVYPKDNRkgckgfdgfgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGAS  370
            GS+ GTVVYPK+NRKGC+ F+  G SF SK+G++PTFV+VDRGDC FALK WNAQNAGA+
Sbjct  61   GSIPGTVVYPKENRKGCRNFEDSGTSFKSKSGAMPTFVLVDRGDCFFALKVWNAQNAGAA  120

Query  371  AILVADDVEERLITMDSPEEDGSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNL  550
            A+LVADDV+ERLITMDSPE DGSS+ Y+ENITIPSALIEK+F EKLKKAV  GEMV+VNL
Sbjct  121  AVLVADDVDERLITMDSPEADGSSAKYIENITIPSALIEKNFAEKLKKAVSAGEMVNVNL  180

Query  551  DWREAVPHPDDRVEYELWTNSNDECGYKCDMLMK  652
            DWREAVPHPDDRVEYELWT+SNDECG+KCDMLMK
Sbjct  181  DWREAVPHPDDRVEYELWTSSNDECGFKCDMLMK  214



>ref|XP_011088070.1| PREDICTED: vacuolar-sorting receptor 3-like [Sesamum indicum]
Length=629

 Score =   310 bits (795),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 169/214 (79%), Positives = 191/214 (89%), Gaps = 0/214 (0%)
 Frame = +2

Query  11   MGASEKPKAPIllglllltllESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYG  190
            MG SE+PK  ILLGLLLLTL E   GRFVVEKN+L+V SPDSIKGT+DSA+GNFGIPQYG
Sbjct  1    MGCSERPKGAILLGLLLLTLAEIVVGRFVVEKNSLRVLSPDSIKGTHDSAIGNFGIPQYG  60

Query  191  GSMTGTVVYPKDNRkgckgfdgfgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGAS  370
            G M GTVVYP+DNRKGCK FD  G SF +KAG+LP FV+VDRGDC FALK WNAQNAGA+
Sbjct  61   GRMGGTVVYPRDNRKGCKSFDDSGISFKAKAGALPNFVLVDRGDCFFALKVWNAQNAGAA  120

Query  371  AILVADDVEERLITMDSPEEDGSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNL  550
            A+LVADD++E LITMDSPEEDG+S+ Y+ NITIPSALI+KSFGEKLKKA+ +G+MV+VNL
Sbjct  121  AVLVADDLDEPLITMDSPEEDGASARYIANITIPSALIDKSFGEKLKKAISEGDMVNVNL  180

Query  551  DWREAVPHPDDRVEYELWTNSNDECGYKCDMLMK  652
            DWREAVPHPDDRVEYELWTNSNDECG KCDMLM+
Sbjct  181  DWREAVPHPDDRVEYELWTNSNDECGVKCDMLME  214



>gb|EYU37571.1| hypothetical protein MIMGU_mgv1a002851mg [Erythranthe guttata]
Length=631

 Score =   307 bits (787),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 166/213 (78%), Positives = 190/213 (89%), Gaps = 0/213 (0%)
 Frame = +2

Query  11   MGASEKPKAPIllglllltllESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYG  190
            MG SE+ KA +LLG  LL L E AAGRFVVEKN+L+V SP+SIKG +DSA+GNFGIPQYG
Sbjct  1    MGCSERSKAAVLLGFSLLILAELAAGRFVVEKNSLRVISPESIKGNHDSAIGNFGIPQYG  60

Query  191  GSMTGTVVYPKDNRkgckgfdgfgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGAS  370
            GSM+GTV+YPKDN+KGCK FD FG SF +KAG+LP FV+VDRGDC FALK WNAQNAGA+
Sbjct  61   GSMSGTVLYPKDNKKGCKNFDDFGISFKAKAGALPNFVLVDRGDCFFALKVWNAQNAGAA  120

Query  371  AILVADDVEERLITMDSPEEDGSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNL  550
            A+LVAD+++E LITMD+PEE G+S+ Y+ NITIPSALI+KSFGEKLKKAV DGEMV+VNL
Sbjct  121  AVLVADNLDEALITMDTPEESGASAKYIANITIPSALIDKSFGEKLKKAVTDGEMVNVNL  180

Query  551  DWREAVPHPDDRVEYELWTNSNDECGYKCDMLM  649
            DWREAVPHPDDRVEYELWTNSNDECG KCDMLM
Sbjct  181  DWREAVPHPDDRVEYELWTNSNDECGVKCDMLM  213



>ref|XP_009760191.1| PREDICTED: vacuolar-sorting receptor 3-like [Nicotiana sylvestris]
Length=631

 Score =   303 bits (777),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 155/193 (80%), Positives = 175/193 (91%), Gaps = 0/193 (0%)
 Frame = +2

Query  74   ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfd  253
            +S  GRFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGS+ GTVVYPK N+KGC+ FD
Sbjct  23   QSVVGRFVVEKNSLRVVSPDDIKGTYDSAIGNFGIPQYGGSLPGTVVYPKGNQKGCRNFD  82

Query  254  gfgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  433
              G SF SK+G++PTFV+VDRGDC FALK WNAQNAGA+A+LVADDV+ERLITMD+PE D
Sbjct  83   DSGISFKSKSGAMPTFVLVDRGDCFFALKVWNAQNAGAAAVLVADDVDERLITMDTPEAD  142

Query  434  GSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNS  613
            GSS+ Y+ENITIPSALIEKSF EKLKKAV  GEMV+VNLDWREAVPHPDDRVEYELWT+S
Sbjct  143  GSSAKYIENITIPSALIEKSFAEKLKKAVSAGEMVNVNLDWREAVPHPDDRVEYELWTSS  202

Query  614  NDECGYKCDMLMK  652
            NDECG+KCDMLMK
Sbjct  203  NDECGFKCDMLMK  215



>ref|XP_009598407.1| PREDICTED: vacuolar-sorting receptor 3-like [Nicotiana tomentosiformis]
Length=631

 Score =   303 bits (777),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 155/193 (80%), Positives = 175/193 (91%), Gaps = 0/193 (0%)
 Frame = +2

Query  74   ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfd  253
            +S  GRFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGS+ GTVVYPK N+KGC+ FD
Sbjct  23   QSVVGRFVVEKNSLRVVSPDDIKGTYDSAIGNFGIPQYGGSLPGTVVYPKGNQKGCRNFD  82

Query  254  gfgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  433
              G SF SK+G++PTFV+VDRGDC FALK WNAQNAGA+A+LVADDV+ERLITMD+PE D
Sbjct  83   DSGISFKSKSGAMPTFVLVDRGDCFFALKVWNAQNAGAAAVLVADDVDERLITMDTPEAD  142

Query  434  GSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNS  613
            GSS+ Y+ENITIPSALIEKSF EKLKKAV  GEMV+VNLDWREAVPHPDDRVEYELWT+S
Sbjct  143  GSSAKYIENITIPSALIEKSFAEKLKKAVNAGEMVNVNLDWREAVPHPDDRVEYELWTSS  202

Query  614  NDECGYKCDMLMK  652
            NDECG+KCDMLMK
Sbjct  203  NDECGFKCDMLMK  215



>emb|CDO97275.1| unnamed protein product [Coffea canephora]
Length=630

 Score =   303 bits (777),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 163/213 (77%), Positives = 187/213 (88%), Gaps = 0/213 (0%)
 Frame = +2

Query  11   MGASEKPKAPIllglllltllESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYG  190
            MG  E+ K+ ILLG L+L L +   GRFVVEKN+L+V SPDSIKGT+DSA+GNFGIPQYG
Sbjct  1    MGRYERSKSAILLGFLVLNLTQLVMGRFVVEKNSLRVTSPDSIKGTHDSAIGNFGIPQYG  60

Query  191  GSMTGTVVYPKDNRkgckgfdgfgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGAS  370
            GSM+GTVV+PK+N+KGCK F  FG SF  K+G++P F++VDRGDC FALK WNAQNAGAS
Sbjct  61   GSMSGTVVFPKENQKGCKTFSDFGSSFKPKSGAMPNFLLVDRGDCLFALKVWNAQNAGAS  120

Query  371  AILVADDVEERLITMDSPEEDGSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNL  550
            A+LVADDV+E LITMDSPEE+ SS+ Y+ENITIPSALIEKSFGEKLKKA+  GEMV VNL
Sbjct  121  AVLVADDVDEALITMDSPEEERSSAKYIENITIPSALIEKSFGEKLKKAINAGEMVSVNL  180

Query  551  DWREAVPHPDDRVEYELWTNSNDECGYKCDMLM  649
            DWREAVPHPDDRVEYELWTNSNDECG+KCDMLM
Sbjct  181  DWREAVPHPDDRVEYELWTNSNDECGFKCDMLM  213



>emb|CAN79862.1| hypothetical protein VITISV_021998 [Vitis vinifera]
Length=599

 Score =   300 bits (769),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 157/188 (84%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            +FVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N KGCKGFD +G S
Sbjct  28   KFVVEKNSLTVVSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENTKGCKGFDEYGIS  87

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
            F SK G+LPTFV+VDRGDC FALK WNAQNAGASA+LVAD++EE LITMDSPEEDGSSS 
Sbjct  88   FKSKIGALPTFVVVDRGDCFFALKVWNAQNAGASAVLVADNIEEPLITMDSPEEDGSSSK  147

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            Y+ENITIPSALIEKSFGEKLKKA+  GEMV+VNLDWREAVPHPDDRVEYELWTNSNDECG
Sbjct  148  YIENITIPSALIEKSFGEKLKKAITSGEMVNVNLDWREAVPHPDDRVEYELWTNSNDECG  207

Query  629  YKCDMLMK  652
             KCDMLM+
Sbjct  208  VKCDMLME  215



>emb|CBI22461.3| unnamed protein product [Vitis vinifera]
Length=631

 Score =   301 bits (770),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 157/188 (84%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            +FVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N KGCKGFD +G S
Sbjct  28   KFVVEKNSLTVVSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENTKGCKGFDEYGIS  87

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
            F SK G+LPTFV+VDRGDC FALK WNAQNAGASA+LVAD++EE LITMDSPEEDGSSS 
Sbjct  88   FKSKIGALPTFVVVDRGDCFFALKVWNAQNAGASAVLVADNIEEPLITMDSPEEDGSSSK  147

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            Y+ENITIPSALIEKSFGEKLKKA+  GEMV+VNLDWREAVPHPDDRVEYELWTNSNDECG
Sbjct  148  YIENITIPSALIEKSFGEKLKKAITSGEMVNVNLDWREAVPHPDDRVEYELWTNSNDECG  207

Query  629  YKCDMLMK  652
             KCDMLM+
Sbjct  208  VKCDMLME  215



>ref|XP_002264769.1| PREDICTED: vacuolar-sorting receptor 3 [Vitis vinifera]
Length=636

 Score =   301 bits (770),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 157/188 (84%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            +FVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N KGCKGFD +G S
Sbjct  33   KFVVEKNSLTVVSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENTKGCKGFDEYGIS  92

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
            F SK G+LPTFV+VDRGDC FALK WNAQNAGASA+LVAD++EE LITMDSPEEDGSSS 
Sbjct  93   FKSKIGALPTFVVVDRGDCFFALKVWNAQNAGASAVLVADNIEEPLITMDSPEEDGSSSK  152

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            Y+ENITIPSALIEKSFGEKLKKA+  GEMV+VNLDWREAVPHPDDRVEYELWTNSNDECG
Sbjct  153  YIENITIPSALIEKSFGEKLKKAITSGEMVNVNLDWREAVPHPDDRVEYELWTNSNDECG  212

Query  629  YKCDMLMK  652
             KCDMLM+
Sbjct  213  VKCDMLME  220



>ref|XP_002527509.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF34907.1| zinc finger protein, putative [Ricinus communis]
Length=633

 Score =   299 bits (766),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 154/192 (80%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGSM G V YPKDN+KGCK FD 
Sbjct  26   SCVGRFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVTYPKDNKKGCKEFDD  85

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            FG SF S+ G+LPTFV++DRGDC FALK WNAQ AGASA+LV+DD+EE LITMD+PEEDG
Sbjct  86   FGVSFKSRPGALPTFVLLDRGDCFFALKVWNAQKAGASAVLVSDDIEEPLITMDTPEEDG  145

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            SS+NY+ENITIPSALIEKSFGE LKKA+ +G+MV+VNLDWREAVPHPDDRVEYELWTNSN
Sbjct  146  SSANYIENITIPSALIEKSFGEILKKALSNGDMVNVNLDWREAVPHPDDRVEYELWTNSN  205

Query  617  DECGYKCDMLMK  652
            DECG KCDMLM+
Sbjct  206  DECGVKCDMLME  217



>ref|XP_008455032.1| PREDICTED: vacuolar-sorting receptor 3-like [Cucumis melo]
Length=630

 Score =   299 bits (765),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
            +  RFVVEKN+L+V SPD +KGTYDSA+GNFGIPQYGGSM+GTVV+PK+N+KGC+ F   
Sbjct  25   SVARFVVEKNSLRVTSPDGLKGTYDSAIGNFGIPQYGGSMSGTVVFPKENQKGCREFSDA  84

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
            G SF SK G+LPTFV+VDRGDC FALK WNAQ AGASA+LVAD++EERLITMDSPEEDGS
Sbjct  85   GISFQSKPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADNIEERLITMDSPEEDGS  144

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
            ++ Y+ENITIPSALIEKSFGEKLKK +  GEMV V+LDWREAVPHPDDRVEYELWTNSND
Sbjct  145  TAKYIENITIPSALIEKSFGEKLKKEISSGEMVSVSLDWREAVPHPDDRVEYELWTNSND  204

Query  620  ECGYKCDMLMK  652
            ECG KCDMLM+
Sbjct  205  ECGVKCDMLME  215



>gb|KEH44022.1| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=529

 Score =   296 bits (757),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 172/192 (90%), Gaps = 0/192 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S+  +FVVEKN+L+V SPDSIKGTYDSA+GNFGIPQYGGSM G VVYPKDN+KGCK FD 
Sbjct  23   SSMAKFVVEKNSLRVTSPDSIKGTYDSAIGNFGIPQYGGSMAGNVVYPKDNQKGCKEFDE  82

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
             G SF SK G+LPT V++DRG C FALK WNAQ AGAS++LVADD+EE+LITMD+PEEDG
Sbjct  83   SGISFKSKPGALPTIVLLDRGSCFFALKVWNAQKAGASSVLVADDIEEKLITMDTPEEDG  142

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            SS+ Y+ENITIPSALIEK+FGEKLKKA+  G+MV+VNLDWREAVPHPDDRVEYELWTNSN
Sbjct  143  SSAKYIENITIPSALIEKNFGEKLKKAISGGDMVNVNLDWREAVPHPDDRVEYELWTNSN  202

Query  617  DECGYKCDMLMK  652
            DECG KCDMLM+
Sbjct  203  DECGVKCDMLME  214



>ref|XP_004496877.1| PREDICTED: vacuolar-sorting receptor 1-like [Cicer arietinum]
Length=630

 Score =   298 bits (764),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 172/192 (90%), Gaps = 0/192 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S+  +FVVEKN+L+V SPDSIKGTYDSA+GNFGIPQYGGSM G V+YPKDNRKGCK FD 
Sbjct  22   SSIAKFVVEKNSLRVTSPDSIKGTYDSAIGNFGIPQYGGSMAGNVLYPKDNRKGCKEFDD  81

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
             G SF SK G+LPTFV++DRG+C FALK WNAQ AGASA+LVADD+EE+LITMD+PEEDG
Sbjct  82   SGISFKSKPGALPTFVLLDRGNCFFALKVWNAQKAGASAVLVADDIEEKLITMDTPEEDG  141

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            SS+ Y+ENITIPSALIEK FGEKLK A+  G+MV+VNLDWREAVPHPDDRVEYELWTNSN
Sbjct  142  SSAKYIENITIPSALIEKKFGEKLKSAISSGDMVNVNLDWREAVPHPDDRVEYELWTNSN  201

Query  617  DECGYKCDMLMK  652
            DECG KCDMLM+
Sbjct  202  DECGVKCDMLME  213



>ref|XP_008384516.1| PREDICTED: vacuolar-sorting receptor 3-like [Malus domestica]
Length=629

 Score =   298 bits (762),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 169/191 (88%), Gaps = 0/191 (0%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
            A GRFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGSM G VVYPK+N+KGCK F  F
Sbjct  22   ANGRFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKENQKGCKEFSEF  81

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
            G +F S  G+LPTFV+VDRGDC FALK WNAQ AGASA+LVAD++EE LITMDSPEEDGS
Sbjct  82   GITFKSSPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADNIEEALITMDSPEEDGS  141

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
            +S Y+ENITIPSALIEK FGE LKKA+  G+MV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  142  TSKYIENITIPSALIEKRFGEXLKKAISAGDMVNVNLDWREAVPHPDDRVEYELWTNSND  201

Query  620  ECGYKCDMLMK  652
            ECG KCDMLM+
Sbjct  202  ECGVKCDMLME  212



>ref|XP_004136938.1| PREDICTED: vacuolar-sorting receptor 3-like [Cucumis sativus]
 gb|KGN43851.1| hypothetical protein Csa_7G071400 [Cucumis sativus]
Length=631

 Score =   298 bits (763),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            RFVVEKN+L+V SPD +KGTYDSA+GNFGIPQYGGSM+GTVV+PK+N+KGC+ F   G S
Sbjct  29   RFVVEKNSLRVTSPDGLKGTYDSAIGNFGIPQYGGSMSGTVVFPKENQKGCREFSDAGIS  88

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
            F SK G+LPTFV+VDRGDC FALK WNAQ AGASA+LVAD++EERLITMDSPEEDGS++ 
Sbjct  89   FQSKPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADNLEERLITMDSPEEDGSTAK  148

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            Y+ENITIPSALIEKSFGEKLKK +  GEMV V+LDWREAVPHPDDRVEYELWTNSNDECG
Sbjct  149  YIENITIPSALIEKSFGEKLKKEINSGEMVSVSLDWREAVPHPDDRVEYELWTNSNDECG  208

Query  629  YKCDMLMK  652
             KCDMLM+
Sbjct  209  VKCDMLME  216



>ref|XP_002313909.1| vacuolar sorting receptor protein BP-80 [Populus trichocarpa]
 gb|EEE87864.1| vacuolar sorting receptor protein BP-80 [Populus trichocarpa]
Length=630

 Score =   297 bits (760),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 153/192 (80%), Positives = 171/192 (89%), Gaps = 0/192 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S+  RFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGSM G VVYPKDN+KGCK F+ 
Sbjct  23   SSIARFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKDNKKGCKEFEE  82

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  SF SK G+LPTFV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMD+PEED 
Sbjct  83   FRISFQSKPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADDMEEALITMDTPEEDV  142

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            SS+ Y+ENITIPSALIEKSFGE LKKA+ +G+MV+VNLDWREAVPHPDDRVEYELWTNSN
Sbjct  143  SSAKYIENITIPSALIEKSFGETLKKALSNGDMVNVNLDWREAVPHPDDRVEYELWTNSN  202

Query  617  DECGYKCDMLMK  652
            DECG KCDMLM+
Sbjct  203  DECGVKCDMLME  214



>gb|AES62774.2| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=632

 Score =   296 bits (759),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 172/192 (90%), Gaps = 0/192 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S+  +FVVEKN+L+V SPDSIKGTYDSA+GNFGIPQYGGSM G VVYPKDN+KGCK FD 
Sbjct  23   SSMAKFVVEKNSLRVTSPDSIKGTYDSAIGNFGIPQYGGSMAGNVVYPKDNQKGCKEFDE  82

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
             G SF SK G+LPT V++DRG C FALK WNAQ AGAS++LVADD+EE+LITMD+PEEDG
Sbjct  83   SGISFKSKPGALPTIVLLDRGSCFFALKVWNAQKAGASSVLVADDIEEKLITMDTPEEDG  142

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            SS+ Y+ENITIPSALIEK+FGEKLKKA+  G+MV+VNLDWREAVPHPDDRVEYELWTNSN
Sbjct  143  SSAKYIENITIPSALIEKNFGEKLKKAISGGDMVNVNLDWREAVPHPDDRVEYELWTNSN  202

Query  617  DECGYKCDMLMK  652
            DECG KCDMLM+
Sbjct  203  DECGVKCDMLME  214



>ref|XP_009349164.1| PREDICTED: vacuolar-sorting receptor 3-like [Pyrus x bretschneideri]
Length=628

 Score =   296 bits (758),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 169/191 (88%), Gaps = 0/191 (0%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
            A GRFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGSM G V+YPK N+KGCK F  F
Sbjct  22   ANGRFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVLYPKQNQKGCKEFSEF  81

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
            G  F S+ G+LPTFV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMDSPEEDGS
Sbjct  82   GIKFESRPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDSPEEDGS  141

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
            ++ Y+ENITIPSALIEKSFG+ LKKA+  G+MV+VNLDWREAVPHPDDRVEY+LWTNSND
Sbjct  142  TAKYIENITIPSALIEKSFGQILKKAINAGDMVNVNLDWREAVPHPDDRVEYQLWTNSND  201

Query  620  ECGYKCDMLMK  652
            ECG KCDMLM+
Sbjct  202  ECGVKCDMLME  212



>ref|XP_008348888.1| PREDICTED: vacuolar-sorting receptor 3-like [Malus domestica]
Length=628

 Score =   296 bits (758),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 169/191 (88%), Gaps = 0/191 (0%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
            A GRFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGSM G V+YPK N+KGCK F  F
Sbjct  22   ANGRFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVLYPKQNQKGCKEFSEF  81

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
            G  F S+ G+LPTFV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMDSPEEDGS
Sbjct  82   GIKFESRPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDSPEEDGS  141

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
            ++ Y+ENITIPSALIEKSFG+ LKKA+  G+MV+VNLDWREAVPHPDDRVEY+LWTNSND
Sbjct  142  TAKYIENITIPSALIEKSFGQILKKAINAGDMVNVNLDWREAVPHPDDRVEYQLWTNSND  201

Query  620  ECGYKCDMLMK  652
            ECG KCDMLM+
Sbjct  202  ECGVKCDMLME  212



>ref|XP_010111675.1| Vacuolar-sorting receptor 3 [Morus notabilis]
 gb|EXC31466.1| Vacuolar-sorting receptor 3 [Morus notabilis]
Length=631

 Score =   296 bits (758),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 170/192 (89%), Gaps = 0/192 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S   RFVVEKN+L+V SPD I+GT+DSA+GNFGIPQYGGSM G VVYPKDN+KGCK F  
Sbjct  25   SLHARFVVEKNSLRVTSPDRIRGTHDSAIGNFGIPQYGGSMAGNVVYPKDNQKGCKEFSD  84

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            +G SF SK G+LPTFV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMDSPEEDG
Sbjct  85   YGISFQSKPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADDMEEALITMDSPEEDG  144

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            S++ Y+ENITIPSALIEKSFGE LKKA+  G+MV+VNLDWREAVPHPDDRVEYELWTNSN
Sbjct  145  STAKYIENITIPSALIEKSFGETLKKAINSGDMVNVNLDWREAVPHPDDRVEYELWTNSN  204

Query  617  DECGYKCDMLMK  652
            DECG KCDMLM+
Sbjct  205  DECGVKCDMLME  216



>gb|KCW63607.1| hypothetical protein EUGRSUZ_G01233 [Eucalyptus grandis]
Length=578

 Score =   295 bits (754),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
            +A RFVVEKN+L V SPD IKG YDSA+GNFGIPQYGGSM G V YP+ NRKGCK F  F
Sbjct  36   SAARFVVEKNSLAVTSPDKIKGNYDSAIGNFGIPQYGGSMAGAVTYPEKNRKGCKEFSEF  95

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
              SF SK G LP FV+VDRGDC FALK WNAQ AGASA+LVADD+EERLITMDSPEEDGS
Sbjct  96   DISFKSKPGMLPKFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEERLITMDSPEEDGS  155

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
            ++ Y+ENITIPSALIEKSFGE LKKA+  G+MV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  156  TAKYIENITIPSALIEKSFGETLKKAISSGDMVNVNLDWREAVPHPDDRVEYELWTNSND  215

Query  620  ECGYKCDMLMK  652
            ECG KCDMLM+
Sbjct  216  ECGVKCDMLME  226



>ref|XP_004159916.1| PREDICTED: LOW QUALITY PROTEIN: vacuolar-sorting receptor 3-like 
[Cucumis sativus]
Length=631

 Score =   296 bits (757),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 169/188 (90%), Gaps = 0/188 (0%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            RFVVEKN+L+V SPD +KGTYDSA+GNFGIPQYGGSM+GTVV+PK+N+KGC+ F   G S
Sbjct  29   RFVVEKNSLRVTSPDGLKGTYDSAIGNFGIPQYGGSMSGTVVFPKENQKGCREFSDAGIS  88

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
            F SK G+LPTFV+VDRGDC FALK WNAQ AGASA+LVAD++EERLITMDSPEEDGS++ 
Sbjct  89   FQSKPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADNLEERLITMDSPEEDGSTAK  148

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            Y+ENITIPSALI KSFGEKLKK +  GEMV V+LDWREAVPHPDDRVEYELWTNSNDECG
Sbjct  149  YIENITIPSALIXKSFGEKLKKEINSGEMVSVSLDWREAVPHPDDRVEYELWTNSNDECG  208

Query  629  YKCDMLMK  652
             KCDMLM+
Sbjct  209  VKCDMLME  216



>ref|XP_010277061.1| PREDICTED: vacuolar-sorting receptor 3-like [Nelumbo nucifera]
Length=634

 Score =   296 bits (757),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
            A  RFVVEKN+L V SPDSIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N K CK F+ F
Sbjct  28   ATARFVVEKNSLTVTSPDSIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENMKACKDFNEF  87

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
            G SF +K G+LPTFV+VDRGDC FALK WNAQNAGASA+LVAD+VEE LITMDSP+EDG 
Sbjct  88   GTSFKAKPGALPTFVLVDRGDCFFALKVWNAQNAGASAVLVADNVEEPLITMDSPQEDGG  147

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
            S+ Y+ENITIPSALI+K+FGEKLKKA+  G+MV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  148  STKYIENITIPSALIDKNFGEKLKKALSAGDMVNVNLDWREAVPHPDDRVEYELWTNSND  207

Query  620  ECGYKCDMLMK  652
            ECG KCDMLM+
Sbjct  208  ECGVKCDMLME  218



>ref|XP_003592523.1| Vacuolar-sorting receptor [Medicago truncatula]
Length=601

 Score =   295 bits (754),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            +FVVEKN+L+V SPDSIKGTYDSA+GNFGIPQYGGSM G VVYPKDN+KGCK FD  G S
Sbjct  3    KFVVEKNSLRVTSPDSIKGTYDSAIGNFGIPQYGGSMAGNVVYPKDNQKGCKEFDESGIS  62

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
            F SK G+LPT V++DRG C FALK WNAQ AGAS++LVADD+EE+LITMD+PEEDGSS+ 
Sbjct  63   FKSKPGALPTIVLLDRGSCFFALKVWNAQKAGASSVLVADDIEEKLITMDTPEEDGSSAK  122

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            Y+ENITIPSALIEK+FGEKLKKA+  G+MV+VNLDWREAVPHPDDRVEYELWTNSNDECG
Sbjct  123  YIENITIPSALIEKNFGEKLKKAISGGDMVNVNLDWREAVPHPDDRVEYELWTNSNDECG  182

Query  629  YKCDMLMK  652
             KCDMLM+
Sbjct  183  VKCDMLME  190



>gb|KDP44487.1| hypothetical protein JCGZ_16320 [Jatropha curcas]
Length=630

 Score =   295 bits (755),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 169/191 (88%), Gaps = 0/191 (0%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
            +  RFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGSM G V YPKDNRKGCK F+ F
Sbjct  24   SVARFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVTYPKDNRKGCKDFNDF  83

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
            G SF S+ G+LPTFV++DRGDC FALK WNAQ AGASA+LVADD+EE LITMDSPEEDGS
Sbjct  84   GLSFKSQPGALPTFVLLDRGDCFFALKVWNAQKAGASAVLVADDIEEPLITMDSPEEDGS  143

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
            ++ Y+ENIT+PSALIEKSFGE LKKA   G+MV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  144  ATKYIENITVPSALIEKSFGEMLKKATSSGDMVNVNLDWREAVPHPDDRVEYELWTNSND  203

Query  620  ECGYKCDMLMK  652
            ECG KCDMLM+
Sbjct  204  ECGVKCDMLME  214



>ref|XP_009375671.1| PREDICTED: vacuolar-sorting receptor 3-like [Pyrus x bretschneideri]
Length=628

 Score =   295 bits (755),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 169/191 (88%), Gaps = 0/191 (0%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
            A GRFVVEKN+L+V SPD IKGTYD+A+GNFGIPQYGGSM G V+YPK N+KGCK F  F
Sbjct  22   ANGRFVVEKNSLRVTSPDKIKGTYDTAIGNFGIPQYGGSMAGAVLYPKQNQKGCKEFSEF  81

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
            G  F S+ G+LPTFV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMDSPEEDGS
Sbjct  82   GIKFESRPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDSPEEDGS  141

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
            ++ Y+ENITIPSALIEKSFG+ LKKA+  G+MV+VNLDWREAVPHPDDRVEY+LWTNSND
Sbjct  142  TAKYIENITIPSALIEKSFGQILKKAINAGDMVNVNLDWREAVPHPDDRVEYQLWTNSND  201

Query  620  ECGYKCDMLMK  652
            ECG KCDMLM+
Sbjct  202  ECGVKCDMLME  212



>ref|XP_008236323.1| PREDICTED: vacuolar-sorting receptor 3 [Prunus mume]
Length=629

 Score =   295 bits (754),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
            ++ RFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGSM G V+YPK+N+KGCK F  F
Sbjct  23   SSARFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVLYPKENQKGCKEFSEF  82

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
            G SF S  G+LPTFV+VDRGDC FALK WNAQ AGASA+LVAD++EE LITMDSPEEDGS
Sbjct  83   GISFKSTPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADNIEEALITMDSPEEDGS  142

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
            ++ Y+ENITIPSALIEKSFG+ LKK++  G+MV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  143  TAKYIENITIPSALIEKSFGQTLKKSISSGDMVNVNLDWREAVPHPDDRVEYELWTNSND  202

Query  620  ECGYKCDMLMK  652
            ECG KCDMLM+
Sbjct  203  ECGVKCDMLME  213



>ref|XP_010065899.1| PREDICTED: vacuolar-sorting receptor 1-like [Eucalyptus grandis]
 gb|KCW63606.1| hypothetical protein EUGRSUZ_G01233 [Eucalyptus grandis]
Length=644

 Score =   295 bits (754),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
            +A RFVVEKN+L V SPD IKG YDSA+GNFGIPQYGGSM G V YP+ NRKGCK F  F
Sbjct  36   SAARFVVEKNSLAVTSPDKIKGNYDSAIGNFGIPQYGGSMAGAVTYPEKNRKGCKEFSEF  95

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
              SF SK G LP FV+VDRGDC FALK WNAQ AGASA+LVADD+EERLITMDSPEEDGS
Sbjct  96   DISFKSKPGMLPKFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEERLITMDSPEEDGS  155

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
            ++ Y+ENITIPSALIEKSFGE LKKA+  G+MV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  156  TAKYIENITIPSALIEKSFGETLKKAISSGDMVNVNLDWREAVPHPDDRVEYELWTNSND  215

Query  620  ECGYKCDMLMK  652
            ECG KCDMLM+
Sbjct  216  ECGVKCDMLME  226



>gb|KHF97360.1| Vacuolar-sorting receptor 3 -like protein [Gossypium arboreum]
Length=628

 Score =   294 bits (752),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
            GRFVVEKN+L V SP+ IKGTYDSA+GNFGIPQYGGSM GTVVYPKDN+K CK FD F  
Sbjct  24   GRFVVEKNSLTVTSPEKIKGTYDSAIGNFGIPQYGGSMAGTVVYPKDNQKACKAFDEFSI  83

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            SF SK GSLPTFV+VDRGDC FALK WN Q AGASA+LVADD+EE LITMD+PEED SSS
Sbjct  84   SFQSKPGSLPTFVLVDRGDCFFALKVWNVQKAGASAVLVADDIEEALITMDTPEEDSSSS  143

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
             Y+ENITIPSALI+KSFGE LKKA+   +MV+VNLDWRE+VPHPDDRVEYELWTNSNDEC
Sbjct  144  KYIENITIPSALIQKSFGEALKKAISGADMVNVNLDWRESVPHPDDRVEYELWTNSNDEC  203

Query  626  GYKCDMLMK  652
            G KCDMLM+
Sbjct  204  GVKCDMLME  212



>gb|KJB79450.1| hypothetical protein B456_013G050300 [Gossypium raimondii]
Length=628

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
            GRFVVEKN+L V SP+ IKGTYDSA+GNFGIPQYGGSM GTVVYPKDN+KGCK FD F  
Sbjct  24   GRFVVEKNSLTVTSPEKIKGTYDSAIGNFGIPQYGGSMAGTVVYPKDNQKGCKAFDEFSI  83

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            SF SK GSLPTFV+VDRGDC FALK WN Q AGASA+LVADD+EE LITMD+PEED SSS
Sbjct  84   SFPSKPGSLPTFVLVDRGDCFFALKVWNVQKAGASAVLVADDIEEALITMDTPEEDSSSS  143

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
             Y+ENITIPSALI+KSFGE LKKA+   +MV+VNLDWRE+VPHPDDRVEYELWTNSNDEC
Sbjct  144  KYIENITIPSALIQKSFGEALKKAISGADMVNVNLDWRESVPHPDDRVEYELWTNSNDEC  203

Query  626  GYKCDMLMK  652
            G KCDMLM+
Sbjct  204  GVKCDMLME  212



>ref|XP_007199755.1| hypothetical protein PRUPE_ppa002822mg [Prunus persica]
 gb|EMJ00954.1| hypothetical protein PRUPE_ppa002822mg [Prunus persica]
Length=629

