BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF041H01

Length=642
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004235934.1|  PREDICTED: factor of DNA methylation 1             230   2e-67   Solanum lycopersicum
ref|XP_009793120.1|  PREDICTED: protein GRIP-like isoform X2            226   3e-67   Nicotiana sylvestris
ref|XP_006341360.1|  PREDICTED: myosin-9-like                           228   6e-67   Solanum tuberosum [potatoes]
ref|XP_009793116.1|  PREDICTED: protein MLP1-like isoform X1            225   7e-66   Nicotiana sylvestris
ref|XP_009605544.1|  PREDICTED: myb-like protein X isoform X2           217   1e-62   Nicotiana tomentosiformis
ref|XP_009605543.1|  PREDICTED: myb-like protein X isoform X1           217   1e-62   Nicotiana tomentosiformis
ref|XP_011073344.1|  PREDICTED: factor of DNA methylation 1             207   7e-59   Sesamum indicum [beniseed]
emb|CDO98219.1|  unnamed protein product                                207   8e-59   Coffea canephora [robusta coffee]
ref|XP_009626788.1|  PREDICTED: coiled-coil domain-containing pro...    202   2e-57   Nicotiana tomentosiformis
gb|EYU21722.1|  hypothetical protein MIMGU_mgv1a002818mg                200   2e-56   Erythranthe guttata [common monkey flower]
gb|KJB56540.1|  hypothetical protein B456_009G124400                    197   5e-56   Gossypium raimondii
ref|XP_009763380.1|  PREDICTED: myosin type-2 heavy chain 1-like        199   6e-56   Nicotiana sylvestris
gb|KJB56539.1|  hypothetical protein B456_009G124400                    196   5e-55   Gossypium raimondii
gb|KJB56538.1|  hypothetical protein B456_009G124400                    196   5e-55   Gossypium raimondii
gb|KHG15531.1|  suppressor of gene silencing 3                          196   6e-55   Gossypium arboreum [tree cotton]
emb|CAN62667.1|  hypothetical protein VITISV_028278                     195   1e-54   Vitis vinifera
ref|XP_002267670.1|  PREDICTED: factor of DNA methylation 1 isofo...    194   3e-54   Vitis vinifera
ref|XP_010656778.1|  PREDICTED: factor of DNA methylation 1 isofo...    194   3e-54   Vitis vinifera
emb|CAN83544.1|  hypothetical protein VITISV_021077                     194   4e-54   Vitis vinifera
ref|XP_007023402.1|  XH/XS domain-containing protein                    191   4e-53   
ref|XP_002267381.1|  PREDICTED: factor of DNA methylation 1             189   1e-52   Vitis vinifera
ref|XP_007214938.1|  hypothetical protein PRUPE_ppa002776mg             187   7e-52   Prunus persica
gb|KDO42997.1|  hypothetical protein CISIN_1g006762mg                   185   2e-51   Citrus sinensis [apfelsine]
ref|XP_008228782.1|  PREDICTED: interaptin-like                         186   3e-51   Prunus mume [ume]
ref|XP_006427593.1|  hypothetical protein CICLE_v10025142mg             185   5e-51   
gb|KDO42995.1|  hypothetical protein CISIN_1g006762mg                   185   5e-51   Citrus sinensis [apfelsine]
ref|XP_006465197.1|  PREDICTED: myosin-10-like                          185   6e-51   Citrus sinensis [apfelsine]
ref|XP_008361182.1|  PREDICTED: putative leucine-rich repeat-cont...    181   1e-49   Malus domestica [apple tree]
ref|XP_002527307.1|  conserved hypothetical protein                     179   1e-48   Ricinus communis
ref|XP_003530299.1|  PREDICTED: structural maintenance of chromos...    177   3e-48   Glycine max [soybeans]
ref|XP_003531733.1|  PREDICTED: protein MLP1-like isoform X1            177   4e-48   Glycine max [soybeans]
ref|XP_007135808.1|  hypothetical protein PHAVU_010G160300g             174   6e-47   Phaseolus vulgaris [French bean]
ref|XP_007135809.1|  hypothetical protein PHAVU_010G160300g             174   6e-47   Phaseolus vulgaris [French bean]
ref|XP_004510284.1|  PREDICTED: uncharacterized protein PFB0145c-...    172   2e-46   
gb|KDP41984.1|  hypothetical protein JCGZ_27002                         172   3e-46   Jatropha curcas
ref|XP_010678967.1|  PREDICTED: factor of DNA methylation 1-like        170   2e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010063555.1|  PREDICTED: CAP-Gly domain-containing linker ...    168   8e-45   Eucalyptus grandis [rose gum]
ref|XP_010092186.1|  hypothetical protein L484_013504                   167   2e-44   Morus notabilis
ref|XP_008375509.1|  PREDICTED: putative leucine-rich repeat-cont...    167   2e-44   Malus domestica [apple tree]
ref|XP_010101455.1|  hypothetical protein L484_012877                   166   3e-44   Morus notabilis
ref|XP_003610367.1|  hypothetical protein MTR_4g131350                  166   3e-44   
ref|XP_008375623.1|  PREDICTED: uncharacterized protein LOC103438859    162   6e-44   
ref|XP_011467028.1|  PREDICTED: factor of DNA methylation 1             165   7e-44   Fragaria vesca subsp. vesca
gb|EPS59185.1|  hypothetical protein M569_15623                         164   1e-43   Genlisea aurea
gb|KEH32486.1|  XH/XS domain protein                                    164   1e-43   Medicago truncatula
gb|KGN44516.1|  hypothetical protein Csa_7G323110                       161   1e-42   Cucumis sativus [cucumbers]
ref|XP_004139640.1|  PREDICTED: uncharacterized protein LOC101205093    161   2e-42   Cucumis sativus [cucumbers]
ref|XP_002303841.1|  XH domain-containing family protein                160   5e-42   Populus trichocarpa [western balsam poplar]
ref|XP_008454609.1|  PREDICTED: putative leucine-rich repeat-cont...    160   5e-42   Cucumis melo [Oriental melon]
ref|XP_008454606.1|  PREDICTED: putative leucine-rich repeat-cont...    160   5e-42   Cucumis melo [Oriental melon]
ref|XP_008461480.1|  PREDICTED: putative leucine-rich repeat-cont...    159   8e-42   Cucumis melo [Oriental melon]
gb|AES86419.2|  XH/XS domain protein                                    156   9e-41   Medicago truncatula
ref|XP_003604222.1|  hypothetical protein MTR_4g006760                  156   1e-40   
ref|XP_010265647.1|  PREDICTED: factor of DNA methylation 1-like ...    155   2e-40   Nelumbo nucifera [Indian lotus]
ref|XP_010265646.1|  PREDICTED: factor of DNA methylation 1-like ...    155   2e-40   Nelumbo nucifera [Indian lotus]
ref|XP_010678965.1|  PREDICTED: factor of DNA methylation 1-like        155   3e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010265641.1|  PREDICTED: factor of DNA methylation 1-like ...    154   4e-40   Nelumbo nucifera [Indian lotus]
ref|XP_010537880.1|  PREDICTED: factor of DNA methylation 1-like        154   7e-40   Tarenaya hassleriana [spider flower]
emb|CDX81740.1|  BnaC08g38610D                                          151   3e-39   
ref|XP_006416865.1|  hypothetical protein EUTSA_v10007054mg             149   3e-38   Eutrema salsugineum [saltwater cress]
ref|XP_009117794.1|  PREDICTED: myosin-11-like                          143   6e-36   Brassica rapa
emb|CDY52860.1|  BnaA09g56520D                                          143   6e-36   Brassica napus [oilseed rape]
ref|XP_010497500.1|  PREDICTED: factor of DNA methylation 1             140   8e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010459126.1|  PREDICTED: factor of DNA methylation 1-like        136   7e-34   Camelina sativa [gold-of-pleasure]
dbj|BAE99100.1|  hypothetical protein                                   133   7e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010476691.1|  PREDICTED: factor of DNA methylation 1-like        134   1e-32   
ref|XP_006306990.1|  hypothetical protein CARUB_v10008566mg             133   2e-32   Capsella rubella
ref|NP_178194.1|  FACTOR OF DNA METHYLATION 5                           133   3e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002890136.1|  XH/XS domain-containing protein                    132   4e-32   
ref|NP_173043.1|  factor of DNA methylation 1                           132   6e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003610364.1|  hypothetical protein MTR_4g131310                  128   4e-31   
gb|AAF02798.1|AF195115_18  F5I10.22 gene product                        128   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567176.2|  XH/XS domain-containing protein                       127   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009149026.1|  PREDICTED: nuclear mitotic apparatus protein 1     127   3e-30   Brassica rapa
gb|KHN04171.1|  hypothetical protein glysoja_032667                     125   5e-30   Glycine soja [wild soybean]
emb|CDY33370.1|  BnaC05g12130D                                          127   1e-29   Brassica napus [oilseed rape]
emb|CBI40115.3|  unnamed protein product                                124   2e-29   Vitis vinifera
ref|XP_010937610.1|  PREDICTED: factor of DNA methylation 1-like        122   1e-28   
ref|XP_006389833.1|  hypothetical protein EUTSA_v10018261mg             122   1e-28   Eutrema salsugineum [saltwater cress]
gb|EMT06773.1|  hypothetical protein F775_17939                         121   5e-28   
gb|EEC75682.1|  hypothetical protein OsI_12489                          120   9e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_009104485.1|  PREDICTED: myosin-9-like                           120   9e-28   Brassica rapa
emb|CDX67967.1|  BnaA07g20070D                                          120   1e-27   
gb|EMT14402.1|  hypothetical protein F775_20219                         120   1e-27   
emb|CDX79353.1|  BnaC06g19500D                                          119   2e-27   
ref|XP_006391023.1|  hypothetical protein EUTSA_v10019728mg             119   2e-27   
gb|AAO60001.1|  putative XS domain containing protein                   117   2e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006300858.1|  hypothetical protein CARUB_v10019950mg             117   8e-27   
ref|XP_008799862.1|  PREDICTED: MAR-binding filament-like protein 1     117   8e-27   Phoenix dactylifera
ref|XP_006300857.1|  hypothetical protein CARUB_v10019950mg             117   1e-26   Capsella rubella
ref|XP_010429902.1|  PREDICTED: factor of DNA methylation 5-like        117   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_008784591.1|  PREDICTED: uncharacterized protein LOC103703501    116   3e-26   Phoenix dactylifera
gb|EMS45500.1|  hypothetical protein TRIUR3_12203                       115   5e-26   Triticum urartu
ref|XP_008802711.1|  PREDICTED: paramyosin, long form-like              115   7e-26   Phoenix dactylifera
ref|XP_010472874.1|  PREDICTED: factor of DNA methylation 5-like        114   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010910789.1|  PREDICTED: factor of DNA methylation 1-like        113   2e-25   
ref|XP_009416142.1|  PREDICTED: uncharacterized protein LOC103996844    113   3e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004968083.1|  PREDICTED: synaptonemal complex protein 1-like     112   5e-25   Setaria italica
ref|XP_010417660.1|  PREDICTED: factor of DNA methylation 5-like        112   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_006659121.1|  PREDICTED: putative leucine-rich repeat-cont...    110   5e-24   Oryza brachyantha
ref|XP_010256908.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-like      109   6e-24   Nelumbo nucifera [Indian lotus]
tpg|DAA50216.1|  TPA: putative XH domain family protein                 108   1e-23   
ref|XP_002443867.1|  hypothetical protein SORBIDRAFT_07g003550          108   2e-23   
ref|NP_001168342.1|  putative XH domain family protein                  107   3e-23   Zea mays [maize]
ref|XP_003559697.1|  PREDICTED: factor of DNA methylation 4-like        106   8e-23   Brachypodium distachyon [annual false brome]
ref|XP_010922973.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-like      104   2e-22   
ref|XP_010067411.1|  PREDICTED: coiled-coil domain-containing pro...    105   2e-22   Eucalyptus grandis [rose gum]
gb|KCW65539.1|  hypothetical protein EUGRSUZ_G02937                     105   2e-22   Eucalyptus grandis [rose gum]
gb|EAY85442.1|  hypothetical protein OsI_06823                          103   4e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_011091511.1|  PREDICTED: protein INVOLVED IN DE NOVO 2           103   7e-22   Sesamum indicum [beniseed]
gb|EEE56772.1|  hypothetical protein OsJ_06333                          103   1e-21   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD21477.1|  putative X1                                            103   1e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010940184.1|  PREDICTED: factor of DNA methylation 1-like        103   2e-21   