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 169/191 (88%), Gaps = 0/191 (0%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
            ++ RFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGSM G V+YPK+N+KGCK F  F
Sbjct  23   SSARFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVLYPKENQKGCKEFSEF  82

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
            G SF S  G+LP FV+VDRGDC FALK WNAQ AGASA+LVAD++EE LITMDSPEEDGS
Sbjct  83   GISFKSTPGALPKFVLVDRGDCFFALKVWNAQKAGASAVLVADNIEEPLITMDSPEEDGS  142

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
            +S Y+ENITIPSALIEKSFG+ LKK++  G+MV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  143  TSKYIENITIPSALIEKSFGQTLKKSISSGDMVNVNLDWREAVPHPDDRVEYELWTNSND  202

Query  620  ECGYKCDMLMK  652
            ECG KCDMLM+
Sbjct  203  ECGVKCDMLME  213



>ref|XP_010272410.1| PREDICTED: vacuolar-sorting receptor 3-like [Nelumbo nucifera]
Length=635

 Score =   293 bits (749),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
            A  RFVVEKN+L V SPDSIKGT+DSA+GNFGIPQYGGSM GTV+YPK+N KGCK FD F
Sbjct  29   ATARFVVEKNSLTVTSPDSIKGTHDSAIGNFGIPQYGGSMAGTVIYPKENMKGCKDFDDF  88

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
            G SF +K+G+LPTFV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMDSP+EDG 
Sbjct  89   GISFKTKSGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEPLITMDSPQEDGG  148

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
            S+ Y+ENITIPSALI+K FG+KLKKA+  G+MV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  149  SAKYIENITIPSALIDKKFGDKLKKALSSGDMVNVNLDWREAVPHPDDRVEYELWTNSND  208

Query  620  ECGYKCDMLMK  652
            ECG KCDMLM+
Sbjct  209  ECGVKCDMLME  219



>gb|KJB12290.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=532

 Score =   290 bits (742),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            +   RFVVEKN+L V SP+ IKGT+DSA+GNFGIPQYGGSM G VVYPK+N+K CK F  
Sbjct  22   NCCARFVVEKNSLTVTSPEKIKGTHDSAIGNFGIPQYGGSMAGVVVYPKENQKACKSFGD  81

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            FG SF SK GSLPTFV+VDRGDC FALK WN Q AGASA+LVADD+EE LITMD+PEED 
Sbjct  82   FGISFKSKPGSLPTFVLVDRGDCFFALKVWNVQQAGASAVLVADDIEEALITMDNPEEDS  141

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            SS+ Y+ENITIPSALIEK+FGE LKKA+  G+MV+VNLDWREAVPHPDDRVEYELWTNSN
Sbjct  142  SSAKYIENITIPSALIEKTFGETLKKAISGGDMVNVNLDWREAVPHPDDRVEYELWTNSN  201

Query  617  DECGYKCDMLM  649
            DECG KCDMLM
Sbjct  202  DECGVKCDMLM  212



>gb|KJB12295.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=477

 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            +   RFVVEKN+L V SP+ IKGT+DSA+GNFGIPQYGGSM G VVYPK+N+K CK F  
Sbjct  22   NCCARFVVEKNSLTVTSPEKIKGTHDSAIGNFGIPQYGGSMAGVVVYPKENQKACKSFGD  81

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            FG SF SK GSLPTFV+VDRGDC FALK WN Q AGASA+LVADD+EE LITMD+PEED 
Sbjct  82   FGISFKSKPGSLPTFVLVDRGDCFFALKVWNVQQAGASAVLVADDIEEALITMDNPEEDS  141

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            SS+ Y+ENITIPSALIEK+FGE LKKA+  G+MV+VNLDWREAVPHPDDRVEYELWTNSN
Sbjct  142  SSAKYIENITIPSALIEKTFGETLKKAISGGDMVNVNLDWREAVPHPDDRVEYELWTNSN  201

Query  617  DECGYKCDMLM  649
            DECG KCDMLM
Sbjct  202  DECGVKCDMLM  212



>ref|XP_007042634.1| Vaculolar sorting receptor 3 isoform 2, partial [Theobroma cacao]
 gb|EOX98465.1| Vaculolar sorting receptor 3 isoform 2, partial [Theobroma cacao]
Length=501

 Score =   288 bits (738),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 169/188 (90%), Gaps = 0/188 (0%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            RFVVEKN+L V SP+ IKGT+DSA+GNFGIPQYGGSM G V+YPK+NRKGCKGFD FG S
Sbjct  23   RFVVEKNSLMVTSPEKIKGTHDSAIGNFGIPQYGGSMAGAVIYPKENRKGCKGFDEFGIS  82

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
            F SK G+LPTFV++DRGDC FALK WNAQ AGASA+LVADD+EE LITMD+PEED SS+ 
Sbjct  83   FQSKPGALPTFVLLDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEEDTSSAK  142

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            Y+ENITIPSALIEK+FGE LKKA+  GEMV+VNLDWREAVPHPDDRVEYELWTNSNDECG
Sbjct  143  YLENITIPSALIEKTFGETLKKAISGGEMVNVNLDWREAVPHPDDRVEYELWTNSNDECG  202

Query  629  YKCDMLMK  652
             KCDMLM+
Sbjct  203  VKCDMLME  210



>gb|KDO57883.1| hypothetical protein CISIN_1g006786mg [Citrus sinensis]
Length=410

 Score =   285 bits (730),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 166/192 (86%), Gaps = 0/192 (0%)
 Frame = +2

Query  74   ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfd  253
             ++  RFVVEKN+L V SP+ IKG++DSA+GNFGIPQYGGSM G V YPK+NRKGC+ F 
Sbjct  23   HTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFG  82

Query  254  gfgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  433
             FG SF +K G+LP FV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMD+PEED
Sbjct  83   DFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEED  142

Query  434  GSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNS  613
             SS+ Y+ENITIPSALI+KSFGE LKKA+  GEMV+VNLDWREAVPHPDDRVEYELWTNS
Sbjct  143  ISSAKYIENITIPSALIDKSFGETLKKALSGGEMVNVNLDWREAVPHPDDRVEYELWTNS  202

Query  614  NDECGYKCDMLM  649
            NDECG KCDMLM
Sbjct  203  NDECGVKCDMLM  214



>ref|XP_002298772.1| hypothetical protein POPTR_0001s30160g [Populus trichocarpa]
 gb|EEE83577.1| hypothetical protein POPTR_0001s30160g [Populus trichocarpa]
Length=630

 Score =   291 bits (746),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 169/188 (90%), Gaps = 0/188 (0%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            RFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGSM G VVYPKDN+KGCK FDGFG S
Sbjct  27   RFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKDNKKGCKEFDGFGIS  86

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
            F SK G+LPTFV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMD+P ED SS+ 
Sbjct  87   FQSKPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADDMEEPLITMDTPAEDASSAQ  146

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            Y+ENITIPSALIEKSF E LKKA+ +G+MV+VNLDWREAVPHPDDRVEYELWTNSNDECG
Sbjct  147  YIENITIPSALIEKSFSETLKKALSNGDMVNVNLDWREAVPHPDDRVEYELWTNSNDECG  206

Query  629  YKCDMLMK  652
             KCDMLM+
Sbjct  207  VKCDMLME  214



>ref|XP_011030346.1| PREDICTED: vacuolar-sorting receptor 3-like [Populus euphratica]
Length=630

 Score =   291 bits (745),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 169/188 (90%), Gaps = 0/188 (0%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            RFVVEKN+L++ SPD IKGTYDSA+GNFGIPQYGGSM G VVYPKDN+KGCK FDGFG S
Sbjct  27   RFVVEKNSLRITSPDKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKDNKKGCKEFDGFGIS  86

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
            F SK G+LPTFV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMD+P ED SS+ 
Sbjct  87   FQSKPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADDMEEPLITMDTPAEDVSSAQ  146

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            Y+ENITIPSALIEKSF E LKKA+ DG+MV+VNLDWREAVPHPDDRVEYELWTNSNDECG
Sbjct  147  YIENITIPSALIEKSFSETLKKALSDGDMVNVNLDWREAVPHPDDRVEYELWTNSNDECG  206

Query  629  YKCDMLMK  652
             KCDMLM+
Sbjct  207  VKCDMLME  214



>ref|XP_011001937.1| PREDICTED: vacuolar-sorting receptor 3 [Populus euphratica]
Length=630

 Score =   291 bits (744),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 171/192 (89%), Gaps = 0/192 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S+  RFVVEKN+L++ SPD IKGTYDSA+GNFGIPQYGGSM G VVYPKDN+KGCK FDG
Sbjct  23   SSIARFVVEKNSLRITSPDKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKDNKKGCKEFDG  82

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            FG SF SK G+LPTFV+VDRGDC FALK WNAQ  GASA+LVADD+EE LITMD+PEED 
Sbjct  83   FGISFQSKPGALPTFVLVDRGDCFFALKVWNAQKVGASAVLVADDMEEALITMDTPEEDV  142

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            SS+ Y+ENITIPSALIEKSFGE LKK++ +G+MV+VNLDWREAVPHPDDRVEYELWT SN
Sbjct  143  SSAKYIENITIPSALIEKSFGETLKKSLSNGDMVNVNLDWREAVPHPDDRVEYELWTTSN  202

Query  617  DECGYKCDMLMK  652
            DECG KCDMLM+
Sbjct  203  DECGVKCDMLME  214



>gb|KJB12294.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=604

 Score =   288 bits (738),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            +   RFVVEKN+L V SP+ IKGT+DSA+GNFGIPQYGGSM G VVYPK+N+K CK F  
Sbjct  22   NCCARFVVEKNSLTVTSPEKIKGTHDSAIGNFGIPQYGGSMAGVVVYPKENQKACKSFGD  81

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            FG SF SK GSLPTFV+VDRGDC FALK WN Q AGASA+LVADD+EE LITMD+PEED 
Sbjct  82   FGISFKSKPGSLPTFVLVDRGDCFFALKVWNVQQAGASAVLVADDIEEALITMDNPEEDS  141

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            SS+ Y+ENITIPSALIEK+FGE LKKA+  G+MV+VNLDWREAVPHPDDRVEYELWTNSN
Sbjct  142  SSAKYIENITIPSALIEKTFGETLKKAISGGDMVNVNLDWREAVPHPDDRVEYELWTNSN  201

Query  617  DECGYKCDMLM  649
            DECG KCDMLM
Sbjct  202  DECGVKCDMLM  212



>ref|XP_007042633.1| Vaculolar sorting receptor 3 isoform 1 [Theobroma cacao]
 gb|EOX98464.1| Vaculolar sorting receptor 3 isoform 1 [Theobroma cacao]
Length=626

 Score =   289 bits (739),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 169/188 (90%), Gaps = 0/188 (0%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            RFVVEKN+L V SP+ IKGT+DSA+GNFGIPQYGGSM G V+YPK+NRKGCKGFD FG S
Sbjct  23   RFVVEKNSLMVTSPEKIKGTHDSAIGNFGIPQYGGSMAGAVIYPKENRKGCKGFDEFGIS  82

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
            F SK G+LPTFV++DRGDC FALK WNAQ AGASA+LVADD+EE LITMD+PEED SS+ 
Sbjct  83   FQSKPGALPTFVLLDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEEDTSSAK  142

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            Y+ENITIPSALIEK+FGE LKKA+  GEMV+VNLDWREAVPHPDDRVEYELWTNSNDECG
Sbjct  143  YLENITIPSALIEKTFGETLKKAISGGEMVNVNLDWREAVPHPDDRVEYELWTNSNDECG  202

Query  629  YKCDMLMK  652
             KCDMLM+
Sbjct  203  VKCDMLME  210



>ref|XP_011092498.1| PREDICTED: vacuolar-sorting receptor 3-like [Sesamum indicum]
Length=630

 Score =   288 bits (738),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = +2

Query  74   ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfd  253
            ++  GRFVVEKN+L+V SP+SIKGT+DSA+GNFGIPQYGGSM G VVYPKDNRKGCK FD
Sbjct  22   QAVVGRFVVEKNSLRVTSPESIKGTHDSAIGNFGIPQYGGSMAGIVVYPKDNRKGCKNFD  81

Query  254  gfgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  433
             FG SF +KAG++P FV+VDRGDC FALK WNAQNAGA+A+LVADD++E LITMDSPEED
Sbjct  82   DFGISFKAKAGAMPNFVLVDRGDCFFALKVWNAQNAGAAAVLVADDLDEPLITMDSPEED  141

Query  434  GSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNS  613
             +S+ Y+ NITIPSAL++K+FGEKLK+A+  G+MV+VNLDWREAVPHPDDRVEYELW+NS
Sbjct  142  AASAKYIVNITIPSALVDKNFGEKLKQAISGGDMVNVNLDWREAVPHPDDRVEYELWSNS  201

Query  614  NDECGYKCDMLMK  652
            NDECG KCDMLM+
Sbjct  202  NDECGVKCDMLME  214



>ref|XP_003536576.1| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine 
max]
Length=631

 Score =   288 bits (737),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 147/188 (78%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            +FVVEKN+L V SPD IKGT+DSA+GNFGIPQYGGSM G V+YPKDN+KGCK FD +G S
Sbjct  27   KFVVEKNSLTVTSPDDIKGTHDSAIGNFGIPQYGGSMAGNVLYPKDNKKGCKEFDEYGIS  86

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
            F SK G+LPT V++DRG+C FALK WNAQ AGASA+LV+DD+EE+LITMD+PEEDGSS+ 
Sbjct  87   FKSKPGALPTIVLLDRGNCFFALKVWNAQKAGASAVLVSDDIEEKLITMDTPEEDGSSAK  146

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            Y+ENITIPSALIEKSFGEKLK A+ +G+MV+VNLDWREAVPHPDDRVEYELWTNSNDECG
Sbjct  147  YIENITIPSALIEKSFGEKLKVAISNGDMVNVNLDWREAVPHPDDRVEYELWTNSNDECG  206

Query  629  YKCDMLMK  652
             KCDMLM+
Sbjct  207  VKCDMLME  214



>gb|KJB12291.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=624

 Score =   288 bits (737),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            +   RFVVEKN+L V SP+ IKGT+DSA+GNFGIPQYGGSM G VVYPK+N+K CK F  
Sbjct  22   NCCARFVVEKNSLTVTSPEKIKGTHDSAIGNFGIPQYGGSMAGVVVYPKENQKACKSFGD  81

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            FG SF SK GSLPTFV+VDRGDC FALK WN Q AGASA+LVADD+EE LITMD+PEED 
Sbjct  82   FGISFKSKPGSLPTFVLVDRGDCFFALKVWNVQQAGASAVLVADDIEEALITMDNPEEDS  141

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            SS+ Y+ENITIPSALIEK+FGE LKKA+  G+MV+VNLDWREAVPHPDDRVEYELWTNSN
Sbjct  142  SSAKYIENITIPSALIEKTFGETLKKAISGGDMVNVNLDWREAVPHPDDRVEYELWTNSN  201

Query  617  DECGYKCDMLM  649
            DECG KCDMLM
Sbjct  202  DECGVKCDMLM  212



>gb|KJB12292.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
 gb|KJB12293.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=629

 Score =   288 bits (737),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            +   RFVVEKN+L V SP+ IKGT+DSA+GNFGIPQYGGSM G VVYPK+N+K CK F  
Sbjct  22   NCCARFVVEKNSLTVTSPEKIKGTHDSAIGNFGIPQYGGSMAGVVVYPKENQKACKSFGD  81

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            FG SF SK GSLPTFV+VDRGDC FALK WN Q AGASA+LVADD+EE LITMD+PEED 
Sbjct  82   FGISFKSKPGSLPTFVLVDRGDCFFALKVWNVQQAGASAVLVADDIEEALITMDNPEEDS  141

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            SS+ Y+ENITIPSALIEK+FGE LKKA+  G+MV+VNLDWREAVPHPDDRVEYELWTNSN
Sbjct  142  SSAKYIENITIPSALIEKTFGETLKKAISGGDMVNVNLDWREAVPHPDDRVEYELWTNSN  201

Query  617  DECGYKCDMLM  649
            DECG KCDMLM
Sbjct  202  DECGVKCDMLM  212



>ref|XP_010467255.1| PREDICTED: vacuolar-sorting receptor 4-like [Camelina sativa]
Length=626

 Score =   287 bits (735),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F  
Sbjct  22   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  81

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            S+ S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  82   SYKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  141

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
             Y+ENITIPSAL+ KSFGEKLKKA+  G+MV++NLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  142  KYIENITIPSALVTKSFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDEC  201

Query  626  GYKCDMLMK  652
            G KCDMLM+
Sbjct  202  GVKCDMLME  210



>gb|KDO57886.1| hypothetical protein CISIN_1g006786mg [Citrus sinensis]
Length=560

 Score =   285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 166/192 (86%), Gaps = 0/192 (0%)
 Frame = +2

Query  74   ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfd  253
             ++  RFVVEKN+L V SP+ IKG++DSA+GNFGIPQYGGSM G V YPK+NRKGC+ F 
Sbjct  23   HTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFG  82

Query  254  gfgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  433
             FG SF +K G+LP FV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMD+PEED
Sbjct  83   DFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEED  142

Query  434  GSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNS  613
             SS+ Y+ENITIPSALI+KSFGE LKKA+  GEMV+VNLDWREAVPHPDDRVEYELWTNS
Sbjct  143  ISSAKYIENITIPSALIDKSFGETLKKALSGGEMVNVNLDWREAVPHPDDRVEYELWTNS  202

Query  614  NDECGYKCDMLM  649
            NDECG KCDMLM
Sbjct  203  NDECGVKCDMLM  214



>ref|XP_006409641.1| hypothetical protein EUTSA_v10022594mg [Eutrema salsugineum]
 gb|ESQ51094.1| hypothetical protein EUTSA_v10022594mg [Eutrema salsugineum]
Length=631

 Score =   287 bits (735),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 145/192 (76%), Positives = 166/192 (86%), Gaps = 0/192 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
                RFVVEKN+L V SPDSIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  
Sbjct  24   CCKARFVVEKNSLSVTSPDSIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSD  83

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  SF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED 
Sbjct  84   FSISFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDV  143

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            SS+ Y+ENITIPSAL+ K FGEKLKKA+  G+MV++NLDWREAVPHPDDRVEYELWTNSN
Sbjct  144  SSAKYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSN  203

Query  617  DECGYKCDMLMK  652
            DECG KCDMLM+
Sbjct  204  DECGVKCDMLME  215



>ref|XP_011457866.1| PREDICTED: vacuolar-sorting receptor 3 [Fragaria vesca subsp. 
vesca]
Length=630

 Score =   287 bits (734),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 168/191 (88%), Gaps = 0/191 (0%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
            +  RFVVEKN+L+V SPD IKG YDSA+GNFG+PQYGGSM+G V+YPK+N+KGCK F  F
Sbjct  23   STARFVVEKNSLRVTSPDKIKGKYDSAIGNFGLPQYGGSMSGAVIYPKENQKGCKEFSDF  82

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
            G S+ S  G+LPTF++VDRGDC FALK WNAQ AGASA+LVADD+EE LITMD+PEED S
Sbjct  83   GLSYKSTPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEEDIS  142

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
            ++ Y+ENITIPSALIEKSFG+ LKK++  G+MV+VNLDWRE+VPHPDDRVEYELWTNSND
Sbjct  143  TAKYIENITIPSALIEKSFGQTLKKSISSGDMVNVNLDWRESVPHPDDRVEYELWTNSND  202

Query  620  ECGYKCDMLMK  652
            ECG KCDMLM+
Sbjct  203  ECGVKCDMLME  213



>ref|XP_010687358.1| PREDICTED: vacuolar-sorting receptor 4-like [Beta vulgaris subsp. 
vulgaris]
Length=633

 Score =   287 bits (734),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 163/191 (85%), Gaps = 0/191 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S   RFVVEKN+L+V SPD +KGTYD+A+GNFGIPQYGGSM GTV+YPKDN+KGCK F  
Sbjct  28   SIESRFVVEKNSLRVTSPDDVKGTYDTAIGNFGIPQYGGSMAGTVIYPKDNKKGCKDFSD  87

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  SF  K G LPTFV++DRGDC FALK WNAQ AGA+A+LVADDV+E LITMD+PEED 
Sbjct  88   FSISFKKKPGQLPTFVLLDRGDCFFALKVWNAQEAGAAAVLVADDVDEALITMDTPEEDT  147

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
             SS Y+ENITIPSALIEKSFGE LKKA   G+MV+VNLDWREAVPHPDDRVEYELWT SN
Sbjct  148  VSSKYIENITIPSALIEKSFGESLKKAFNKGDMVNVNLDWREAVPHPDDRVEYELWTTSN  207

Query  617  DECGYKCDMLM  649
            DECG KC+MLM
Sbjct  208  DECGVKCEMLM  218



>ref|XP_006409638.1| hypothetical protein EUTSA_v10022598mg [Eutrema salsugineum]
 gb|ESQ51091.1| hypothetical protein EUTSA_v10022598mg [Eutrema salsugineum]
Length=626

 Score =   286 bits (733),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 145/192 (76%), Positives = 167/192 (87%), Gaps = 0/192 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S   RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  
Sbjct  19   SCEARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSD  78

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  SF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED 
Sbjct  79   FSISFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDV  138

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            SS+ Y+ENITIPSAL+ K FGEKLKKA+  G+MV++NLDWREAVPHPDDRVEYELWTNSN
Sbjct  139  SSAKYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSN  198

Query  617  DECGYKCDMLMK  652
            DECG KCDMLM+
Sbjct  199  DECGVKCDMLME  210



>ref|XP_010517675.1| PREDICTED: vacuolar-sorting receptor 4-like [Camelina sativa]
Length=626

 Score =   286 bits (732),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F  
Sbjct  22   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  81

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            S+ S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  82   SYKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  141

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
             Y+ENITIPSAL+ KSFGEKLKKA   G+MV++NLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  142  KYIENITIPSALVTKSFGEKLKKATSGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDEC  201

Query  626  GYKCDMLMK  652
            G KCDMLM+
Sbjct  202  GVKCDMLME  210



>ref|XP_007143116.1| hypothetical protein PHAVU_007G045100g [Phaseolus vulgaris]
 gb|ESW15110.1| hypothetical protein PHAVU_007G045100g [Phaseolus vulgaris]
Length=630

 Score =   286 bits (732),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 147/188 (78%), Positives = 169/188 (90%), Gaps = 0/188 (0%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            +FVVEKN+L V SPD+IKGT+DSA+GNFGIPQYGGSM G VVYPK+N+KGCK FD  G S
Sbjct  26   KFVVEKNSLTVTSPDNIKGTHDSAIGNFGIPQYGGSMAGNVVYPKENQKGCKEFDDSGIS  85

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
            F SK G+LPT V++DRG+C FALK WNAQ AGASA+LVADD+EE+LITMD+PEEDGSS+ 
Sbjct  86   FKSKPGALPTVVLLDRGNCFFALKVWNAQKAGASAVLVADDIEEKLITMDTPEEDGSSAK  145

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            Y+ENITIPSALIEKSFG KLK A+ +G+MV+VNLDWREAVPHPDDRVEYELWTNSNDECG
Sbjct  146  YIENITIPSALIEKSFGGKLKDAISNGDMVNVNLDWREAVPHPDDRVEYELWTNSNDECG  205

Query  629  YKCDMLMK  652
             KCDMLM+
Sbjct  206  VKCDMLME  213



>ref|XP_007157213.1| hypothetical protein PHAVU_002G052000g [Phaseolus vulgaris]
 gb|ESW29207.1| hypothetical protein PHAVU_002G052000g [Phaseolus vulgaris]
Length=626

 Score =   286 bits (731),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 167/192 (87%), Gaps = 0/192 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKN+L+V SP+ I+GT+DSA+GNFGIPQYGGSM G VVYPKDN+KGCK F+ 
Sbjct  19   SIMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGNVVYPKDNKKGCKEFED  78

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
             G SF S  G+LPTFV++DRG C FALK WNAQ AGASA+LVADDVEE LITMD+PEEDG
Sbjct  79   SGISFKSTPGALPTFVLLDRGSCFFALKVWNAQKAGASAVLVADDVEEPLITMDTPEEDG  138

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            SS+ YV NITIPSAL+ KSFGEKLK A+  G+MV+VNLDWRE+VPHPDDRVEYELW+NSN
Sbjct  139  SSAKYVANITIPSALVGKSFGEKLKDAISGGDMVNVNLDWRESVPHPDDRVEYELWSNSN  198

Query  617  DECGYKCDMLMK  652
            DECG KCDMLM+
Sbjct  199  DECGVKCDMLME  210



>ref|XP_010488908.1| PREDICTED: vacuolar-sorting receptor 4 [Camelina sativa]
Length=626

 Score =   286 bits (731),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F  
Sbjct  22   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  81

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            SF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  82   SFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  141

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
             Y+ENITIPSAL+ K FGEKLKKA+  G+MV++NLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  142  KYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDEC  201

Query  626  GYKCDMLMK  652
            G KCDMLM+
Sbjct  202  GVKCDMLME  210



>gb|KHN06808.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=631

 Score =   286 bits (731),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 146/188 (78%), Positives = 169/188 (90%), Gaps = 0/188 (0%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            +FVVEKN+L V SPD IKGT+DSA+GNFGIPQYGGSM G V+YPKDN+KGCK FD +G S
Sbjct  27   KFVVEKNSLTVTSPDDIKGTHDSAIGNFGIPQYGGSMAGNVLYPKDNKKGCKEFDEYGIS  86

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
            F SK G+LPT V++DRG+C FALK WNAQ AGASA+LV+DD+EE+LITMD+PEEDGSS+ 
Sbjct  87   FKSKPGALPTIVLLDRGNCFFALKVWNAQKAGASAVLVSDDIEEKLITMDTPEEDGSSAK  146

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            Y+ENITIPSALIEKSFGEKLK A+ +G+MV+VNLDWREAVPHPDDRVEYELWTNSNDECG
Sbjct  147  YIENITIPSALIEKSFGEKLKVAISNGDMVNVNLDWREAVPHPDDRVEYELWTNSNDECG  206

Query  629  YKCDMLMK  652
             KCD LM+
Sbjct  207  VKCDTLME  214



>gb|KFK39977.1| hypothetical protein AALP_AA3G313900 [Arabis alpina]
Length=626

 Score =   286 bits (731),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F  
Sbjct  23   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  82

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            SF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  83   SFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  142

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
             Y+ENITIPSAL+ K FGEKLKKA+  G+MV++NLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  143  KYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDEC  202

Query  626  GYKCDMLMK  652
            G KCDMLM+
Sbjct  203  GVKCDMLME  211



>ref|XP_006300216.1| hypothetical protein CARUB_v10016452mg [Capsella rubella]
 gb|EOA33114.1| hypothetical protein CARUB_v10016452mg [Capsella rubella]
Length=629

 Score =   286 bits (731),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F  
Sbjct  25   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  84

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            SF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  85   SFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  144

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
             Y+ENITIPSAL+ K FGEKLKKA+  G+MV++NLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  145  KYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDEC  204

Query  626  GYKCDMLMK  652
            G KCDMLM+
Sbjct  205  GVKCDMLME  213



>ref|XP_002885935.1| VSR-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62194.1| VSR-2 [Arabidopsis lyrata subsp. lyrata]
Length=627

 Score =   285 bits (730),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F  
Sbjct  23   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  82

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            SF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  83   SFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  142

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
             Y+ENITIPSAL+ K FGEKLKKA+  G+MV++NLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  143  KYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDEC  202

Query  626  GYKCDMLMK  652
            G KCDMLM+
Sbjct  203  GVKCDMLME  211



>ref|NP_179081.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
 ref|NP_849955.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
 sp|O80977.1|VSR3_ARATH RecName: Full=Vacuolar-sorting receptor 3; Short=AtVSR3; AltName: 
Full=BP80-like protein a'; Short=AtBP80a'; AltName: Full=Epidermal 
growth factor receptor-like protein 2a; Short=AtELP2a; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC24183.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAM15053.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AEC06328.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
 gb|AEC06329.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
Length=628

 Score =   285 bits (730),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F  
Sbjct  24   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  83

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            SF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  84   SFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  143

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
             Y+ENITIPSAL+ K FGEKLKKA+  G+MV++NLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  144  KYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDEC  203

Query  626  GYKCDMLMK  652
            G KCDMLM+
Sbjct  204  GVKCDMLME  212



>ref|NP_179079.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
 ref|NP_849954.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
 sp|Q56ZQ3.2|VSR4_ARATH RecName: Full=Vacuolar-sorting receptor 4; Short=AtVSR4; AltName: 
Full=BP80-like protein a; Short=AtBP80a; AltName: Full=Epidermal 
growth factor receptor-like protein 2b; Short=AtELP2b; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC24185.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAL32822.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAM15052.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAP37749.1| At2g14720 [Arabidopsis thaliana]
 gb|AEC06326.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
 gb|AEC06327.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
Length=628

 Score =   285 bits (730),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F  
Sbjct  24   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  83

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            SF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  84   SFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  143

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
             Y+ENITIPSAL+ K FGEKLKKA+  G+MV++NLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  144  KYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDEC  203

Query  626  GYKCDMLMK  652
            G KCDMLM+
Sbjct  204  GVKCDMLME  212



>ref|XP_002883854.1| hypothetical protein ARALYDRAFT_899691 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60113.1| hypothetical protein ARALYDRAFT_899691 [Arabidopsis lyrata subsp. 
lyrata]
Length=627

 Score =   285 bits (730),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F  
Sbjct  23   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  82

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            SF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  83   SFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  142

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
             Y+ENITIPSAL+ K FGEKLKKA+  G+MV++NLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  143  KYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDEC  202

Query  626  GYKCDMLMK  652
            G KCDMLM+
Sbjct  203  GVKCDMLME  211



>ref|XP_010547949.1| PREDICTED: vacuolar-sorting receptor 3-like [Tarenaya hassleriana]
Length=635

 Score =   285 bits (730),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
             RFVVEKN+L V SP+SIKGT+DSA+GNFG+PQYGGSM GTVVYPK+N+K CK F  F  
Sbjct  31   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGVPQYGGSMAGTVVYPKENQKACKEFSDFSI  90

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            SF S+ G+LPTF+++DRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  91   SFKSQPGALPTFLLLDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  150

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
             Y+ENITIPSAL+ KSFGEK+KKA+  G+MV+VNLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  151  KYIENITIPSALVTKSFGEKMKKAISRGDMVNVNLDWREAVPHPDDRVEYELWTNSNDEC  210

Query  626  GYKCDMLMK  652
            G KCDM+M+
Sbjct  211  GVKCDMMMQ  219



>gb|KDO57884.1| hypothetical protein CISIN_1g006786mg [Citrus sinensis]
Length=629

 Score =   285 bits (729),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 166/192 (86%), Gaps = 0/192 (0%)
 Frame = +2

Query  74   ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfd  253
             ++  RFVVEKN+L V SP+ IKG++DSA+GNFGIPQYGGSM G V YPK+NRKGC+ F 
Sbjct  23   HTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFG  82

Query  254  gfgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  433
             FG SF +K G+LP FV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMD+PEED
Sbjct  83   DFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEED  142

Query  434  GSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNS  613
             SS+ Y+ENITIPSALI+KSFGE LKKA+  GEMV+VNLDWREAVPHPDDRVEYELWTNS
Sbjct  143  ISSAKYIENITIPSALIDKSFGETLKKALSGGEMVNVNLDWREAVPHPDDRVEYELWTNS  202

Query  614  NDECGYKCDMLM  649
            NDECG KCDMLM
Sbjct  203  NDECGVKCDMLM  214



>ref|XP_006422827.1| hypothetical protein CICLE_v10028015mg [Citrus clementina]
 gb|ESR36067.1| hypothetical protein CICLE_v10028015mg [Citrus clementina]
Length=631

 Score =   285 bits (729),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 166/192 (86%), Gaps = 0/192 (0%)
 Frame = +2

Query  74   ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfd  253
             ++  RFVVEKN+L V SP+ IKG++DSA+GNFGIPQYGGSM G V YPK+NRKGC+ F 
Sbjct  23   HTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFG  82

Query  254  gfgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  433
             FG SF +K G+LP FV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMD+PEED
Sbjct  83   DFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEED  142

Query  434  GSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNS  613
             SS+ Y+ENITIPSALI+KSFGE LKKA+  GEMV+VNLDWREAVPHPDDRVEYELWTNS
Sbjct  143  ISSAKYIENITIPSALIDKSFGETLKKALSGGEMVNVNLDWREAVPHPDDRVEYELWTNS  202

Query  614  NDECGYKCDMLM  649
            NDECG KCDMLM
Sbjct  203  NDECGVKCDMLM  214



>gb|KDO57885.1| hypothetical protein CISIN_1g006786mg [Citrus sinensis]
Length=631

 Score =   285 bits (729),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 166/192 (86%), Gaps = 0/192 (0%)
 Frame = +2

Query  74   ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfd  253
             ++  RFVVEKN+L V SP+ IKG++DSA+GNFGIPQYGGSM G V YPK+NRKGC+ F 
Sbjct  23   HTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFG  82

Query  254  gfgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  433
             FG SF +K G+LP FV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMD+PEED
Sbjct  83   DFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEED  142

Query  434  GSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNS  613
             SS+ Y+ENITIPSALI+KSFGE LKKA+  GEMV+VNLDWREAVPHPDDRVEYELWTNS
Sbjct  143  ISSAKYIENITIPSALIDKSFGETLKKALSGGEMVNVNLDWREAVPHPDDRVEYELWTNS  202

Query  614  NDECGYKCDMLM  649
            NDECG KCDMLM
Sbjct  203  NDECGVKCDMLM  214



>ref|XP_010547948.1| PREDICTED: vacuolar-sorting receptor 3 [Tarenaya hassleriana]
Length=635

 Score =   285 bits (729),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
             RFVVEKN+L V SP+SIKGT+DSA+GNFG+PQYGGSM GTVVYPK+N K CK F  F  
Sbjct  31   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGVPQYGGSMAGTVVYPKENHKACKEFSDFSI  90

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            SF S+ G+LPTF+++DRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  91   SFKSQPGALPTFLLLDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  150

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
             Y+ENITIPSAL+ KSFGEK+KKA+  G+MV+VNLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  151  KYIENITIPSALVTKSFGEKMKKAISGGDMVNVNLDWREAVPHPDDRVEYELWTNSNDEC  210

Query  626  GYKCDMLMK  652
            G KCDM+M+
Sbjct  211  GVKCDMMMQ  219



>ref|XP_010488909.1| PREDICTED: vacuolar-sorting receptor 3 [Camelina sativa]
Length=626

 Score =   285 bits (728),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F  
Sbjct  22   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  81

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            SF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED +S+
Sbjct  82   SFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVASA  141

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
             Y+ENITIPSAL+ K FGEKLKKA+  G+MV++NLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  142  KYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDEC  201

Query  626  GYKCDMLMK  652
            G KCDMLM+
Sbjct  202  GVKCDMLME  210



>gb|KHN42313.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=631

 Score =   284 bits (726),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 146/188 (78%), Positives = 169/188 (90%), Gaps = 0/188 (0%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            +FVVEKN+L V SPD+IKGT+DSA+GNFGIPQYGGSM G V+YPKDN+KGCK FD +G S
Sbjct  27   KFVVEKNSLTVTSPDNIKGTHDSAIGNFGIPQYGGSMAGNVLYPKDNKKGCKEFDEYGIS  86

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
            F SK G+LPT V++DRG+C FALK WNAQ AGASA+LVADD+ E+LITMD+PEED SS+ 
Sbjct  87   FKSKPGALPTIVLLDRGNCFFALKVWNAQKAGASAVLVADDIVEKLITMDTPEEDVSSAK  146

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            Y+ENITIPSALIEKSFGEKLK A+ +G+MV+VNLDWREAVPHPDDRVEYELWTNSNDECG
Sbjct  147  YIENITIPSALIEKSFGEKLKDAISNGDMVNVNLDWREAVPHPDDRVEYELWTNSNDECG  206

Query  629  YKCDMLMK  652
             KCDMLM+
Sbjct  207  VKCDMLME  214



>ref|XP_003555992.1| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine 
max]
Length=631

 Score =   284 bits (726),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 146/188 (78%), Positives = 169/188 (90%), Gaps = 0/188 (0%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            +FVVEKN+L V SPD+IKGT+DSA+GNFGIPQYGGSM G V+YPKDN+KGCK FD +G S
Sbjct  27   KFVVEKNSLTVTSPDNIKGTHDSAIGNFGIPQYGGSMAGNVLYPKDNKKGCKEFDEYGIS  86

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
            F SK G+LPT V++DRG+C FALK WNAQ AGASA+LVADD+ E+LITMD+PEED SS+ 
Sbjct  87   FKSKPGALPTIVLLDRGNCFFALKVWNAQKAGASAVLVADDIVEKLITMDTPEEDVSSAK  146

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            Y+ENITIPSALIEKSFGEKLK A+ +G+MV+VNLDWREAVPHPDDRVEYELWTNSNDECG
Sbjct  147  YIENITIPSALIEKSFGEKLKDAISNGDMVNVNLDWREAVPHPDDRVEYELWTNSNDECG  206

Query  629  YKCDMLMK  652
             KCDMLM+
Sbjct  207  VKCDMLME  214



>gb|EPS57970.1| hypothetical protein M569_16845, partial [Genlisea aurea]
Length=598

 Score =   283 bits (724),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 2/189 (1%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
            GRFVVEKN+L+V SP+SIKGT+DSA+GNFGIPQYGGSM GTV+YPKD+ +         F
Sbjct  1    GRFVVEKNSLRVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVLYPKDDNRKGCKTFDASF  60

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
              ++ A  LP F++VDRGDC FALK WNAQNAGA+A+LVADDV E LITMD+PEEDGSS 
Sbjct  61   KANAGA--LPNFLLVDRGDCFFALKVWNAQNAGAAAVLVADDVSEALITMDTPEEDGSSL  118

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
            +Y+ NITIPSAL+ KSFGEKLKKAV  G+MV ++LDWRE+VPHPDDRVEYELWTNSNDEC
Sbjct  119  SYIANITIPSALVTKSFGEKLKKAVSSGDMVSLSLDWRESVPHPDDRVEYELWTNSNDEC  178

Query  626  GYKCDMLMK  652
            G KCDMLM+
Sbjct  179  GVKCDMLME  187



>ref|XP_006486921.1| PREDICTED: vacuolar-sorting receptor 3-like [Citrus sinensis]
Length=631

 Score =   284 bits (726),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 145/192 (76%), Positives = 166/192 (86%), Gaps = 0/192 (0%)
 Frame = +2

Query  74   ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfd  253
             ++  RFVVEKN+L V SP+ IKG++DSA+GNFGIPQYGGSM G V YPK+NRKGC+ F 
Sbjct  23   HTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFG  82

Query  254  gfgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  433
             FG SF +K G+LP FV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMD+PEED
Sbjct  83   DFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEED  142

Query  434  GSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNS  613
             SS+ Y+ENITIPSALI+KSFGE LKK++  GEMV+VNLDWREAVPHPDDRVEYELWTNS
Sbjct  143  ISSAKYIENITIPSALIDKSFGETLKKSLSGGEMVNVNLDWREAVPHPDDRVEYELWTNS  202

Query  614  NDECGYKCDMLM  649
            NDECG KCDMLM
Sbjct  203  NDECGVKCDMLM  214



>gb|KFK39979.1| hypothetical protein AALP_AA3G314200 [Arabis alpina]
Length=627

 Score =   283 bits (725),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F  
Sbjct  23   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  82

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            SF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  83   SFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  142

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
             Y+ENITIPSAL+ K FGEKLKKA+  G+MV++NLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  143  KYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDEC  202

Query  626  GYKCDMLMK  652
            G KC+MLM+
Sbjct  203  GVKCNMLME  211



>gb|KJB32253.1| hypothetical protein B456_005G231800 [Gossypium raimondii]
Length=559

 Score =   281 bits (720),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
             RFVVEKN+L++ SP+ IKGTYDSA+GNFGIPQYGGSM G VVYPK+N+KGCK FD FG 
Sbjct  26   ARFVVEKNSLRLTSPEKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKENQKGCKSFDDFGI  85

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            SF SK G+LP FV+VDRGDC FALK WN Q AGASA+LVADD++E LITMD+PEED  ++
Sbjct  86   SFKSKPGALPAFVLVDRGDCFFALKVWNVQQAGASAVLVADDIQEALITMDTPEEDRLAA  145

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
             Y+ENITIPSALIEK FGE LKKA+  G+MV+VNLDWRE+VPHPDDRVEYELWTNSNDEC
Sbjct  146  KYIENITIPSALIEKKFGETLKKAISGGDMVNVNLDWRESVPHPDDRVEYELWTNSNDEC  205

Query  626  GYKCDMLMK  652
            G KCDMLM+
Sbjct  206  GVKCDMLME  214



>emb|CDY37219.1| BnaA09g08400D [Brassica napus]
Length=624

 Score =   283 bits (724),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 164/188 (87%), Gaps = 0/188 (0%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            RFVVEKN+L V SPDSIKG +D A+GNFGIPQYGGSM GTVVYPK+N+K CK F  F  S
Sbjct  21   RFVVEKNSLSVTSPDSIKGAHDCAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSIS  80

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
            F S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED +S+ 
Sbjct  81   FKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDAASAK  140

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            Y+ENITIPSAL+ KSFGEKLKKA+  G+MV++NLDWREAVPHPD RVEYELWTNSNDECG
Sbjct  141  YIENITIPSALVTKSFGEKLKKAISGGDMVNLNLDWREAVPHPDARVEYELWTNSNDECG  200

Query  629  YKCDMLMK  652
             KCDMLM+
Sbjct  201  VKCDMLME  208



>ref|XP_009136249.1| PREDICTED: vacuolar-sorting receptor 3 [Brassica rapa]
Length=631

 Score =   283 bits (724),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTV+YPK+N+K CK F  F  
Sbjct  27   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVIYPKENQKSCKEFSDFSI  86

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            SF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  87   SFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  146

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
             Y+ENITIPSAL+ K+FGEKLKKA+  G+MV++NLDWREAVPHPD RVEYELWTNSNDEC
Sbjct  147  KYIENITIPSALVTKTFGEKLKKAISGGDMVNLNLDWREAVPHPDARVEYELWTNSNDEC  206

Query  626  GYKCDMLMK  652
            G KCDMLM+
Sbjct  207  GVKCDMLME  215



>ref|XP_010517715.1| PREDICTED: vacuolar-sorting receptor 3-like isoform X2 [Camelina 
sativa]
Length=626

 Score =   283 bits (724),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
             RFVVEKN+L V SP++IKGT+DSA+GNFGIPQYGGSM GTVVYP++N K CK F  F  
Sbjct  22   ARFVVEKNSLSVTSPETIKGTHDSAIGNFGIPQYGGSMAGTVVYPRENHKSCKEFSDFSI  81

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            SF S+ G+LP F++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  82   SFKSQPGALPIFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  141

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
             Y+ENITIPSAL+ KSFGEKLKKA+  G+MV++NLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  142  KYIENITIPSALVTKSFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDEC  201

Query  626  GYKCDMLMK  652
            G KCDMLM+
Sbjct  202  GVKCDMLME  210



>gb|KHN05603.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=628

 Score =   282 bits (722),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 167/192 (87%), Gaps = 0/192 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKN+L+V SP+ I+GT+DSA+GNFGIPQYGGSM G V+YPKDN+KGCK FD 
Sbjct  21   SIMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGNVLYPKDNKKGCKEFDD  80

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            FG SF S  G+LPT V++DRG C FALK WNAQ AGASA+LVADDVEE LITMD+PEEDG
Sbjct  81   FGISFKSSPGALPTIVLLDRGSCFFALKVWNAQKAGASAVLVADDVEEPLITMDTPEEDG  140

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            SS+ YVENITIPSAL+ KSF +KLK A+  G+MV+VNLDWREAVPHPDDRVEYELWTNSN
Sbjct  141  SSAKYVENITIPSALVGKSFAQKLKDAIIVGDMVNVNLDWREAVPHPDDRVEYELWTNSN  200

Query  617  DECGYKCDMLMK  652
            DECG KCDMLM+
Sbjct  201  DECGLKCDMLMQ  212



>ref|XP_003538018.1| PREDICTED: vacuolar-sorting receptor 1-like [Glycine max]
Length=628

 Score =   282 bits (722),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 167/192 (87%), Gaps = 0/192 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKN+L+V SP+ I+GT+DSA+GNFGIPQYGGSM G V+YPKDN+KGCK FD 
Sbjct  21   SIMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGNVLYPKDNKKGCKEFDD  80

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            FG SF S  G+LPT V++DRG C FALK WNAQ AGASA+LVADDVEE LITMD+PEEDG
Sbjct  81   FGISFKSSPGALPTIVLLDRGSCFFALKVWNAQKAGASAVLVADDVEEPLITMDTPEEDG  140

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            SS+ YVENITIPSAL+ KSF +KLK A+  G+MV+VNLDWREAVPHPDDRVEYELWTNSN
Sbjct  141  SSAKYVENITIPSALVGKSFAQKLKDAIIVGDMVNVNLDWREAVPHPDDRVEYELWTNSN  200

Query  617  DECGYKCDMLMK  652
            DECG KCDMLM+
Sbjct  201  DECGLKCDMLMQ  212



>ref|XP_006297095.1| hypothetical protein CARUB_v10013097mg, partial [Capsella rubella]
 gb|EOA29993.1| hypothetical protein CARUB_v10013097mg, partial [Capsella rubella]
Length=698

 Score =   284 bits (726),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F  
Sbjct  94   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  153

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            SF S+ G+LP F++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  154  SFKSQPGALPIFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  213

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
             Y+ENITIPSAL+ K FGEKLKKA+  G+MV++NLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  214  KYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDEC  273

Query  626  GYKCDMLMK  652
            G KCDMLM+
Sbjct  274  GVKCDMLME  282



>ref|XP_010467256.1| PREDICTED: vacuolar-sorting receptor 3-like [Camelina sativa]
Length=629

 Score =   282 bits (721),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N K CK F  F  
Sbjct  25   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENHKSCKEFSDFSI  84

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            SF S+ G+LP F++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED +S+
Sbjct  85   SFKSQPGALPIFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVASA  144

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
             Y+ENITIPSAL+ K FGEKLKKA+  G+MV++NLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  145  KYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDEC  204

Query  626  GYKCDMLMK  652
            G KCDMLM+
Sbjct  205  GVKCDMLME  213



>ref|XP_004511312.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Cicer 
arietinum]
Length=623

 Score =   281 bits (720),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 161/191 (84%), Gaps = 3/191 (2%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
            +  RFVVEKN+L V SPD IKG +DSA+GNFGIPQYGGSM GTVVYPKDN KGCK FD  
Sbjct  20   SMARFVVEKNSLSVTSPDKIKGRHDSAIGNFGIPQYGGSMAGTVVYPKDNNKGCKDFDQS  79

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
              S       LPT +++DRG+C FALK WNAQ AGASA+LVADD+EE LITMD+PEEDGS
Sbjct  80   FKSRPGA---LPTILLLDRGNCFFALKVWNAQKAGASAVLVADDIEEPLITMDTPEEDGS  136

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
            S+ Y+ENITIPSALIEKSFGEKLK A+  G+MV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  137  SAKYIENITIPSALIEKSFGEKLKDAISGGDMVNVNLDWREAVPHPDDRVEYELWTNSND  196

Query  620  ECGYKCDMLMK  652
            ECG KCDML++
Sbjct  197  ECGVKCDMLIE  207



>emb|CDY65441.1| BnaCnng47180D [Brassica napus]
Length=631

 Score =   281 bits (720),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTV+YPK+N+K CK F  F  
Sbjct  27   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVIYPKENQKSCKEFSDFSI  86

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            SF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  87   SFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDISSA  146

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
             YVENITIPSAL+ K FGEKLKK++  G+MV++NLDWREAVPHPD RVEYELWTNSNDEC
Sbjct  147  KYVENITIPSALVTKGFGEKLKKSISGGDMVNLNLDWREAVPHPDARVEYELWTNSNDEC  206

Query  626  GYKCDMLMK  652
            G KCDMLM+
Sbjct  207  GVKCDMLME  215



>gb|KHN30433.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=643

 Score =   281 bits (720),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 166/192 (86%), Gaps = 0/192 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKN+L+V SP+ I+GT+DSA+GNFGIPQYGGSM G V+YPKDN+KGCK FD 
Sbjct  36   STMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGNVIYPKDNKKGCKEFDE  95

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            FG SF S  G+LPT V++DRG C FALK WNAQ AGASA+LVADDVEE LITMD+PEEDG
Sbjct  96   FGISFKSTPGALPTIVLLDRGSCFFALKVWNAQKAGASAVLVADDVEEPLITMDTPEEDG  155

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            SS+ YVENITIPSAL+ KSFG KLK A   G+MV++NLDWRE+VPHPDDRVEYELWTNSN
Sbjct  156  SSAKYVENITIPSALVGKSFGLKLKDAFSGGDMVNLNLDWRESVPHPDDRVEYELWTNSN  215

Query  617  DECGYKCDMLMK  652
            DECG KCDMLM+
Sbjct  216  DECGVKCDMLME  227



>ref|XP_003517598.2| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine 
max]
Length=643

 Score =   281 bits (720),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 166/192 (86%), Gaps = 0/192 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKN+L+V SP+ I+GT+DSA+GNFGIPQYGGSM G V+YPKDN+KGCK FD 
Sbjct  36   STMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGNVIYPKDNKKGCKEFDE  95

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            FG SF S  G+LPT V++DRG C FALK WNAQ AGASA+LVADDVEE LITMD+PEEDG
Sbjct  96   FGISFKSTPGALPTIVLLDRGSCFFALKVWNAQKAGASAVLVADDVEEPLITMDTPEEDG  155

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            SS+ YVENITIPSAL+ KSFG KLK A   G+MV++NLDWRE+VPHPDDRVEYELWTNSN
Sbjct  156  SSAKYVENITIPSALVGKSFGLKLKDAFSGGDMVNLNLDWRESVPHPDDRVEYELWTNSN  215

Query  617  DECGYKCDMLMK  652
            DECG KCDMLM+
Sbjct  216  DECGVKCDMLME  227



>ref|XP_004173121.1| PREDICTED: vacuolar-sorting receptor 3-like, partial [Cucumis 
sativus]
Length=517

 Score =   278 bits (711),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 163/191 (85%), Gaps = 0/191 (0%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
              GRFVVEKN+L+V SP+ I+GTYDSA+GNFGIPQYGGS+ G VVYPK+N+KGCK F  F
Sbjct  23   CMGRFVVEKNSLRVTSPEKIRGTYDSAIGNFGIPQYGGSLAGVVVYPKENQKGCKDFGDF  82

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
              SF SK GSLP FV+VDRGDC FALK WNAQ  GASA+LVAD ++E LITMDSPEEDGS
Sbjct  83   HISFQSKPGSLPIFVMVDRGDCLFALKVWNAQKVGASAVLVADHLDEPLITMDSPEEDGS  142

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
            ++ YVENITIPSALI K F E+LKK +  GEMV ++LDWREAVPHPDDRVEYELWTNSND
Sbjct  143  TATYVENITIPSALIRKGFSEQLKKEINAGEMVSLSLDWREAVPHPDDRVEYELWTNSND  202

Query  620  ECGYKCDMLMK  652
            ECG+KCDMLM+
Sbjct  203  ECGFKCDMLME  213



>gb|KJB32254.1| hypothetical protein B456_005G231800 [Gossypium raimondii]
Length=600

 Score =   280 bits (717),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 144/188 (77%), Positives = 165/188 (88%), Gaps = 0/188 (0%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            RFVVEKN+L++ SP+ IKGTYDSA+GNFGIPQYGGSM G VVYPK+N+KGCK FD FG S
Sbjct  27   RFVVEKNSLRLTSPEKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKENQKGCKSFDDFGIS  86

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
            F SK G+LP FV+VDRGDC FALK WN Q AGASA+LVADD++E LITMD+PEED  ++ 
Sbjct  87   FKSKPGALPAFVLVDRGDCFFALKVWNVQQAGASAVLVADDIQEALITMDTPEEDRLAAK  146

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            Y+ENITIPSALIEK FGE LKKA+  G+MV+VNLDWRE+VPHPDDRVEYELWTNSNDECG
Sbjct  147  YIENITIPSALIEKKFGETLKKAISGGDMVNVNLDWRESVPHPDDRVEYELWTNSNDECG  206

Query  629  YKCDMLMK  652
             KCDMLM+
Sbjct  207  VKCDMLME  214



>ref|XP_004511311.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Cicer 
arietinum]
Length=654

 Score =   281 bits (720),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 161/191 (84%), Gaps = 3/191 (2%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
            +  RFVVEKN+L V SPD IKG +DSA+GNFGIPQYGGSM GTVVYPKDN KGCK FD  
Sbjct  20   SMARFVVEKNSLSVTSPDKIKGRHDSAIGNFGIPQYGGSMAGTVVYPKDNNKGCKDFDQS  79

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
              S       LPT +++DRG+C FALK WNAQ AGASA+LVADD+EE LITMD+PEEDGS
Sbjct  80   FKSRPGA---LPTILLLDRGNCFFALKVWNAQKAGASAVLVADDIEEPLITMDTPEEDGS  136

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
            S+ Y+ENITIPSALIEKSFGEKLK A+  G+MV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  137  SAKYIENITIPSALIEKSFGEKLKDAISGGDMVNVNLDWREAVPHPDDRVEYELWTNSND  196

Query  620  ECGYKCDMLMK  652
            ECG KCDML++
Sbjct  197  ECGVKCDMLIE  207



>emb|CDX81459.1| BnaC09g08700D [Brassica napus]
Length=624

 Score =   281 bits (718),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 163/188 (87%), Gaps = 0/188 (0%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            RFVVEKN+L V SPDSIKG +D A+GNFGIPQYGGSM GTVVYPK+N+K CK F  F  S
Sbjct  21   RFVVEKNSLSVTSPDSIKGAHDCAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSIS  80

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
            F S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED +S+ 
Sbjct  81   FKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDAASAK  140

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            Y+ENITIPSAL+ K FGEKLKKA+  G+MV++NLDWREAVPHPD RVEYELWTNSNDECG
Sbjct  141  YIENITIPSALVTKGFGEKLKKAIGGGDMVNLNLDWREAVPHPDARVEYELWTNSNDECG  200

Query  629  YKCDMLMK  652
             KCDMLM+
Sbjct  201  VKCDMLME  208



>ref|XP_010517708.1| PREDICTED: vacuolar-sorting receptor 3-like isoform X1 [Camelina 
sativa]
Length=626

 Score =   280 bits (716),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
             RFVVEKN+L V SP++IKGT+DSA+GNFGIPQYGGSM GTVVYP++N K CK F  F  
Sbjct  22   ARFVVEKNSLSVTSPETIKGTHDSAIGNFGIPQYGGSMAGTVVYPRENHKSCKEFSDFSI  81

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            SF S+ G+LP F++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED +S+
Sbjct  82   SFKSQPGALPIFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVASA  141

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
             Y+ENITIPSAL+ K FGEKLKKA+  G+MV++NLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  142  KYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDEC  201

Query  626  GYKCDMLMK  652
            G KCDMLM+
Sbjct  202  GVKCDMLME  210



>ref|XP_006849341.1| hypothetical protein AMTR_s00164p00059220 [Amborella trichopoda]
 gb|ERN10922.1| hypothetical protein AMTR_s00164p00059220 [Amborella trichopoda]
Length=611

 Score =   280 bits (715),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/188 (77%), Positives = 167/188 (89%), Gaps = 0/188 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
            GRFVVEKN+L V SPDSI+G +DSA+GNFG+PQYGGSM G VVYPKDN+KGCKGFD FG 
Sbjct  7    GRFVVEKNSLTVTSPDSIRGMHDSAIGNFGVPQYGGSMAGAVVYPKDNKKGCKGFDEFGL  66

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            SF SK G+LPTFV++DRG C F LK WNAQNAGA+A+LVADD +E LITMDSPEED  ++
Sbjct  67   SFKSKLGALPTFVMLDRGGCFFTLKVWNAQNAGAAAVLVADDTDEPLITMDSPEEDDKAA  126

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
             Y++NITIPSALI+K+FG+KLKKA+ +GEMV+VNLDWREAVPHPDDRVEYE WTNSNDEC
Sbjct  127  RYIQNITIPSALIDKNFGDKLKKALSNGEMVNVNLDWREAVPHPDDRVEYEFWTNSNDEC  186

Query  626  GYKCDMLM  649
            G KCDM+M
Sbjct  187  GPKCDMIM  194



>gb|KJB32252.1| hypothetical protein B456_005G231800 [Gossypium raimondii]
Length=630

 Score =   280 bits (716),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/188 (77%), Positives = 165/188 (88%), Gaps = 0/188 (0%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            RFVVEKN+L++ SP+ IKGTYDSA+GNFGIPQYGGSM G VVYPK+N+KGCK FD FG S
Sbjct  27   RFVVEKNSLRLTSPEKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKENQKGCKSFDDFGIS  86

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
            F SK G+LP FV+VDRGDC FALK WN Q AGASA+LVADD++E LITMD+PEED  ++ 
Sbjct  87   FKSKPGALPAFVLVDRGDCFFALKVWNVQQAGASAVLVADDIQEALITMDTPEEDRLAAK  146

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            Y+ENITIPSALIEK FGE LKKA+  G+MV+VNLDWRE+VPHPDDRVEYELWTNSNDECG
Sbjct  147  YIENITIPSALIEKKFGETLKKAISGGDMVNVNLDWRESVPHPDDRVEYELWTNSNDECG  206

Query  629  YKCDMLMK  652
             KCDMLM+
Sbjct  207  VKCDMLME  214



>ref|XP_009123210.1| PREDICTED: vacuolar-sorting receptor 3-like [Brassica rapa]
Length=624

 Score =   280 bits (715),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 162/188 (86%), Gaps = 0/188 (0%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            RFVVEKN+L V SPDSIKG +D A+GNFGIPQYGGSM GTVVYPK+N+K CK F  F  S
Sbjct  21   RFVVEKNSLSVTSPDSIKGAHDCAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSIS  80

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
            F S+ G+LPTF++VDRGDC FALK WNAQ  GASA+LVAD+V+E LITMD+PEED +S+ 
Sbjct  81   FKSQPGALPTFLLVDRGDCFFALKVWNAQKTGASAVLVADNVDEPLITMDTPEEDAASAK  140

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            Y+ENITIPSAL+ K FGEKLKKA+  G+MV++NLDWREAVPHPD RVEYELWTNSNDECG
Sbjct  141  YIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDARVEYELWTNSNDECG  200

Query  629  YKCDMLMK  652
             KCDMLM+
Sbjct  201  VKCDMLME  208



>gb|AAB72112.1| vacuolar sorting receptor homolog [Arabidopsis thaliana]
Length=630

 Score =   279 bits (714),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 166/191 (87%), Gaps = 2/191 (1%)
 Frame = +2

Query  86   GRFVV--EKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
             RFVV  EKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F
Sbjct  24   ARFVVSNEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDF  83

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
              SF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED S
Sbjct  84   SISFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVS  143

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
            S+ Y+ENITIPSAL+ K FGEKLK+A+  G+MV++NLDWREAVPHPDDRVEYELWTNSND
Sbjct  144  SAKYIENITIPSALVTKGFGEKLKQAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSND  203

Query  620  ECGYKCDMLMK  652
            ECG KCDMLM+
Sbjct  204  ECGVKCDMLME  214



>ref|XP_004152276.1| PREDICTED: vacuolar-sorting receptor 3-like [Cucumis sativus]
 gb|KGN52769.1| hypothetical protein Csa_4G000880 [Cucumis sativus]
Length=632

 Score =   278 bits (712),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
            GRFVVEKN+L+V SP+ I+GTYDSA+GNFGIPQYGGS+ G VVYPK+N+KGCK F  F  
Sbjct  25   GRFVVEKNSLRVTSPEKIRGTYDSAIGNFGIPQYGGSLAGVVVYPKENQKGCKDFGDFHI  84

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            SF SK GSLP FV+VDRGDC FALK WNAQ  GASA+LVAD ++E LITMDSPEEDGS++
Sbjct  85   SFQSKPGSLPIFVMVDRGDCLFALKVWNAQKVGASAVLVADHLDEPLITMDSPEEDGSTA  144

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
             YVENITIPSALI K F E+LKK +  GEMV ++LDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  145  TYVENITIPSALIRKGFSEQLKKEINAGEMVSLSLDWREAVPHPDDRVEYELWTNSNDEC  204

Query  626  GYKCDMLMK  652
            G+KCDMLM+
Sbjct  205  GFKCDMLME  213



>ref|XP_008454393.1| PREDICTED: vacuolar-sorting receptor 4-like isoform X2 [Cucumis 
melo]
Length=632

 Score =   277 bits (709),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 162/188 (86%), Gaps = 0/188 (0%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            RFVVEKN+L+V SP+ I+GTYDSA+GNFGIPQYGGS+ G VVYPK+N+KGCK F  F  S
Sbjct  26   RFVVEKNSLRVTSPEKIRGTYDSAIGNFGIPQYGGSLAGVVVYPKENQKGCKDFSDFHIS  85

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
            F SK GSLP FV+VDRGDC FALK WNAQ  GASA+LVAD ++E LITMDSPEEDGS++ 
Sbjct  86   FQSKPGSLPIFVMVDRGDCLFALKVWNAQKVGASAVLVADHLDEPLITMDSPEEDGSTAT  145

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            YVENITIPSALI K F E+LKK +  GEMV ++LDWREAVPHPDDRVEYELWTNSNDECG
Sbjct  146  YVENITIPSALIRKGFSEQLKKEINAGEMVSLSLDWREAVPHPDDRVEYELWTNSNDECG  205

Query  629  YKCDMLMK  652
            +KCDMLM+
Sbjct  206  FKCDMLME  213



>ref|XP_008454392.1| PREDICTED: vacuolar-sorting receptor 4-like isoform X1 [Cucumis 
melo]
Length=633

 Score =   277 bits (708),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 162/188 (86%), Gaps = 0/188 (0%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            RFVVEKN+L+V SP+ I+GTYDSA+GNFGIPQYGGS+ G VVYPK+N+KGCK F  F  S
Sbjct  26   RFVVEKNSLRVTSPEKIRGTYDSAIGNFGIPQYGGSLAGVVVYPKENQKGCKDFSDFHIS  85

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
            F SK GSLP FV+VDRGDC FALK WNAQ  GASA+LVAD ++E LITMDSPEEDGS++ 
Sbjct  86   FQSKPGSLPIFVMVDRGDCLFALKVWNAQKVGASAVLVADHLDEPLITMDSPEEDGSTAT  145

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            YVENITIPSALI K F E+LKK +  GEMV ++LDWREAVPHPDDRVEYELWTNSNDECG
Sbjct  146  YVENITIPSALIRKGFSEQLKKEINAGEMVSLSLDWREAVPHPDDRVEYELWTNSNDECG  205

Query  629  YKCDMLMK  652
            +KCDMLM+
Sbjct  206  FKCDMLME  213



>sp|P93484.1|VSR1_PEA RecName: Full=Vacuolar-sorting receptor 1; AltName: Full=80 kDa 
proaleurein-binding protein; AltName: Full=BP-80; Flags: 
Precursor [Pisum sativum]
 gb|AAB72110.1| BP-80 vacuolar sorting receptor [Pisum sativum]
Length=623

 Score =   272 bits (695),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 159/191 (83%), Gaps = 3/191 (2%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
            +  RFVVEKN+L V SP+ IKG +DSA+GNFGIPQYGGSM G VVYPKDN    KG   F
Sbjct  20   STARFVVEKNSLSVTSPEKIKGKHDSAIGNFGIPQYGGSMAGNVVYPKDN---SKGCKDF  76

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
              SF S+ G+LPT +++DRG C FALK WNAQ AGASA+LVADD+EE LITMD+PEED S
Sbjct  77   DSSFKSRPGALPTILLLDRGSCFFALKVWNAQKAGASAVLVADDIEEPLITMDTPEEDVS  136

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
            S+ Y+ENITIPSALI KSFGEKLK A+  G+MV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  137  SAKYIENITIPSALIGKSFGEKLKDAISGGDMVNVNLDWREAVPHPDDRVEYELWTNSND  196

Query  620  ECGYKCDMLMK  652
            ECG KCDML++
Sbjct  197  ECGVKCDMLIE  207



>ref|XP_009404782.1| PREDICTED: vacuolar-sorting receptor 4-like [Musa acuminata subsp. 
malaccensis]
Length=633

 Score =   272 bits (695),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 152/190 (80%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
            AAGRFVVEKN+L V SP  +KG +DSA+GNFGIPQYGGSM G VVYPK+N          
Sbjct  27   AAGRFVVEKNSLMVISPSELKGKHDSAIGNFGIPQYGGSMAGAVVYPKEN-ARACDQFSR  85

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
               F  KAG+LP FV++DRGDC FA K WNAQNAGASA+LV DD  E LITMD P ED  
Sbjct  86   SDLFKPKAGALPNFVLIDRGDCLFAKKVWNAQNAGASAVLVVDDKNEPLITMDLPREDDE  145

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
            ++ Y+ENITIPSALI+K FGE+LKKAV+ GEMV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  146  AAKYIENITIPSALIDKKFGEQLKKAVRSGEMVNVNLDWREAVPHPDDRVEYELWTNSND  205

Query  620  ECGYKCDMLM  649
            ECG KCDMLM
Sbjct  206  ECGTKCDMLM  215



>ref|XP_003610620.1| Vacuolar-sorting receptor [Medicago truncatula]
 gb|AES93578.1| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=622

 Score =   271 bits (693),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 157/191 (82%), Gaps = 1/191 (1%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
            +  RFVVEKN+L V SPD IKG +DSA+GNFGIPQYGGSM G VVYPKDN KGCK FD  
Sbjct  21   STARFVVEKNSLSVTSPDKIKGKHDSAIGNFGIPQYGGSMAGNVVYPKDNNKGCKDFDDS  80

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
                S     LPT +++DRG C FALK WNAQ AGASA+LVADD+EE LITMD+PEED S
Sbjct  81   SSFKSKPGA-LPTILLLDRGSCFFALKVWNAQKAGASAVLVADDIEEPLITMDTPEEDVS  139

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
            S+ Y+ENITIPSALI K+FG+KLK A+  G+MV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  140  SAKYIENITIPSALIGKTFGQKLKDAISGGDMVNVNLDWREAVPHPDDRVEYELWTNSND  199

Query  620  ECGYKCDMLMK  652
            ECG KCDML++
Sbjct  200  ECGVKCDMLIE  210



>ref|XP_002968618.1| hypothetical protein SELMODRAFT_440462 [Selaginella moellendorffii]
 gb|EFJ30872.1| hypothetical protein SELMODRAFT_440462 [Selaginella moellendorffii]
Length=624

 Score =   270 bits (690),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 152/185 (82%), Gaps = 1/185 (1%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
            G+F+VEKN+L V SPDS+KGTYDSA+GNFG+PQYGG+M GTV YPKD+R  CK +     
Sbjct  22   GKFLVEKNSLSVTSPDSLKGTYDSAIGNFGVPQYGGTMVGTVTYPKDSRMACKPYSDSDT  81

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
                  G LP  V+VDRGDC FALK WNAQNAGA+A+LVADD  E LITMDSPEED ++S
Sbjct  82   FRRKSGG-LPNVVLVDRGDCYFALKVWNAQNAGAAAVLVADDRSEPLITMDSPEEDSAAS  140

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
             YVENITIPSALIEKSF +KLK+A+ D EMV++NLDWRE++PHPDDRVEYE WTNSNDEC
Sbjct  141  EYVENITIPSALIEKSFADKLKRALSDNEMVNINLDWRESLPHPDDRVEYEFWTNSNDEC  200