ref|XP_003569414.1|  PREDICTED: factor of DNA methylation 1-like        102   2e-21   Brachypodium distachyon [annual false brome]
ref|XP_007163408.1|  hypothetical protein PHAVU_001G232400g             102   2e-21   Phaseolus vulgaris [French bean]
ref|XP_011089483.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-like    99.0    4e-21   Sesamum indicum [beniseed]
gb|EMS54623.1|  hypothetical protein TRIUR3_33647                       100   8e-21   Triticum urartu
ref|XP_006435547.1|  hypothetical protein CICLE_v10030937mg             100   9e-21   
ref|XP_006486475.1|  PREDICTED: intracellular protein transport p...    100   9e-21   
gb|KDO69293.1|  hypothetical protein CISIN_1g0065972mg                  100   1e-20   Citrus sinensis [apfelsine]
emb|CAN81646.1|  hypothetical protein VITISV_010798                   97.8    1e-20   Vitis vinifera
gb|KDO41499.1|  hypothetical protein CISIN_1g047081mg                 98.6    1e-20   Citrus sinensis [apfelsine]
gb|KDO69291.1|  hypothetical protein CISIN_1g0065972mg                  100   1e-20   Citrus sinensis [apfelsine]
ref|XP_006435548.1|  hypothetical protein CICLE_v10030937mg             100   2e-20   Citrus clementina [clementine]
emb|CDP00105.1|  unnamed protein product                                100   2e-20   Coffea canephora [robusta coffee]
ref|XP_006362466.1|  PREDICTED: myosin-2 heavy chain-like isoform X1  99.8    2e-20   
ref|XP_004307495.1|  PREDICTED: protein INVOLVED IN DE NOVO 2         99.8    2e-20   Fragaria vesca subsp. vesca
ref|XP_006362467.1|  PREDICTED: myosin-2 heavy chain-like isoform X2  99.8    2e-20   Solanum tuberosum [potatoes]
ref|XP_006491885.1|  PREDICTED: calponin homology domain-containi...  97.8    4e-20   
ref|XP_002464269.1|  hypothetical protein SORBIDRAFT_01g015250        98.6    4e-20   
ref|XP_006846222.1|  hypothetical protein AMTR_s00012p00230440        98.6    5e-20   Amborella trichopoda
ref|XP_006491884.1|  PREDICTED: calponin homology domain-containi...  98.2    6e-20   Citrus sinensis [apfelsine]
ref|XP_006431941.1|  hypothetical protein CICLE_v10000571mg           98.2    6e-20   
gb|EMT17491.1|  hypothetical protein F775_14734                       99.4    6e-20   
ref|XP_007220898.1|  hypothetical protein PRUPE_ppa002712mg           98.2    6e-20   Prunus persica
ref|XP_006644407.1|  PREDICTED: intracellular protein transport p...  98.2    7e-20   Oryza brachyantha
ref|XP_004972827.1|  PREDICTED: synaptonemal complex protein 1-li...  97.8    7e-20   
ref|XP_003569416.1|  PREDICTED: factor of DNA methylation 1-like      97.8    9e-20   Brachypodium distachyon [annual false brome]
ref|XP_004972828.1|  PREDICTED: synaptonemal complex protein 1-li...  97.8    9e-20   Setaria italica
ref|XP_004240949.1|  PREDICTED: protein INVOLVED IN DE NOVO 2         97.8    9e-20   Solanum lycopersicum
ref|XP_006431940.1|  hypothetical protein CICLE_v10000571mg           97.8    9e-20   Citrus clementina [clementine]
ref|XP_009387522.1|  PREDICTED: uncharacterized protein LOC103974422  97.8    9e-20   
ref|XP_007156380.1|  hypothetical protein PHAVU_003G281400g           97.8    1e-19   Phaseolus vulgaris [French bean]
gb|KHN17925.1|  hypothetical protein glysoja_017976                   97.4    1e-19   Glycine soja [wild soybean]
ref|XP_003538408.1|  PREDICTED: putative leucine-rich repeat-cont...  97.4    1e-19   
gb|KDP44945.1|  hypothetical protein JCGZ_01445                       97.4    1e-19   Jatropha curcas
ref|XP_002533154.1|  conserved hypothetical protein                   97.1    2e-19   Ricinus communis
gb|ACF22790.1|  gene X-like protein                                   96.7    3e-19   Brachypodium distachyon [annual false brome]
ref|XP_010234409.1|  PREDICTED: factor of DNA methylation 1-like ...  95.9    4e-19   Brachypodium distachyon [annual false brome]
ref|XP_010234408.1|  PREDICTED: factor of DNA methylation 1-like ...  95.9    4e-19   Brachypodium distachyon [annual false brome]
emb|CDY35897.1|  BnaA07g00900D                                        90.1    5e-19   Brassica napus [oilseed rape]
ref|XP_010690719.1|  PREDICTED: protein INVOLVED IN DE NOVO 2         95.5    5e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006585879.1|  PREDICTED: myosin heavy chain, clone 203-lik...  95.1    6e-19   Glycine max [soybeans]
ref|XP_010651011.1|  PREDICTED: protein INVOLVED IN DE NOVO 2         95.1    7e-19   
emb|CDY08088.1|  BnaA06g16380D                                        95.5    7e-19   Brassica napus [oilseed rape]
ref|XP_004161917.1|  PREDICTED: uncharacterized LOC101219429          95.1    8e-19   
emb|CDY35048.1|  BnaA06g10580D                                        94.7    8e-19   Brassica napus [oilseed rape]
gb|KGN50554.1|  hypothetical protein Csa_5G182100                     95.5    8e-19   Cucumis sativus [cucumbers]
ref|XP_009357740.1|  PREDICTED: myosin heavy chain, cardiac muscl...  94.4    1e-18   Pyrus x bretschneideri [bai li]
ref|XP_004147687.1|  PREDICTED: uncharacterized protein LOC101219429  94.4    1e-18   Cucumis sativus [cucumbers]
ref|XP_009149803.1|  PREDICTED: myosin-11                             94.0    2e-18   Brassica rapa
gb|KHN07563.1|  hypothetical protein glysoja_019670                   93.6    2e-18   Glycine soja [wild soybean]
ref|XP_007009302.1|  XH/XS domain-containing protein isoform 5        93.6    2e-18   
ref|XP_010658558.1|  PREDICTED: protein INVOLVED IN DE NOVO 2 iso...  93.6    2e-18   Vitis vinifera
ref|XP_007009301.1|  XH/XS domain-containing protein, putative is...  93.2    2e-18   
ref|XP_007009300.1|  XH/XS domain-containing protein, putative is...  93.2    2e-18   
ref|XP_002278500.1|  PREDICTED: protein INVOLVED IN DE NOVO 2 iso...  93.6    2e-18   Vitis vinifera
ref|XP_007009298.1|  XH/XS domain-containing protein, putative is...  93.6    3e-18   
ref|XP_007009299.1|  XH/XS domain-containing protein, putative is...  93.6    3e-18   
ref|XP_008371804.1|  PREDICTED: WEB family protein At4g27595, chl...  93.6    3e-18   Malus domestica [apple tree]
ref|XP_006599359.1|  PREDICTED: uncharacterized protein PFB0765w-...  93.2    3e-18   
gb|KHN27026.1|  hypothetical protein glysoja_039182                   92.8    4e-18   Glycine soja [wild soybean]
gb|KHG15173.1|  Forkhead-associated domain-containing 1               92.8    4e-18   Gossypium arboreum [tree cotton]
ref|XP_008461675.1|  PREDICTED: flagellar attachment zone protein 1   92.8    4e-18   Cucumis melo [Oriental melon]
ref|XP_008343538.1|  PREDICTED: myosin-2 heavy chain-like             92.8    5e-18   
gb|KJB76093.1|  hypothetical protein B456_012G071000                  92.8    5e-18   Gossypium raimondii
ref|XP_008354129.1|  PREDICTED: myosin-2 heavy chain-like             92.8    5e-18   
ref|XP_009343557.1|  PREDICTED: myosin heavy chain, cardiac muscl...  92.4    6e-18   
ref|XP_006846214.1|  hypothetical protein AMTR_s00012p00226630        92.0    8e-18   Amborella trichopoda
gb|EYU18986.1|  hypothetical protein MIMGU_mgv1a011844mg              89.4    8e-18   Erythranthe guttata [common monkey flower]
ref|XP_011027214.1|  PREDICTED: protein INVOLVED IN DE NOVO 2         92.0    9e-18   Populus euphratica
gb|EEC71144.1|  hypothetical protein OsI_02969                        91.7    1e-17   Oryza sativa Indica Group [Indian rice]
ref|NP_001043655.1|  Os01g0633200                                     91.7    1e-17   
gb|KJB67636.1|  hypothetical protein B456_010G201400                  89.7    3e-17   Gossypium raimondii
ref|XP_008233634.1|  PREDICTED: LOW QUALITY PROTEIN: CAP-Gly doma...  90.5    3e-17   Prunus mume [ume]
ref|XP_006292435.1|  hypothetical protein CARUB_v10018651mg           89.7    5e-17   Capsella rubella
ref|XP_002456013.1|  hypothetical protein SORBIDRAFT_03g028860        89.7    5e-17   Sorghum bicolor [broomcorn]
gb|AGT17258.1|  X1 protein                                            89.7    5e-17   Saccharum hybrid cultivar R570
ref|XP_002316281.2|  XH/XS domain-containing family protein           90.1    5e-17   Populus trichocarpa [western balsam poplar]
gb|AGT16789.1|  hypothetical protein SHCRBa_009_B01_R_10              89.4    6e-17   Saccharum hybrid cultivar R570
ref|XP_009799105.1|  PREDICTED: golgin candidate 4                    89.4    7e-17   Nicotiana sylvestris
gb|KJB67635.1|  hypothetical protein B456_010G201400                  89.0    9e-17   Gossypium raimondii
ref|XP_006404228.1|  hypothetical protein EUTSA_v10010188mg           88.2    2e-16   Eutrema salsugineum [saltwater cress]
gb|AGT16810.1|  transcription factor                                  88.2    2e-16   Saccharum hybrid cultivar R570
gb|KHG06632.1|  KilA-N domain-containing protein                      88.2    2e-16   Gossypium arboreum [tree cotton]
ref|XP_010520104.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-like    87.8    2e-16   Tarenaya hassleriana [spider flower]
ref|XP_006595902.1|  PREDICTED: uncharacterized protein LOC100790...  88.6    2e-16   
gb|KHN20923.1|  hypothetical protein glysoja_009231                   88.2    2e-16   Glycine soja [wild soybean]
ref|XP_010426360.1|  PREDICTED: protein INVOLVED IN DE NOVO 2         87.8    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_003545257.1|  PREDICTED: uncharacterized protein LOC100790...  88.2    3e-16   Glycine max [soybeans]
ref|XP_009589398.1|  PREDICTED: golgin candidate 4                    86.7    5e-16   Nicotiana tomentosiformis
ref|XP_009150181.1|  PREDICTED: uncharacterized protein LOC103873521  86.7    5e-16   Brassica rapa
ref|XP_004503147.1|  PREDICTED: myosin-11-like isoform X1             86.7    6e-16   Cicer arietinum [garbanzo]
ref|NP_190436.2|  XH/XS domain-containing protein                     86.7    6e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CAB62356.1|  putative protein                                     86.3    7e-16   Arabidopsis thaliana [mouse-ear cress]
gb|KEH34701.1|  XH/XS domain protein                                  86.3    8e-16   Medicago truncatula
ref|XP_003616411.1|  Transcription factor X1-like protein             86.7    8e-16   Medicago truncatula
ref|XP_010503501.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-like    85.9    9e-16   Camelina sativa [gold-of-pleasure]
gb|KHN41100.1|  hypothetical protein glysoja_013442                   86.3    1e-15   Glycine soja [wild soybean]
ref|XP_009610609.1|  PREDICTED: uncharacterized protein LOC104104...  86.3    1e-15   Nicotiana tomentosiformis
ref|XP_006575506.1|  PREDICTED: uncharacterized protein LOC100806...  86.3    1e-15   Glycine max [soybeans]
dbj|BAJ90280.1|  predicted protein                                    85.5    1e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006575503.1|  PREDICTED: uncharacterized protein LOC100806...  86.3    1e-15   Glycine max [soybeans]
ref|XP_009610603.1|  PREDICTED: uncharacterized protein LOC104104...  86.3    1e-15   Nicotiana tomentosiformis
ref|XP_009610606.1|  PREDICTED: uncharacterized protein LOC104104...  86.3    1e-15   Nicotiana tomentosiformis
ref|XP_002875916.1|  XH/XS domain-containing protein                  85.5    1e-15   
ref|XP_009610604.1|  PREDICTED: uncharacterized protein LOC104104...  85.9    1e-15   Nicotiana tomentosiformis
ref|XP_006575505.1|  PREDICTED: uncharacterized protein LOC100806...  85.9    1e-15   
ref|XP_009610608.1|  PREDICTED: uncharacterized protein LOC104104...  85.9    1e-15   Nicotiana tomentosiformis
emb|CDY05861.1|  BnaC08g20380D                                        85.1    2e-15   
gb|EMT07790.1|  hypothetical protein F775_28070                       84.3    3e-15   
ref|XP_006424841.1|  hypothetical protein CICLE_v10029911mg           84.7    3e-15   
ref|XP_009791210.1|  PREDICTED: uncharacterized protein LOC104238...  84.7    3e-15   Nicotiana sylvestris
ref|XP_009791212.1|  PREDICTED: uncharacterized protein LOC104238...  84.7    3e-15   Nicotiana sylvestris
ref|XP_009791219.1|  PREDICTED: uncharacterized protein LOC104238...  84.7    3e-15   Nicotiana sylvestris
ref|XP_009791213.1|  PREDICTED: uncharacterized protein LOC104238...  84.7    4e-15   Nicotiana sylvestris