Query  626  GYKCD  640
            G KCD
Sbjct  201  GPKCD  205



>ref|XP_002975863.1| hypothetical protein SELMODRAFT_175218 [Selaginella moellendorffii]
 gb|EFJ22768.1| hypothetical protein SELMODRAFT_175218 [Selaginella moellendorffii]
Length=624

 Score =   270 bits (690),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 152/185 (82%), Gaps = 1/185 (1%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
            G+F+VEKN+L V SPDS+KGTYDSA+GNFG+PQYGG+M GTV YPKD+R  CK +     
Sbjct  22   GKFLVEKNSLSVTSPDSLKGTYDSAIGNFGVPQYGGTMVGTVTYPKDSRMACKPYSDSDT  81

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
                  G LP  V+VDRGDC FALK WNAQNAGA+A+LVADD  E LITMDSPEED ++S
Sbjct  82   FRRKSGG-LPNVVLVDRGDCYFALKVWNAQNAGAAAVLVADDRTEPLITMDSPEEDSAAS  140

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
             YVENITIPSALIEKSF +KLK+A+ D EMV++NLDWRE++PHPDDRVEYE WTNSNDEC
Sbjct  141  EYVENITIPSALIEKSFADKLKRALSDNEMVNINLDWRESLPHPDDRVEYEFWTNSNDEC  200

Query  626  GYKCD  640
            G KCD
Sbjct  201  GPKCD  205



>ref|XP_008787225.1| PREDICTED: vacuolar-sorting receptor 3-like [Phoenix dactylifera]
Length=568

 Score =   268 bits (684),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 152/190 (80%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
            AAGRFVVEKN+L V SP  I+G +DSA+GNFGIPQYGGSM GTVVYPK N   CK F   
Sbjct  27   AAGRFVVEKNSLMVTSPSEIRGKHDSAIGNFGIPQYGGSMAGTVVYPKTNNYACKEFSAS  86

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
                      LP F+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  
Sbjct  87   DLFKPKPGA-LPNFLLIDRGECLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDE  145

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
            ++ Y++NITIPSALI+K+FGEKLKKAV+ GEMV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  146  AAKYIQNITIPSALIDKNFGEKLKKAVRSGEMVNVNLDWREAVPHPDDRVEYELWTNSND  205

Query  620  ECGYKCDMLM  649
            ECG KC+MLM
Sbjct  206  ECGPKCNMLM  215



>gb|ABR17683.1| unknown [Picea sitchensis]
Length=635

 Score =   268 bits (686),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 163/191 (85%), Gaps = 0/191 (0%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
            A  +FVVEKN+L+V SP++IKG YDSA+GNFGIPQYGG+M GT VYPK+N+ GCK FD F
Sbjct  29   AMAKFVVEKNSLRVLSPENIKGNYDSAIGNFGIPQYGGTMVGTAVYPKENQNGCKTFDTF  88

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
              SF SK G LP  V+V+RGDC FALK WNAQNAGA+A+LV+DD +E LITMDSPEED S
Sbjct  89   EISFKSKPGGLPNVVLVNRGDCYFALKVWNAQNAGAAAVLVSDDRDEPLITMDSPEEDSS  148

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
            ++ Y++NITIPSALIEK+FG+KLK A+  G+MV++NLDWRE+VPHPDDRVEYELWTNSND
Sbjct  149  AAEYLQNITIPSALIEKAFGDKLKVAINKGDMVNINLDWRESVPHPDDRVEYELWTNSND  208

Query  620  ECGYKCDMLMK  652
            ECG KCD  ++
Sbjct  209  ECGAKCDTQLE  219



>ref|XP_004983263.1| PREDICTED: vacuolar-sorting receptor 3-like [Setaria italica]
Length=631

 Score =   268 bits (686),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 152/187 (81%), Gaps = 1/187 (1%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            RFVVEKN+L V SP S++G  DSA+GNFGIPQYGGSM G VVYPKDN             
Sbjct  28   RFVVEKNSLMVTSPTSLRGRRDSAIGNFGIPQYGGSMAGAVVYPKDN-SNACDDFDGKHP  86

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
            F +K G++PTF++VDRGDC FA K WNAQNAGASA+LV DD +E LITMD P ED  ++ 
Sbjct  87   FRAKPGAMPTFLLVDRGDCLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEAAK  146

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            Y++NITIPSALI+K FGE+LKKAVKDGEMV+VNLDWREAVPHPDDRVEYELWTNSNDECG
Sbjct  147  YIQNITIPSALIDKKFGEQLKKAVKDGEMVNVNLDWREAVPHPDDRVEYELWTNSNDECG  206

Query  629  YKCDMLM  649
             KCDMLM
Sbjct  207  PKCDMLM  213



>gb|AFW68896.1| hypothetical protein ZEAMMB73_054159 [Zea mays]
Length=548

 Score =   266 bits (680),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 153/187 (82%), Gaps = 1/187 (1%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            RFVVEKN+L V SP S++G +DSA+GNFGIPQYGGSM G VVYPKDN             
Sbjct  29   RFVVEKNSLMVTSPTSLRGRHDSAIGNFGIPQYGGSMAGAVVYPKDN-AKACDDFDGRHP  87

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
            F +K G++PTF+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  +S 
Sbjct  88   FRAKPGAMPTFLLIDRGECLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEASK  147

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            Y++NITIPSALI++ FG++LKKAVKDGEMV+VNLDWREAVPHPDDRVEYELWTNSNDECG
Sbjct  148  YIQNITIPSALIDEKFGDQLKKAVKDGEMVNVNLDWREAVPHPDDRVEYELWTNSNDECG  207

Query  629  YKCDMLM  649
             KCDMLM
Sbjct  208  PKCDMLM  214



>ref|NP_001064400.1| Os10g0346600 [Oryza sativa Japonica Group]
 gb|AAK92655.1|AC079634_16 Putative vacuolar sorting receptor protein homolog [Oryza sativa 
Japonica Group]
 gb|ABB47273.1| Vacuolar sorting receptor 1 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26314.1| Os10g0346600 [Oryza sativa Japonica Group]
 gb|EAZ15760.1| hypothetical protein OsJ_31179 [Oryza sativa Japonica Group]
Length=631

 Score =   268 bits (685),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 153/187 (82%), Gaps = 1/187 (1%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            RFVVEKN+L V SP S++G +DSA+GNFG+PQYGGSM GTVVYPKDN             
Sbjct  28   RFVVEKNSLMVTSPTSLRGRHDSAIGNFGVPQYGGSMAGTVVYPKDN-ADACEAYDGDRH  86

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
            F +K G+LP F+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  ++ 
Sbjct  87   FRAKPGALPNFLLIDRGNCLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEAAK  146

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            Y++NITIPSALI+K FGE+LKKA+KDGEMV+VNLDWREAVPHPDDRVEYELWTNSNDECG
Sbjct  147  YIQNITIPSALIDKKFGEQLKKAIKDGEMVNVNLDWREAVPHPDDRVEYELWTNSNDECG  206

Query  629  YKCDMLM  649
             KCDMLM
Sbjct  207  PKCDMLM  213



>gb|AFW68893.1| hypothetical protein ZEAMMB73_054159 [Zea mays]
Length=587

 Score =   266 bits (681),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 152/187 (81%), Gaps = 15/187 (8%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            RFVVEKN+L V SP S++G +DSA+GNFGIPQYGGSM G VVYPKDN             
Sbjct  29   RFVVEKNSLMVTSPTSLRGRHDSAIGNFGIPQYGGSMAGAVVYPKDN-------------  75

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
              +K G++PTF+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  +S 
Sbjct  76   --AKPGAMPTFLLIDRGECLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEASK  133

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            Y++NITIPSALI++ FG++LKKAVKDGEMV+VNLDWREAVPHPDDRVEYELWTNSNDECG
Sbjct  134  YIQNITIPSALIDEKFGDQLKKAVKDGEMVNVNLDWREAVPHPDDRVEYELWTNSNDECG  193

Query  629  YKCDMLM  649
             KCDMLM
Sbjct  194  PKCDMLM  200



>gb|ACG44286.1| vacuolar sorting receptor 3 precursor [Zea mays]
Length=575

 Score =   266 bits (680),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 153/188 (81%), Gaps = 1/188 (1%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
             RFVVEKN+L V SP S++G +DSA+GNFGIPQYGGSM G VVYPKDN            
Sbjct  21   ARFVVEKNSLMVTSPTSLRGRHDSAIGNFGIPQYGGSMAGAVVYPKDN-AKACDDFDGRH  79

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
             F +K G++PTF+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  +S
Sbjct  80   PFRAKPGAMPTFLLIDRGECLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEAS  139

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
             Y++NITIPSALI++ FG++LKKAVKDGEMV+VNLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  140  KYIQNITIPSALIDEKFGDQLKKAVKDGEMVNVNLDWREAVPHPDDRVEYELWTNSNDEC  199

Query  626  GYKCDMLM  649
            G KCDMLM
Sbjct  200  GPKCDMLM  207



>gb|AAN05373.1| Putative vacuolar sorting receptor protein [Oryza sativa Japonica 
Group]
Length=643

 Score =   268 bits (684),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 153/187 (82%), Gaps = 1/187 (1%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            RFVVEKN+L V SP S++G +DSA+GNFG+PQYGGSM GTVVYPKDN             
Sbjct  28   RFVVEKNSLMVTSPTSLRGRHDSAIGNFGVPQYGGSMAGTVVYPKDN-ADACEAYDGDRH  86

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
            F +K G+LP F+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  ++ 
Sbjct  87   FRAKPGALPNFLLIDRGNCLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEAAK  146

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            Y++NITIPSALI+K FGE+LKKA+KDGEMV+VNLDWREAVPHPDDRVEYELWTNSNDECG
Sbjct  147  YIQNITIPSALIDKKFGEQLKKAIKDGEMVNVNLDWREAVPHPDDRVEYELWTNSNDECG  206

Query  629  YKCDMLM  649
             KCDMLM
Sbjct  207  PKCDMLM  213



>gb|AFW68895.1| hypothetical protein ZEAMMB73_054159 [Zea mays]
Length=601

 Score =   266 bits (679),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 153/187 (82%), Gaps = 1/187 (1%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            RFVVEKN+L V SP S++G +DSA+GNFGIPQYGGSM G VVYPKDN             
Sbjct  29   RFVVEKNSLMVTSPTSLRGRHDSAIGNFGIPQYGGSMAGAVVYPKDN-AKACDDFDGRHP  87

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
            F +K G++PTF+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  +S 
Sbjct  88   FRAKPGAMPTFLLIDRGECLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEASK  147

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            Y++NITIPSALI++ FG++LKKAVKDGEMV+VNLDWREAVPHPDDRVEYELWTNSNDECG
Sbjct  148  YIQNITIPSALIDEKFGDQLKKAVKDGEMVNVNLDWREAVPHPDDRVEYELWTNSNDECG  207

Query  629  YKCDMLM  649
             KCDMLM
Sbjct  208  PKCDMLM  214



>gb|AFW68894.1| hypothetical protein ZEAMMB73_054159 [Zea mays]
Length=618

 Score =   266 bits (679),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 153/187 (82%), Gaps = 1/187 (1%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            RFVVEKN+L V SP S++G +DSA+GNFGIPQYGGSM G VVYPKDN             
Sbjct  29   RFVVEKNSLMVTSPTSLRGRHDSAIGNFGIPQYGGSMAGAVVYPKDN-AKACDDFDGRHP  87

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
            F +K G++PTF+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  +S 
Sbjct  88   FRAKPGAMPTFLLIDRGECLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEASK  147

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            Y++NITIPSALI++ FG++LKKAVKDGEMV+VNLDWREAVPHPDDRVEYELWTNSNDECG
Sbjct  148  YIQNITIPSALIDEKFGDQLKKAVKDGEMVNVNLDWREAVPHPDDRVEYELWTNSNDECG  207

Query  629  YKCDMLM  649
             KCDMLM
Sbjct  208  PKCDMLM  214



>ref|NP_001130741.1| uncharacterized protein LOC100191845 precursor [Zea mays]
 gb|ACF79081.1| unknown [Zea mays]
Length=632

 Score =   266 bits (679),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 153/187 (82%), Gaps = 1/187 (1%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            RFVVEKN+L V SP S++G +DSA+GNFGIPQYGGSM G VVYPKDN             
Sbjct  29   RFVVEKNSLMVTSPTSLRGRHDSAIGNFGIPQYGGSMAGAVVYPKDN-AKACDDFDGRHP  87

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
            F +K G++PTF+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  +S 
Sbjct  88   FRAKPGAMPTFLLIDRGECLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEASK  147

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            Y++NITIPSALI++ FG++LKKAVKDGEMV+VNLDWREAVPHPDDRVEYELWTNSNDECG
Sbjct  148  YIQNITIPSALIDEKFGDQLKKAVKDGEMVNVNLDWREAVPHPDDRVEYELWTNSNDECG  207

Query  629  YKCDMLM  649
             KCDMLM
Sbjct  208  PKCDMLM  214



>gb|ACN30885.1| unknown [Zea mays]
Length=625

 Score =   266 bits (679),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 153/187 (82%), Gaps = 1/187 (1%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            RFVVEKN+L V SP S++G +DSA+GNFGIPQYGGSM G VVYPKDN             
Sbjct  22   RFVVEKNSLMVTSPTSLRGRHDSAIGNFGIPQYGGSMAGAVVYPKDN-AKACDDFDGRHP  80

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
            F +K G++PTF+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  +S 
Sbjct  81   FRAKPGAMPTFLLIDRGECLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEASK  140

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            Y++NITIPSALI++ FG++LKKAVKDGEMV+VNLDWREAVPHPDDRVEYELWTNSNDECG
Sbjct  141  YIQNITIPSALIDEKFGDQLKKAVKDGEMVNVNLDWREAVPHPDDRVEYELWTNSNDECG  200

Query  629  YKCDMLM  649
             KCDMLM
Sbjct  201  PKCDMLM  207



>ref|XP_010942821.1| PREDICTED: vacuolar-sorting receptor 1-like [Elaeis guineensis]
Length=631

 Score =   265 bits (678),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 150/190 (79%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
            AAGRFVVEKN+L V SP  I+G +DSA+GNFGIPQYGGSM GTVVYPK N   C+ F   
Sbjct  25   AAGRFVVEKNSLMVTSPSDIRGKHDSAIGNFGIPQYGGSMAGTVVYPKTNNYACEKFSAS  84

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
                      LP F+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  
Sbjct  85   DLFKPKPGA-LPNFLLIDRGECLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDE  143

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
            ++ Y++NITIPSALI+K+FGEKLKKA   GEMV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  144  AAKYIQNITIPSALIDKNFGEKLKKAFHSGEMVNVNLDWREAVPHPDDRVEYELWTNSND  203

Query  620  ECGYKCDMLM  649
            ECG KC+MLM
Sbjct  204  ECGPKCNMLM  213



>ref|XP_006661708.1| PREDICTED: vacuolar-sorting receptor 3-like [Oryza brachyantha]
Length=627

 Score =   265 bits (677),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 153/187 (82%), Gaps = 1/187 (1%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            RFVVEKN+L V SP S++G +DSA+GNFG+PQYGGSM GTVVYPK+N             
Sbjct  24   RFVVEKNSLMVTSPTSLRGRHDSAIGNFGVPQYGGSMAGTVVYPKEN-ADACDAFDGDRH  82

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
            F +K G+LP F+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  ++ 
Sbjct  83   FRAKPGALPNFLLIDRGNCLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEAAK  142

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            Y++NITIPSALI+K FGE+LKK++KDGEMV+VNLDWREAVPHPDDRVEYELWTNSNDECG
Sbjct  143  YIQNITIPSALIDKKFGEQLKKSIKDGEMVNVNLDWREAVPHPDDRVEYELWTNSNDECG  202

Query  629  YKCDMLM  649
             KCDMLM
Sbjct  203  PKCDMLM  209



>ref|XP_009421105.1| PREDICTED: vacuolar-sorting receptor 3-like [Musa acuminata subsp. 
malaccensis]
Length=633

 Score =   265 bits (676),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 150/189 (79%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   AGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfg  262
            AGRFVVEKN+L V SP  IKG +DSA+GNFGIPQYGGSM G VVYPK+N           
Sbjct  28   AGRFVVEKNSLMVISPSEIKGKHDSAIGNFGIPQYGGSMAGAVVYPKEN-AAACDEFSRP  86

Query  263  fsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSS  442
              F SK G+LP F+++DRGDC F  K WNAQNAGASA+LV DD +E LITMD P ED  S
Sbjct  87   DLFRSKVGALPNFLLIDRGDCLFTKKVWNAQNAGASAVLVVDDKDEPLITMDLPLEDDES  146

Query  443  SNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDE  622
            + Y++NITIPSALI+K FGE+LK AV+ GEMV+VNLDWREAVPHPD+RVEYELWTNSNDE
Sbjct  147  AKYIQNITIPSALIDKRFGEQLKTAVRSGEMVNVNLDWREAVPHPDERVEYELWTNSNDE  206

Query  623  CGYKCDMLM  649
            CG KCDMLM
Sbjct  207  CGAKCDMLM  215



>ref|XP_010938945.1| PREDICTED: vacuolar-sorting receptor 3-like [Elaeis guineensis]
Length=633

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 150/189 (79%), Gaps = 1/189 (1%)
 Frame = +2

Query  83   AGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfg  262
            AGRFVVEKN+L V SP  ++G +DSA+GNFGIPQYGGSM GTVVYPK N+  C+ F    
Sbjct  28   AGRFVVEKNSLMVTSPSELRGKHDSAIGNFGIPQYGGSMAGTVVYPKTNKYVCEEFSDSD  87

Query  263  fsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSS  442
                     LP F++VDRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  +
Sbjct  88   LFKPKPGA-LPNFLLVDRGECLFAKKVWNAQNAGASAVLVIDDKDEPLITMDLPREDDKA  146

Query  443  SNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDE  622
            + Y++NITIPSALI+K FGEKLKKAV  GEMV+VNLDWREAVPHPDDRVEYELWTNSNDE
Sbjct  147  AKYIQNITIPSALIDKKFGEKLKKAVLSGEMVNVNLDWREAVPHPDDRVEYELWTNSNDE  206

Query  623  CGYKCDMLM  649
            CG KC+MLM
Sbjct  207  CGPKCNMLM  215



>ref|NP_001169650.1| hypothetical protein precursor [Zea mays]
 gb|ACN34397.1| unknown [Zea mays]
Length=521

 Score =   260 bits (664),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 158/188 (84%), Gaps = 1/188 (1%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
               GRFVVEKN+LKV +PD +KGTY+ A+GNFG+PQYGG+M G V YPK NRK CK FD 
Sbjct  21   CCQGRFVVEKNSLKVTAPDGLKGTYECAIGNFGVPQYGGTMVGFVAYPKANRKACKSFDD  80

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  S+ +K G+ PTF++VDRGDC FA KAWNAQ AGA+AILVADD +E LITMD+PEE G
Sbjct  81   FDISYKAKPGAFPTFLLVDRGDCYFAKKAWNAQKAGAAAILVADDKDEPLITMDNPEE-G  139

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
             +++Y+ENITIPSALI KSFG++LKKA+  G+MV+VNLDWREA+PHPD+RVEYE WTNSN
Sbjct  140  GNTDYLENITIPSALITKSFGDRLKKAIDSGDMVNVNLDWREALPHPDERVEYEFWTNSN  199

Query  617  DECGYKCD  640
            DECG KCD
Sbjct  200  DECGPKCD  207



>emb|CDX93144.1| BnaA03g38660D [Brassica napus]
Length=610

 Score =   262 bits (669),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 151/189 (80%), Gaps = 22/189 (12%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GT                   
Sbjct  28   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGT-------------------  68

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
               S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  69   ---SQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  125

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
             Y+ENITIPSAL+ K+FGEKLKKA+  G+MV++NLDWREAVPHPD RVEYELWTNSNDEC
Sbjct  126  KYIENITIPSALVTKTFGEKLKKAISGGDMVNLNLDWREAVPHPDARVEYELWTNSNDEC  185

Query  626  GYKCDMLMK  652
            G KCDMLM+
Sbjct  186  GVKCDMLME  194



>ref|XP_002309184.1| vacuolar sorting receptor family protein [Populus trichocarpa]
 gb|EEE92707.1| vacuolar sorting receptor family protein [Populus trichocarpa]
Length=625

 Score =   262 bits (669),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 159/185 (86%), Gaps = 0/185 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
            GRFVVEKNNLK+ SPDS+KG Y+ A+GNFG+PQYGG++ GTV+YPK N+K CKGFDG   
Sbjct  21   GRFVVEKNNLKLTSPDSLKGVYECAIGNFGVPQYGGTLVGTVIYPKANQKACKGFDGVDI  80

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            SF S+ G LPTFV+VDRGDC F LKAWNAQN GA+AILVADD +E LITMD+PEE+ + +
Sbjct  81   SFKSRPGGLPTFVLVDRGDCYFTLKAWNAQNGGAAAILVADDKDEPLITMDTPEEENADA  140

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
            +Y++NITIPSALI KS G+ +KKA+ +GEMV++NLDW EA+PHPD+RVEYE WTNSNDEC
Sbjct  141  DYLQNITIPSALISKSLGDSIKKAISNGEMVNMNLDWTEALPHPDERVEYEFWTNSNDEC  200

Query  626  GYKCD  640
            G KCD
Sbjct  201  GPKCD  205



>ref|XP_009384326.1| PREDICTED: vacuolar-sorting receptor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009384327.1| PREDICTED: vacuolar-sorting receptor 1-like [Musa acuminata subsp. 
malaccensis]
Length=621

 Score =   261 bits (668),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 157/188 (84%), Gaps = 0/188 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKN+LKV SPDS+KG Y+ A+GNFG+PQYGG+M G V YPKDN+K CK F  
Sbjct  19   SCWGRFVVEKNSLKVTSPDSLKGIYECAIGNFGVPQYGGTMVGIVAYPKDNQKACKSFRD  78

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  S+ SK G  PTF++VDRGDC F  KAWNAQNAGA+AILVAD+  E LITMD+PEE+ 
Sbjct  79   FDISYKSKPGGFPTFLLVDRGDCYFTAKAWNAQNAGAAAILVADNKAEPLITMDTPEEED  138

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            + ++Y+++ITIPSALI KSFG+ LKKA+++G+MV VNLDWRE++PHPDDRVEYE WTNSN
Sbjct  139  TKADYLQDITIPSALISKSFGDSLKKAIENGDMVSVNLDWRESLPHPDDRVEYEFWTNSN  198

Query  617  DECGYKCD  640
            DECG KCD
Sbjct  199  DECGPKCD  206



>gb|EEE52644.1| hypothetical protein OsJ_35003 [Oryza sativa Japonica Group]
Length=591

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 159/188 (85%), Gaps = 1/188 (1%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKN+LKV SP  +KGTY+ A+GNFG+PQYGG+M G V YPK N+K CK FD 
Sbjct  24   SCHGRFVVEKNSLKVTSPSDMKGTYECAIGNFGVPQYGGTMVGVVAYPKANKKACKSFDD  83

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  S+ +K GSLPTF++VDRGDC F  KAWNAQNAGA+AILVADD  E LITMD+PEE G
Sbjct  84   FDISYKAKPGSLPTFLLVDRGDCFFTKKAWNAQNAGAAAILVADDKTEPLITMDTPEESG  143

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            ++ +Y+ENITIPSALI KSFG+KLKKA+ +G+MV+VNLDWRE++PHPD+RVEYE WTNSN
Sbjct  144  NT-DYLENITIPSALITKSFGDKLKKAIDNGDMVNVNLDWRESLPHPDERVEYEFWTNSN  202

Query  617  DECGYKCD  640
            DECG KCD
Sbjct  203  DECGPKCD  210



>ref|XP_010253066.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Nelumbo 
nucifera]
Length=580

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 157/188 (84%), Gaps = 0/188 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKN+L+V SP S+KG Y+ A+GNFG+PQYGG+M GTVVYPK N+K C  FD 
Sbjct  17   SCLGRFVVEKNSLRVTSPQSLKGVYECAIGNFGVPQYGGTMVGTVVYPKVNQKACNDFDE  76

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
               SF SK G LPTF++ DRGDC F LKAWNAQ AGA+AILVADD  E LITMD+PEE+ 
Sbjct  77   VDLSFKSKPGGLPTFLLADRGDCFFTLKAWNAQKAGAAAILVADDKIEPLITMDTPEEEN  136

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            SS++Y++NITIPSALI KSFG+ +KKA+ +G+M+++NLDWRE++PHPD+RVEYE WTNSN
Sbjct  137  SSADYLQNITIPSALISKSFGDGIKKALSNGDMININLDWRESLPHPDERVEYEFWTNSN  196

Query  617  DECGYKCD  640
            DECG KCD
Sbjct  197  DECGPKCD  204



>ref|XP_009410512.1| PREDICTED: vacuolar-sorting receptor 1 [Musa acuminata subsp. 
malaccensis]
Length=622

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 161/192 (84%), Gaps = 0/192 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  G+FVVEKN+LKV SPDS+KG Y+ A+GNFG+PQYGG+M G V YPK NRKGC+GFD 
Sbjct  20   SCWGKFVVEKNSLKVTSPDSLKGIYECAIGNFGVPQYGGTMVGIVAYPKANRKGCQGFDN  79

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  S+ SK G  PTF++VDRGDC F  KAWNAQNAGA+A+LVAD+  E LITMD+PEED 
Sbjct  80   FDISYKSKPGGFPTFLLVDRGDCYFTAKAWNAQNAGAAAVLVADNKAEPLITMDTPEEDD  139

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            + ++Y++NITIPSALI KSFG+ LKKA+++G+MV VNLDWRE++PHPDDRVEYE WTNSN
Sbjct  140  NKADYLQNITIPSALISKSFGDSLKKAIENGDMVSVNLDWRESLPHPDDRVEYEFWTNSN  199

Query  617  DECGYKCDMLMK  652
            DECG KCD  ++
Sbjct  200  DECGPKCDSQIQ  211



>gb|EEC68730.1| hypothetical protein OsI_37233 [Oryza sativa Indica Group]
Length=626

 Score =   260 bits (665),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 160/188 (85%), Gaps = 1/188 (1%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKN+LKV SP  +KGTY+ A+GNFG+PQYGG+M G V YPK N+K CK FD 
Sbjct  24   SCHGRFVVEKNSLKVTSPSDMKGTYECAIGNFGVPQYGGTMVGVVAYPKANKKACKSFDD  83

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  S+ +K GSLPTF++VDRGDC F  KAWNAQNAGA+AILVADD  E LITMD+PEE+G
Sbjct  84   FDISYKAKPGSLPTFLLVDRGDCFFTKKAWNAQNAGAAAILVADDKTEPLITMDTPEENG  143

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            ++ +Y+ENITIPSALI KSFG+KLKKA+ +G+MV+VNLDWRE++PHPD+RVEYE WTNSN
Sbjct  144  NT-DYLENITIPSALITKSFGDKLKKAIDNGDMVNVNLDWRESLPHPDERVEYEFWTNSN  202

Query  617  DECGYKCD  640
            DECG KCD
Sbjct  203  DECGPKCD  210



>ref|XP_008805693.1| PREDICTED: vacuolar-sorting receptor 3-like [Phoenix dactylifera]
Length=633

 Score =   260 bits (665),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 149/190 (78%), Gaps = 1/190 (1%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
            AAGRFVVEKN+L V SP  ++G +DSA+GNFGIPQYGGSM G VVYPK NR  C+ F   
Sbjct  27   AAGRFVVEKNSLMVTSPSELRGKHDSAIGNFGIPQYGGSMAGMVVYPKTNRYACEKFSAS  86

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
                      LP F+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  
Sbjct  87   DLFRPKPGA-LPNFLLIDRGECLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDE  145

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
            ++ Y++NI IPSALI+K+FG+KLKK V  GEMV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  146  AAKYIQNIMIPSALIDKNFGKKLKKVVLSGEMVNVNLDWREAVPHPDDRVEYELWTNSND  205

Query  620  ECGYKCDMLM  649
            ECG KC+MLM
Sbjct  206  ECGPKCNMLM  215



>gb|EEC67546.1| hypothetical protein OsI_34875 [Oryza sativa Indica Group]
Length=626

 Score =   260 bits (665),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 159/188 (85%), Gaps = 1/188 (1%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKN+LKV SP  +KGTY+ A+GNFG+PQYGG+M G V YPK N+K CK FD 
Sbjct  24   SCHGRFVVEKNSLKVTSPSDMKGTYECAIGNFGVPQYGGTMVGVVAYPKANKKACKSFDD  83

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  S+ +K GSLPTF++VDRGDC F  KAWNAQNAGA+AILVADD  E LITMD+PEE G
Sbjct  84   FDISYKAKPGSLPTFLLVDRGDCFFTKKAWNAQNAGAAAILVADDKTEPLITMDTPEESG  143

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            ++ +Y+ENITIPSALI KSFG+KLKKA+ +G+MV+VNLDWRE++PHPD+RVEYE WTNSN
Sbjct  144  NT-DYLENITIPSALITKSFGDKLKKAIDNGDMVNVNLDWRESLPHPDERVEYEFWTNSN  202

Query  617  DECGYKCD  640
            DECG KCD
Sbjct  203  DECGPKCD  210



>ref|XP_008677615.1| PREDICTED: uncharacterized protein LOC100383531 isoform X1 [Zea 
mays]
 gb|AFW64625.1| hypothetical protein ZEAMMB73_291086 [Zea mays]
Length=623

 Score =   260 bits (664),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 158/188 (84%), Gaps = 1/188 (1%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
               GRFVVEKN+LKV +PD +KGTY+ A+GNFG+PQYGG+M G V YPK NRK CK FD 
Sbjct  21   CCQGRFVVEKNSLKVTAPDGLKGTYECAIGNFGVPQYGGTMVGFVAYPKANRKACKSFDD  80

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  S+ +K G+ PTF++VDRGDC FA KAWNAQ AGA+AILVADD +E LITMD+PEE G
Sbjct  81   FDISYKAKPGAFPTFLLVDRGDCYFAKKAWNAQKAGAAAILVADDKDEPLITMDNPEE-G  139

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
             +++Y+ENITIPSALI KSFG++LKKA+  G+MV+VNLDWREA+PHPD+RVEYE WTNSN
Sbjct  140  GNTDYLENITIPSALITKSFGDRLKKAIDSGDMVNVNLDWREALPHPDERVEYEFWTNSN  199

Query  617  DECGYKCD  640
            DECG KCD
Sbjct  200  DECGPKCD  207



>gb|EEE51529.1| hypothetical protein OsJ_32728 [Oryza sativa Japonica Group]
Length=626

 Score =   260 bits (664),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 159/188 (85%), Gaps = 1/188 (1%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKN+LKV SP  +KGTY+ A+GNFG+PQYGG+M G V YPK N+K CK FD 
Sbjct  24   SCHGRFVVEKNSLKVTSPSDMKGTYECAIGNFGVPQYGGTMVGVVAYPKANKKACKSFDD  83

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  S+ +K GSLPTF++VDRGDC F  KAWNAQNAGA+AILVADD  E LITMD+PEE G
Sbjct  84   FDISYKAKPGSLPTFLLVDRGDCFFTKKAWNAQNAGAAAILVADDKTEPLITMDTPEESG  143

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            ++ +Y+ENITIPSALI KSFG+KLKKA+ +G+MV+VNLDWRE++PHPD+RVEYE WTNSN
Sbjct  144  NT-DYLENITIPSALITKSFGDKLKKAIDNGDMVNVNLDWRESLPHPDERVEYEFWTNSN  202

Query  617  DECGYKCD  640
            DECG KCD
Sbjct  203  DECGPKCD  210



>ref|XP_010253065.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nelumbo 
nucifera]
Length=623

 Score =   260 bits (664),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 157/188 (84%), Gaps = 0/188 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKN+L+V SP S+KG Y+ A+GNFG+PQYGG+M GTVVYPK N+K C  FD 
Sbjct  17   SCLGRFVVEKNSLRVTSPQSLKGVYECAIGNFGVPQYGGTMVGTVVYPKVNQKACNDFDE  76

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
               SF SK G LPTF++ DRGDC F LKAWNAQ AGA+AILVADD  E LITMD+PEE+ 
Sbjct  77   VDLSFKSKPGGLPTFLLADRGDCFFTLKAWNAQKAGAAAILVADDKIEPLITMDTPEEEN  136

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            SS++Y++NITIPSALI KSFG+ +KKA+ +G+M+++NLDWRE++PHPD+RVEYE WTNSN
Sbjct  137  SSADYLQNITIPSALISKSFGDGIKKALSNGDMININLDWRESLPHPDERVEYEFWTNSN  196

Query  617  DECGYKCD  640
            DECG KCD
Sbjct  197  DECGPKCD  204



>tpg|DAA39323.1| TPA: hypothetical protein ZEAMMB73_720222, partial [Zea mays]
Length=620

 Score =   260 bits (664),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 157/185 (85%), Gaps = 1/185 (1%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
            GRFVVEKN+LKV +PD +KGTY+ A+GNFG+PQYGG+M G V YPK NRK CK FD F  
Sbjct  25   GRFVVEKNSLKVTAPDDLKGTYECAIGNFGVPQYGGTMVGFVAYPKANRKACKSFDDFDI  84

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            S+ +K G+ PTF++VDRGDC FA KAWNAQ AGA+AILVADD +E LITMD+PEE G++ 
Sbjct  85   SYKAKPGAFPTFLLVDRGDCYFAKKAWNAQKAGAAAILVADDKDEPLITMDNPEESGNT-  143

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
            +Y+ENITIPSALI KSFG+KLKK + +G+MV VNLDWREA+PHPD+RVEYE WTNSNDEC
Sbjct  144  DYLENITIPSALITKSFGDKLKKVIDNGDMVSVNLDWREALPHPDERVEYEFWTNSNDEC  203

Query  626  GYKCD  640
            G KCD
Sbjct  204  GLKCD  208



>ref|XP_008669942.1| PREDICTED: vacuolar-sorting receptor 1-like [Zea mays]
Length=624

 Score =   260 bits (664),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 157/185 (85%), Gaps = 1/185 (1%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
            GRFVVEKN+LKV +PD +KGTY+ A+GNFG+PQYGG+M G V YPK NRK CK FD F  
Sbjct  25   GRFVVEKNSLKVTAPDDLKGTYECAIGNFGVPQYGGTMVGFVAYPKANRKACKSFDDFDI  84

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            S+ +K G+ PTF++VDRGDC FA KAWNAQ AGA+AILVADD +E LITMD+PEE G++ 
Sbjct  85   SYKAKPGAFPTFLLVDRGDCYFAKKAWNAQKAGAAAILVADDKDEPLITMDNPEESGNT-  143

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
            +Y+ENITIPSALI KSFG+KLKK + +G+MV VNLDWREA+PHPD+RVEYE WTNSNDEC
Sbjct  144  DYLENITIPSALITKSFGDKLKKVIDNGDMVSVNLDWREALPHPDERVEYEFWTNSNDEC  203

Query  626  GYKCD  640
            G KCD
Sbjct  204  GLKCD  208



>ref|XP_010922756.1| PREDICTED: vacuolar-sorting receptor 1-like [Elaeis guineensis]
Length=620

 Score =   259 bits (663),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 158/188 (84%), Gaps = 0/188 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S+ GRFVVEKN+LKV SP+S+KG Y+ A+GNFG+PQYGG+M G VVYPK N+K C+ F  
Sbjct  17   SSLGRFVVEKNSLKVTSPESLKGIYECAIGNFGVPQYGGTMVGIVVYPKANKKACRNFAD  76

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  SF SK G  PTF++VDRGDC F  KAWNAQNAGA+AILVADD  E LITMD+PEE+ 
Sbjct  77   FDISFKSKPGGFPTFLLVDRGDCYFTAKAWNAQNAGAAAILVADDKVEPLITMDTPEEES  136

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
              ++Y++NITIPSALI KSFG+ LKKA+++G+M++VNLDWRE++PHPD+RVEYE WTNSN
Sbjct  137  GGADYLQNITIPSALISKSFGDNLKKALENGDMINVNLDWRESLPHPDERVEYEFWTNSN  196

Query  617  DECGYKCD  640
            DECG KCD
Sbjct  197  DECGPKCD  204



>ref|XP_002450144.1| hypothetical protein SORBIDRAFT_05g001160 [Sorghum bicolor]
 gb|EES09132.1| hypothetical protein SORBIDRAFT_05g001160 [Sorghum bicolor]
Length=627

 Score =   259 bits (663),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 158/188 (84%), Gaps = 1/188 (1%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
               GRFVVEKN+LKV +PD +KGTY+ A+GNFG+PQYGG+M G V YPK NRK CK FD 
Sbjct  25   CCQGRFVVEKNSLKVTAPDDLKGTYECAIGNFGVPQYGGTMVGFVAYPKANRKACKSFDD  84

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  S+ +K G+ PTF++VDRGDC FA KAWNAQ AGA+AILVADD +E LITMD+PEE G
Sbjct  85   FDISYKAKPGAFPTFLLVDRGDCYFAKKAWNAQKAGAAAILVADDKDEPLITMDNPEESG  144

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            ++ +Y+ENITIPSALI KSFG++LKKA+  G+MV+VNLDWREA+PHPD+RVEYE WTNSN
Sbjct  145  NT-DYLENITIPSALITKSFGDRLKKAIDKGDMVNVNLDWREALPHPDERVEYEFWTNSN  203

Query  617  DECGYKCD  640
            DECG KCD
Sbjct  204  DECGPKCD  211



>ref|XP_008788526.1| PREDICTED: vacuolar-sorting receptor 1-like [Phoenix dactylifera]
Length=624

 Score =   259 bits (662),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 157/188 (84%), Gaps = 0/188 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S+ GRFVVEKN+LKV SP+S+KG Y+ A+GNFG+PQYGG+M G VVYPK NRK C  FD 
Sbjct  21   SSLGRFVVEKNSLKVTSPESLKGIYECAIGNFGVPQYGGTMVGIVVYPKANRKACSKFDD  80

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  SF SK GS PTF++VDRGDC F  KAWNAQNAGA+AILVADD  E LITMD PEE+ 
Sbjct  81   FDISFKSKPGSFPTFLLVDRGDCYFTAKAWNAQNAGAAAILVADDKVEPLITMDMPEEES  140

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
              ++Y++NITIPSALI KSFG+ LKKA+ +G+M++VNLDWRE++PHPD+RVEYE WTNSN
Sbjct  141  GGADYLQNITIPSALISKSFGDNLKKALDNGDMINVNLDWRESLPHPDERVEYEFWTNSN  200

Query  617  DECGYKCD  640
            DECG KCD
Sbjct  201  DECGPKCD  208



>ref|XP_004977384.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Setaria 
italica]
Length=624

 Score =   259 bits (662),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 158/185 (85%), Gaps = 1/185 (1%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
            GRFVVEKN+LKV +PD +KGTY+ A+GNFG+PQYGG+M G V YPK N+K CK FD F  
Sbjct  25   GRFVVEKNSLKVTAPDDLKGTYECAIGNFGVPQYGGTMVGFVAYPKANKKACKSFDDFDI  84

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            S+ +K G+ PTF++VDRGDC F  KAWNAQNAGA+AILVADD +E LITMD+PEE G + 
Sbjct  85   SYKAKPGAFPTFLLVDRGDCYFTKKAWNAQNAGAAAILVADDKDEPLITMDTPEESGRA-  143

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
            +Y+ENITIPSALI KSFG++LKKA+ +G+MV+VNLDWREA+PHPD+RVEYE WTNSNDEC
Sbjct  144  DYLENITIPSALITKSFGDRLKKAIDNGDMVNVNLDWREALPHPDERVEYEFWTNSNDEC  203

Query  626  GYKCD  640
            G KCD
Sbjct  204  GPKCD  208



>ref|XP_004978527.1| PREDICTED: vacuolar-sorting receptor 1-like [Setaria italica]
Length=624

 Score =   259 bits (662),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 158/185 (85%), Gaps = 1/185 (1%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
            GRFVVEKN+LKV +PD +KGTY+ A+GNFG+PQYGG+M G V YPK N+K CK FD F  
Sbjct  25   GRFVVEKNSLKVTAPDDLKGTYECAIGNFGVPQYGGTMVGFVAYPKANKKACKSFDDFDI  84

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            S+ +K G+ PTF++VDRGDC F  KAWNAQNAGA+AILVADD +E LITMD+PEE G + 
Sbjct  85   SYKAKPGAFPTFLLVDRGDCYFTKKAWNAQNAGAAAILVADDKDEPLITMDTPEESGRA-  143

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
            +Y+ENITIPSALI KSFG++LKKA+ +G+MV+VNLDWREA+PHPD+RVEYE WTNSNDEC
Sbjct  144  DYLENITIPSALITKSFGDRLKKAIDNGDMVNVNLDWREALPHPDERVEYEFWTNSNDEC  203

Query  626  GYKCD  640
            G KCD
Sbjct  204  GPKCD  208



>ref|XP_003623631.1| Vacuolar sorting receptor [Medicago truncatula]
 gb|AES79849.1| vacuolar sorting receptor [Medicago truncatula]
Length=625

 Score =   259 bits (661),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 156/190 (82%), Gaps = 1/190 (1%)
 Frame = +2

Query  74   ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfd  253
            E   GRF+VEKN+L++ SP S+KG+Y+ A+GNFG+PQYGG++ G+VVYP  N+KGCK F 
Sbjct  18   ECCFGRFLVEKNSLRITSPKSLKGSYECAIGNFGVPQYGGTLVGSVVYPNVNQKGCKNFT  77

Query  254  gfgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  433
             F  SF S  G+ PTFV+VDRGDC F LKAWNAQN GA+AILVADD EE LITMD+PEE 
Sbjct  78   DFSASFHSMPGNFPTFVLVDRGDCYFTLKAWNAQNGGAAAILVADDREETLITMDTPEEG  137

Query  434  GS-SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTN  610
               + +Y+E I IPSALI KS G+++KKA+ DGEMVH+NLDWREA+PHPDDRVEYELWTN
Sbjct  138  NVVNDDYIEKINIPSALISKSLGDRIKKALSDGEMVHINLDWREALPHPDDRVEYELWTN  197

Query  611  SNDECGYKCD  640
            SNDECG KCD
Sbjct  198  SNDECGPKCD  207



>gb|KJB71518.1| hypothetical protein B456_011G126800 [Gossypium raimondii]
Length=569

 Score =   257 bits (657),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 157/188 (84%), Gaps = 0/188 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            +  GRFVVEKN+LKV SP+SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+  CK FD 
Sbjct  18   NCLGRFVVEKNSLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYPKANQGACKSFDD  77

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  SF SK G LPTF++VDRGDC F LKAWNAQ AGA+AILVAD  +E LITMD+PEE+ 
Sbjct  78   FDISFKSKPGGLPTFLLVDRGDCFFTLKAWNAQKAGAAAILVADSKDEPLITMDTPEEEN  137

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            +++ Y++NITIPSALI KS G+ LKKA+  GEMV++NLDWRE++PHPD+RVEYE WTNSN
Sbjct  138  ANAEYLQNITIPSALISKSLGDSLKKALNGGEMVNMNLDWRESLPHPDERVEYEFWTNSN  197

Query  617  DECGYKCD  640
            DECG KCD
Sbjct  198  DECGPKCD  205



>gb|EMT19677.1| Vacuolar-sorting receptor 1 [Aegilops tauschii]
Length=618

 Score =   258 bits (660),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 157/185 (85%), Gaps = 1/185 (1%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
            GRFVVEKN+LKV +PDS+KG+Y+ A+GNFG+PQYGG+M G V YPK NRK CK FD F  
Sbjct  21   GRFVVEKNSLKVTAPDSLKGSYECAIGNFGVPQYGGTMVGVVAYPKSNRKACKSFDDFDI  80

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            S+ +K GSLPTF++VDRGDC F  KAWNAQNAG +AILVADD +E LITMD+PEE G + 
Sbjct  81   SYKAKPGSLPTFLLVDRGDCFFTKKAWNAQNAGVAAILVADDKDEPLITMDTPEESGRA-  139

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
            +Y+ENITIPSALI KSFG++L+KAV  G MV+VNLDWRE++PHPD+RVEYE WTNSNDEC
Sbjct  140  DYLENITIPSALITKSFGDRLRKAVDGGHMVNVNLDWRESLPHPDERVEYEFWTNSNDEC  199

Query  626  GYKCD  640
            G KCD
Sbjct  200  GPKCD  204



>gb|KGN58683.1| hypothetical protein Csa_3G728010 [Cucumis sativus]
Length=522

 Score =   256 bits (654),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 154/188 (82%), Gaps = 0/188 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKN+LK+ SPDSIKG Y+ A+GNFG+P+YGG+MTG V YPK N+K CK FD 
Sbjct  18   SCLGRFVVEKNSLKITSPDSIKGVYECAIGNFGVPEYGGTMTGIVHYPKANQKACKSFDD  77

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
             G SF SK GSLPTFV+ DRGDC F +KAWNAQN GA+AILVADD  E LITMDSPEE+ 
Sbjct  78   AGISFKSKPGSLPTFVLADRGDCYFTMKAWNAQNGGAAAILVADDRLEPLITMDSPEEEK  137

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            + SNY++ I IPSALI KS G+ +KKA+  GEMV++NLDW EA+PHPDDRVEYE WTNSN
Sbjct  138  ADSNYLKGIAIPSALISKSLGDDIKKALSSGEMVNINLDWTEALPHPDDRVEYEFWTNSN  197

Query  617  DECGYKCD  640
            DECG KCD
Sbjct  198  DECGPKCD  205



>ref|XP_003573873.1| PREDICTED: vacuolar-sorting receptor 1-like [Brachypodium distachyon]
Length=629

 Score =   258 bits (660),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 153/189 (81%), Gaps = 2/189 (1%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            RFVVEKN+L V SP +++G +DSA+GNFGIPQYGGSM G VVYPK N   C  FDG G  
Sbjct  24   RFVVEKNSLMVTSPTTLRGRHDSAIGNFGIPQYGGSMAGAVVYPKANTDACDSFDGGGKE  83

Query  269  fsskag--sLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSS  442
               +    +LP+F+++DR +C FA K WNAQNAGASA+LV DD +E LITMD P ED  +
Sbjct  84   HIFRNNPGALPSFLLIDRRNCLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEA  143

Query  443  SNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDE  622
            + Y++NITIPSALI+K FGE+LKKAVKDGEMV+VNLDWREAVPHPDDRVEYELWTNSNDE
Sbjct  144  AKYIQNITIPSALIDKKFGEQLKKAVKDGEMVNVNLDWREAVPHPDDRVEYELWTNSNDE  203

Query  623  CGYKCDMLM  649
            CG KCDML+
Sbjct  204  CGPKCDMLI  212



>ref|NP_001065992.1| Os12g0116000 [Oryza sativa Japonica Group]
 gb|ABA96293.2| Vacuolar sorting receptor 1 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29011.1| Os12g0116000 [Oryza sativa Japonica Group]
 dbj|BAG90054.1| unnamed protein product [Oryza sativa Japonica Group]
Length=728

 Score =   260 bits (665),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 159/188 (85%), Gaps = 1/188 (1%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKN+LKV SP  +KGTY+ A+GNFG+PQYGG+M G V YPK N+K CK FD 
Sbjct  126  SCHGRFVVEKNSLKVTSPSDMKGTYECAIGNFGVPQYGGTMVGVVAYPKANKKACKSFDD  185

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  S+ +K GSLPTF++VDRGDC F  KAWNAQNAGA+AILVADD  E LITMD+PEE G
Sbjct  186  FDISYKAKPGSLPTFLLVDRGDCFFTKKAWNAQNAGAAAILVADDKTEPLITMDTPEESG  245

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            ++ +Y+ENITIPSALI KSFG+KLKKA+ +G+MV+VNLDWRE++PHPD+RVEYE WTNSN
Sbjct  246  NT-DYLENITIPSALITKSFGDKLKKAIDNGDMVNVNLDWRESLPHPDERVEYEFWTNSN  304

Query  617  DECGYKCD  640
            DECG KCD
Sbjct  305  DECGPKCD  312



>ref|XP_006842496.1| hypothetical protein AMTR_s00077p00095230 [Amborella trichopoda]
 gb|ERN04171.1| hypothetical protein AMTR_s00077p00095230 [Amborella trichopoda]
Length=622

 Score =   258 bits (659),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 156/189 (83%), Gaps = 0/189 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
            GRFVVEKN+L+V SPDS+K TY+ A+GNFG+PQYGG+M GTV YPK N+K C+ +     
Sbjct  20   GRFVVEKNSLRVTSPDSLKDTYECAIGNFGVPQYGGTMVGTVTYPKSNQKACREYKEVEI  79

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            SF SK G LPT V+ DRGDC F LKAWNAQ AGA+AILVADD  E LITMD+PEE+ S +
Sbjct  80   SFKSKPGGLPTIVLADRGDCYFTLKAWNAQKAGAAAILVADDKIEPLITMDTPEEENSKA  139

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
            +Y++NITIPSALI KSFG+ +KKA+ +G+MV++NLDWRE++PHPD+RVEYE WTNSNDEC
Sbjct  140  DYLQNITIPSALISKSFGDSIKKALANGDMVNINLDWRESLPHPDERVEYEFWTNSNDEC  199

Query  626  GYKCDMLMK  652
            G KCD  ++
Sbjct  200  GPKCDTQIE  208



>gb|KDO64109.1| hypothetical protein CISIN_1g0100101mg [Citrus sinensis]
Length=362

 Score =   251 bits (640),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 153/185 (83%), Gaps = 0/185 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
            GRFVVEKN+LKV SP+ IKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CKGFD    
Sbjct  21   GRFVVEKNSLKVTSPEKIKGVYECAIGNFGVPQYGGTLIGTVVYPKANQKACKGFDEVDL  80

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            SF S+ G LPTF++VDRGDC F LKAWNAQ  GA+AILVADD  E LITMD+PEE+ + +
Sbjct  81   SFKSRPGGLPTFLLVDRGDCYFTLKAWNAQKGGAAAILVADDKTEPLITMDTPEEENADA  140

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
             Y++NITIPSALI KS G+ +KK++  GEMV++NLDW EA+PHPD+RVEYE WTNSNDEC
Sbjct  141  EYLQNITIPSALISKSLGDSIKKSLSGGEMVNMNLDWTEALPHPDERVEYEFWTNSNDEC  200

Query  626  GYKCD  640
            G KC+
Sbjct  201  GPKCE  205



>pir||T00044 vacuolar sorting receptor protein homolog PV72 - cucurbit
 dbj|BAA25079.1| PV72 [Cucurbita cv. Kurokawa Amakuri]
Length=624

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 156/188 (83%), Gaps = 0/188 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKN+LKV  PDSIKG Y+ A+GNFG+P+YGG+MTG V YPK N+K CK FD 
Sbjct  18   SCFGRFVVEKNSLKVTYPDSIKGVYECAIGNFGVPEYGGTMTGIVHYPKANQKACKSFDD  77

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
             G SF SK GSLPTFV+ DRGDC F LKAWNAQN GA+AILVADD  E LITMDSPEE  
Sbjct  78   VGISFKSKPGSLPTFVLADRGDCYFTLKAWNAQNGGAAAILVADDRLEPLITMDSPEEAK  137

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            + +NY+++ITIPSALI KS G+++KKA+ +GEMV++NLDW EA+PHPDDRVEYE WTNSN
Sbjct  138  ADANYLKDITIPSALISKSLGDEIKKALSNGEMVNINLDWTEALPHPDDRVEYEFWTNSN  197

Query  617  DECGYKCD  640
            DECG KCD
Sbjct  198  DECGAKCD  205



>ref|XP_011019003.1| PREDICTED: vacuolar-sorting receptor 1-like [Populus euphratica]
Length=625

 Score =   258 bits (658),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
            GRFVVEKN+LK+ SPDS+KG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CKGFD    
Sbjct  21   GRFVVEKNSLKLTSPDSLKGVYECAIGNFGVPQYGGTLVGTVVYPKANQKACKGFDEVDI  80

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            SF S+ G LPTFV+ DRGDC F LKAWNAQN GA+AILVADD  E LITMD+PEED + +
Sbjct  81   SFKSRPGWLPTFVLADRGDCYFTLKAWNAQNGGAAAILVADDKVEPLITMDNPEEDDADA  140

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
             Y++NITIPSALI KS G+ +KKA+ +GEMV++NLDW EA+PHPD+RVEYE WTNSNDEC
Sbjct  141  AYLQNITIPSALISKSLGDSIKKAISNGEMVNMNLDWTEALPHPDERVEYEFWTNSNDEC  200

Query  626  GYKCD  640
            G KCD
Sbjct  201  GPKCD  205



>ref|XP_007140077.1| hypothetical protein PHAVU_008G082200g [Phaseolus vulgaris]
 gb|ESW12071.1| hypothetical protein PHAVU_008G082200g [Phaseolus vulgaris]
Length=619

 Score =   257 bits (657),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 156/193 (81%), Gaps = 3/193 (2%)
 Frame = +2

Query  74   ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfd  253
            E   GRFVVEKN+L+V +P S+KGTY+ A+GNFG+P+YGG++ G+VVYPK N+KGC  F 
Sbjct  17   ECTVGRFVVEKNSLRVTAPTSLKGTYECAIGNFGVPKYGGTLVGSVVYPKVNQKGCLNFT  76

Query  254  gfgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEE-  430
               F         PTF++VDRGDC F LKAWNAQN GA+AILVADD  E LITMD+PEE 
Sbjct  77   DVNFQSKPGV--FPTFLLVDRGDCYFTLKAWNAQNGGAAAILVADDKAETLITMDTPEEG  134

Query  431  DGSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTN  610
             G++ +YV+NI+IPSALI KSFG+ +KKA+ DG+MV++NLDWREA+PHPDDRVEYELWTN
Sbjct  135  KGTNDDYVDNISIPSALISKSFGDSIKKALSDGDMVNMNLDWREALPHPDDRVEYELWTN  194

Query  611  SNDECGYKCDMLM  649
            SNDECG KCD L+
Sbjct  195  SNDECGPKCDSLI  207



>ref|XP_004137673.1| PREDICTED: vacuolar-sorting receptor 1-like [Cucumis sativus]
 ref|XP_004160331.1| PREDICTED: vacuolar-sorting receptor 1-like [Cucumis sativus]
Length=624

 Score =   257 bits (656),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 154/188 (82%), Gaps = 0/188 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKN+LK+ SPDSIKG Y+ A+GNFG+P+YGG+MTG V YPK N+K CK FD 
Sbjct  18   SCLGRFVVEKNSLKITSPDSIKGVYECAIGNFGVPEYGGTMTGIVHYPKANQKACKSFDD  77

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
             G SF SK GSLPTFV+ DRGDC F +KAWNAQN GA+AILVADD  E LITMDSPEE+ 
Sbjct  78   AGISFKSKPGSLPTFVLADRGDCYFTMKAWNAQNGGAAAILVADDRLEPLITMDSPEEEK  137

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            + SNY++ I IPSALI KS G+ +KKA+  GEMV++NLDW EA+PHPDDRVEYE WTNSN
Sbjct  138  ADSNYLKGIAIPSALISKSLGDDIKKALSSGEMVNINLDWTEALPHPDDRVEYEFWTNSN  197

Query  617  DECGYKCD  640
            DECG KCD
Sbjct  198  DECGPKCD  205



>gb|KJB71519.1| hypothetical protein B456_011G126800 [Gossypium raimondii]
 gb|KJB71520.1| hypothetical protein B456_011G126800 [Gossypium raimondii]
Length=621

 Score =   257 bits (656),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 157/188 (84%), Gaps = 0/188 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            +  GRFVVEKN+LKV SP+SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+  CK FD 
Sbjct  18   NCLGRFVVEKNSLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYPKANQGACKSFDD  77

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  SF SK G LPTF++VDRGDC F LKAWNAQ AGA+AILVAD  +E LITMD+PEE+ 
Sbjct  78   FDISFKSKPGGLPTFLLVDRGDCFFTLKAWNAQKAGAAAILVADSKDEPLITMDTPEEEN  137

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            +++ Y++NITIPSALI KS G+ LKKA+  GEMV++NLDWRE++PHPD+RVEYE WTNSN
Sbjct  138  ANAEYLQNITIPSALISKSLGDSLKKALNGGEMVNMNLDWRESLPHPDERVEYEFWTNSN  197

Query  617  DECGYKCD  640
            DECG KCD
Sbjct  198  DECGPKCD  205



>gb|KHG14060.1| Vacuolar-sorting receptor 1 -like protein [Gossypium arboreum]
Length=621

 Score =   257 bits (656),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 157/188 (84%), Gaps = 0/188 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            +  GRFVVEKN+LKV SP+SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+  CK FD 
Sbjct  18   NCLGRFVVEKNSLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYPKANQGACKSFDD  77

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  SF SK G LPTF++VDRGDC F LKAWNAQ AGA+AILVAD  +E LITMD+PEE+ 
Sbjct  78   FDISFKSKPGGLPTFLLVDRGDCFFTLKAWNAQKAGAAAILVADSKDEPLITMDTPEEEN  137

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            +++ Y++NITIPSALI KS G+ LKKA+  GEMV++NLDWRE++PHPD+RVEYE WTNSN
Sbjct  138  ANAEYLQNITIPSALISKSLGDSLKKALNGGEMVNMNLDWRESLPHPDERVEYEFWTNSN  197

Query  617  DECGYKCD  640
            DECG KCD
Sbjct  198  DECGPKCD  205



>ref|NP_180588.1| vacuolar-sorting receptor 2 [Arabidopsis thaliana]
 sp|O22925.1|VSR2_ARATH RecName: Full=Vacuolar-sorting receptor 2; Short=AtVSR2; AltName: 
Full=BP80-like protein c; Short=AtBP80c; AltName: Full=Epidermal 
growth factor receptor-like protein 4; Short=AtELP4; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC16948.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|ABE65874.1| vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AEC08366.1| vacuolar-sorting receptor 2 [Arabidopsis thaliana]
Length=625

 Score =   257 bits (656),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 126/192 (66%), Positives = 156/192 (81%), Gaps = 0/192 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKNNL+V SP+SI+G Y+ ALGNFG+PQYGGSM+G VVYPK N+K CK FD 
Sbjct  20   SCTGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVVYPKTNQKACKNFDD  79

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  SF S+   LPTFV+VDRGDC F LKAWNAQ AGA+ ILVAD+  E+LITMD+PE++ 
Sbjct  80   FEISFRSRVAGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEQLITMDAPEDET  139

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            S ++Y++NITIPSAL+ +S G  +K A+  G+ VH++LDWREA+PHP+DRV YELWTNSN
Sbjct  140  SDADYLQNITIPSALVSRSLGSAIKTAIAHGDPVHISLDWREALPHPNDRVAYELWTNSN  199

Query  617  DECGYKCDMLMK  652
            DECG KCD  ++
Sbjct  200  DECGSKCDAQIR  211



>gb|KDO64107.1| hypothetical protein CISIN_1g0100101mg, partial [Citrus sinensis]
 gb|KDO64108.1| hypothetical protein CISIN_1g0100101mg, partial [Citrus sinensis]
Length=410

 Score =   251 bits (641),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 153/185 (83%), Gaps = 0/185 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
            GRFVVEKN+LKV SP+ IKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CKGFD    
Sbjct  21   GRFVVEKNSLKVTSPEKIKGVYECAIGNFGVPQYGGTLIGTVVYPKANQKACKGFDEVDL  80

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            SF S+ G LPTF++VDRGDC F LKAWNAQ  GA+AILVADD  E LITMD+PEE+ + +
Sbjct  81   SFKSRPGGLPTFLLVDRGDCYFTLKAWNAQKGGAAAILVADDKTEPLITMDTPEEENADA  140

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
             Y++NITIPSALI KS G+ +KK++  GEMV++NLDW EA+PHPD+RVEYE WTNSNDEC
Sbjct  141  EYLQNITIPSALISKSLGDSIKKSLSGGEMVNMNLDWTEALPHPDERVEYEFWTNSNDEC  200

Query  626  GYKCD  640
            G KC+
Sbjct  201  GPKCE  205



>gb|KDO64106.1| hypothetical protein CISIN_1g0100101mg [Citrus sinensis]
Length=411

 Score =   251 bits (641),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 153/185 (83%), Gaps = 0/185 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
            GRFVVEKN+LKV SP+ IKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CKGFD    
Sbjct  21   GRFVVEKNSLKVTSPEKIKGVYECAIGNFGVPQYGGTLIGTVVYPKANQKACKGFDEVDL  80

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            SF S+ G LPTF++VDRGDC F LKAWNAQ  GA+AILVADD  E LITMD+PEE+ + +
Sbjct  81   SFKSRPGGLPTFLLVDRGDCYFTLKAWNAQKGGAAAILVADDKTEPLITMDTPEEENADA  140

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
             Y++NITIPSALI KS G+ +KK++  GEMV++NLDW EA+PHPD+RVEYE WTNSNDEC
Sbjct  141  EYLQNITIPSALISKSLGDSIKKSLSGGEMVNMNLDWTEALPHPDERVEYEFWTNSNDEC  200

Query  626  GYKCD  640
            G KC+
Sbjct  201  GPKCE  205



>ref|NP_001189637.1| vacuolar-sorting receptor 2 [Arabidopsis thaliana]
 gb|AEC08367.1| vacuolar-sorting receptor 2 [Arabidopsis thaliana]
Length=641

 Score =   257 bits (657),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 126/192 (66%), Positives = 156/192 (81%), Gaps = 0/192 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKNNL+V SP+SI+G Y+ ALGNFG+PQYGGSM+G VVYPK N+K CK FD 
Sbjct  20   SCTGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVVYPKTNQKACKNFDD  79

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  SF S+   LPTFV+VDRGDC F LKAWNAQ AGA+ ILVAD+  E+LITMD+PE++ 
Sbjct  80   FEISFRSRVAGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEQLITMDAPEDET  139

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            S ++Y++NITIPSAL+ +S G  +K A+  G+ VH++LDWREA+PHP+DRV YELWTNSN
Sbjct  140  SDADYLQNITIPSALVSRSLGSAIKTAIAHGDPVHISLDWREALPHPNDRVAYELWTNSN  199

Query  617  DECGYKCDMLMK  652
            DECG KCD  ++
Sbjct  200  DECGSKCDAQIR  211



>ref|XP_009388213.1| PREDICTED: vacuolar-sorting receptor 1-like [Musa acuminata subsp. 
malaccensis]
Length=529

 Score =   254 bits (648),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 156/188 (83%), Gaps = 0/188 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            +  GRFVVEKN+LKV SP+S+KG Y+SA+GNFG+PQYGG+M G V YPK N K C  F  
Sbjct  18   TCWGRFVVEKNSLKVTSPNSLKGIYESAIGNFGVPQYGGTMVGIVAYPKVNWKACHNFKD  77

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  S+ SK G  PTF++VDRGDC F  KAWNAQN+GA+A+LVAD+V E LITM++PEE+ 
Sbjct  78   FDISYKSKPGGFPTFLLVDRGDCYFITKAWNAQNSGAAAVLVADNVAEPLITMNTPEEEN  137

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            S ++Y++NITIPSALI KSFG++LKKA+++G+MV VNLDW+E++PHPD+RVEYE WTN N
Sbjct  138  SKADYLQNITIPSALISKSFGDRLKKAIENGDMVSVNLDWKESLPHPDNRVEYEFWTNCN  197

Query  617  DECGYKCD  640
            DECG KCD
Sbjct  198  DECGPKCD  205



>ref|XP_010252051.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nelumbo 
nucifera]
Length=624

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 158/188 (84%), Gaps = 0/188 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKN+LKV SP+ +KG Y+ A+GNFG+PQYGG+M GTV+YPK N+K CK FD 
Sbjct  18   SCLGRFVVEKNSLKVTSPEDLKGVYECAIGNFGVPQYGGTMIGTVIYPKANQKACKDFDE  77

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
               SF SK G LPTF++ DRGDC F LKAWNAQ AGA+AILV+DD  E LITMD+PEE+ 
Sbjct  78   VDLSFKSKPGGLPTFLLADRGDCFFTLKAWNAQKAGAAAILVSDDKVEPLITMDTPEEEN  137

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            + ++YV+NI+IPSALI K+FG+++KK++  G+M+++NLDWREA+PHPD+RVEYELWTNSN
Sbjct  138  ARADYVQNISIPSALISKTFGDRIKKSLSMGDMININLDWREALPHPDERVEYELWTNSN  197

Query  617  DECGYKCD  640
            DECG KCD
Sbjct  198  DECGPKCD  205



>ref|XP_003579018.1| PREDICTED: vacuolar-sorting receptor 1 [Brachypodium distachyon]
Length=623

 Score =   256 bits (654),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 158/185 (85%), Gaps = 1/185 (1%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
            GRFVVEKN+LKV +PD+++GTY+ A+GNFG+PQYGG+M G V YPK NRK CK FD F  
Sbjct  25   GRFVVEKNSLKVTAPDALRGTYECAIGNFGVPQYGGTMVGVVAYPKANRKACKSFDDFDI  84

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            S+ +K GS PTF++VDRGDC F  KAWNAQNAG +AILVADD +E LITMD+PEE G + 
Sbjct  85   SYKAKPGSFPTFLLVDRGDCFFTKKAWNAQNAGVAAILVADDKDEPLITMDTPEESGRA-  143

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
            +++ENITIPSALI KSFG++L+KAV +G+MV+VNLDWRE++PHPD+RVEYE WTNSNDEC
Sbjct  144  DHLENITIPSALITKSFGDRLRKAVNNGDMVNVNLDWRESLPHPDERVEYEFWTNSNDEC  203

Query  626  GYKCD  640
            G KCD
Sbjct  204  GPKCD  208



>ref|XP_008442315.1| PREDICTED: vacuolar-sorting receptor 1 [Cucumis melo]
Length=622

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 154/188 (82%), Gaps = 0/188 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKN+LK+ SPDSIKG Y+ A+GNFG+P+YGG+MTG V YPK N+K CK FD 
Sbjct  18   SCLGRFVVEKNSLKITSPDSIKGVYECAIGNFGVPEYGGTMTGIVHYPKANQKACKSFDD  77

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
             G SF SK GSLPTFV+ DRGDC F +KAWNAQN GA+AILVADD  E LITMDSPEE+ 
Sbjct  78   AGISFKSKPGSLPTFVLADRGDCYFTMKAWNAQNGGAAAILVADDRLEPLITMDSPEEEK  137

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            + +NY++ I IPSALI KS G+ +KKA+  GEMV++NLDW EA+PHPDDRVEYE WTNSN
Sbjct  138  ADANYLKGIAIPSALISKSLGDDIKKALSSGEMVNINLDWTEALPHPDDRVEYEFWTNSN  197

Query  617  DECGYKCD  640
            DECG KCD
Sbjct  198  DECGPKCD  205



>ref|XP_010529936.1| PREDICTED: vacuolar-sorting receptor 1 isoform X1 [Tarenaya hassleriana]
Length=626

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 154/188 (82%), Gaps = 0/188 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            +A GRFVVEKNNLKV SPDSI+G Y+ A+GNFG+PQYGG++ GTVVYP  N+K CK F+ 
Sbjct  18   TALGRFVVEKNNLKVTSPDSIRGIYECAIGNFGVPQYGGTLVGTVVYPSSNQKACKNFED  77

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  SF SK G LPTFV++DRGDC F LKAWNAQ AGA+AILVAD+  E LITMD+PEED 
Sbjct  78   FDVSFKSKPGHLPTFVLIDRGDCYFTLKAWNAQRAGAAAILVADNKVEPLITMDTPEEDN  137

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            + + Y++ ITIPSALI KS G+ +K A+  G MV++NLDW E+VPHPD+RVEYELWTNSN
Sbjct  138  ADAEYLDKITIPSALISKSLGDSIKSALSSGNMVNMNLDWTESVPHPDERVEYELWTNSN  197