ref|XP_009791218.1|  PREDICTED: uncharacterized protein LOC104238...  84.7    4e-15   Nicotiana sylvestris
ref|XP_010678966.1|  PREDICTED: factor of DNA methylation 5-like      84.0    4e-15   Beta vulgaris subsp. vulgaris [field beet]
gb|EMT16668.1|  hypothetical protein F775_11900                       84.0    4e-15   
ref|XP_010108755.1|  hypothetical protein L484_011413                 83.6    5e-15   
gb|KDO72840.1|  hypothetical protein CISIN_1g038527mg                 83.6    5e-15   Citrus sinensis [apfelsine]
ref|XP_006488337.1|  PREDICTED: myosin-2 heavy chain-like isoform X1  83.6    6e-15   Citrus sinensis [apfelsine]
gb|AAB94013.1|  gene X-like protein                                   82.8    2e-14   Sorghum bicolor [broomcorn]
gb|EMS57088.1|  hypothetical protein TRIUR3_02882                     82.0    2e-14   Triticum urartu
gb|EEE62370.1|  hypothetical protein OsJ_17159                        81.6    3e-14   Oryza sativa Japonica Group [Japonica rice]
gb|AAL35831.2|AF434705_1  putative transcription factor X1            81.6    3e-14   Triticum monococcum [einkorn wheat]
emb|CDY37917.1|  BnaA06g19000D                                        80.9    4e-14   Brassica napus [oilseed rape]
ref|NP_001054677.1|  Os05g0153200                                     80.9    4e-14   
gb|EPS61376.1|  hypothetical protein M569_13419                       80.1    7e-14   Genlisea aurea
gb|KHG17770.1|  suppressor of gene silencing 3 -like protein          80.1    1e-13   Gossypium arboreum [tree cotton]
emb|CDX77918.1|  BnaC03g53010D                                        79.3    1e-13   
gb|KJB67633.1|  hypothetical protein B456_010G201300                  79.3    2e-13   Gossypium raimondii
gb|EAY96594.1|  hypothetical protein OsI_18500                        79.3    2e-13   Oryza sativa Indica Group [Indian rice]
gb|KJB67632.1|  hypothetical protein B456_010G201300                  79.7    2e-13   Gossypium raimondii
ref|XP_007141865.1|  hypothetical protein PHAVU_008G232300g           79.3    2e-13   Phaseolus vulgaris [French bean]
emb|CDP09063.1|  unnamed protein product                              79.0    2e-13   Coffea canephora [robusta coffee]
ref|XP_010520107.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-like    78.6    3e-13   Tarenaya hassleriana [spider flower]
ref|XP_004490889.1|  PREDICTED: uncharacterized protein LOC101499...  78.2    5e-13   Cicer arietinum [garbanzo]
ref|NP_001146275.1|  putative transcription factor                    77.8    5e-13   Zea mays [maize]
tpg|DAA58436.1|  TPA: putative XH domain family protein               77.0    5e-13   
gb|EYU43462.1|  hypothetical protein MIMGU_mgv1a002657mg              77.4    6e-13   Erythranthe guttata [common monkey flower]
ref|XP_008660211.1|  PREDICTED: uncharacterized protein LOC103639...  75.9    7e-13   
gb|EYU37790.1|  hypothetical protein MIMGU_mgv1a002821mg              76.3    1e-12   Erythranthe guttata [common monkey flower]
ref|XP_008660210.1|  PREDICTED: uncharacterized protein LOC103639...  75.5    1e-12   
ref|XP_010486975.1|  PREDICTED: factor of DNA methylation 3           75.9    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_003568833.1|  PREDICTED: factor of DNA methylation 1-like      75.9    2e-12   Brachypodium distachyon [annual false brome]
ref|XP_003568908.1|  PREDICTED: factor of DNA methylation 1-like      75.5    3e-12   
ref|XP_008673715.1|  PREDICTED: intraflagellar transport protein ...  75.1    4e-12   Zea mays [maize]
ref|XP_010106492.1|  hypothetical protein L484_025250                 74.7    5e-12   Morus notabilis
ref|XP_006407322.1|  hypothetical protein EUTSA_v10020282mg           74.7    5e-12   Eutrema salsugineum [saltwater cress]
ref|XP_006345968.1|  PREDICTED: uncharacterized protein LOC102583...  74.3    9e-12   
ref|XP_006345966.1|  PREDICTED: uncharacterized protein LOC102583...  74.3    9e-12   Solanum tuberosum [potatoes]
ref|XP_006345969.1|  PREDICTED: uncharacterized protein LOC102583...  73.9    1e-11   
emb|CDY42155.1|  BnaC05g40640D                                        73.2    1e-11   Brassica napus [oilseed rape]
gb|EYU17877.1|  hypothetical protein MIMGU_mgv1a002871mg              73.2    1e-11   Erythranthe guttata [common monkey flower]
gb|ABB89773.1|  At3g12550-like protein                                73.2    2e-11   Boechera stricta
ref|XP_002455202.1|  hypothetical protein SORBIDRAFT_03g006150        73.2    2e-11   Sorghum bicolor [broomcorn]
ref|XP_001783710.1|  predicted protein                                72.8    2e-11   
emb|CDY08424.1|  BnaA05g26600D                                        72.4    2e-11   Brassica napus [oilseed rape]
ref|XP_010465028.1|  PREDICTED: factor of DNA methylation 3-like      72.4    3e-11   Camelina sativa [gold-of-pleasure]
ref|XP_002882779.1|  hypothetical protein ARALYDRAFT_318024           72.4    3e-11   Arabidopsis lyrata subsp. lyrata
ref|XP_001763767.1|  predicted protein                                70.5    4e-11   
gb|AAG51004.1|AC069474_3  unknown protein; 49125-46422                71.6    4e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008655632.1|  PREDICTED: centrosomal protein of 128 kDa-like   71.6    5e-11   Zea mays [maize]
ref|NP_187861.2|  XH/XS domain-containing protein                     71.6    5e-11   Arabidopsis thaliana [mouse-ear cress]
gb|EMT02372.1|  hypothetical protein F775_12527                       70.5    6e-11   
ref|XP_010685748.1|  PREDICTED: factor of DNA methylation 4           71.2    7e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009146609.1|  PREDICTED: uncharacterized protein LOC103870246  71.2    7e-11   Brassica rapa
ref|XP_002526601.1|  conserved hypothetical protein                   70.9    8e-11   
ref|XP_010321721.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-like    70.9    1e-10   
ref|XP_006369526.1|  hypothetical protein POPTR_0001s24750g           70.5    1e-10   
ref|XP_004968205.1|  PREDICTED: uncharacterized protein LOC101778142  70.5    1e-10   
ref|XP_003557426.1|  PREDICTED: factor of DNA methylation 1-like      70.1    1e-10   
ref|XP_006366492.1|  PREDICTED: interaptin-like                       69.7    2e-10   
ref|XP_010499136.1|  PREDICTED: factor of DNA methylation 3-like      69.7    2e-10   
ref|XP_001777897.1|  predicted protein                                69.3    2e-10   
emb|CDM82421.1|  unnamed protein product                              69.3    3e-10   
gb|EMS65455.1|  hypothetical protein TRIUR3_13658                     69.3    3e-10   
ref|XP_002440617.1|  hypothetical protein SORBIDRAFT_09g004150        68.2    6e-10   
ref|XP_003566895.1|  PREDICTED: factor of DNA methylation 1           68.2    6e-10   
gb|EMS64523.1|  hypothetical protein TRIUR3_35150                     67.8    8e-10   
ref|XP_006297188.1|  hypothetical protein CARUB_v10013193mg           67.8    9e-10   
gb|EMT16997.1|  hypothetical protein F775_14651                       67.4    1e-09   
gb|EPS62632.1|  hypothetical protein M569_12161                       65.5    1e-09   
ref|XP_004977060.1|  PREDICTED: myosin heavy chain, clone 203-like    66.6    2e-09   
ref|XP_006378650.1|  XH/XS domain-containing family protein           66.6    2e-09   
gb|EYU24614.1|  hypothetical protein MIMGU_mgv1a004328mg              65.9    3e-09   
ref|XP_004239795.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-like    66.2    3e-09   
dbj|BAJ97190.1|  predicted protein                                    65.9    3e-09   
gb|EYU24613.1|  hypothetical protein MIMGU_mgv1a013548mg              63.2    4e-09   
gb|KHN12113.1|  hypothetical protein glysoja_048283                   63.2    7e-09   
dbj|BAH20228.1|  AT1G80790                                            64.7    7e-09   
ref|XP_006584160.1|  PREDICTED: aquaporin NIP3-3-like                 62.8    1e-08   
dbj|BAK05532.1|  predicted protein                                    62.0    6e-08   
ref|XP_010232950.1|  PREDICTED: factor of DNA methylation 1-like      60.8    1e-07   
ref|NP_001042014.1|  Os01g0147700                                     60.8    2e-07   
ref|NP_001169159.1|  putative XH domain family protein                60.5    2e-07   
gb|EAZ10533.1|  hypothetical protein OsJ_00365                        60.5    2e-07   
ref|XP_010232024.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-lik...  60.1    2e-07   
ref|XP_010232023.1|  PREDICTED: factor of DNA methylation 1-like ...  60.1    3e-07   
ref|XP_006655910.1|  PREDICTED: myosin-9-like                         59.7    3e-07   
gb|EAY72526.1|  hypothetical protein OsI_00387                        58.9    6e-07   
ref|XP_002457445.1|  hypothetical protein SORBIDRAFT_03g007460        57.4    1e-06   
gb|EMS50669.1|  hypothetical protein TRIUR3_29122                     57.4    2e-06   
gb|EMT22338.1|  hypothetical protein F775_15062                       56.6    3e-06   
ref|XP_006645454.1|  PREDICTED: centrosomal protein of 128 kDa-like   56.2    5e-06   
gb|EMS57892.1|  hypothetical protein TRIUR3_23802                     56.2    5e-06   
ref|XP_008384852.1|  PREDICTED: calponin homology domain-containi...  56.2    5e-06   
gb|EMT32524.1|  hypothetical protein F775_28173                       55.5    1e-05   
gb|EPS57463.1|  hypothetical protein M569_17354                       54.7    1e-05   
emb|CDM83432.1|  unnamed protein product                              55.1    1e-05   
ref|XP_009353657.1|  PREDICTED: uncharacterized protein LOC103944909  54.7    2e-05   
ref|XP_010476408.1|  PREDICTED: factor of DNA methylation 4-like ...  54.7    2e-05   
ref|XP_010476407.1|  PREDICTED: factor of DNA methylation 4-like ...  54.7    2e-05   
ref|XP_002444012.1|  hypothetical protein SORBIDRAFT_07g005860        54.3    2e-05   
gb|EMT09583.1|  hypothetical protein F775_10228                       53.5    4e-05   
ref|XP_004145335.1|  PREDICTED: uncharacterized LOC101207144          53.5    4e-05   
ref|XP_004165825.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  53.5    4e-05   
ref|XP_004154410.1|  PREDICTED: uncharacterized protein LOC101207144  53.5    4e-05   
gb|KGN65727.1|  hypothetical protein Csa_1G522530                     53.5    4e-05   
gb|AAV69067.1|  X1                                                    53.5    5e-05   
gb|AAV69068.1|  X1                                                    53.1    5e-05   
emb|CDY33798.1|  BnaA09g46040D                                        53.1    6e-05   
gb|AAV69069.1|  X1                                                    53.1    6e-05   
emb|CDP10823.1|  unnamed protein product                              53.1    6e-05   
ref|XP_002890022.1|  XH/XS domain-containing protein                  52.8    8e-05   
ref|XP_009402759.1|  PREDICTED: uncharacterized protein LOC103986461  51.2    1e-04   
gb|EMT15579.1|  hypothetical protein F775_11438                       51.6    2e-04   
ref|XP_011035877.1|  PREDICTED: factor of DNA methylation 4           51.6    2e-04   
ref|XP_006598036.1|  PREDICTED: uncharacterized protein LOC102662966  50.1    2e-04   
ref|XP_010911107.1|  PREDICTED: factor of DNA methylation 5-like      50.4    2e-04   
ref|XP_010458844.1|  PREDICTED: LOW QUALITY PROTEIN: factor of DN...  51.2    3e-04   
gb|EYU18979.1|  hypothetical protein MIMGU_mgv1a025152mg              51.2    3e-04   
dbj|BAB21190.1|  putative transcription factor                        50.8    3e-04   
ref|XP_007206603.1|  hypothetical protein PRUPE_ppa020716mg           50.8    3e-04   
gb|KHN32844.1|  hypothetical protein glysoja_048275                   50.4    4e-04   
ref|XP_006595025.1|  PREDICTED: myosin-11-like isoform X1             50.8    4e-04   
ref|XP_008223681.1|  PREDICTED: uncharacterized protein PFB0765w      50.4    4e-04   
ref|XP_006598540.1|  PREDICTED: ankyrin repeat domain-containing ...  50.1    6e-04   
gb|EMT28887.1|  hypothetical protein F775_12850                       49.7    7e-04   
ref|XP_010495608.1|  PREDICTED: factor of DNA methylation 4-like      50.1    7e-04   
gb|EMT18771.1|  Pumilio domain-containing-like protein                50.1    7e-04   
ref|XP_008457475.1|  PREDICTED: centrosomal protein of 83 kDa         49.7    7e-04   



>ref|XP_004235934.1| PREDICTED: factor of DNA methylation 1 [Solanum lycopersicum]
 ref|XP_010318733.1| PREDICTED: factor of DNA methylation 1 [Solanum lycopersicum]
Length=634

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 146/177 (82%), Gaps = 5/177 (3%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I E+KEKPYEELR+GK KVKGPNG LRCPFCAGKKKQDYKYKDLLQHATGVGKGSANRS 
Sbjct  16   IFEFKEKPYEELRTGKLKVKGPNGSLRCPFCAGKKKQDYKYKDLLQHATGVGKGSANRSA  75

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVAPED-----NNLYCWPWTGIVVNVSKDNANG  465
            KQKANH+ALAKYLE DL ++AEP+P+RAV PE      + L+ WPWTGI VNVSK+ ANG
Sbjct  76   KQKANHLALAKYLETDLVNEAEPIPKRAVTPEHSEAEKDKLFFWPWTGIFVNVSKETANG  135

Query  466  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
             + ++++YWLK+FS Y   EVK+FCD+++R S+ +++  S+W G+K A+ FE +FEA
Sbjct  136  RSPDDKEYWLKKFSMYMPLEVKLFCDNQARVSEAIVRFNSNWTGFKGAMEFEKSFEA  192



>ref|XP_009793120.1| PREDICTED: protein GRIP-like isoform X2 [Nicotiana sylvestris]
Length=501

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 145/177 (82%), Gaps = 5/177 (3%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I E+KEKPYEELR+GK +VKGPNG LRCPFCAGKKKQDYKYKDLLQHATGVGKGSANR  
Sbjct  30   IYEFKEKPYEELRTGKLRVKGPNGSLRCPFCAGKKKQDYKYKDLLQHATGVGKGSANRRA  89

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVA-----PEDNNLYCWPWTGIVVNVSKDNANG  465
            KQKANH+ALAKYL+ DL ++A+P+P RAV      PE   L+CWPWTG+VVN+SK+ ANG
Sbjct  90   KQKANHLALAKYLQTDLVNEADPIPARAVTPERSEPEKTELFCWPWTGVVVNISKEAANG  149

Query  466  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
             ++++++YWL++FS Y   EVK F D+++R S+ +++  SDW G+K+A+ FE +FEA
Sbjct  150  RSLDDKEYWLRKFSIYMPSEVKFFYDNQARVSEAIVRFNSDWTGFKSAMEFEKSFEA  206



>ref|XP_006341360.1| PREDICTED: myosin-9-like [Solanum tuberosum]
Length=635

 Score =   228 bits (582),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 144/177 (81%), Gaps = 5/177 (3%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I E+KEKPYEELR GK KVKGPNG LRCPFCAGKKKQDYKYKDLLQHATGVGKGSANRS 
Sbjct  16   IFEFKEKPYEELRKGKLKVKGPNGSLRCPFCAGKKKQDYKYKDLLQHATGVGKGSANRSA  75

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP-----EDNNLYCWPWTGIVVNVSKDNANG  465
            KQKANH+ALAKYLE DL ++AEP+P+RAV P     E + L+ WPWTGI VNVSK+ ANG
Sbjct  76   KQKANHLALAKYLETDLVNEAEPIPKRAVTPERSESEKDELFFWPWTGIFVNVSKETANG  135

Query  466  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
             + ++++YWLK+FS Y   EVK+FCD+++  S+ V++  SDW G+K A+ FE +FEA
Sbjct  136  RSPDDKEYWLKKFSLYMPLEVKLFCDNQATVSEAVVRFNSDWTGFKGAMEFEKSFEA  192



>ref|XP_009793116.1| PREDICTED: protein MLP1-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009793117.1| PREDICTED: protein MLP1-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009793118.1| PREDICTED: protein MLP1-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009793119.1| PREDICTED: protein MLP1-like isoform X1 [Nicotiana sylvestris]
Length=635

 Score =   225 bits (574),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 145/177 (82%), Gaps = 5/177 (3%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I E+KEKPYEELR+GK +VKGPNG LRCPFCAGKKKQDYKYKDLLQHATGVGKGSANR  
Sbjct  16   IYEFKEKPYEELRTGKLRVKGPNGSLRCPFCAGKKKQDYKYKDLLQHATGVGKGSANRRA  75

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVA-----PEDNNLYCWPWTGIVVNVSKDNANG  465
            KQKANH+ALAKYL+ DL ++A+P+P RAV      PE   L+CWPWTG+VVN+SK+ ANG
Sbjct  76   KQKANHLALAKYLQTDLVNEADPIPARAVTPERSEPEKTELFCWPWTGVVVNISKEAANG  135

Query  466  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
             ++++++YWL++FS Y   EVK F D+++R S+ +++  SDW G+K+A+ FE +FEA
Sbjct  136  RSLDDKEYWLRKFSIYMPSEVKFFYDNQARVSEAIVRFNSDWTGFKSAMEFEKSFEA  192



>ref|XP_009605544.1| PREDICTED: myb-like protein X isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009605546.1| PREDICTED: myb-like protein X isoform X2 [Nicotiana tomentosiformis]
Length=635

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 140/177 (79%), Gaps = 5/177 (3%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I E+KEKPYEELR+ K +VKGPNG LRCPFCAGKKKQDYKYKDLLQHATGVGKGSANR  
Sbjct  16   IYEFKEKPYEELRTEKLRVKGPNGSLRCPFCAGKKKQDYKYKDLLQHATGVGKGSANRRA  75

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVA-----PEDNNLYCWPWTGIVVNVSKDNANG  465
            KQKANH+ALAKYL+ DL ++ EP+P RAV      PE   L+CWPWTG+VVN+SK+ ANG
Sbjct  76   KQKANHLALAKYLQTDLVNEVEPIPARAVTPERSEPEKTELFCWPWTGVVVNISKEAANG  135