Query  617  DECGYKCD  640
            DECG KCD
Sbjct  198  DECGKKCD  205



>ref|XP_010529937.1| PREDICTED: vacuolar-sorting receptor 1 isoform X2 [Tarenaya hassleriana]
Length=624

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 154/188 (82%), Gaps = 0/188 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            +A GRFVVEKNNLKV SPDSI+G Y+ A+GNFG+PQYGG++ GTVVYP  N+K CK F+ 
Sbjct  18   TALGRFVVEKNNLKVTSPDSIRGIYECAIGNFGVPQYGGTLVGTVVYPSSNQKACKNFED  77

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  SF SK G LPTFV++DRGDC F LKAWNAQ AGA+AILVAD+  E LITMD+PEED 
Sbjct  78   FDVSFKSKPGHLPTFVLIDRGDCYFTLKAWNAQRAGAAAILVADNKVEPLITMDTPEEDN  137

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            + + Y++ ITIPSALI KS G+ +K A+  G MV++NLDW E+VPHPD+RVEYELWTNSN
Sbjct  138  ADAEYLDKITIPSALISKSLGDSIKSALSSGNMVNMNLDWTESVPHPDERVEYELWTNSN  197

Query  617  DECGYKCD  640
            DECG KCD
Sbjct  198  DECGKKCD  205



>ref|XP_006296113.1| hypothetical protein CARUB_v10025264mg [Capsella rubella]
 gb|EOA29011.1| hypothetical protein CARUB_v10025264mg [Capsella rubella]
Length=623

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 155/192 (81%), Gaps = 0/192 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKNNL+V SP+SI+G Y+ ALGNFGIPQYGGSM+G V+YPK N+K CK F  
Sbjct  18   SCMGRFVVEKNNLRVTSPESIRGVYECALGNFGIPQYGGSMSGAVLYPKANQKACKNFAD  77

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  SF S+   LPTFV+VDRGDC F LKAWNAQ AGA+ ILVAD+  E+LITMD+PE++ 
Sbjct  78   FDISFRSRVAGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEQLITMDAPEDET  137

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            + ++Y++NITIPSAL+ +S G  +K A+  GE VH++LDWREA+PHP+DRV YELWTNSN
Sbjct  138  TDADYLQNITIPSALVSRSLGSAIKTAIAHGEPVHISLDWREALPHPNDRVAYELWTNSN  197

Query  617  DECGYKCDMLMK  652
            DECG KCD  ++
Sbjct  198  DECGPKCDAQIQ  209



>emb|CAN66483.1| hypothetical protein VITISV_015390 [Vitis vinifera]
Length=625

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 156/188 (83%), Gaps = 0/188 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKN+L+V SP+S+K  Y+ A+GNFG+PQYGG+M GTVVYPK N+K CK F+ 
Sbjct  18   SCVGRFVVEKNSLRVTSPESLKDVYECAIGNFGVPQYGGTMVGTVVYPKANQKACKSFED  77

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
               SF SK G LPTF++ DRGDC F LKAWNAQNAGA+AILVADD  E LITMD+PEE+ 
Sbjct  78   VEISFKSKPGGLPTFLLADRGDCFFTLKAWNAQNAGAAAILVADDKIEPLITMDTPEEEN  137

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            + ++Y++NITIPSALI KSFG+ +K A+  G+MV++NLDWRE++PHPD+RVEYE WTNSN
Sbjct  138  AHADYLQNITIPSALISKSFGDSIKNALSKGDMVNINLDWRESLPHPDERVEYEFWTNSN  197

Query  617  DECGYKCD  640
            DECG KC+
Sbjct  198  DECGPKCE  205



>ref|XP_006398566.1| hypothetical protein EUTSA_v10015537mg [Eutrema salsugineum]
 gb|ESQ40019.1| hypothetical protein EUTSA_v10015537mg [Eutrema salsugineum]
Length=627

 Score =   255 bits (651),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 155/192 (81%), Gaps = 0/192 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKNNL+V SP+SI+G Y+ ALGNFG+PQYGGSM+G VVYPK N K CK FD 
Sbjct  22   SCTGRFVVEKNNLRVTSPESIRGIYECALGNFGVPQYGGSMSGAVVYPKANHKSCKNFDD  81

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  SF S+   LPTFV+VDRGDC F LKAWNAQ AGA+ ILVAD+  E LITMDSPE++ 
Sbjct  82   FDISFRSRVAGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEPLITMDSPEDET  141

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            + ++Y++NITIPSAL+ +S G+ +K A+  GE VH++LDWREA+PHP+DRV YELWTNSN
Sbjct  142  ADADYLQNITIPSALVSRSLGDAIKTAIAHGEPVHISLDWREALPHPNDRVAYELWTNSN  201

Query  617  DECGYKCDMLMK  652
            DECG KCD  ++
Sbjct  202  DECGPKCDAQIR  213



>ref|XP_008792241.1| PREDICTED: vacuolar-sorting receptor 1-like [Phoenix dactylifera]
Length=620

 Score =   254 bits (650),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 155/188 (82%), Gaps = 0/188 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S+ GRFVVEKN+LKV SP+S+KG Y+ A+GNFG+PQYGG+M G VVYPK NRK C+ FD 
Sbjct  17   SSLGRFVVEKNSLKVTSPESLKGIYECAIGNFGVPQYGGTMVGIVVYPKANRKACQSFDD  76

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  SF  K G  PTF++VDRGDC F  KAW AQNAGA+AILVADD  E LITMD+P E+ 
Sbjct  77   FDISFKPKPGGFPTFLLVDRGDCFFTSKAWKAQNAGAAAILVADDKVEPLITMDTPGEES  136

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
              ++Y++NITIPSALI KSFG+ LKKA+++G+MV VNLDWRE++PHPD+RVEYE WTNSN
Sbjct  137  GGADYLQNITIPSALISKSFGDNLKKALENGDMVSVNLDWRESLPHPDERVEYEFWTNSN  196

Query  617  DECGYKCD  640
            DECG KCD
Sbjct  197  DECGPKCD  204



>ref|XP_002267833.2| PREDICTED: vacuolar-sorting receptor 1 [Vitis vinifera]
 emb|CBI18031.3| unnamed protein product [Vitis vinifera]
Length=624

 Score =   254 bits (650),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 156/188 (83%), Gaps = 0/188 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKN+L+V SP+S+K  Y+ A+GNFG+PQYGG+M GTVVYPK N+K CK F+ 
Sbjct  18   SCVGRFVVEKNSLRVTSPESLKDVYECAIGNFGVPQYGGTMVGTVVYPKANQKACKSFED  77

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
               SF SK G LPTF++ DRGDC F LKAWNAQNAGA+AILVADD  E LITMD+PEE+ 
Sbjct  78   VEISFKSKPGGLPTFLLADRGDCFFTLKAWNAQNAGAAAILVADDKIEPLITMDTPEEEN  137

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            + ++Y++NITIPSALI KSFG+ +K A+  G+MV++NLDWRE++PHPD+RVEYE WTNSN
Sbjct  138  AHADYLQNITIPSALISKSFGDSIKNALSKGDMVNINLDWRESLPHPDERVEYEFWTNSN  197

Query  617  DECGYKCD  640
            DECG KC+
Sbjct  198  DECGPKCE  205



>ref|XP_010510382.1| PREDICTED: vacuolar-sorting receptor 2-like [Camelina sativa]
Length=625

 Score =   254 bits (650),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 126/192 (66%), Positives = 157/192 (82%), Gaps = 0/192 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKNNL+V SP+SI+G Y+ ALGNFG+PQYGGSM+G V+YPK N+K CK FDG
Sbjct  20   SCMGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVLYPKANQKACKNFDG  79

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  SF S+   LPTFV+VDRGDC F LKAWNAQ AGA+ ILVAD+  E+LITMD+PE++ 
Sbjct  80   FDISFRSRVAGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEQLITMDAPEDET  139

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            + ++Y++NITIPSAL+ +S G  +K A+  GE VH++LDWREA+PHP+DRV YELWTNSN
Sbjct  140  TDADYLQNITIPSALVSRSLGSAIKTAIAHGEPVHISLDWREALPHPNDRVAYELWTNSN  199

Query  617  DECGYKCDMLMK  652
            DECG KCD  ++
Sbjct  200  DECGPKCDAQIQ  211



>ref|XP_010931377.1| PREDICTED: vacuolar-sorting receptor 1-like [Elaeis guineensis]
Length=620

 Score =   254 bits (650),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 157/188 (84%), Gaps = 0/188 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S+ GRFVVEKN+LKV SP+S+KGT++ A+GNFG+PQYGG+M G V YPK NRK CK FD 
Sbjct  17   SSFGRFVVEKNSLKVTSPESLKGTHECAIGNFGVPQYGGTMVGIVSYPKANRKACKSFDD  76

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  SF SK G  PTF+++DRGDC F  KAWNAQNAGA+AILVADD  E LITMD+PE+  
Sbjct  77   FDISFKSKPGGFPTFLLLDRGDCYFTEKAWNAQNAGAAAILVADDKVENLITMDTPEQYS  136

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
               +Y++NITIPSALI KSFG+ LKKA+++G+MV+VNLDWRE++PHPD+RVEYE WTNSN
Sbjct  137  GGESYLQNITIPSALISKSFGDDLKKALENGDMVNVNLDWRESLPHPDERVEYEFWTNSN  196

Query  617  DECGYKCD  640
            DECG KCD
Sbjct  197  DECGPKCD  204



>ref|XP_010414284.1| PREDICTED: vacuolar-sorting receptor 2 [Camelina sativa]
Length=625

 Score =   254 bits (650),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 156/192 (81%), Gaps = 0/192 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKNNL+V SP+SI+G Y+ ALGNFG+PQYGGSM+G V+YPK N+K CK FD 
Sbjct  20   SCMGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVLYPKANQKACKNFDD  79

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  SF S+   LPTFV+VDRGDC F LKAWNAQ AGA+ ILVAD+  E+LITMD+PE++ 
Sbjct  80   FDISFRSRVAGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEQLITMDAPEDET  139

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            + ++Y++NITIPSAL+ +S G  +K A+  GE VH++LDWREA+PHP+DRV YELWTNSN
Sbjct  140  TDADYLQNITIPSALVSRSLGSAIKTAIAHGEPVHISLDWREALPHPNDRVAYELWTNSN  199

Query  617  DECGYKCDMLMK  652
            DECG KCD  ++
Sbjct  200  DECGPKCDAQIQ  211



>ref|XP_009801642.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Nicotiana 
sylvestris]
Length=624

 Score =   254 bits (649),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 127/185 (69%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
            GRFVVEKN+L+V SPDSIK  Y+ A+GNFG+PQYGG++ G VVYPK N+K CK F+    
Sbjct  21   GRFVVEKNSLRVTSPDSIKDVYECAIGNFGVPQYGGTLVGNVVYPKANQKSCKSFESADI  80

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            SF SKAGS+P FV+VDRGDC F LKAWNAQ AGA+AILVADD  E LITMD+PEE+ + +
Sbjct  81   SFKSKAGSMPVFVLVDRGDCYFTLKAWNAQKAGAAAILVADDRSEPLITMDTPEEEDAQA  140

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
            NY++NITIPSALI +S G+ +KK +  GEMV++NLDWREA+PHPD+RVEYE WTNSNDEC
Sbjct  141  NYLQNITIPSALISQSLGDSIKKQLSKGEMVNINLDWREALPHPDERVEYEFWTNSNDEC  200

Query  626  GYKCD  640
            G KC+
Sbjct  201  GPKCE  205



>ref|XP_007033523.1| Vacuolar sorting receptor isoform 3 [Theobroma cacao]
 gb|EOY04449.1| Vacuolar sorting receptor isoform 3 [Theobroma cacao]
Length=515

 Score =   251 bits (642),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 156/188 (83%), Gaps = 0/188 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            +  GRFVVEKN+LKV SP+SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+  CK FD 
Sbjct  18   NCLGRFVVEKNSLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYPKANQGACKIFDD  77

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  SF SK G LPTF++VDRGDC F +KAWNAQ AGA+AILVAD+ +E LITMD+PEE+ 
Sbjct  78   FDISFKSKPGGLPTFLLVDRGDCFFTMKAWNAQKAGAAAILVADNKDEPLITMDTPEEED  137

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            +S+ YV NITIPSAL+ KS G+ +KKA+  GEMV++NLDW E++PHPD+RVEYE WTNSN
Sbjct  138  ASAEYVLNITIPSALVSKSLGDSIKKALSLGEMVNMNLDWTESLPHPDERVEYEFWTNSN  197

Query  617  DECGYKCD  640
            DECG KCD
Sbjct  198  DECGPKCD  205



>ref|XP_009801640.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nicotiana 
sylvestris]
Length=626

 Score =   254 bits (648),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/185 (69%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
            GRFVVEKN+L+V SPDSIK  Y+ A+GNFG+PQYGG++ G VVYPK N+K CK F+    
Sbjct  21   GRFVVEKNSLRVTSPDSIKDVYECAIGNFGVPQYGGTLVGNVVYPKANQKSCKSFESADI  80

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            SF SKAGS+P FV+VDRGDC F LKAWNAQ AGA+AILVADD  E LITMD+PEE+ + +
Sbjct  81   SFKSKAGSMPVFVLVDRGDCYFTLKAWNAQKAGAAAILVADDRSEPLITMDTPEEEDAQA  140

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
            NY++NITIPSALI +S G+ +KK +  GEMV++NLDWREA+PHPD+RVEYE WTNSNDEC
Sbjct  141  NYLQNITIPSALISQSLGDSIKKQLSKGEMVNINLDWREALPHPDERVEYEFWTNSNDEC  200

Query  626  GYKCD  640
            G KC+
Sbjct  201  GPKCE  205



>ref|XP_011002594.1| PREDICTED: vacuolar-sorting receptor 1-like [Populus euphratica]
Length=625

 Score =   254 bits (648),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
            GRFVVEKN+LK+ SP+S+KG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CKGFD    
Sbjct  21   GRFVVEKNSLKLTSPESLKGVYECAIGNFGVPQYGGTLVGTVVYPKANQKACKGFDEVDI  80

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            SF S+ G LPTFV+ DRGDC F LKAWNAQN GA+AILVADD  E LITMD+PEED + +
Sbjct  81   SFKSRPGGLPTFVLADRGDCYFTLKAWNAQNGGAAAILVADDKVEPLITMDNPEEDDADA  140

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
             Y++NITIPSALI KS G+ +KKA+ DGEMV++NLDW E++PHPD+RVEYE WTNSND C
Sbjct  141  AYLQNITIPSALISKSLGDSIKKALSDGEMVNMNLDWTESLPHPDERVEYEFWTNSNDAC  200

Query  626  GYKCD  640
            G KCD
Sbjct  201  GPKCD  205



>gb|EMT24279.1| Vacuolar-sorting receptor 1 [Aegilops tauschii]
Length=625

 Score =   254 bits (648),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 156/184 (85%), Gaps = 1/184 (1%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            RFVVEKN+L+V +P+++KG Y+ A+GNFG+PQYGG+M G V YPK NRK CKGFD F  S
Sbjct  27   RFVVEKNSLRVTAPEALKGAYECAIGNFGVPQYGGTMVGVVAYPKANRKACKGFDDFDVS  86

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
            F ++ G+LPTF++VDRGDC F  KAWNAQNAGA+AILVADD +E LITMD+PEE G    
Sbjct  87   FKARPGALPTFLLVDRGDCYFTKKAWNAQNAGAAAILVADDRDEPLITMDTPEESGRVE-  145

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            Y+ENITIPSALI KSFG++LKK + +GEMV+VNLDWRE++PHPD+RVEYE WTNSNDECG
Sbjct  146  YLENITIPSALISKSFGDRLKKTIDNGEMVNVNLDWRESLPHPDERVEYEFWTNSNDECG  205

Query  629  YKCD  640
             KCD
Sbjct  206  PKCD  209



>dbj|BAK03786.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=695

 Score =   255 bits (651),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 156/185 (84%), Gaps = 1/185 (1%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
            GRFVVEKN+LKV +PDS+KG+Y+ A+GNFG+PQYGG+M G V YPK NRK CK FD F  
Sbjct  96   GRFVVEKNSLKVTAPDSLKGSYECAIGNFGVPQYGGTMVGVVAYPKANRKACKSFDDFDI  155

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            S+ +K GSLPTF++VDRGDC F  KAWNAQNAG +AILVADD +E LITMD+PEE G + 
Sbjct  156  SYKAKPGSLPTFLLVDRGDCFFTKKAWNAQNAGVAAILVADDKDEPLITMDTPEESGRA-  214

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
            +Y+ENITI SALI KSFG++L+KAV  G MV+VNLDWRE++PHPD+RVEYE WTNSNDEC
Sbjct  215  DYLENITIASALITKSFGDRLRKAVDSGHMVNVNLDWRESLPHPDERVEYEFWTNSNDEC  274

Query  626  GYKCD  640
            G KCD
Sbjct  275  GPKCD  279



>ref|XP_006290748.1| hypothetical protein CARUB_v10016844mg [Capsella rubella]
 gb|EOA23646.1| hypothetical protein CARUB_v10016844mg [Capsella rubella]
Length=626

 Score =   253 bits (647),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
            A GRFVVEKNNLKV SP+SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CK ++ F
Sbjct  20   ALGRFVVEKNNLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYNDF  79

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
              SF SK G LPTFV++DRGDC F LKAW AQ AGA+AILVAD   E LITMD+PEED S
Sbjct  80   DISFKSKPGRLPTFVLIDRGDCFFTLKAWTAQQAGAAAILVADSKAEPLITMDTPEEDKS  139

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
             ++Y++NITIPSALI KS G+ +K A+  G+MV++ LDW E+VPHPD+RVEYELWTNSND
Sbjct  140  DADYLQNITIPSALITKSLGDSIKSALSGGDMVNMKLDWTESVPHPDERVEYELWTNSND  199

Query  620  ECGYKCD  640
             CG KCD
Sbjct  200  VCGKKCD  206



>ref|XP_002881098.1| hypothetical protein ARALYDRAFT_481940 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57357.1| hypothetical protein ARALYDRAFT_481940 [Arabidopsis lyrata subsp. 
lyrata]
Length=623

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 156/192 (81%), Gaps = 0/192 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKNNL+V SP+SI+G Y+ ALGNFG+PQYGGSM+G VVYPK N+KGCK FD 
Sbjct  19   SCTGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVVYPKANQKGCKNFDD  78

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  SF S+   LPTFV+VDRGDC F LKAWNAQ AGA+ ILVAD+  E+LITMD+PE++ 
Sbjct  79   FEISFRSRLAGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEQLITMDAPEDET  138

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            S ++Y++NITIPSAL+ +S G  +K A+  GE VH++LDWREA+PHP+DRV  ELWTNSN
Sbjct  139  SDADYLQNITIPSALVSRSLGSAIKTAIAHGEPVHISLDWREALPHPNDRVADELWTNSN  198

Query  617  DECGYKCDMLMK  652
            DECG KCD  ++
Sbjct  199  DECGSKCDAQIQ  210



>ref|XP_006362349.1| PREDICTED: vacuolar-sorting receptor 1-like [Solanum tuberosum]
Length=624

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 153/188 (81%), Gaps = 0/188 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKN+L+V SPDSIK  Y+ A+GNFG+PQYGG+M G VVYPK N+K CK F  
Sbjct  18   SCLGRFVVEKNSLRVTSPDSIKDVYECAIGNFGVPQYGGTMVGIVVYPKANQKSCKDFAD  77

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
               SF +KAG +P FV+VDRGDC F LKAWNAQ AGA+AILVADD  E LITMD+PEE+ 
Sbjct  78   SDISFKTKAGGMPVFVLVDRGDCYFTLKAWNAQKAGAAAILVADDRNEPLITMDTPEEED  137

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            + ++Y++NITIPSALI +S G+ +KK +  GEMV++NLDWREA+PHPD+RVEYE WTNSN
Sbjct  138  AKADYLQNITIPSALISQSLGDSIKKQLSKGEMVNINLDWREALPHPDERVEYEFWTNSN  197

Query  617  DECGYKCD  640
            DECG KC+
Sbjct  198  DECGPKCE  205



>dbj|BAB64531.1| vacuolar sorting receptor [Vigna mungo]
Length=619

 Score =   253 bits (645),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 151/192 (79%), Gaps = 3/192 (2%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
               GRFVVEKN+L+V +P S+KGTY+ A+GNFG+P YGG++ G+V+YPK N+KGC  F  
Sbjct  18   CTVGRFVVEKNSLRVTAPSSLKGTYECAIGNFGVPMYGGTLVGSVLYPKVNQKGCLNFTD  77

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEE-D  433
              F         PTF++VDRGDC F LKAWNAQN GA+A+LVADD  E LITMD+PEE  
Sbjct  78   VNFQSKPGG--FPTFLLVDRGDCYFTLKAWNAQNGGAAAVLVADDKAETLITMDTPEEGK  135

Query  434  GSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNS  613
            G+  +YVENI+IPS LI KS G+ +KKA+ DGEMV++NLDWREA+PHPDDRVEYELWTNS
Sbjct  136  GTDDDYVENISIPSVLISKSLGDSIKKALSDGEMVNMNLDWREALPHPDDRVEYELWTNS  195

Query  614  NDECGYKCDMLM  649
            NDECG KCD L+
Sbjct  196  NDECGQKCDSLI  207



>ref|XP_010469873.1| PREDICTED: vacuolar-sorting receptor 2-like [Camelina sativa]
Length=625

 Score =   253 bits (645),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 157/192 (82%), Gaps = 0/192 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKNNL+V SP+SI+G Y+ ALGNFG+PQYGGSM+G V+YPK N+K CK FDG
Sbjct  20   SCMGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVLYPKANQKACKNFDG  79

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  SF S+   LPTFV+VDRGDC F LKAWNAQ AGA+ ILVAD+  E+LITMD+PE++ 
Sbjct  80   FDISFRSRVAGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEQLITMDAPEDET  139

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            + ++Y++NITIPSAL+ +S G  +K A+  GE VH++LDWR+A+PHP+DRV YELWTNSN
Sbjct  140  TDADYLQNITIPSALVSRSLGSAIKTAIAHGEPVHISLDWRKALPHPNDRVAYELWTNSN  199

Query  617  DECGYKCDMLMK  652
            DECG KCD  ++
Sbjct  200  DECGPKCDAQIQ  211



>ref|XP_002528694.1| Vacuolar sorting receptor 1 precursor, putative [Ricinus communis]
 gb|EEF33683.1| Vacuolar sorting receptor 1 precursor, putative [Ricinus communis]
Length=625

 Score =   253 bits (645),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 155/191 (81%), Gaps = 0/191 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKN+L+V SPDS+KG ++ A+GNFG+PQYGG++ GTVVYPK N+K CKGFD 
Sbjct  18   SCLGRFVVEKNSLRVTSPDSVKGIHECAIGNFGVPQYGGTLVGTVVYPKANQKACKGFDE  77

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
               SF SK G LPTF++ DRGDC F LKAWNAQN GA+AILVADD  E LITMD+PEE+ 
Sbjct  78   VDISFKSKPGGLPTFLLADRGDCYFTLKAWNAQNGGAAAILVADDKLEPLITMDTPEEEN  137

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            + ++Y++ I IPSALI KS G+ +KKA+  GEMV++NLDW EA+PHPD+RVEYE WTNSN
Sbjct  138  ADADYLQKINIPSALITKSLGDSIKKALSGGEMVNINLDWTEALPHPDERVEYEFWTNSN  197

Query  617  DECGYKCDMLM  649
            DECG KCD  M
Sbjct  198  DECGPKCDSQM  208



>ref|XP_010327707.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Solanum 
lycopersicum]
Length=624

 Score =   252 bits (644),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 153/188 (81%), Gaps = 0/188 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKN+L+V SPDSIK  Y+ A+GNFG+PQYGG+M G V+YPK N+K CK F  
Sbjct  18   SCLGRFVVEKNSLRVTSPDSIKNVYECAIGNFGVPQYGGTMVGIVMYPKANQKSCKDFAD  77

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
               SF +KAG +P FV+VDRGDC F LKAWNAQ AGA+AILVADD  E LITMD+PEE+ 
Sbjct  78   SDISFKTKAGGMPVFVLVDRGDCYFTLKAWNAQKAGAAAILVADDRNEPLITMDTPEEED  137

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            + ++Y++NITIPSALI +S G+ +KK +  GEMV++NLDWREA+PHPD+RVEYE WTNSN
Sbjct  138  AKADYLQNITIPSALISQSLGDSIKKQLSKGEMVNINLDWREALPHPDERVEYEFWTNSN  197

Query  617  DECGYKCD  640
            DECG KC+
Sbjct  198  DECGPKCE  205



>ref|XP_011095146.1| PREDICTED: vacuolar-sorting receptor 1-like [Sesamum indicum]
Length=624

 Score =   252 bits (644),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 151/188 (80%), Gaps = 0/188 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKN+LKV SPDS+KG ++ A+GNFG+PQYGG++ G+V YPK N+K C  F  
Sbjct  18   SCFGRFVVEKNSLKVASPDSLKGLHECAIGNFGVPQYGGTLVGSVFYPKSNQKACTNFQD  77

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
               SF +K G +P F++ DRGDC F LKAWNAQN GA+AILVADD  E LITMD+PEE+ 
Sbjct  78   VDLSFQTKPGGIPIFLLADRGDCYFTLKAWNAQNGGAAAILVADDRVEPLITMDTPEEED  137

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            + ++Y++NITIPSALI K  G+K+KK +  GEMV +NLDWREA+PHPD+RVEYELWTNSN
Sbjct  138  ARADYLQNITIPSALISKDLGDKIKKELSKGEMVSINLDWREALPHPDERVEYELWTNSN  197

Query  617  DECGYKCD  640
            DECG KCD
Sbjct  198  DECGPKCD  205



>ref|XP_010327706.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Solanum 
lycopersicum]
Length=626

 Score =   252 bits (644),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 153/188 (81%), Gaps = 0/188 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKN+L+V SPDSIK  Y+ A+GNFG+PQYGG+M G V+YPK N+K CK F  
Sbjct  18   SCLGRFVVEKNSLRVTSPDSIKNVYECAIGNFGVPQYGGTMVGIVMYPKANQKSCKDFAD  77

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
               SF +KAG +P FV+VDRGDC F LKAWNAQ AGA+AILVADD  E LITMD+PEE+ 
Sbjct  78   SDISFKTKAGGMPVFVLVDRGDCYFTLKAWNAQKAGAAAILVADDRNEPLITMDTPEEED  137

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            + ++Y++NITIPSALI +S G+ +KK +  GEMV++NLDWREA+PHPD+RVEYE WTNSN
Sbjct  138  AKADYLQNITIPSALISQSLGDSIKKQLSKGEMVNINLDWREALPHPDERVEYEFWTNSN  197

Query  617  DECGYKCD  640
            DECG KC+
Sbjct  198  DECGPKCE  205



>gb|KHN40635.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=618

 Score =   252 bits (643),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 152/187 (81%), Gaps = 2/187 (1%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            RFVVEKN+LKV SP S+KGTY+ A+GNFG+P+YGG++ G+V+YPK N+KGC  F    F 
Sbjct  22   RFVVEKNSLKVTSPKSLKGTYECAIGNFGVPKYGGTLVGSVLYPKVNQKGCTNFSDVNFQ  81

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
                   LPTF++VDRGDC F LKAWNAQN GA+AILVADD  E LITMD+PEE  ++ +
Sbjct  82   SKPGG--LPTFLLVDRGDCYFTLKAWNAQNGGAAAILVADDKAETLITMDTPEEGKANDD  139

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            YV+ I+IPSALI KS G+ +K+A+ DGEMV++NLDWRE++PHPDDRVEYELWTNSNDECG
Sbjct  140  YVDKISIPSALISKSLGDSIKQALSDGEMVNINLDWRESLPHPDDRVEYELWTNSNDECG  199

Query  629  YKCDMLM  649
             KCD L+
Sbjct  200  PKCDSLI  206



>ref|XP_003552313.1| PREDICTED: vacuolar-sorting receptor 1-like [Glycine max]
Length=619

 Score =   252 bits (643),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 152/187 (81%), Gaps = 2/187 (1%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            RFVVEKN+LKV SP S+KGTY+ A+GNFG+P+YGG++ G+V+YPK N+KGC  F    F 
Sbjct  23   RFVVEKNSLKVTSPKSLKGTYECAIGNFGVPKYGGTLVGSVLYPKVNQKGCTNFSDVNFQ  82

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
                   LPTF++VDRGDC F LKAWNAQN GA+AILVADD  E LITMD+PEE  ++ +
Sbjct  83   SKPGG--LPTFLLVDRGDCYFTLKAWNAQNGGAAAILVADDKAETLITMDTPEEGKANDD  140

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            YV+ I+IPSALI KS G+ +K+A+ DGEMV++NLDWRE++PHPDDRVEYELWTNSNDECG
Sbjct  141  YVDKISIPSALISKSLGDSIKQALSDGEMVNINLDWRESLPHPDDRVEYELWTNSNDECG  200

Query  629  YKCDMLM  649
             KCD L+
Sbjct  201  PKCDSLI  207



>dbj|BAK00302.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=642

 Score =   252 bits (644),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 156/184 (85%), Gaps = 1/184 (1%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            RFVVEKN+L+V +P ++KG Y+ A+GNFG+PQYGG+M G V YPK NRK CKGFD F  S
Sbjct  44   RFVVEKNSLRVTAPVALKGAYECAIGNFGVPQYGGTMVGVVAYPKANRKACKGFDDFDVS  103

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
            F ++ G+LPTF++VDRGDC F  KAWNAQNAGA+AILVADD +E LITMD+PEE G    
Sbjct  104  FKARPGALPTFLLVDRGDCYFTKKAWNAQNAGAAAILVADDRDEPLITMDTPEESGRVE-  162

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            Y+ENITIPSALI KSFG++LKKA+ +G+MV+VNLDWRE++PHPD+RVEYE WTNSNDECG
Sbjct  163  YLENITIPSALISKSFGDRLKKAIDNGDMVNVNLDWRESLPHPDERVEYEFWTNSNDECG  222

Query  629  YKCD  640
             KCD
Sbjct  223  PKCD  226



>gb|KJB29888.1| hypothetical protein B456_005G122400 [Gossypium raimondii]
Length=621

 Score =   251 bits (642),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 156/192 (81%), Gaps = 0/192 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            +  GRFVVE+N+LKV SP SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+  CK FD 
Sbjct  18   NCLGRFVVEENSLKVTSPGSIKGVYECAIGNFGVPQYGGTLVGTVVYPKANQGACKIFDE  77

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  SF SK G LPTF++V+RGDC F LKAWNAQ AGA+A+LVAD+ +E LITMD+PEE  
Sbjct  78   FDISFKSKPGGLPTFLLVNRGDCFFTLKAWNAQKAGAAAVLVADNQDESLITMDTPEEKN  137

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            +S+ Y++NITIPSALI KS G+ LKKA+  GEMV ++LDW E++PHPD+RVEYE WTNSN
Sbjct  138  ASAKYLQNITIPSALISKSLGDSLKKAITFGEMVKISLDWTESLPHPDERVEYEFWTNSN  197

Query  617  DECGYKCDMLMK  652
            DECG KCD  M+
Sbjct  198  DECGPKCDSQME  209



>gb|KJB29887.1| hypothetical protein B456_005G122400 [Gossypium raimondii]
Length=621

 Score =   251 bits (642),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 156/192 (81%), Gaps = 0/192 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            +  GRFVVE+N+LKV SP SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+  CK FD 
Sbjct  18   NCLGRFVVEENSLKVTSPGSIKGVYECAIGNFGVPQYGGTLVGTVVYPKANQGACKIFDE  77

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  SF SK G LPTF++V+RGDC F LKAWNAQ AGA+A+LVAD+ +E LITMD+PEE  
Sbjct  78   FDISFKSKPGGLPTFLLVNRGDCFFTLKAWNAQKAGAAAVLVADNQDESLITMDTPEEKN  137

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            +S+ Y++NITIPSALI KS G+ LKKA+  GEMV ++LDW E++PHPD+RVEYE WTNSN
Sbjct  138  ASAKYLQNITIPSALISKSLGDSLKKAITFGEMVKISLDWTESLPHPDERVEYEFWTNSN  197

Query  617  DECGYKCDMLMK  652
            DECG KCD  M+
Sbjct  198  DECGPKCDSQME  209



>gb|KJB29886.1| hypothetical protein B456_005G122400 [Gossypium raimondii]
Length=623

 Score =   251 bits (642),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 156/192 (81%), Gaps = 0/192 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            +  GRFVVE+N+LKV SP SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+  CK FD 
Sbjct  18   NCLGRFVVEENSLKVTSPGSIKGVYECAIGNFGVPQYGGTLVGTVVYPKANQGACKIFDE  77

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  SF SK G LPTF++V+RGDC F LKAWNAQ AGA+A+LVAD+ +E LITMD+PEE  
Sbjct  78   FDISFKSKPGGLPTFLLVNRGDCFFTLKAWNAQKAGAAAVLVADNQDESLITMDTPEEKN  137

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            +S+ Y++NITIPSALI KS G+ LKKA+  GEMV ++LDW E++PHPD+RVEYE WTNSN
Sbjct  138  ASAKYLQNITIPSALISKSLGDSLKKAITFGEMVKISLDWTESLPHPDERVEYEFWTNSN  197

Query  617  DECGYKCDMLMK  652
            DECG KCD  M+
Sbjct  198  DECGPKCDSQME  209



>ref|XP_007033521.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
 ref|XP_007033522.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
 gb|EOY04447.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
 gb|EOY04448.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
Length=621

 Score =   251 bits (641),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 156/188 (83%), Gaps = 0/188 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            +  GRFVVEKN+LKV SP+SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+  CK FD 
Sbjct  18   NCLGRFVVEKNSLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYPKANQGACKIFDD  77