Query  466  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
             ++++++YWL++FS Y   E K F D+++R S+ +++  SDW G+K A+ FE +FE 
Sbjct  136  RSLDDKEYWLRKFSIYIPSEAKFFYDNQARVSEAIVRFNSDWTGFKGAMEFEMSFET  192



>ref|XP_009605543.1| PREDICTED: myb-like protein X isoform X1 [Nicotiana tomentosiformis]
Length=647

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 140/177 (79%), Gaps = 5/177 (3%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I E+KEKPYEELR+ K +VKGPNG LRCPFCAGKKKQDYKYKDLLQHATGVGKGSANR  
Sbjct  28   IYEFKEKPYEELRTEKLRVKGPNGSLRCPFCAGKKKQDYKYKDLLQHATGVGKGSANRRA  87

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVA-----PEDNNLYCWPWTGIVVNVSKDNANG  465
            KQKANH+ALAKYL+ DL ++ EP+P RAV      PE   L+CWPWTG+VVN+SK+ ANG
Sbjct  88   KQKANHLALAKYLQTDLVNEVEPIPARAVTPERSEPEKTELFCWPWTGVVVNISKEAANG  147

Query  466  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
             ++++++YWL++FS Y   E K F D+++R S+ +++  SDW G+K A+ FE +FE 
Sbjct  148  RSLDDKEYWLRKFSIYIPSEAKFFYDNQARVSEAIVRFNSDWTGFKGAMEFEMSFET  204



>ref|XP_011073344.1| PREDICTED: factor of DNA methylation 1 [Sesamum indicum]
Length=635

 Score =   207 bits (526),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 131/177 (74%), Gaps = 5/177 (3%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            INEYKEKPYE L++G YKVKGPNG LRCPFCAGKKKQDY+Y  LLQHA GV KGSA+RS 
Sbjct  16   INEYKEKPYELLKAGTYKVKGPNGSLRCPFCAGKKKQDYQYNHLLQHAIGVAKGSASRSA  75

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQR-----AVAPEDNNLYCWPWTGIVVNVSKDNANG  465
            KQKANH+ALA +LE DL ++AEPLPQ      A  PE + LYCWPW GIV N+  +  N 
Sbjct  76   KQKANHLALATFLENDLANEAEPLPQHTAPLPAAKPEKSELYCWPWVGIVANILNEPKNS  135

Query  466  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
              +    YWL +FSKY+  E++IF DD+  T+Q V++  +DW G+KNA+ FE +FEA
Sbjct  136  DCLASRGYWLNKFSKYKPIEIEIFWDDQQHTAQAVLRFDNDWTGFKNAMEFEKSFEA  192



>emb|CDO98219.1| unnamed protein product [Coffea canephora]
Length=677

 Score =   207 bits (527),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 136/179 (76%), Gaps = 6/179 (3%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I +YKEKP EEL+SGK+KVKGPNG LRCPFCAGKKKQDYKYKDLLQHATGV KGSANRS 
Sbjct  61   IKDYKEKPLEELKSGKFKVKGPNGTLRCPFCAGKKKQDYKYKDLLQHATGVSKGSANRSA  120

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP------EDNNLYCWPWTGIVVNVSKDNAN  462
             QKA H+ALA+YLE DL ++AEP P R   P      E N LYCWPWTG+VVN+  +  +
Sbjct  121  IQKAKHLALAEYLETDLVNEAEPQPLRVTPPAVADTSEQNELYCWPWTGVVVNILNETKS  180

Query  463  GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
            G AV+   +WL +FSKY+  EVK+F DD+ + +Q V+K  +DW G++NA+ FE +FE +
Sbjct  181  GKAVDSSAFWLNKFSKYKPLEVKVFWDDECQIAQAVVKFDNDWIGFRNAMEFEKSFEGD  239



>ref|XP_009626788.1| PREDICTED: coiled-coil domain-containing protein 150-like [Nicotiana 
tomentosiformis]
Length=632

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 137/177 (77%), Gaps = 6/177 (3%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            IN+Y EKPY+ELR+GKYKVKGPNG LRCPFCAG+KKQDYKY +LLQHA+G GKG A    
Sbjct  15   INDYIEKPYQELRTGKYKVKGPNGSLRCPFCAGRKKQDYKYNELLQHASGAGKG-ARLGA  73

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVAPE-----DNNLYCWPWTGIVVNVSKDNANG  465
            KQKANH+ALAKYLE DL ++AEP+P RAV PE        ++CWPWT +VVN+SK+ A+G
Sbjct  74   KQKANHLALAKYLESDLANEAEPVPPRAVTPERTEAEQTEVFCWPWTAVVVNISKETADG  133

Query  466  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
             +V++++YWLK+FS Y+  E+ +F D+++  S+ ++    +W G+ NA+ FE +FEA
Sbjct  134  ESVDDKEYWLKKFSLYKPLEIVLFHDNQALVSEAIVTFDRNWTGFNNAMEFEKSFEA  190



>gb|EYU21722.1| hypothetical protein MIMGU_mgv1a002818mg [Erythranthe guttata]
Length=634

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 131/177 (74%), Gaps = 5/177 (3%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            INEYKEKPYE L++G +KV+GPNG  RCPFCAGKKKQDY++  L QHA GV KGSA+R  
Sbjct  16   INEYKEKPYELLKAGTHKVRGPNGSFRCPFCAGKKKQDYQFNHLYQHAIGVAKGSASRGA  75

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQR-----AVAPEDNNLYCWPWTGIVVNVSKDNANG  465
            KQKANH+ALA +LE DL ++A P PQ      A  PE + LYCWPW GIVVN+ K+  NG
Sbjct  76   KQKANHLALATFLENDLANEAPPQPQPTVPVPAAKPEQSELYCWPWVGIVVNILKEAKNG  135

Query  466  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
              V+  DYW K+FSKY+  E+KIF DD   T+QVV++  +DW G+KNA+ FE +FEA
Sbjct  136  DCVDSSDYWSKKFSKYKPVEIKIFWDDDRSTAQVVLRFDNDWTGFKNAMEFEKSFEA  192



>gb|KJB56540.1| hypothetical protein B456_009G124400 [Gossypium raimondii]
Length=537

 Score =   197 bits (501),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 133/179 (74%), Gaps = 6/179 (3%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            INEYKEKPYEE+RSGKYKVK  NG LRCPFCAGKKKQDYKYKDLLQHA+GVGKGSANRS 
Sbjct  16   INEYKEKPYEEIRSGKYKVKALNGSLRCPFCAGKKKQDYKYKDLLQHASGVGKGSANRSA  75

Query  301  KQKANHVALAKYLEIDLGDQAE----PLPQRAV--APEDNNLYCWPWTGIVVNVSKDNAN  462
            KQ+ANH+ALAKYLEIDL  +A+    P   +AV   PE   LY WPW GI++N+  ++ N
Sbjct  76   KQRANHLALAKYLEIDLASEADETSRPTVPQAVDQTPEQTELYVWPWMGIIMNIVAESKN  135

Query  463  GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
               + ++ YWLKRF+KY+   V+ F ++   T Q ++   SDWNG+ NA  FE AFE+E
Sbjct  136  IDTLHDKGYWLKRFAKYKPINVQCFWNEVDLTGQAIVVFNSDWNGFVNATQFEKAFESE  194



>ref|XP_009763380.1| PREDICTED: myosin type-2 heavy chain 1-like [Nicotiana sylvestris]
 ref|XP_009763381.1| PREDICTED: myosin type-2 heavy chain 1-like [Nicotiana sylvestris]
Length=632

 Score =   199 bits (505),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 135/177 (76%), Gaps = 6/177 (3%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            IN+Y EKPY+ELR+GKYKVKGPNG LRCPFCAG+KKQDYKYK+LLQHA+G GKG A    
Sbjct  15   INDYIEKPYQELRTGKYKVKGPNGSLRCPFCAGRKKQDYKYKELLQHASGAGKG-ARLGA  73

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVAPE-----DNNLYCWPWTGIVVNVSKDNANG  465
            KQKANH+ALA YLE DL ++AEP+P RAV PE        ++CWPWT +VVN+SK+ A+G
Sbjct  74   KQKANHLALAMYLESDLANEAEPVPPRAVTPERTEAEQTEVFCWPWTAVVVNMSKETADG  133

Query  466  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
             +V+ ++YWLK+FS Y+  E+ +F D++   S+ ++    +W G+ NA+ FE +FEA
Sbjct  134  ESVDNKEYWLKKFSLYKPLEIMLFHDNQVLVSEAIVTFDRNWTGFNNAMEFEKSFEA  190



>gb|KJB56539.1| hypothetical protein B456_009G124400 [Gossypium raimondii]
Length=617

 Score =   196 bits (498),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 133/179 (74%), Gaps = 6/179 (3%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            INEYKEKPYEE+RSGKYKVK  NG LRCPFCAGKKKQDYKYKDLLQHA+GVGKGSANRS 
Sbjct  16   INEYKEKPYEEIRSGKYKVKALNGSLRCPFCAGKKKQDYKYKDLLQHASGVGKGSANRSA  75

Query  301  KQKANHVALAKYLEIDLGDQAE----PLPQRAV--APEDNNLYCWPWTGIVVNVSKDNAN  462
            KQ+ANH+ALAKYLEIDL  +A+    P   +AV   PE   LY WPW GI++N+  ++ N
Sbjct  76   KQRANHLALAKYLEIDLASEADETSRPTVPQAVDQTPEQTELYVWPWMGIIMNIVAESKN  135

Query  463  GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
               + ++ YWLKRF+KY+   V+ F ++   T Q ++   SDWNG+ NA  FE AFE+E
Sbjct  136  IDTLHDKGYWLKRFAKYKPINVQCFWNEVDLTGQAIVVFNSDWNGFVNATQFEKAFESE  194



>gb|KJB56538.1| hypothetical protein B456_009G124400 [Gossypium raimondii]
 gb|KJB56541.1| hypothetical protein B456_009G124400 [Gossypium raimondii]
 gb|KJB56542.1| hypothetical protein B456_009G124400 [Gossypium raimondii]
 gb|KJB56543.1| hypothetical protein B456_009G124400 [Gossypium raimondii]
 gb|KJB56544.1| hypothetical protein B456_009G124400 [Gossypium raimondii]
Length=633

 Score =   196 bits (498),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 133/179 (74%), Gaps = 6/179 (3%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            INEYKEKPYEE+RSGKYKVK  NG LRCPFCAGKKKQDYKYKDLLQHA+GVGKGSANRS 
Sbjct  16   INEYKEKPYEEIRSGKYKVKALNGSLRCPFCAGKKKQDYKYKDLLQHASGVGKGSANRSA  75

Query  301  KQKANHVALAKYLEIDLGDQAE----PLPQRAV--APEDNNLYCWPWTGIVVNVSKDNAN  462
            KQ+ANH+ALAKYLEIDL  +A+    P   +AV   PE   LY WPW GI++N+  ++ N
Sbjct  76   KQRANHLALAKYLEIDLASEADETSRPTVPQAVDQTPEQTELYVWPWMGIIMNIVAESKN  135

Query  463  GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
               + ++ YWLKRF+KY+   V+ F ++   T Q ++   SDWNG+ NA  FE AFE+E
Sbjct  136  IDTLHDKGYWLKRFAKYKPINVQCFWNEVDLTGQAIVVFNSDWNGFVNATQFEKAFESE  194



>gb|KHG15531.1| suppressor of gene silencing 3 [Gossypium arboreum]
Length=633

 Score =   196 bits (498),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 131/179 (73%), Gaps = 6/179 (3%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            INEYKEKPYEE+RSGKYKVK  NG LRCPFCAGKKKQDYKYKDLLQHA+GVGKGSANRS 
Sbjct  16   INEYKEKPYEEIRSGKYKVKALNGSLRCPFCAGKKKQDYKYKDLLQHASGVGKGSANRSA  75

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAV------APEDNNLYCWPWTGIVVNVSKDNAN  462
            KQ+ANH+ALAKYLEIDL  +A+   +  V       PE   LY WPW GI++N+  ++ N
Sbjct  76   KQRANHLALAKYLEIDLASEADETSRPTVPQVVDQTPEQTELYVWPWMGIIMNIVAESKN  135

Query  463  GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
               + ++ YWLKRF+KY+   V+ F ++   T Q ++   SDWNG+ NA  FE AFE+E
Sbjct  136  IDTLHDKGYWLKRFAKYKPINVQCFWNEVDLTGQAIVVFNSDWNGFVNATQFEKAFESE  194



>emb|CAN62667.1| hypothetical protein VITISV_028278 [Vitis vinifera]
Length=626

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 133/180 (74%), Gaps = 8/180 (4%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I EYKEKPYE+L++GKYKVKG NG LRCPFCAGKKKQDY+YKDLLQHA+GV KGSANRS 
Sbjct  16   IVEYKEKPYEQLKTGKYKVKGTNGTLRCPFCAGKKKQDYRYKDLLQHASGVAKGSANRSA  75

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP-------EDNNLYCWPWTGIVVNVSKDNA  459
            KQKANH+ALAKYLE DL  +++  P RAV P       E ++L+ WPWTGI+ N+  +  
Sbjct  76   KQKANHLALAKYLETDLASESDQAP-RAVEPKPVTRTQEQDDLFVWPWTGIITNIVTEQK  134

Query  460  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
            NG  + +  YWLK+FSK++  EV  F +D  +T+  +++  +DW G+ NA  FE AFEA+
Sbjct  135  NGNDLGDSAYWLKKFSKHKPLEVHTFWNDMDQTALAIVRFNNDWTGFMNATAFEKAFEAD  194



>ref|XP_002267670.1| PREDICTED: factor of DNA methylation 1 isoform X2 [Vitis vinifera]
Length=633

 Score =   194 bits (493),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 132/180 (73%), Gaps = 8/180 (4%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I EYKEKPYE+L++GKYKVKG NG LRCPFCAGKKKQDY+YKDLLQHA+GV KGSANRS 
Sbjct  16   IVEYKEKPYEQLKTGKYKVKGTNGTLRCPFCAGKKKQDYRYKDLLQHASGVAKGSANRSA  75

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP-------EDNNLYCWPWTGIVVNVSKDNA  459
            KQK NH+ALAKYLE DL  +++  P RAV P       E ++L+ WPWTGI+ N+  +  
Sbjct  76   KQKVNHLALAKYLETDLASESDQAP-RAVEPKPVTRTQEQDDLFVWPWTGIITNIVTEQM  134

Query  460  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
            NG  + +  YWLK+FSK++  EV  F +D  +T+  +++  +DW G+ NA  FE AFEA+
Sbjct  135  NGNDLGDSAYWLKKFSKHKPLEVHTFWNDMDQTALAIVRFNNDWTGFMNATAFEKAFEAD  194



>ref|XP_010656778.1| PREDICTED: factor of DNA methylation 1 isoform X1 [Vitis vinifera]
 ref|XP_010656779.1| PREDICTED: factor of DNA methylation 1 isoform X1 [Vitis vinifera]
Length=657

 Score =   194 bits (493),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 132/180 (73%), Gaps = 8/180 (4%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I EYKEKPYE+L++GKYKVKG NG LRCPFCAGKKKQDY+YKDLLQHA+GV KGSANRS 
Sbjct  40   IVEYKEKPYEQLKTGKYKVKGTNGTLRCPFCAGKKKQDYRYKDLLQHASGVAKGSANRSA  99

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP-------EDNNLYCWPWTGIVVNVSKDNA  459
            KQK NH+ALAKYLE DL  +++  P RAV P       E ++L+ WPWTGI+ N+  +  
Sbjct  100  KQKVNHLALAKYLETDLASESDQAP-RAVEPKPVTRTQEQDDLFVWPWTGIITNIVTEQM  158

Query  460  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
            NG  + +  YWLK+FSK++  EV  F +D  +T+  +++  +DW G+ NA  FE AFEA+
Sbjct  159  NGNDLGDSAYWLKKFSKHKPLEVHTFWNDMDQTALAIVRFNNDWTGFMNATAFEKAFEAD  218



>emb|CAN83544.1| hypothetical protein VITISV_021077 [Vitis vinifera]
Length=633

 Score =   194 bits (492),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 131/180 (73%), Gaps = 8/180 (4%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I EYKEKPYE+L++GKYKVKG NG LRCPFCAGKKKQDY YKDLLQHA+GV KGSANRS 
Sbjct  16   IVEYKEKPYEQLKTGKYKVKGTNGTLRCPFCAGKKKQDYXYKDLLQHASGVAKGSANRSA  75

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP-------EDNNLYCWPWTGIVVNVSKDNA  459
            KQK NH+ALAKYLE DL  +++  P RAV P       E ++L+ WPWTGI+ N+  +  
Sbjct  76   KQKVNHLALAKYLETDLASESDQAP-RAVEPKPVTRTQEQDDLFVWPWTGIITNIVTEQM  134

Query  460  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
            NG  + +  YWLK+FSK++  EV  F +D  +T+  +++  +DW G+ NA  FE AFEA+
Sbjct  135  NGNDLGDSAYWLKKFSKHKPLEVHTFWNDMDQTALAIVRFNNDWTGFMNATAFEKAFEAD  194



>ref|XP_007023402.1| XH/XS domain-containing protein [Theobroma cacao]
 gb|EOY26024.1| XH/XS domain-containing protein [Theobroma cacao]
Length=633

 Score =   191 bits (485),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 133/180 (74%), Gaps = 6/180 (3%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            IN+Y EKPYE+L+SGKY+VK  NG LRCPFCAGKKKQDYKYKDLLQHA+GVGKGSANRS 
Sbjct  16   INDYIEKPYEQLKSGKYQVKALNGSLRCPFCAGKKKQDYKYKDLLQHASGVGKGSANRSA  75

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAV------APEDNNLYCWPWTGIVVNVSKDNAN  462
             QKANH+ALAKYLEIDL  +A+   + AV       PE N+LY WPW GI++N+  ++ +
Sbjct  76   IQKANHLALAKYLEIDLASEADQTLRPAVPRPVNQTPEQNDLYVWPWMGIILNIVAESKD  135

Query  463  GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAEC  642
              A+ ++ YWLK+F+KY+  EV+ F +++  T Q ++K  +DWNG+ NA  FE  F  E 
Sbjct  136  KNALHDQGYWLKKFAKYKPLEVQSFWNEQDLTGQAILKFNNDWNGFMNATEFEKVFVTEL  195



>ref|XP_002267381.1| PREDICTED: factor of DNA methylation 1 [Vitis vinifera]
 ref|XP_010656777.1| PREDICTED: factor of DNA methylation 1 [Vitis vinifera]
Length=626

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 130/180 (72%), Gaps = 15/180 (8%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I EYKEKPYE+L++GKYKVKG NG LRCPFCAGKKKQDY+YKDLLQHA+GV KGSANRS 
Sbjct  16   IVEYKEKPYEQLKTGKYKVKGTNGTLRCPFCAGKKKQDYRYKDLLQHASGVAKGSANRSA  75

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP-------EDNNLYCWPWTGIVVNVSKDNA  459
            KQKANH+ALAKYLE DL  +++  P RAV P       E ++L+ WPWTGI+ N+  +  
Sbjct  76   KQKANHLALAKYLETDLASESDQAP-RAVEPKPVTRTQEQDDLFVWPWTGIITNIVTEQK  134

Query  460  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
            N        YWLK+FSK++  EV  F +D  +T+  +++  +DW G+ NA  FE AFEA+
Sbjct  135  NA-------YWLKKFSKHKPLEVHTFWNDMDQTALAIVRFNNDWTGFMNATAFEKAFEAD  187



>ref|XP_007214938.1| hypothetical protein PRUPE_ppa002776mg [Prunus persica]
 gb|EMJ16137.1| hypothetical protein PRUPE_ppa002776mg [Prunus persica]
Length=635

 Score =   187 bits (476),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 129/180 (72%), Gaps = 7/180 (4%)
 Frame = +1

Query  124  NEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVK  303
            N+YK+KPYE+LR GKYKVKGPNG LRCPFCAGKKKQDYK+KDL QHA+GVGKGSANRS K
Sbjct  17   NDYKDKPYEQLREGKYKVKGPNGTLRCPFCAGKKKQDYKFKDLFQHASGVGKGSANRSAK  76

Query  304  QKANHVALAKYLEIDLGDQAE----PLPQRAVAP---EDNNLYCWPWTGIVVNVSKDNAN  462
            QKANH+ALA YLE DL  +A+    PL    VAP   ++ +LY WPWTGIVVN+     +
Sbjct  77   QKANHIALAIYLENDLASEADQIQRPLLPTPVAPQEKQEEDLYVWPWTGIVVNIVSQPKD  136

Query  463  GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAEC  642
            G  + +  YWL++FSKY+  EV  F +++   +  V+    DW+G+ NA  FE  FE +C
Sbjct  137  GKDLLDSRYWLRKFSKYKPSEVHTFLNEEEPAACAVVCFSKDWSGFGNATDFEKMFETDC  196



>gb|KDO42997.1| hypothetical protein CISIN_1g006762mg [Citrus sinensis]
Length=557

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 133/180 (74%), Gaps = 9/180 (5%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            INEY EKPYEELR+GKYKV+  NG LRCPFC+GKKKQDYK+KDLLQHA+GVGKGSANRS 
Sbjct  16   INEYLEKPYEELRAGKYKVR-VNGTLRCPFCSGKKKQDYKHKDLLQHASGVGKGSANRSA  74

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP-------EDNNLYCWPWTGIVVNVSKDNA  459
            KQKANH+ALAKYLE+DL    +  PQR V P       E  +LY WPW GI+VN+  +  
Sbjct  75   KQKANHLALAKYLEVDLAGGVDK-PQRPVLPQPVNQNPEQEDLYVWPWMGIIVNIVMETK  133

Query  460  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
            +  +  +  YWLKRF+ ++  EV+IF ++++ T+Q V+K  +DWNG+  A  FE AF+A+
Sbjct  134  DRGSFLDSGYWLKRFAVFKPVEVRIFWNEENPTAQAVVKFNNDWNGFMQASDFEKAFDAD  193



>ref|XP_008228782.1| PREDICTED: interaptin-like [Prunus mume]
 ref|XP_008228783.1| PREDICTED: interaptin-like [Prunus mume]
Length=635

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 129/180 (72%), Gaps = 7/180 (4%)
 Frame = +1