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  SF SK G LPTF++VDRGDC F +KAWNAQ AGA+AILVAD+ +E LITMD+PEE+ 
Sbjct  78   FDISFKSKPGGLPTFLLVDRGDCFFTMKAWNAQKAGAAAILVADNKDEPLITMDTPEEED  137

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            +S+ YV NITIPSAL+ KS G+ +KKA+  GEMV++NLDW E++PHPD+RVEYE WTNSN
Sbjct  138  ASAEYVLNITIPSALVSKSLGDSIKKALSLGEMVNMNLDWTESLPHPDERVEYEFWTNSN  197

Query  617  DECGYKCD  640
            DECG KCD
Sbjct  198  DECGPKCD  205



>ref|XP_006429591.1| hypothetical protein CICLE_v10011298mg [Citrus clementina]
 ref|XP_006481200.1| PREDICTED: vacuolar-sorting receptor 1-like [Citrus sinensis]
 gb|ESR42831.1| hypothetical protein CICLE_v10011298mg [Citrus clementina]
Length=623

 Score =   251 bits (640),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 153/185 (83%), Gaps = 0/185 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
            GRFVVEKN+LKV SP+ IKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CKGFD    
Sbjct  21   GRFVVEKNSLKVTSPEKIKGVYECAIGNFGVPQYGGTLIGTVVYPKANQKACKGFDEVDL  80

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            SF S+ G LPTF++VDRGDC F LKAWNAQ  GA+AILVADD  E LITMD+PEE+ + +
Sbjct  81   SFKSRPGGLPTFLLVDRGDCYFTLKAWNAQKGGAAAILVADDKTEPLITMDTPEEENADA  140

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
             Y++NITIPSALI KS G+ +KK++  GEMV++NLDW EA+PHPD+RVEYE WTNSNDEC
Sbjct  141  EYLQNITIPSALISKSLGDSIKKSLSGGEMVNMNLDWTEALPHPDERVEYEFWTNSNDEC  200

Query  626  GYKCD  640
            G KC+
Sbjct  201  GPKCE  205



>ref|XP_006664280.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=698

 Score =   252 bits (644),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 156/185 (84%), Gaps = 1/185 (1%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
            G F+VEKN+L+V +P  +KGTY+ A+GNFG+PQYGG+M G V YPK N+K CK FD F  
Sbjct  99   GGFLVEKNSLRVTAPSDLKGTYECAIGNFGVPQYGGTMVGVVTYPKANKKACKSFDDFDI  158

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            S+  K GSLPTF++VDRGDC F  KAWNAQNAGA+AILVADD  E LITMD+PEE G++ 
Sbjct  159  SYKPKPGSLPTFLLVDRGDCFFTKKAWNAQNAGAAAILVADDKTEPLITMDTPEESGNT-  217

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
            +Y+ENITIPSALI KSFG+KLKKA+ +G+MV+VNLDWRE++PHPD+RVEYE WTNSNDEC
Sbjct  218  DYLENITIPSALITKSFGDKLKKAIDNGDMVNVNLDWRESLPHPDERVEYEFWTNSNDEC  277

Query  626  GYKCD  640
            G KCD
Sbjct  278  GPKCD  282



>ref|XP_003534638.1| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine 
max]
 gb|KHN29499.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=619

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 151/187 (81%), Gaps = 2/187 (1%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            RFVVEKN+LKV SP S+KGTY+ A+GNFG+P+YGG++ G+V+YPK N+KGC  F    F 
Sbjct  23   RFVVEKNSLKVTSPKSLKGTYECAIGNFGVPKYGGTLVGSVLYPKVNQKGCTNFSDVNFQ  82

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
                    PTF++VDRGDC F LKAWNAQN GA+AILVADD  E LITMD+PEE  ++ +
Sbjct  83   SKPGG--FPTFLLVDRGDCYFTLKAWNAQNGGAAAILVADDKAETLITMDTPEEGKANDD  140

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            YV+ I+IPSALI KS G+ +K+A+ DGEMV++NLDWRE++PHPDDRVEYELWTNSNDECG
Sbjct  141  YVDKISIPSALISKSLGDSIKQALSDGEMVNINLDWRESLPHPDDRVEYELWTNSNDECG  200

Query  629  YKCDMLM  649
             KCD L+
Sbjct  201  PKCDSLI  207



>ref|XP_006663158.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=653

 Score =   251 bits (641),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 157/188 (84%), Gaps = 1/188 (1%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            +  G FVVEKN+L+V +P  +KGTY+ A+GNFG+PQYGG+M G V YPK N+K CK FD 
Sbjct  51   ACRGGFVVEKNSLRVTAPSDLKGTYECAIGNFGVPQYGGTMVGVVAYPKANKKACKSFDD  110

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  S+  K GSLPTF++VDRGDC F  KAWNAQ+AGA+AILVADD  E LITMD+PEE G
Sbjct  111  FDISYKPKPGSLPTFLLVDRGDCFFTKKAWNAQSAGAAAILVADDKTEPLITMDTPEESG  170

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            ++ +Y+ENITIPSALI KSFG+KLKKA+ +G+MV+VNLDWRE++PHPD+RVEYE WTNSN
Sbjct  171  NT-DYLENITIPSALITKSFGDKLKKAIDNGDMVNVNLDWRESLPHPDERVEYEFWTNSN  229

Query  617  DECGYKCD  640
            DECG KCD
Sbjct  230  DECGPKCD  237



>emb|CDP06387.1| unnamed protein product [Coffea canephora]
Length=628

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 154/188 (82%), Gaps = 0/188 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S +GRFVVEKN+LK+ SPDS+K  Y+ A+GNFG+PQYGG+M GTVVYPK ++K CK FD 
Sbjct  22   SCSGRFVVEKNSLKITSPDSLKRVYECAIGNFGVPQYGGTMIGTVVYPKADQKACKSFDD  81

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
               SF SK G  PTF++ DRGDC F LKAWNAQ AGA+AILVADD +E LITMD+PEE+ 
Sbjct  82   VDISFKSKPGGRPTFLLADRGDCYFTLKAWNAQKAGAAAILVADDRDEPLITMDNPEEED  141

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            + ++Y+++ITIPSALI KS G+K+K  +  GEMV +NLDWREA+PHPDDRVEYE WTNSN
Sbjct  142  AQADYLQSITIPSALISKSLGDKIKNELSKGEMVSINLDWREALPHPDDRVEYEFWTNSN  201

Query  617  DECGYKCD  640
            DECG KC+
Sbjct  202  DECGPKCE  209



>gb|KDP21863.1| hypothetical protein JCGZ_00650 [Jatropha curcas]
Length=622

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 153/192 (80%), Gaps = 0/192 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKN+LKV SPDS++G Y+ A+GNFG+PQYGG++ GTVVYPK N+K CK FD 
Sbjct  18   SCFGRFVVEKNSLKVTSPDSVRGIYECAIGNFGVPQYGGTLVGTVVYPKANQKACKEFDE  77

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
               SF SK G LPTFV+VDRGDC F  KAWNAQ  GA+AILV+DD  E LITMD+PEE+ 
Sbjct  78   ADGSFKSKPGGLPTFVLVDRGDCYFTSKAWNAQRGGAAAILVSDDKIEPLITMDTPEEEN  137

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            + + Y++ I IPSALI KS G+ +KKA+  GEMV+VNLDW EA+PHPD+RVEYE WTNSN
Sbjct  138  ADAEYLQKINIPSALISKSLGDSIKKALAAGEMVNVNLDWTEALPHPDERVEYEFWTNSN  197

Query  617  DECGYKCDMLMK  652
            DECG KCD  M+
Sbjct  198  DECGPKCDSQME  209



>ref|XP_004302536.1| PREDICTED: vacuolar-sorting receptor 1-like [Fragaria vesca subsp. 
vesca]
Length=625

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
              GRFVVEKN+LKV SP+S+K  Y+ A+GNFG+PQYGG++ GTV YPK N+K CKGF+ F
Sbjct  19   CVGRFVVEKNSLKVTSPNSLKNVYECAIGNFGVPQYGGTLVGTVFYPKANQKACKGFEDF  78

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
              SF SK G LPTF++ DRGDC F LKAWNAQN GA+AILVADD  E LITMD+PEE+ +
Sbjct  79   DISFKSKPGGLPTFLLADRGDCYFTLKAWNAQNGGAAAILVADDRTEPLITMDTPEEENA  138

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
             ++Y++ I IPSALI KS G+ +KKA+ DGEMV++NLDW EA+PHPD+RVEYE WTNSND
Sbjct  139  DADYLQKIAIPSALISKSLGDSIKKALSDGEMVNINLDWTEALPHPDERVEYEFWTNSND  198

Query  620  ECGYKCD  640
            ECG KCD
Sbjct  199  ECGPKCD  205



>ref|XP_009143376.1| PREDICTED: vacuolar-sorting receptor 1-like [Brassica rapa]
Length=620

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 155/189 (82%), Gaps = 0/189 (0%)
 Frame = +2

Query  74   ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfd  253
            E A G F+VEKNNLKV SPDSIKG Y+ A+GNFGIP+YGG++ GTVVYP  N KGCK F 
Sbjct  15   ELAFGTFLVEKNNLKVTSPDSIKGVYECAIGNFGIPKYGGTLVGTVVYPMSNHKGCKSFS  74

Query  254  gfgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  433
             FG SF S  GSLPTF+++DRGDC FALKAWNAQ AGA+AILV+D+  E LITMD+PEED
Sbjct  75   EFGVSFKSSPGSLPTFLLIDRGDCYFALKAWNAQQAGAAAILVSDNKLEPLITMDTPEED  134

Query  434  GSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNS  613
             ++++Y+E I IPSALI KS G+ +K A+ DG MV++ LDW E+VPHPD+RVEYELWT+S
Sbjct  135  TANADYLEKINIPSALISKSLGDSIKSAISDGNMVNMKLDWTESVPHPDERVEYELWTDS  194

Query  614  NDECGYKCD  640
            NDECG KCD
Sbjct  195  NDECGKKCD  203



>gb|KHG23770.1| Vacuolar-sorting receptor 1 -like protein [Gossypium arboreum]
Length=621

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 155/192 (81%), Gaps = 0/192 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            +  GRFVVE+N+LKV SP SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+  CK FD 
Sbjct  18   NCLGRFVVEENSLKVTSPGSIKGVYECAIGNFGVPQYGGTLVGTVVYPKANQGACKIFDE  77

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  SF SK G LPTF++V+RGDC F LKAWNAQ AGA+AILVAD+ +E LITMD+PEE  
Sbjct  78   FDISFKSKPGGLPTFLLVNRGDCFFTLKAWNAQKAGAAAILVADNQDESLITMDTPEEKN  137

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            +S+ Y++NITIPSALI KS G+ LK A+  GEMV ++LDW E++PHPD+RVEYE WTNSN
Sbjct  138  ASAEYLQNITIPSALISKSLGDSLKNAITFGEMVKISLDWTESLPHPDERVEYEFWTNSN  197

Query  617  DECGYKCDMLMK  652
            DECG KCD  M+
Sbjct  198  DECGPKCDSQME  209



>ref|XP_009611966.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=624

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 154/188 (82%), Gaps = 0/188 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKN+L+V SP+SIK  Y+ A+GNFG+PQYGG++ G V YPK N+K CK F+ 
Sbjct  18   SCYGRFVVEKNSLRVTSPESIKDVYECAIGNFGVPQYGGTLVGNVAYPKANQKSCKSFES  77

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
               SF SKAGS+P FV+VDRGDC F LKAWNAQ AGA+AILVADD  E LITMD+PEE+ 
Sbjct  78   ADISFKSKAGSMPVFVLVDRGDCYFTLKAWNAQKAGAAAILVADDRSEPLITMDTPEEED  137

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            + ++Y++NITIPSALI +S G+ +KK +  GEMV++NLDWREA+PHPD+RVEYE WTNSN
Sbjct  138  AQADYLQNITIPSALISQSLGDSIKKQLSKGEMVNINLDWREALPHPDERVEYEFWTNSN  197

Query  617  DECGYKCD  640
            DECG KC+
Sbjct  198  DECGPKCE  205



>emb|CDX91478.1| BnaC04g06720D [Brassica napus]
Length=620

 Score =   250 bits (638),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 155/189 (82%), Gaps = 0/189 (0%)
 Frame = +2

Query  74   ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfd  253
            E A G F+VEKNNLKV SPDSIKG Y+ A+GNFGIP+YGG++ GTVVYP  N KGCK F 
Sbjct  15   ELAFGTFLVEKNNLKVTSPDSIKGVYECAIGNFGIPKYGGTLVGTVVYPMSNHKGCKSFS  74

Query  254  gfgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  433
             FG SF S  GSLPTF+++DRGDC FALKAWNAQ AGA+AILV+D+  E LITMD+PEED
Sbjct  75   EFGVSFKSSPGSLPTFLLIDRGDCYFALKAWNAQQAGAAAILVSDNKLEPLITMDTPEED  134

Query  434  GSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNS  613
             ++++Y+E I IPSALI KS G+ +K A+ DG MV++ LDW E+VPHPD+RVEYELWT+S
Sbjct  135  TANADYLEKINIPSALISKSLGDSIKSAISDGNMVNMKLDWTESVPHPDERVEYELWTDS  194

Query  614  NDECGYKCD  640
            NDECG KCD
Sbjct  195  NDECGKKCD  203



>ref|XP_009611965.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=626

 Score =   250 bits (639),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 154/188 (82%), Gaps = 0/188 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKN+L+V SP+SIK  Y+ A+GNFG+PQYGG++ G V YPK N+K CK F+ 
Sbjct  18   SCYGRFVVEKNSLRVTSPESIKDVYECAIGNFGVPQYGGTLVGNVAYPKANQKSCKSFES  77

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
               SF SKAGS+P FV+VDRGDC F LKAWNAQ AGA+AILVADD  E LITMD+PEE+ 
Sbjct  78   ADISFKSKAGSMPVFVLVDRGDCYFTLKAWNAQKAGAAAILVADDRSEPLITMDTPEEED  137

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            + ++Y++NITIPSALI +S G+ +KK +  GEMV++NLDWREA+PHPD+RVEYE WTNSN
Sbjct  138  AQADYLQNITIPSALISQSLGDSIKKQLSKGEMVNINLDWREALPHPDERVEYEFWTNSN  197

Query  617  DECGYKCD  640
            DECG KC+
Sbjct  198  DECGPKCE  205



>ref|XP_010543160.1| PREDICTED: vacuolar-sorting receptor 2 [Tarenaya hassleriana]
Length=628

 Score =   250 bits (638),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
            GRFVVEKNNL+V SP+SI+G Y+ A+GNFG+PQYGGSMTG VV+PK N+KGC+ FD F  
Sbjct  23   GRFVVEKNNLRVTSPESIRGIYECAIGNFGVPQYGGSMTGEVVFPKANQKGCQSFDQFDI  82

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            SFSSK G LPTFV+VDRGDC F LKAWNAQ AGA+ ILV D+  E LITMD+PEE+ + +
Sbjct  83   SFSSKPGGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVVDNRPEPLITMDAPEEETADA  142

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
            +Y++NITIPSAL+ KS G  +K A+  GE V ++LDWREA+PHPDDRV+YELWTNSNDEC
Sbjct  143  DYLQNITIPSALVSKSLGNAMKMAIAHGEPVRISLDWREALPHPDDRVQYELWTNSNDEC  202

Query  626  GYKCD  640
            G KCD
Sbjct  203  GPKCD  207



>emb|CDY04821.1| BnaAnng00030D [Brassica napus]
Length=635

 Score =   249 bits (637),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 123/192 (64%), Positives = 154/192 (80%), Gaps = 0/192 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKN+L+V SP+SI+G Y+ ALGNFG+PQYGGSM+G+VVYPK N+K CK F+ 
Sbjct  29   SCMGRFVVEKNSLRVTSPESIRGIYECALGNFGVPQYGGSMSGSVVYPKANQKACKNFED  88

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  SF S+   LPTFV+VDRGDC F LKAWNAQ AGA+ ILVAD+  E LITMD+PE++ 
Sbjct  89   FDISFRSRVSGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEPLITMDAPEDET  148

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            + + Y++NITIPSAL+ +S G  +K A+  GE V ++LDWREA+PHP+DRV YELWTNSN
Sbjct  149  ADAEYLQNITIPSALLSRSLGSAIKTAIDQGEPVRISLDWREALPHPNDRVAYELWTNSN  208

Query  617  DECGYKCDMLMK  652
            DECG KCD  ++
Sbjct  209  DECGSKCDAQIR  220



>ref|XP_006341299.1| PREDICTED: vacuolar-sorting receptor 1 isoform X2 [Solanum tuberosum]
Length=578

 Score =   248 bits (633),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 150/188 (80%), Gaps = 0/188 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
               GRFVVEKN+L+V SPDSIK  Y+ A+GNFG+PQYGG+M G V+YPK N+K CK F  
Sbjct  16   CCMGRFVVEKNSLRVTSPDSIKEVYECAIGNFGVPQYGGTMVGNVMYPKTNQKSCKNFSD  75

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F   + SK G +P F++VDRGDC F LKAWNAQ AGA AILVADD  E LITMD+PEE+ 
Sbjct  76   FDIFYKSKPGGMPVFLLVDRGDCFFTLKAWNAQQAGAGAILVADDRVEPLITMDTPEEED  135

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            + ++Y+++ITIPSALI KS G+ +KK +  GEMV++NLDWREA+PHPDDRVEYE WTNSN
Sbjct  136  AKADYLQDITIPSALISKSLGDSIKKELSKGEMVNINLDWREALPHPDDRVEYEFWTNSN  195

Query  617  DECGYKCD  640
            DECG KC+
Sbjct  196  DECGPKCE  203



>ref|XP_004510100.1| PREDICTED: vacuolar-sorting receptor 1-like [Cicer arietinum]
Length=629

 Score =   249 bits (636),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 152/190 (80%), Gaps = 2/190 (1%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKNNLK+ SP S++G Y+ A+GNFG+P+YGG+M GTVVYPK NR GC  F+ 
Sbjct  20   SCVGRFVVEKNNLKITSPKSLRGIYECAIGNFGVPKYGGTMIGTVVYPKFNRNGCNKFND  79

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
               S +SK GS PTFV+VDRGDC F LKAWNAQN GA+AILVADD  E LITMD+PEE  
Sbjct  80   GDTSLTSKPGSFPTFVLVDRGDCYFTLKAWNAQNGGAAAILVADDRIEPLITMDTPEEGN  139

Query  437  SSSN--YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTN  610
             +++  Y+E ITIPSALI KS G+ +K A+  G MV+VNLDWREA+PHPD+RVEYELWT+
Sbjct  140  GANDDDYIEKITIPSALISKSLGDNIKMALSSGAMVNVNLDWREALPHPDERVEYELWTS  199

Query  611  SNDECGYKCD  640
            SNDECG KC+
Sbjct  200  SNDECGPKCE  209



>gb|KFK24686.1| hypothetical protein AALP_AA8G011700 [Arabis alpina]
Length=627

 Score =   249 bits (635),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 153/192 (80%), Gaps = 1/192 (1%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
              GRFVVEKNNL+V SP++I+G Y+ ALGNFG+PQYGGSM G VVYPK N+K CK F+ F
Sbjct  22   CTGRFVVEKNNLRVTSPEAIRGVYECALGNFGVPQYGGSMAGAVVYPKANQKACKNFNDF  81

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
              SF S+   LPTFV+VDRGDC F LKAWNAQ AGA+ ILVAD+  E LITMD+PE++ S
Sbjct  82   DISFRSRLAGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEPLITMDAPEDETS  141

Query  440  S-SNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            + + Y++NITIPSALI +S G  +K A+  GE VH++LDWREA+PHP+DRV YELWTNSN
Sbjct  142  TDAEYLQNITIPSALISRSLGSAIKTAIAHGEPVHISLDWREALPHPNDRVAYELWTNSN  201

Query  617  DECGYKCDMLMK  652
            DECG KCD  ++
Sbjct  202  DECGPKCDAQIR  213



>emb|CDY60753.1| BnaA05g34780D [Brassica napus]
Length=620

 Score =   249 bits (635),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 154/189 (81%), Gaps = 0/189 (0%)
 Frame = +2

Query  74   ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfd  253
            E   G F+VEKNNLKV SPDSIKG Y+ A+GNFGIP+YGG++ GTVVYP  N KGCK F 
Sbjct  15   ELTFGTFLVEKNNLKVTSPDSIKGVYECAIGNFGIPKYGGTLVGTVVYPMSNHKGCKSFS  74

Query  254  gfgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  433
             FG SF S  GSLPTF+++DRGDC FALKAWNAQ AGA+AILV+D+  E LITMD+PEED
Sbjct  75   EFGVSFKSSPGSLPTFLLIDRGDCYFALKAWNAQQAGAAAILVSDNKLEPLITMDTPEED  134

Query  434  GSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNS  613
             ++++Y+E I IPSALI KS G+ +K A+ DG MV++ LDW E+VPHPD+RVEYELWT+S
Sbjct  135  TANADYLEKINIPSALISKSLGDSIKSAISDGNMVNMKLDWTESVPHPDERVEYELWTDS  194

Query  614  NDECGYKCD  640
            NDECG KCD
Sbjct  195  NDECGKKCD  203



>ref|XP_003626680.1| Vacuolar sorting receptor [Medicago truncatula]
 gb|AET01156.1| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=625

 Score =   249 bits (635),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 152/190 (80%), Gaps = 2/190 (1%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKNNLK+ SP S++G Y+ A+GNFG+P+YGG+M GTVVYPK N+ GC  F+ 
Sbjct  18   SCMGRFVVEKNNLKITSPKSLRGIYECAIGNFGVPKYGGTMIGTVVYPKLNKNGCTKFND  77

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
               S +SK GS PTFV+VDRGDC F LKAWNAQ  GA+AILVADD  E LITMD+PEE  
Sbjct  78   ADTSLNSKPGSFPTFVLVDRGDCYFTLKAWNAQIGGAAAILVADDRVEPLITMDTPEEGN  137

Query  437  SSSN--YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTN  610
             ++N  YVE ITIPSALI KS G+ +KKA+  G MV+VNLDWREA+PHPD+RVEYELWT+
Sbjct  138  GATNDDYVEKITIPSALISKSVGDSIKKALSSGGMVNVNLDWREALPHPDERVEYELWTS  197

Query  611  SNDECGYKCD  640
            SNDECG KC+
Sbjct  198  SNDECGPKCE  207



>ref|XP_009611473.1| PREDICTED: vacuolar-sorting receptor 1-like [Nicotiana tomentosiformis]
Length=623

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 152/188 (81%), Gaps = 0/188 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKN+L+V SP SIK  Y+ A+GNFG+PQYGG+M G V+YPK N+K CK F  
Sbjct  18   SCLGRFVVEKNSLRVTSPSSIKDVYECAIGNFGVPQYGGTMVGIVMYPKANQKSCKNFTD  77

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  SF SK G++P F++VDRGDC F LKAWNAQ AGA AILVADD  E LITMD+PEE+ 
Sbjct  78   FDISFKSKPGAMPVFLLVDRGDCYFTLKAWNAQRAGAGAILVADDRVEPLITMDTPEEED  137

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            + ++Y++NITIPSALI KS G+ +KK +  GEMV++NLDWREA+PHPD+RVEYE WTNSN
Sbjct  138  AQADYLQNITIPSALISKSLGDSIKKELSRGEMVNINLDWREALPHPDERVEYEFWTNSN  197

Query  617  DECGYKCD  640
            DECG KC+
Sbjct  198  DECGPKCE  205



>ref|XP_009775401.1| PREDICTED: vacuolar-sorting receptor 1-like [Nicotiana sylvestris]
Length=623

 Score =   248 bits (633),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 152/188 (81%), Gaps = 0/188 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKN+L+V SP SIK  Y+ A+GNFG+PQYGG+M G V+YPK N+K CK F  
Sbjct  18   SCLGRFVVEKNSLRVTSPSSIKDVYECAIGNFGVPQYGGTMVGIVMYPKANQKSCKNFAD  77

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  SF SK G++P F++VDRGDC F LKAWNAQ AGA AILVADD  E LITMD+PEE+ 
Sbjct  78   FDISFKSKPGAMPVFLLVDRGDCYFTLKAWNAQRAGAGAILVADDRVEPLITMDTPEEED  137

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            + ++Y++NITIPSALI KS G+ +KK +  GEMV++NLDWREA+PHPD+RVEYE WTNSN
Sbjct  138  AQADYLQNITIPSALISKSLGDSIKKELSRGEMVNINLDWREALPHPDERVEYEFWTNSN  197

Query  617  DECGYKCD  640
            DECG KC+
Sbjct  198  DECGPKCE  205



>ref|XP_004492565.1| PREDICTED: vacuolar-sorting receptor 1-like [Cicer arietinum]
Length=621

 Score =   248 bits (633),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 150/186 (81%), Gaps = 1/186 (1%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
            GRF+VEKN+LK+ SP S+KGTY+ A+GNFG+PQYGG++ G+VVYP  N+KGC  F     
Sbjct  21   GRFLVEKNSLKITSPKSLKGTYECAIGNFGVPQYGGTLVGSVVYPNVNQKGCDNFTDVNA  80

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG-SS  442
            SF SK G  PTF++VDRGDC F LKAWNAQN GA+AILVAD+ EE LITMD+PEE   + 
Sbjct  81   SFQSKPGGFPTFLLVDRGDCYFTLKAWNAQNGGAAAILVADNREEILITMDTPEEGNVAK  140

Query  443  SNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDE  622
             +Y+E I IPS LI KS G+ +KKA+ +GEMV +NLDWREA+PHPDDRVEYELWTNSNDE
Sbjct  141  DDYMEKINIPSTLISKSLGDSIKKALSNGEMVRINLDWREALPHPDDRVEYELWTNSNDE  200

Query  623  CGYKCD  640
            CG KCD
Sbjct  201  CGPKCD  206



>gb|EYU42029.1| hypothetical protein MIMGU_mgv1a002928mg [Erythranthe guttata]
Length=624

 Score =   248 bits (633),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 149/187 (80%), Gaps = 0/187 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKN+LKV SPDS+K  Y+ A+GNFG+P YGGSM G+V YPK N K CK F  
Sbjct  18   SCLGRFVVEKNSLKVTSPDSLKDVYECAIGNFGVPDYGGSMAGSVFYPKSNEKACKNFQD  77

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  +  +K G LP F++ DRG+C F LKAWNAQNAGA+AILVADD  E LITMD+PEE+ 
Sbjct  78   FDIALKTKPGGLPIFLLADRGECFFTLKAWNAQNAGAAAILVADDRVEPLITMDTPEEED  137

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            + ++Y++NITIPSALI K  G+K+KK +  GEMV++NLDWREA+PHPD+RVEYE WTNSN
Sbjct  138  ARADYLQNITIPSALISKDLGDKIKKELSKGEMVNINLDWREALPHPDERVEYEFWTNSN  197

Query  617  DECGYKC  637
            DECG KC
Sbjct  198  DECGPKC  204



>ref|XP_011086922.1| PREDICTED: vacuolar-sorting receptor 1-like [Sesamum indicum]
Length=631

 Score =   248 bits (633),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 148/185 (80%), Gaps = 0/185 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
            GRFVVEKNNL+V SP S++G Y+ A+GNFG+PQYGG+M G+V YPK N+K C  F     
Sbjct  28   GRFVVEKNNLRVTSPGSVRGIYECAIGNFGVPQYGGTMLGSVFYPKANQKACNTFQDSDI  87

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            ++ +K G +P F++ DRGDC F LKAWNAQNAGA+AILVADD  E LITMD+PEE  + +
Sbjct  88   TWKNKPGGIPIFLLADRGDCYFTLKAWNAQNAGAAAILVADDRIEPLITMDTPEETDAQA  147

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
            +Y++NI+IPSALI K  GE++KK +  GEMV +NLDWREA+PHPD+RVEYE WTNSNDEC
Sbjct  148  DYLQNISIPSALISKELGERMKKELSKGEMVSINLDWREALPHPDERVEYEFWTNSNDEC  207

Query  626  GYKCD  640
            G KC+
Sbjct  208  GPKCE  212



>ref|XP_008244809.1| PREDICTED: vacuolar-sorting receptor 1-like [Prunus mume]
Length=622

 Score =   247 bits (631),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 151/187 (81%), Gaps = 0/187 (0%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
              GRFVVEKN+LKV SP S+K  Y+ A+GNFG+PQYGG++ GTV YPK N+K CK FD F
Sbjct  19   CVGRFVVEKNSLKVTSPSSLKSVYECAIGNFGVPQYGGTLVGTVYYPKANQKACKSFDDF  78

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
              SF SK G LPTF++VDRGDC F LKAWNAQ  GA+AILVADD  E LITMD+PEE+ +
Sbjct  79   DVSFKSKPGGLPTFLLVDRGDCFFTLKAWNAQKGGAAAILVADDRNEPLITMDTPEEENA  138

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
             ++Y++ ITIPSALI KS G+ +KK++  GEMV++NLDW EA+PHPD+RVEYE WTNSND
Sbjct  139  DADYLQKITIPSALISKSLGDSIKKSLSSGEMVNINLDWTEALPHPDERVEYEFWTNSND  198

Query  620  ECGYKCD  640
            ECG KCD
Sbjct  199  ECGPKCD  205



>ref|XP_010683480.1| PREDICTED: vacuolar-sorting receptor 1-like [Beta vulgaris subsp. 
vulgaris]
Length=626

 Score =   247 bits (630),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 149/185 (81%), Gaps = 0/185 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
            GRFVVEKN+LKV SP S++G Y+ A+GNFG+PQYGG+M G V +PK N+KGCK F     
Sbjct  25   GRFVVEKNSLKVTSPSSLRGVYECAIGNFGVPQYGGAMGGIVAFPKSNQKGCKPFSDDDI  84

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            SF  K G LP F++V+RG+C F LKAW+AQNAGA+A+LV DD  E LITMD+PEE G+  
Sbjct  85   SFKPKPGGLPVFLLVERGECFFTLKAWHAQNAGAAAVLVGDDRMEPLITMDTPEEGGAED  144

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
            +YV NITIPSAL+ KSFG+KLKK+V  G++V ++LDWRE VPHPDDRVEYE WTNSNDEC
Sbjct  145  DYVRNITIPSALVSKSFGDKLKKSVSKGDVVKISLDWRETVPHPDDRVEYEYWTNSNDEC  204

Query  626  GYKCD  640
            G KCD
Sbjct  205  GAKCD  209



>gb|EPS72005.1| hypothetical protein M569_02753, partial [Genlisea aurea]
Length=557

 Score =   245 bits (626),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 148/191 (77%), Gaps = 0/191 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S   RFVVEKNNLKV SP+S+KG Y+ A+GNFG+PQYGG+M G+V YPK NR  C  F G
Sbjct  15   SCTARFVVEKNNLKVTSPESLKGLYECAIGNFGVPQYGGTMPGSVYYPKSNRHACSDFRG  74

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
               ++ +K G +P F++VDRG+C F LKAWN+Q AG +A+LV+DD  E LITMDSPEE  
Sbjct  75   SDITWRNKPGGIPAFLLVDRGECYFTLKAWNSQKAGVAAVLVSDDRIEPLITMDSPEESD  134

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            +  NY++NITIPSALI K  G+++K  +   +MV +NLDWRE++PHPDDRVEYELWTNSN
Sbjct  135  AQPNYLQNITIPSALITKQLGDRIKNELSRSQMVKLNLDWRESLPHPDDRVEYELWTNSN  194

Query  617  DECGYKCDMLM  649
            DECG KCD+ +
Sbjct  195  DECGPKCDIQL  205



>ref|XP_008370265.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Malus 
domestica]
Length=626

 Score =   246 bits (629),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 150/187 (80%), Gaps = 0/187 (0%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
              GRFVVEKN+LKV SP S+KG Y+ A+GNFG+PQYGG++ GTV YPK N+K CKGF+ F
Sbjct  19   CVGRFVVEKNSLKVTSPSSMKGLYECAIGNFGVPQYGGTLVGTVYYPKTNQKACKGFEDF  78

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
              SF  K G LPTF++VDRGDC F LKAWNAQ  G +AILVADD  E LITMD+PEE+ +
Sbjct  79   DESFKPKPGGLPTFLLVDRGDCYFTLKAWNAQKGGXAAILVADDRNEPLITMDNPEEENA  138

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
             ++Y++ ITIPSALI K  GE +KK++  GEMV++NLDW EA+PHPD+RVEYE WTNSND
Sbjct  139  DADYLQKITIPSALISKELGESIKKSLSGGEMVNINLDWTEALPHPDERVEYEFWTNSND  198

Query  620  ECGYKCD  640
            ECG KCD
Sbjct  199  ECGPKCD  205



>ref|XP_008370266.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Malus 
domestica]
Length=625

 Score =   246 bits (629),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 150/187 (80%), Gaps = 0/187 (0%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
              GRFVVEKN+LKV SP S+KG Y+ A+GNFG+PQYGG++ GTV YPK N+K CKGF+ F
Sbjct  19   CVGRFVVEKNSLKVTSPSSMKGLYECAIGNFGVPQYGGTLVGTVYYPKTNQKACKGFEDF  78

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
              SF  K G LPTF++VDRGDC F LKAWNAQ  G +AILVADD  E LITMD+PEE+ +
Sbjct  79   DESFKPKPGGLPTFLLVDRGDCYFTLKAWNAQKGGXAAILVADDRNEPLITMDNPEEENA  138

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
             ++Y++ ITIPSALI K  GE +KK++  GEMV++NLDW EA+PHPD+RVEYE WTNSND
Sbjct  139  DADYLQKITIPSALISKELGESIKKSLSGGEMVNINLDWTEALPHPDERVEYEFWTNSND  198

Query  620  ECGYKCD  640
            ECG KCD
Sbjct  199  ECGPKCD  205



>ref|XP_010093546.1| Vacuolar-sorting receptor 1 [Morus notabilis]
 gb|EXB54253.1| Vacuolar-sorting receptor 1 [Morus notabilis]
Length=628