Query  124  NEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVK  303
            N+YK+KPYE+LR GKYKVKGPNG LRCPFCAGKKKQDYK+KDL QHA+GVGKGSANRS K
Sbjct  17   NDYKDKPYEQLREGKYKVKGPNGTLRCPFCAGKKKQDYKFKDLFQHASGVGKGSANRSAK  76

Query  304  QKANHVALAKYLEIDLGDQAE----PLPQRAVAP---EDNNLYCWPWTGIVVNVSKDNAN  462
            QKANH+ALA YLE DL  +A+    PL    VAP   ++ +LY WPWTGIVVN+     +
Sbjct  77   QKANHLALAIYLENDLASEADQIQRPLLPTPVAPQEKQEEDLYVWPWTGIVVNIVIQPKD  136

Query  463  GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAEC  642
            G  + +  YWL++FSKY+  EV  F +++   +  V+    DW+G+ NA  FE  FE +C
Sbjct  137  GKDLLDSRYWLRKFSKYKPSEVHTFLNEEEPAACAVVCFSKDWSGFGNATDFEKMFETDC  196



>ref|XP_006427593.1| hypothetical protein CICLE_v10025142mg [Citrus clementina]
 ref|XP_006427594.1| hypothetical protein CICLE_v10025142mg [Citrus clementina]
 gb|ESR40833.1| hypothetical protein CICLE_v10025142mg [Citrus clementina]
 gb|ESR40834.1| hypothetical protein CICLE_v10025142mg [Citrus clementina]
Length=634

 Score =   185 bits (470),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 133/180 (74%), Gaps = 9/180 (5%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            INEY EKPYEELR+GKYKV+  NG LRCPFC+GKKKQDYK+KDLLQHA+GVGKGSANRS 
Sbjct  16   INEYLEKPYEELRAGKYKVR-VNGTLRCPFCSGKKKQDYKHKDLLQHASGVGKGSANRSA  74

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP-------EDNNLYCWPWTGIVVNVSKDNA  459
            KQKANH+ALAKYLE+DL    +  PQR V P       E  +LY WPW GI+VN+  +  
Sbjct  75   KQKANHLALAKYLEVDLAGGVDK-PQRPVLPQPVNQNPEQEDLYVWPWMGIIVNIVMETK  133

Query  460  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
            +  +  +  YWLKRF+ ++  EV+IF ++++ T+Q V+K  +DWNG+  A  FE AF+A+
Sbjct  134  DRGSFLDSGYWLKRFAVFKPVEVRIFWNEENPTAQAVVKFNNDWNGFMQASDFEKAFDAD  193



>gb|KDO42995.1| hypothetical protein CISIN_1g006762mg [Citrus sinensis]
Length=632

 Score =   185 bits (470),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 133/180 (74%), Gaps = 9/180 (5%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            INEY EKPYEELR+GKYKV+  NG LRCPFC+GKKKQDYK+KDLLQHA+GVGKGSANRS 
Sbjct  16   INEYLEKPYEELRAGKYKVR-VNGTLRCPFCSGKKKQDYKHKDLLQHASGVGKGSANRSA  74

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP-------EDNNLYCWPWTGIVVNVSKDNA  459
            KQKANH+ALAKYLE+DL    +  PQR V P       E  +LY WPW GI+VN+  +  
Sbjct  75   KQKANHLALAKYLEVDLAGGVDK-PQRPVLPQPVNQNPEQEDLYVWPWMGIIVNIVMETK  133

Query  460  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
            +  +  +  YWLKRF+ ++  EV+IF ++++ T+Q V+K  +DWNG+  A  FE AF+A+
Sbjct  134  DRGSFLDSGYWLKRFAVFKPVEVRIFWNEENPTAQAVVKFNNDWNGFMQASDFEKAFDAD  193



>ref|XP_006465197.1| PREDICTED: myosin-10-like [Citrus sinensis]
 gb|KDO42996.1| hypothetical protein CISIN_1g006762mg [Citrus sinensis]
Length=632

 Score =   185 bits (469),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 133/180 (74%), Gaps = 9/180 (5%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            INEY EKPYEELR+GKYKV+  NG LRCPFC+GKKKQDYK+KDLLQHA+GVGKGSANRS 
Sbjct  16   INEYLEKPYEELRAGKYKVR-VNGTLRCPFCSGKKKQDYKHKDLLQHASGVGKGSANRSA  74

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP-------EDNNLYCWPWTGIVVNVSKDNA  459
            KQKANH+ALAKYLE+DL    +  PQR V P       E  +LY WPW GI+VN+  +  
Sbjct  75   KQKANHLALAKYLEVDLAGGVDK-PQRPVLPQPVNQNPEQEDLYVWPWMGIIVNIVMETK  133

Query  460  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
            +  +  +  YWLKRF+ ++  EV+IF ++++ T+Q V+K  +DWNG+  A  FE AF+A+
Sbjct  134  DRGSFLDSGYWLKRFAVFKPVEVRIFWNEENPTAQAVVKFNNDWNGFMQASDFEKAFDAD  193



>ref|XP_008361182.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
[Malus domestica]
 ref|XP_008361190.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
[Malus domestica]
Length=634

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 128/181 (71%), Gaps = 8/181 (4%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I+EYK+KPYE+LR GKYKVKGPNG LRCPFCAGKKKQDYK+KDLLQHA+GV KGSA R+ 
Sbjct  16   IHEYKDKPYEQLREGKYKVKGPNGTLRCPFCAGKKKQDYKFKDLLQHASGVAKGSALRNA  75

Query  301  KQKANHVALAKYLEIDL---GDQAE----PLPQRAVAPEDNNLYCWPWTGIVVNVSKDNA  459
            KQKANH+ALA YLE DL   GDQ +    P P  A   +  +LY WPWTGIVVN+     
Sbjct  76   KQKANHLALALYLENDLASEGDQVQRPTLPAPV-AQQEKQEDLYVWPWTGIVVNIVSQPK  134

Query  460  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
            +G  + +  YW+++FSKY+  EV+  C++ +  +  V+    DWNG+ NA  FE  FE +
Sbjct  135  DGKDLLDSGYWMRKFSKYKPSEVRTLCNEGNPAACAVVYFSKDWNGFGNATDFEKTFETD  194

Query  640  C  642
            C
Sbjct  195  C  195



>ref|XP_002527307.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35059.1| conserved hypothetical protein [Ricinus communis]
Length=637

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 127/178 (71%), Gaps = 7/178 (4%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            IN+YKEKPY EL+SGKYKVK  NG LRCPFCAGKKKQDYKYKDLLQHATGVGKGSANRS 
Sbjct  16   INDYKEKPYGELKSGKYKVK-VNGTLRCPFCAGKKKQDYKYKDLLQHATGVGKGSANRSA  74

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAV------APEDNNLYCWPWTGIVVNVSKDNAN  462
            KQKANHVALA YLE DL D+++   + A+       P+  +L+  PW GIVVN+  +  +
Sbjct  75   KQKANHVALAIYLENDLADESDQSHRPALPKPVNPTPQQVDLFVKPWMGIVVNIVTEGKD  134

Query  463  GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
              A+ +  YWLK+F++Y+  EV  F  +  +T Q V+K   DWNG+ NA  FE +FE 
Sbjct  135  SNALHDNAYWLKKFAQYKPSEVSTFWSEHEQTGQAVLKFNDDWNGFMNATEFEKSFET  192



>ref|XP_003530299.1| PREDICTED: structural maintenance of chromosomes protein 2-like 
isoform X1 [Glycine max]
 ref|XP_006583096.1| PREDICTED: structural maintenance of chromosomes protein 2-like 
isoform X2 [Glycine max]
Length=629

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 125/178 (70%), Gaps = 12/178 (7%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I EY EKPYE+LR+GKYKVK  NG LRCP+CAGKKKQ++KYKDLLQHA+GVGKGSANRS 
Sbjct  16   IEEYAEKPYEQLRAGKYKVKNLNGTLRCPYCAGKKKQEFKYKDLLQHASGVGKGSANRSA  75

Query  301  KQKANHVALAKYLEIDLGDQAEP-----LPQRAVAP-EDNNLYCWPWTGIVVNVSKDNAN  462
            +QKANH+ALAKYLE DL  +AEP     LPQ    P    +LY WPWTGI+VN+      
Sbjct  76   QQKANHLALAKYLETDLACEAEPIQRPALPQAVNQPLHQEDLYVWPWTGIIVNIK-----  130

Query  463  GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
            G ++ +  YWLK F+K+   + +IF  D    +  V+   +DWNG+ NA  FE +FEA
Sbjct  131  GKSI-DSGYWLKEFAKFRPIDFRIFLKDDDLIAGAVVDFNNDWNGFMNASDFEKSFEA  187



>ref|XP_003531733.1| PREDICTED: protein MLP1-like isoform X1 [Glycine max]
 ref|XP_006585612.1| PREDICTED: protein MLP1-like isoform X2 [Glycine max]
 gb|KHN38029.1| hypothetical protein glysoja_007071 [Glycine soja]
Length=629

 Score =   177 bits (449),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 126/179 (70%), Gaps = 14/179 (8%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I EY EKPYE+LR+GKYKVK  NG LRCP+CAGKKKQ++KYKDLLQHA+GVGKGSANRS 
Sbjct  16   IEEYAEKPYEQLRAGKYKVKNLNGTLRCPYCAGKKKQEFKYKDLLQHASGVGKGSANRSA  75

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVAPE-------DNNLYCWPWTGIVVNVSKDNA  459
            +QKANH+ALAKYLE DL  +AE + QR   P+         +LY WPWTGI+VN+     
Sbjct  76   QQKANHLALAKYLETDLASEAESI-QRPAPPQAVNQPLLQEDLYVWPWTGIIVNIK----  130

Query  460  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
             G ++ +  YWLK F+K+   + +IF  D    ++ V+   +DWNG+ NA  FE +FEA
Sbjct  131  -GKSI-DSGYWLKEFAKFRPIDFRIFLKDDDLIAEAVVDFNNDWNGFMNASEFEKSFEA  187



>ref|XP_007135808.1| hypothetical protein PHAVU_010G160300g [Phaseolus vulgaris]
 gb|ESW07802.1| hypothetical protein PHAVU_010G160300g [Phaseolus vulgaris]
Length=640

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 124/179 (69%), Gaps = 13/179 (7%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I +Y EKPYE LR+GKYKVK  NG LRCP+CAGKKKQDYKYKDLLQHA+GVGKGSANRS 
Sbjct  27   IYDYSEKPYELLRAGKYKVKNLNGTLRCPYCAGKKKQDYKYKDLLQHASGVGKGSANRSA  86

Query  301  KQKANHVALAKYLEIDLGDQAEP-----LPQRAVAP--EDNNLYCWPWTGIVVNVSKDNA  459
            KQKANH+ALAKYLE DL  +AEP     LPQ    P  +++  Y WPWTGI+VN+     
Sbjct  87   KQKANHLALAKYLETDLASEAEPIQNPALPQAVNQPSQQEDLYYVWPWTGIIVNIK----  142

Query  460  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
             G +++   +WLK F+++   +  IF  D   T+Q V+    DWNG+ NA  FE +FE 
Sbjct  143  -GKSIDSR-HWLKEFAQFRPNDFHIFMKDGDMTAQAVMDFNKDWNGFINASEFEKSFET  199