 Score =   246 bits (629),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 153/188 (81%), Gaps = 0/188 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
               GRFVVEKN+LKV SP+ +KG Y+ A+GNFG+PQYGG++ GTVVYP+ N+K CK F+ 
Sbjct  20   CVVGRFVVEKNSLKVTSPNPLKGVYECAIGNFGVPQYGGTLVGTVVYPQANQKACKNFED  79

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  SF SK G LPTF++ DRGDC F LKAWNAQN GA+AILVADD  E LITMD+PEE+ 
Sbjct  80   FSVSFKSKPGGLPTFLLADRGDCFFTLKAWNAQNGGAAAILVADDKFEPLITMDNPEEEN  139

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            + ++Y++ ITIPSALI KS G+ ++KA+ D +MV++ LDW EA+PHPD+RVEYELWTNSN
Sbjct  140  ADADYLQKITIPSALISKSLGDSIRKALSDKDMVNIKLDWTEALPHPDERVEYELWTNSN  199

Query  617  DECGYKCD  640
            DECG KCD
Sbjct  200  DECGPKCD  207



>gb|EYU35791.1| hypothetical protein MIMGU_mgv1a002876mg [Erythranthe guttata]
Length=628

 Score =   246 bits (627),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 146/186 (78%), Gaps = 1/186 (1%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
            GRFVVEKNNLKV SP+S++G Y+ A+GNFG+PQYGG M G+V YPK N+KGC  F     
Sbjct  24   GRFVVEKNNLKVTSPESVRGVYECAIGNFGVPQYGGVMVGSVFYPKTNQKGCNTFQDSDL  83

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEE-DGSS  442
            S  +K G +P FV+ DRG+C F LKAWNAQN GA+AILVADD  E LITMD+PEE D + 
Sbjct  84   SSKTKPGGIPLFVLADRGECYFTLKAWNAQNGGAAAILVADDRVEPLITMDTPEEADAAQ  143

Query  443  SNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDE  622
            +NY++NITIPSALI    G+++KK +  GEMV + LDWREA+PHPDDRVEYE WTNSNDE
Sbjct  144  ANYLQNITIPSALISNQLGDRIKKVLAKGEMVTIYLDWREALPHPDDRVEYEFWTNSNDE  203

Query  623  CGYKCD  640
            CG KC+
Sbjct  204  CGPKCE  209



>ref|XP_006411071.1| hypothetical protein EUTSA_v10016384mg [Eutrema salsugineum]
 gb|ESQ52524.1| hypothetical protein EUTSA_v10016384mg [Eutrema salsugineum]
Length=622

 Score =   246 bits (627),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 152/187 (81%), Gaps = 0/187 (0%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
            A G+F+VEKNNLKV SP++IKG Y+ A+GNFGIP+YGG++ G VV+P  N K CK F  F
Sbjct  19   ALGKFLVEKNNLKVTSPETIKGVYECAIGNFGIPKYGGTLVGAVVHPVSNHKACKSFSEF  78

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
            G SF S  G LPTF+++DRGDC F LKAWNAQ AGA+AILVAD+  E LITMD+PEED +
Sbjct  79   GVSFKSTPGRLPTFLLIDRGDCYFTLKAWNAQQAGAAAILVADNKLEPLITMDTPEEDNA  138

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
             ++Y++ ITIPSALI KS G+ +K A+ DG MV++NLDW E+VPHPD+RVEYELWT+SND
Sbjct  139  DADYLDKITIPSALISKSLGDSIKSALSDGNMVNMNLDWTESVPHPDERVEYELWTDSND  198

Query  620  ECGYKCD  640
            ECG KCD
Sbjct  199  ECGKKCD  205



>ref|NP_001275302.1| vacuolar sorting receptor protein PV72-like protein precursor 
[Solanum tuberosum]
 gb|ABC01915.1| vacuolar sorting receptor protein PV72-like protein [Solanum 
tuberosum]
Length=621

 Score =   245 bits (626),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 149/188 (79%), Gaps = 0/188 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
               GRFVVEKN+L+V SPDSIK  Y+ A+GNFG+PQYGG+M G V+YPK N+K CK F  
Sbjct  16   CCMGRFVVEKNSLRVTSPDSIKEVYECAIGNFGVPQYGGTMVGNVMYPKTNQKSCKNFSD  75

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F   + SK G +P F++VDR DC F LKAWNAQ AGA AILVADD  E LITMD+PEE+ 
Sbjct  76   FDIFYKSKPGGMPVFLLVDRRDCFFTLKAWNAQQAGAGAILVADDRVEPLITMDTPEEED  135

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            + ++Y+++ITIPSALI KS G+ +KK +  GEMV++NLDWREA+PHPDDRVEYE WTNSN
Sbjct  136  AKADYLQDITIPSALISKSLGDSIKKELSKGEMVNINLDWREALPHPDDRVEYEFWTNSN  195

Query  617  DECGYKCD  640
            DECG KC+
Sbjct  196  DECGPKCE  203



>ref|XP_007207200.1| hypothetical protein PRUPE_ppa002877mg [Prunus persica]
 gb|EMJ08399.1| hypothetical protein PRUPE_ppa002877mg [Prunus persica]
Length=625

 Score =   245 bits (626),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 152/187 (81%), Gaps = 0/187 (0%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
              GRFVVEKN+LKV SP S+K  Y+ A+GNFG+PQYGG++ GTV YPK N+K CKGFD F
Sbjct  19   CVGRFVVEKNSLKVTSPSSLKSVYECAIGNFGVPQYGGTLVGTVYYPKANQKACKGFDDF  78

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
              SF SK G LPTF++VDRGDC F LKAWNAQ  GA+AILVAD+  E LITMD+PEE+ +
Sbjct  79   DVSFKSKPGGLPTFLLVDRGDCFFTLKAWNAQKGGAAAILVADNRNEPLITMDTPEEENA  138

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
             ++Y++ ITIPSALI KS G+ +KK++  GEMV++NLDW EA+PHPD+RVEYE WTNSND
Sbjct  139  DADYLQKITIPSALISKSLGDSIKKSLSSGEMVNINLDWTEALPHPDERVEYEFWTNSND  198

Query  620  ECGYKCD  640
            ECG KCD
Sbjct  199  ECGPKCD  205



>ref|XP_010043186.1| PREDICTED: vacuolar-sorting receptor 1-like [Eucalyptus grandis]
 gb|KCW88338.1| hypothetical protein EUGRSUZ_A00725 [Eucalyptus grandis]
Length=632

 Score =   245 bits (626),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 148/185 (80%), Gaps = 0/185 (0%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
            GRFVV+KN+LKV SP+S+KG ++ A+GNFG+PQYGG++ GTVVYP  N+  CK F  F  
Sbjct  27   GRFVVQKNSLKVTSPNSMKGAHECAIGNFGVPQYGGTLVGTVVYPSANQHACKEFREFDL  86

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            SF +K G LP FV+ DRGDC F LKAWNAQN GA+AILVADD EE LITMD PEE  + +
Sbjct  87   SFKTKPGGLPVFVLADRGDCYFTLKAWNAQNGGAAAILVADDREEPLITMDVPEEQKADA  146

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
            +Y+E ITIPSALI K+ G+ +KKA+  G MV++NLDW EA+PHPD+RVEYE WTNSNDEC
Sbjct  147  DYLEKITIPSALIRKNLGDSIKKALSGGNMVNLNLDWTEALPHPDERVEYEFWTNSNDEC  206

Query  626  GYKCD  640
            G KCD
Sbjct  207  GPKCD  211



>gb|EEC82690.1| hypothetical protein OsI_27347 [Oryza sativa Indica Group]
Length=626

 Score =   245 bits (625),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 152/190 (80%), Gaps = 2/190 (1%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
            AAGRFVVEKN+L+V SP  ++G Y+ A+GNFG+PQYGG+M G VVYPK N+K C+ FD F
Sbjct  20   AAGRFVVEKNSLRVTSPAGLRGVYECAIGNFGMPQYGGTMHGVVVYPKANKKACRSFDDF  79

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
              SF  K G LP F++VDRGDC F  K WNAQ AGA+A+LVADD  E LITMDSPE  G+
Sbjct  80   DLSFKPKPGGLPVFLLVDRGDCYFTTKGWNAQTAGAAAVLVADDRLEPLITMDSPESSGT  139

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
              +Y+E IT+PSAL+ K FG+ LKKA+++G+MV+V LDWRE++PHPD+RVEYE WTNSND
Sbjct  140  --DYIEKITVPSALVTKKFGDDLKKALENGDMVNVLLDWRESLPHPDERVEYEFWTNSND  197

Query  620  ECGYKCDMLM  649
            ECG KCDM M
Sbjct  198  ECGAKCDMQM  207



>ref|NP_001060643.1| Os07g0680000 [Oryza sativa Japonica Group]
 dbj|BAC80001.1| putative vacuolar targeting receptor [Oryza sativa Japonica Group]
 dbj|BAD31218.1| putative vacuolar targeting receptor [Oryza sativa Japonica Group]
 dbj|BAF22557.1| Os07g0680000 [Oryza sativa Japonica Group]
 gb|EAZ41102.1| hypothetical protein OsJ_25594 [Oryza sativa Japonica Group]
 dbj|BAG93090.1| unnamed protein product [Oryza sativa Japonica Group]
Length=626

 Score =   245 bits (625),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 152/190 (80%), Gaps = 2/190 (1%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
            AAGRFVVEKN+L+V SP  ++G Y+ A+GNFG+PQYGG+M G VVYPK N+K C+ FD F
Sbjct  20   AAGRFVVEKNSLRVTSPAGLRGVYECAIGNFGMPQYGGTMHGVVVYPKANKKACRSFDDF  79

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
              SF  K G LP F++VDRGDC F  K WNAQ AGA+A+LVADD  E LITMDSPE  G+
Sbjct  80   DLSFKPKPGGLPIFLLVDRGDCYFTTKGWNAQTAGAAAVLVADDRLEPLITMDSPESSGT  139

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
              +Y+E IT+PSAL+ K FG+ LKKA+++G+MV+V LDWRE++PHPD+RVEYE WTNSND
Sbjct  140  --DYIEKITVPSALVTKKFGDDLKKALENGDMVNVLLDWRESLPHPDERVEYEFWTNSND  197

Query  620  ECGYKCDMLM  649
            ECG KCDM M
Sbjct  198  ECGAKCDMQM  207



>ref|XP_006658133.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=630

 Score =   243 bits (620),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 153/190 (81%), Gaps = 2/190 (1%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
            AAGRFV EKN+L+V SP  ++G Y+ A+GNFG+PQYGG+M G VVYPK NRK CK FD F
Sbjct  24   AAGRFVGEKNSLRVTSPAGLRGVYECAIGNFGMPQYGGTMHGVVVYPKANRKACKAFDEF  83

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
              SF  K+G LP F++VDRGDC F  K WNAQ+AGA+A+LVADD  E LITMDSPE  G+
Sbjct  84   DLSFKPKSGGLPVFLLVDRGDCYFTTKGWNAQSAGAAAVLVADDRVEPLITMDSPESSGT  143

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
              +Y+E IT+PSAL+ K FG+ LKK++++G+MV+V LDWRE++PHPD+RVEYE WTNSND
Sbjct  144  --DYIEKITVPSALVTKKFGDDLKKSLENGDMVNVLLDWRESLPHPDERVEYEFWTNSND  201

Query  620  ECGYKCDMLM  649
            ECG KCDM M
Sbjct  202  ECGAKCDMQM  211



>emb|CDY38157.1| BnaA07g02260D [Brassica napus]
Length=370

 Score =   236 bits (603),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 151/196 (77%), Gaps = 4/196 (2%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  G FVVEKN+L+V SP+SI+G Y+ ALGNFG+PQYGGSM+G+VVYPK N+K CK F+ 
Sbjct  45   SCMGMFVVEKNSLRVTSPESIRGIYECALGNFGVPQYGGSMSGSVVYPKANQKACKNFED  104

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  SF S+   LPTFV+VDRGDC F LKAWNAQ AGA+ ILVAD+  E LITMD+PE++ 
Sbjct  105  FDISFISRVAGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEPLITMDAPEDET  164

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWRE----AVPHPDDRVEYELW  604
            + + Y+ NITIPSAL+ +S G  +K A+  G  V ++LDWRE    A+PHP+DRV YELW
Sbjct  165  ADAEYLLNITIPSALLSRSLGSTIKTAIDQGVPVRISLDWREIFFQALPHPNDRVAYELW  224

Query  605  TNSNDECGYKCDMLMK  652
            TNSNDECG KCD  ++
Sbjct  225  TNSNDECGSKCDAQIR  240



>ref|XP_004959891.1| PREDICTED: vacuolar-sorting receptor 1-like [Setaria italica]
Length=636

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 153/190 (81%), Gaps = 2/190 (1%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
            AA RFVVEKN+L+V SP +++G Y+ A+GNFG+PQYGG+M G VVYPK N K CK F  F
Sbjct  30   AAARFVVEKNSLRVTSPAALRGVYECAIGNFGMPQYGGTMHGVVVYPKANGKACKPFADF  89

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
            G SF  K G LP F++VDRGDC F  K WNAQN+GA+A+LVADD  E LITMDSPE  G+
Sbjct  90   GLSFKPKPGGLPVFLLVDRGDCYFTTKGWNAQNSGAAAVLVADDKVEPLITMDSPESSGT  149

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
               ++ENITIPSAL+ K FG+ L+KA+++G+MV+V LDWRE++PHPD+RVEYELWTNSND
Sbjct  150  E--HMENITIPSALVTKRFGDDLRKALQNGDMVNVLLDWRESLPHPDERVEYELWTNSND  207

Query  620  ECGYKCDMLM  649
            ECG KCDM M
Sbjct  208  ECGAKCDMQM  217



>ref|XP_004246285.1| PREDICTED: vacuolar-sorting receptor 1-like [Solanum lycopersicum]
Length=621

 Score =   242 bits (617),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 148/188 (79%), Gaps = 0/188 (0%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
               GRFVVEKN+L+V SPDSIK  Y+ A+GNFG+PQYGG++ G V+YPK N+K C  F  
Sbjct  16   CCMGRFVVEKNSLRVTSPDSIKEVYECAIGNFGVPQYGGTLVGNVMYPKSNKKSCNNFSD  75

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F   + SK G  P F++VDRGDC F LKAWNAQ AGA AILVAD+  E LITMD+PEE+ 
Sbjct  76   FDIFYKSKPGGRPVFLLVDRGDCFFTLKAWNAQQAGAGAILVADNRVEPLITMDTPEEED  135

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
            + ++Y+++ITIPSALI KS G+ +K+ +  GE+V++NLDWREA+PHPDDRVEYE WTNSN
Sbjct  136  AKADYLQDITIPSALISKSLGDSIKRELSKGELVNINLDWREALPHPDDRVEYEFWTNSN  195

Query  617  DECGYKCD  640
            DECG KC+
Sbjct  196  DECGPKCE  203



>gb|EMS62484.1| Vacuolar-sorting receptor 1 [Triticum urartu]
Length=925

 Score =   246 bits (629),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 154/181 (85%), Gaps = 1/181 (1%)
 Frame = +2

Query  98   VEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfsfss  277
            +EKN+L+V +P+++KG Y+ A+GNFG+PQYGG+M G V YPK NRK CKGFD F  SF +
Sbjct  330  LEKNSLRVTAPEALKGAYECAIGNFGVPQYGGTMVGVVAYPKANRKACKGFDEFDVSFKA  389

Query  278  kagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSNYVE  457
            + G+LPTF++VDRGDC FA KAWN QNAGA+AILVADD +E LITMD+PEE G    Y+E
Sbjct  390  RPGALPTFLLVDRGDCYFAKKAWNVQNAGAAAILVADDRDEPLITMDTPEESGRVE-YLE  448

Query  458  NITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECGYKC  637
            NITIPSALI KSFG++LKKA+ +G+MV+VNLDWRE++PHPD+RVEYE WTNSNDECG KC
Sbjct  449  NITIPSALISKSFGDRLKKAIDNGDMVNVNLDWRESLPHPDERVEYEFWTNSNDECGPKC  508

Query  638  D  640
            D
Sbjct  509  D  509



>ref|XP_003529053.2| PREDICTED: vacuolar-sorting receptor 1-like [Glycine max]
 gb|KHN25078.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=624

 Score =   242 bits (617),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 148/190 (78%), Gaps = 5/190 (3%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKNNLK+ SP S++G Y+ A+GNFG+P+YGG+M G+VVYPK N+ GC+ FD 
Sbjct  20   SCVGRFVVEKNNLKITSPKSLRGIYECAIGNFGVPKYGGTMIGSVVYPKSNQNGCRNFDA  79

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
               S        PTFV+VDRGDC F LKAWNAQ  GA+AILVAD+ EE LITMD+PEE  
Sbjct  80   SLSSKPGT---FPTFVLVDRGDCYFTLKAWNAQKGGAAAILVADNREEPLITMDTPEEGN  136

Query  437  SSSN--YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTN  610
             + +  Y+E I+IPSALI KS G+K+K+A+  G MV+VNLDWREA+PHPD+RVEYE WT+
Sbjct  137  GAKDDDYIEKISIPSALISKSLGDKIKQALSSGAMVNVNLDWREALPHPDERVEYEFWTS  196

Query  611  SNDECGYKCD  640
            SNDECG KC+
Sbjct  197  SNDECGPKCE  206



>ref|NP_001169232.1| hypothetical protein precursor [Zea mays]
 gb|ACN32039.1| unknown [Zea mays]
 gb|ACN34630.1| unknown [Zea mays]
 tpg|DAA64135.1| TPA: hypothetical protein ZEAMMB73_440222 [Zea mays]
Length=633

 Score =   241 bits (615),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 149/187 (80%), Gaps = 2/187 (1%)
 Frame = +2

Query  89   RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfs  268
            RFVVEKN+L+V SP  ++G Y+ A+GNFG+PQYGG+M G VVYPK + K C+ F   G S
Sbjct  27   RFVVEKNSLRVTSPAVLRGVYECAIGNFGMPQYGGTMHGVVVYPKADAKACRPFADSGLS  86

Query  269  fsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  448
            F  ++G LP F++VDRGDC F  K WNAQNAGA+A+LVADD  E LITMDSPE  G+   
Sbjct  87   FKPRSGGLPVFLLVDRGDCYFTTKGWNAQNAGAAAVLVADDRVEPLITMDSPESSGTE--  144

Query  449  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  628
            ++ENITIPSAL+ K FGE L+KA++ G+MV+V LDWRE++PHPD+RVEYELWTNSNDECG
Sbjct  145  HIENITIPSALVTKRFGEDLRKALQSGDMVNVLLDWRESLPHPDERVEYELWTNSNDECG  204

Query  629  YKCDMLM  649
             KCDM M
Sbjct  205  AKCDMQM  211



>ref|XP_009372030.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=625

 Score =   240 bits (613),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 148/187 (79%), Gaps = 0/187 (0%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
               RFVVEK++LKV SP S+KG Y+ A+GNFG+PQYGG++ GTV YPK N+  CKGF+  
Sbjct  19   CVARFVVEKSSLKVTSPSSMKGEYECAIGNFGVPQYGGTLVGTVYYPKTNQMACKGFEDT  78

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
              SF  K G LPTFV+VDRGDC F LKAWNAQ  GA+AILV D+  E+LITMD+PE++ +
Sbjct  79   DESFKPKPGGLPTFVLVDRGDCYFTLKAWNAQKGGAAAILVVDNKNEQLITMDTPEQEDA  138

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
             ++Y++NITIPSALI K  G+ +KK++   EMV++NLDW EA+PHPD+RVEYE WTNSND
Sbjct  139  DADYLQNITIPSALISKELGDSIKKSLSGDEMVNINLDWTEALPHPDERVEYEFWTNSND  198

Query  620  ECGYKCD  640
            ECG KCD
Sbjct  199  ECGPKCD  205



>ref|XP_009372028.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=626

 Score =   240 bits (613),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 148/187 (79%), Gaps = 0/187 (0%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
               RFVVEK++LKV SP S+KG Y+ A+GNFG+PQYGG++ GTV YPK N+  CKGF+  
Sbjct  19   CVARFVVEKSSLKVTSPSSMKGEYECAIGNFGVPQYGGTLVGTVYYPKTNQMACKGFEDT  78

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
              SF  K G LPTFV+VDRGDC F LKAWNAQ  GA+AILV D+  E+LITMD+PE++ +
Sbjct  79   DESFKPKPGGLPTFVLVDRGDCYFTLKAWNAQKGGAAAILVVDNKNEQLITMDTPEQEDA  138

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
             ++Y++NITIPSALI K  G+ +KK++   EMV++NLDW EA+PHPD+RVEYE WTNSND
Sbjct  139  DADYLQNITIPSALISKELGDSIKKSLSGDEMVNINLDWTEALPHPDERVEYEFWTNSND  198

Query  620  ECGYKCD  640
            ECG KCD
Sbjct  199  ECGPKCD  205



>ref|XP_007134557.1| hypothetical protein PHAVU_010G057200g [Phaseolus vulgaris]
 gb|ESW06551.1| hypothetical protein PHAVU_010G057200g [Phaseolus vulgaris]
Length=625

 Score =   239 bits (611),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 148/190 (78%), Gaps = 5/190 (3%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  G FVVEKNNLK+ SP+S+KG Y+ A+GNFG+P+YGG+M G+VVYPK ++ GCK FD 
Sbjct  21   SCVGTFVVEKNNLKITSPNSLKGIYECAIGNFGVPKYGGTMIGSVVYPKTDQNGCKPFDS  80

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
               S        P+FV++DRG+C F LKAWNAQ  GA+AILVADD  E LITMD+PEE  
Sbjct  81   SLSSKPGT---FPSFVLIDRGECFFTLKAWNAQKGGAAAILVADDRTEPLITMDTPEEGN  137

Query  437  SSSN--YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTN  610
             +SN  Y+E I+IPSALI KS G+K+K A+  GEMV+VNLDWREA+PHPD+RVEYE WT+
Sbjct  138  GASNDDYIEKISIPSALISKSLGDKIKSALSSGEMVNVNLDWREALPHPDERVEYEFWTS  197

Query  611  SNDECGYKCD  640
            SNDECG KC+
Sbjct  198  SNDECGPKCE  207



>ref|XP_002463394.1| hypothetical protein SORBIDRAFT_02g043010 [Sorghum bicolor]
 gb|EER99915.1| hypothetical protein SORBIDRAFT_02g043010 [Sorghum bicolor]
Length=636

 Score =   238 bits (608),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 150/186 (81%), Gaps = 2/186 (1%)
 Frame = +2

Query  92   FVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgfsf  271
            FVVEKN+L+V SP +++G Y+ A+GNFG+PQYGG+M G VVYPK + K C+ FD  G SF
Sbjct  31   FVVEKNSLRVTSPAALRGVYECAIGNFGMPQYGGTMHGVVVYPKVDAKACRPFDASGLSF  90

Query  272  sskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSNY  451
              K+G LP F++VDRGDC F  K WNAQNAGA+A+LVADD  E LITMDSPE  G+   +
Sbjct  91   KPKSGGLPVFLLVDRGDCYFTTKGWNAQNAGAAAVLVADDKVEPLITMDSPESSGTE--H  148

Query  452  VENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECGY  631
            +ENITIPSAL+ K FG+ L+KA+++GEMV+V LDWRE++PHPD+RVEYE WTNSNDECG 
Sbjct  149  IENITIPSALVTKRFGDDLRKALQNGEMVNVLLDWRESLPHPDERVEYEFWTNSNDECGA  208

Query  632  KCDMLM  649
            KCDM M
Sbjct  209  KCDMQM  214



>ref|XP_009125765.1| PREDICTED: LOW QUALITY PROTEIN: vacuolar-sorting receptor 2 [Brassica 
rapa]
Length=643

 Score =   238 bits (608),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 152/196 (78%), Gaps = 4/196 (2%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKN+L+V S + I+G Y+ ALGNFG+PQYGGSM+G+VVYPK N+K CK F+ 
Sbjct  30   SCMGRFVVEKNSLRVTSAEFIRGIYECALGNFGVPQYGGSMSGSVVYPKANQKACKNFED  89

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
            F  SF S+   LPTFV+VDRGDC F LKAWNAQ AGA+ ILVAD+  E LITMD+PE++ 
Sbjct  90   FDISFRSRVSGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEPLITMDAPEDET  149

Query  437  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWRE----AVPHPDDRVEYELW  604
            + + Y++NITIPSAL+ +S G  +K A+  GE V ++LDWRE    A+PHP+DRV YELW
Sbjct  150  ADAEYLQNITIPSALLSRSLGSAIKTAINQGEPVRISLDWREIFFQALPHPNDRVAYELW  209

Query  605  TNSNDECGYKCDMLMK  652
            TNSNDECG KCD  ++
Sbjct  210  TNSNDECGSKCDAQIR  225



>emb|CDX73599.1| BnaC08g24040D [Brassica napus]
Length=625

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 155/187 (83%), Gaps = 0/187 (0%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
            A GRFVVEKNNLKV SPDSIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CK +  F
Sbjct  20   AVGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYSDF  79

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
              SF SKAG LPTFV++DRGDC F LKAW AQ AGA+AILVAD+  E LITMD+PEED S
Sbjct  80   DISFKSKAGRLPTFVLIDRGDCFFTLKAWIAQQAGAAAILVADNKAEPLITMDTPEEDKS  139

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
             ++Y++NITIPSALI KS G+ LK A+  G+MV++ LDW E+VPHPD+RVEYELWTNSND
Sbjct  140  DADYLQNITIPSALITKSLGDSLKSALSKGDMVNMKLDWTESVPHPDERVEYELWTNSND  199

Query  620  ECGYKCD  640
            +CG KCD
Sbjct  200  QCGTKCD  206



>ref|XP_008655380.1| PREDICTED: vacuolar-sorting receptor 1-like [Zea mays]
Length=444

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 142/188 (76%), Gaps = 5/188 (3%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
            GRFVVEKN+++V SPD +KG Y+ A+GNFG+PQYGG++ G V YPK NRK C+ FD    
Sbjct  24   GRFVVEKNSIQVTSPDELKGKYECAIGNFGVPQYGGTLHGLVEYPKSNRKACQSFDISFK  83

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
               +     PTFV+VDRG+C F  KAWNAQNAGA+A+LV DD  E LITMD+PEE     
Sbjct  84   PKQAGGR--PTFVLVDRGECFFTTKAWNAQNAGAAAVLVVDDKSEPLITMDNPEE---GK  138

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
             ++ENITIPS LI K  GE LKK+ ++G+M+ V LDWRE++PHPD+RVEYE WTNSNDEC
Sbjct  139  EHLENITIPSVLITKKLGESLKKSAENGDMLSVLLDWRESLPHPDERVEYEFWTNSNDEC  198

Query  626  GYKCDMLM  649
            G KCDM M
Sbjct  199  GPKCDMQM  206



>ref|XP_009115984.1| PREDICTED: vacuolar-sorting receptor 1 [Brassica rapa]
Length=625

 Score =   237 bits (604),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 155/187 (83%), Gaps = 0/187 (0%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
            A GRFVVEKNNLKV SPDSIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CK +  F
Sbjct  20   AVGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYSDF  79

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
              +F SKAG LPTFV++DRGDC F LKAW AQ AGA+AILVAD+  E LITMD+PEED S
Sbjct  80   DITFKSKAGRLPTFVLIDRGDCFFTLKAWIAQQAGAAAILVADNKAEPLITMDTPEEDKS  139

Query  440  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  619
             ++Y++NITIPSALI KS G+ LK A+  G+MV++ LDW E+VPHPD+RVEYELWTNSND
Sbjct  140  DADYLQNITIPSALIAKSLGDSLKSALSKGDMVNMKLDWTESVPHPDERVEYELWTNSND  199

Query  620  ECGYKCD  640
            +CG KCD
Sbjct  200  QCGKKCD  206



>ref|XP_006650048.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=630

 Score =   237 bits (605),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 154/193 (80%), Gaps = 3/193 (2%)
 Frame = +2

Query  74   ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfd  253
            ++AAGRFVVEKN+L+V SPDSIKG Y+ A+GNFG+PQYGG++ G V YPK NRK CK F+
Sbjct  20   DTAAGRFVVEKNSLRVTSPDSIKGKYECAIGNFGVPQYGGTLHGWVEYPKSNRKACKSFE  79

Query  254  gf-gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEE  430
             F     S+++G  P FV++DRGDC F  KAWNAQNAGA+A+LVAD+  E LITMD+P++
Sbjct  80   DFDISFKSTRSGGRPKFVLIDRGDCYFTTKAWNAQNAGAAAVLVADNKLEPLITMDNPDD  139

Query  431  DGSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTN  610
             G+   ++ENITIPS LI K  G+ LKK+ ++G+MV V LDWRE++PHPD+RVEYE WTN
Sbjct  140  AGTE--HLENITIPSVLITKELGDNLKKSAENGDMVSVLLDWRESLPHPDERVEYEFWTN  197

Query  611  SNDECGYKCDMLM  649
            SNDECG KCDM M
Sbjct  198  SNDECGPKCDMQM  210



>ref|XP_008388357.1| PREDICTED: vacuolar-sorting receptor 1-like [Malus domestica]
Length=626

 Score =   237 bits (604),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 146/188 (78%), Gaps = 1/188 (1%)
 Frame = +2

Query  80   AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgf  259
              GRFVVEKN LKV SP S+KG Y+ A+GNFG+P YGG++ GTV YPK N+  CKGF+  
Sbjct  19   CVGRFVVEKNRLKVTSPSSMKGDYECAIGNFGVPPYGGTLVGTVYYPKTNQMACKGFEDT  78

Query  260  gfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  439
              +F  K   LPTFV+VDRGDC F  KAWNAQ AGA+AILVADD  E LITMD+PEE+ +
Sbjct  79   DETFKPKPRGLPTFVLVDRGDCYFTTKAWNAQKAGAAAILVADDRNEPLITMDTPEEENA  138

Query  440  -SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  616
             +++Y++NITIPSALI K  G+ +KK++   EMV++NLDW EA+PHPD+RVEYE WTNSN
Sbjct  139  DAADYLQNITIPSALISKELGDSIKKSLSGDEMVNINLDWTEALPHPDERVEYEFWTNSN  198

Query  617  DECGYKCD  640
            D CG KCD
Sbjct  199  DVCGPKCD  206



>gb|KHN42141.1| Vacuolar-sorting receptor 2 [Glycine soja]
Length=622

 Score =   237 bits (604),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 145/190 (76%), Gaps = 5/190 (3%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKNNLK+ SP S++G Y+ A+GNFG+P+YGG+M G+VVYPK N+ GC+ FD 
Sbjct  18   SCVGRFVVEKNNLKITSPKSLRGIYECAIGNFGVPKYGGTMIGSVVYPKSNQNGCRNFDA  77

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
               S        PTFV+VDRGDC F LKAWNAQ  GA+AILVAD+  E LITMD+PEE  
Sbjct  78   SLSSKPGT---FPTFVLVDRGDCYFTLKAWNAQKGGAAAILVADNRIEPLITMDTPEEGN  134

Query  437  SSSN--YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTN  610
             + +  Y+E I IPSALI KS G+ +K+A+  G MV+VNLDWREA+PHPD+RVEYE WT+
Sbjct  135  GAKDDDYIEKINIPSALISKSLGDNIKQALSSGAMVNVNLDWREALPHPDERVEYEFWTS  194

Query  611  SNDECGYKCD  640
            SNDECG KC+
Sbjct  195  SNDECGPKCE  204



>ref|XP_003521852.1| PREDICTED: vacuolar-sorting receptor 1-like [Glycine max]
Length=624

 Score =   237 bits (604),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 145/190 (76%), Gaps = 5/190 (3%)
 Frame = +2

Query  77   SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdg  256
            S  GRFVVEKNNLK+ SP S++G Y+ A+GNFG+P+YGG+M G+VVYPK N+ GC+ FD 
Sbjct  20   SCVGRFVVEKNNLKITSPKSLRGIYECAIGNFGVPKYGGTMIGSVVYPKSNQNGCRNFDA  79

Query  257  fgfsfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  436
               S        PTFV+VDRGDC F LKAWNAQ  GA+AILVAD+  E LITMD+PEE  
Sbjct  80   SLSSKPGT---FPTFVLVDRGDCYFTLKAWNAQKGGAAAILVADNRIEPLITMDTPEEGN  136

Query  437  SSSN--YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTN  610
             + +  Y+E I IPSALI KS G+ +K+A+  G MV+VNLDWREA+PHPD+RVEYE WT+
Sbjct  137  GAKDDDYIEKINIPSALISKSLGDNIKQALSSGAMVNVNLDWREALPHPDERVEYEFWTS  196

Query  611  SNDECGYKCD  640
            SNDECG KC+
Sbjct  197  SNDECGPKCE  206



>gb|EMS51356.1| Vacuolar-sorting receptor 1 [Triticum urartu]
Length=640

 Score =   237 bits (604),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 150/188 (80%), Gaps = 2/188 (1%)
 Frame = +2

Query  86   GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRkgckgfdgfgf  265
            GRFVVEKN+L+V SP +++G Y+ A+GNFG+PQYGG+M G VVYPK N K CK F  FG 
Sbjct  36   GRFVVEKNSLRVTSPAALRGVYECAIGNFGMPQYGGTMHGVVVYPKANTKACKPFADFGL  95

Query  266  sfsskagsLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  445
            SF+ KAG LP F++VDRGDC F  K WNAQ AGA+A+LVADD  E LITMD+PE  G   
Sbjct  96   SFNPKAGGLPVFLLVDRGDCYFTTKGWNAQTAGAAAVLVADDRAEPLITMDTPESSGKE-  154

Query  446  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  625
             ++ENIT+PSAL+ K FG+ LK A+++G+MV+V LDWRE++PHPD+RVEYE WTNSNDEC
Sbjct  155  -HLENITVPSALVSKRFGDDLKGALENGDMVNVLLDWRESLPHPDERVEYEFWTNSNDEC  213

Query  626  GYKCDMLM  649
            G KCDM M
Sbjct  214  GAKCDMQM  221



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1001432574250