>ref|XP_007135809.1| hypothetical protein PHAVU_010G160300g [Phaseolus vulgaris]
 gb|ESW07803.1| hypothetical protein PHAVU_010G160300g [Phaseolus vulgaris]
Length=629

 Score =   174 bits (440),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 124/179 (69%), Gaps = 13/179 (7%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I +Y EKPYE LR+GKYKVK  NG LRCP+CAGKKKQDYKYKDLLQHA+GVGKGSANRS 
Sbjct  16   IYDYSEKPYELLRAGKYKVKNLNGTLRCPYCAGKKKQDYKYKDLLQHASGVGKGSANRSA  75

Query  301  KQKANHVALAKYLEIDLGDQAEP-----LPQRAVAP--EDNNLYCWPWTGIVVNVSKDNA  459
            KQKANH+ALAKYLE DL  +AEP     LPQ    P  +++  Y WPWTGI+VN+     
Sbjct  76   KQKANHLALAKYLETDLASEAEPIQNPALPQAVNQPSQQEDLYYVWPWTGIIVNIK----  131

Query  460  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
             G +++   +WLK F+++   +  IF  D   T+Q V+    DWNG+ NA  FE +FE 
Sbjct  132  -GKSIDSR-HWLKEFAQFRPNDFHIFMKDGDMTAQAVMDFNKDWNGFINASEFEKSFET  188



>ref|XP_004510284.1| PREDICTED: uncharacterized protein PFB0145c-like [Cicer arietinum]
Length=586

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 123/173 (71%), Gaps = 14/173 (8%)
 Frame = +1

Query  139  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQKANH  318
            KPYE+L++GKYKVK  NG LRCP+C+GKKKQDYKYKDLLQHA+GVGKGSANRS KQKANH
Sbjct  22   KPYEQLKAGKYKVKNFNGTLRCPYCSGKKKQDYKYKDLLQHASGVGKGSANRSAKQKANH  81

Query  319  VALAKYLEIDLGDQAEPLPQRAVA-------PEDNNLYCWPWTGIVVNVSKDNANGTAVE  477
            +ALAKYLE DL ++A+ +P+ A          +D N Y WPWTGI+VN+       + + 
Sbjct  82   LALAKYLETDLANEADQIPRPASTQAVNQPVQQDEN-YVWPWTGIIVNIK------SQLH  134

Query  478  EEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
            +  YWLK F+KY   +V+IF  D    +Q VI   +DWNG+ NA  FE +FEA
Sbjct  135  DSRYWLKEFAKYRPLDVRIFLMDGDVAAQAVIDFHNDWNGFMNASEFEKSFEA  187



>gb|KDP41984.1| hypothetical protein JCGZ_27002 [Jatropha curcas]
Length=636

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 129/180 (72%), Gaps = 10/180 (6%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            IN+YK+KPYEEL+SGKYKVK  NG LRCPFCAGKKKQDYKYKDLLQHA+GV KGSANRS 
Sbjct  16   INDYKDKPYEELKSGKYKVK-VNGSLRCPFCAGKKKQDYKYKDLLQHASGVAKGSANRSG  74

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVAPE--------DNNLYCWPWTGIVVNVSKDN  456
            KQKANH+ALA YLE DL D+ +   QR V P+        + +++ WPW GIVVN+  + 
Sbjct  75   KQKANHLALAIYLETDLTDEVDQ-SQRPVLPQPVNPTPEQEMDVFVWPWMGIVVNIVNEA  133

Query  457  ANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
             +  A+++  YWLK+F+ Y+  ++  F  ++ +T   V+K  +DWNG+ NA  FE +FE 
Sbjct  134  KDRNALQDSGYWLKKFALYKPLDIYTFWSEEDQTGMAVLKFNNDWNGFINATEFEKSFET  193



>ref|XP_010678967.1| PREDICTED: factor of DNA methylation 1-like [Beta vulgaris subsp. 
vulgaris]
Length=631

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 123/179 (69%), Gaps = 9/179 (5%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I EY EKPY+ LR+G YKVK  NG L+CPFCAGKKKQ+Y +KDL QHA+GV KG+A+RS 
Sbjct  16   IEEYVEKPYQALRTGTYKVKNANGTLKCPFCAGKKKQEYGFKDLYQHASGVAKGAAHRSA  75

Query  301  KQKANHVALAKYLEIDLG-------DQAEPLPQRAVAPEDNNLYCWPWTGIVVNVSKDNA  459
            KQKA H+ALA+YLE+D+G         AEP PQ     E+  +YCWPW G+VVN+  D  
Sbjct  76   KQKAIHLALARYLEVDMGFGSAQNSGAAEPEPQPIEQKEE--VYCWPWIGVVVNIVDDGK  133

Query  460  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
             G  + +  +W+K FSKY+   V++F D++ +  Q V+  + +W G+KNA  FE +F+A
Sbjct  134  AGKQLADGGFWMKTFSKYKPLGVEVFHDEQEQIVQAVVHFEKEWTGFKNAGDFEKSFQA  192



>ref|XP_010063555.1| PREDICTED: CAP-Gly domain-containing linker protein 1-like [Eucalyptus 
grandis]
 ref|XP_010063556.1| PREDICTED: CAP-Gly domain-containing linker protein 1-like [Eucalyptus 
grandis]
 ref|XP_010063557.1| PREDICTED: CAP-Gly domain-containing linker protein 1-like [Eucalyptus 
grandis]
 ref|XP_010063558.1| PREDICTED: CAP-Gly domain-containing linker protein 1-like [Eucalyptus 
grandis]
 ref|XP_010063559.1| PREDICTED: CAP-Gly domain-containing linker protein 1-like [Eucalyptus 
grandis]
 gb|KCW70793.1| hypothetical protein EUGRSUZ_F03952 [Eucalyptus grandis]
 gb|KCW70794.1| hypothetical protein EUGRSUZ_F03952 [Eucalyptus grandis]
Length=633

 Score =   168 bits (425),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 122/169 (72%), Gaps = 6/169 (4%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I ++ +KPY+ELRSGK+KVKGPNG LRCPFC GKKKQDY+YK+L QHA GVGKGSANRS 
Sbjct  16   ILDHVDKPYDELRSGKFKVKGPNGSLRCPFCTGKKKQDYRYKELYQHAAGVGKGSANRSG  75

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQR------AVAPEDNNLYCWPWTGIVVNVSKDNAN  462
            KQKANH+ALAKYLE DL  +A+  PQ       A  P+ + ++ WPWTG++ N+  D ++
Sbjct  76   KQKANHLALAKYLETDLASEADQPPQPVVPQPSAQTPQQDEVFVWPWTGVIANILVDKSS  135

Query  463  GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNA  609
               + +  YWL +F+KY+  EV +F ++  ++++ V++    W G+KNA
Sbjct  136  EKELVDSAYWLTKFTKYKPLEVHVFLNEDGQSAKAVVRFNDHWEGFKNA  184



>ref|XP_010092186.1| hypothetical protein L484_013504 [Morus notabilis]
 gb|EXB50412.1| hypothetical protein L484_013504 [Morus notabilis]
Length=632

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 122/175 (70%), Gaps = 6/175 (3%)
 Frame = +1

Query  127  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQ  306
            +Y EKPY +LR G YKVKG NG L+CPFCAGKKKQDYK+KDLLQHA+GV KGSANRS KQ
Sbjct  18   DYAEKPYGQLRDGTYKVKGANGTLKCPFCAGKKKQDYKFKDLLQHASGVSKGSANRSAKQ  77

Query  307  KANHVALAKYLEIDL-GDQAE---PLPQRAVA--PEDNNLYCWPWTGIVVNVSKDNANGT  468
            KANH+ALAKYLE +L G+ A+   P+  R V    E +N Y WPWTGI+VN+     +G 
Sbjct  78   KANHLALAKYLEAELAGEVAQTELPVVSRPVLQHTEQDNRYVWPWTGIIVNIVGGGNDGL  137

Query  469  AVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  633
            +     +WL +FSK +   V+ F + K RTS+ +++ + DWNG+ NA  FE   E
Sbjct  138  SFPNSSHWLTKFSKCKPSSVQTFWNGKDRTSEAIVEFEGDWNGFMNATQFEKILE  192



>ref|XP_008375509.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
[Malus domestica]
Length=634

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 121/181 (67%), Gaps = 8/181 (4%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I+EYK+KPYE LR GKYKVKGPNG LRCPFCAGKKKQDYK+ +L QHA+GV KGSA R+ 
Sbjct  16   IHEYKDKPYELLREGKYKVKGPNGTLRCPFCAGKKKQDYKFNELFQHASGVAKGSALRNA  75

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP-------EDNNLYCWPWTGIVVNVSKDNA  459
            KQKANH+ALA YLE DL  + E + QR + P       +  +LY WPWTGIVVN+     
Sbjct  76   KQKANHLALAIYLENDLASEGEQI-QRPILPAPVTQQEKQEDLYVWPWTGIVVNIVSQPK  134

Query  460  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
            +G  + +  YW+++FSK +  EV    ++    +  V+    DW+G+ +A  FE  FE +
Sbjct  135  DGKDLLDSGYWMRKFSKCKPSEVHTLWNEGDPAACAVVYFSKDWSGFGSATDFEKMFETD  194

Query  640  C  642
            C
Sbjct  195  C  195



>ref|XP_010101455.1| hypothetical protein L484_012877 [Morus notabilis]
 gb|EXB88438.1| hypothetical protein L484_012877 [Morus notabilis]
Length=632

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 118/174 (68%), Gaps = 6/174 (3%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  309
            Y EKPY +LR G YKVKG NG LRCPFCAGKKKQDYK+KDLLQHA+GV KGSANRS KQK
Sbjct  19   YAEKPYGQLRGGTYKVKGANGTLRCPFCAGKKKQDYKFKDLLQHASGVSKGSANRSAKQK  78

Query  310  ANHVALAKYLEIDLGDQAE----PLPQRAVA--PEDNNLYCWPWTGIVVNVSKDNANGTA  471
            ANH+ALAKYL+ +L  +      P   R V    E +N Y WPWTGI+VN+     +G +
Sbjct  79   ANHLALAKYLDAELAGEVARTELPAISRPVLQHTEQDNQYVWPWTGIIVNIVGGGNDGLS  138

Query  472  VEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  633
              +  +WL +FSK +   V+ F + K RTS+ +++ + DWNG+ NA  FE   E
Sbjct  139  FPDSSHWLTKFSKCKPSRVQTFWNGKDRTSEAIVEFEGDWNGFMNATQFEKILE  192



>ref|XP_003610367.1| hypothetical protein MTR_4g131350 [Medicago truncatula]
 gb|AES92564.1| XH/XS domain protein [Medicago truncatula]
Length=682

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 123/176 (70%), Gaps = 16/176 (9%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  309
            Y +KPY+EL+ GKYKVK  NG LRCP+CAGKKKQ++KYKDL+QHATGV KGSANR+ KQK
Sbjct  72   YSDKPYKELKDGKYKVKNLNGTLRCPYCAGKKKQEFKYKDLMQHATGVSKGSANRNAKQK  131

Query  310  ANHVALAKYLEIDLGDQAEPLPQRAVA-------PEDNNLYCWPWTGIVVNVSKDNANGT  468
            ANH+ALAKYLE DL ++A+ +P  A+A       P+  N Y WPWTGI+VN+ K N N +
Sbjct  132  ANHLALAKYLETDLVNEADQIPPPALAEAVNQPVPQVEN-YVWPWTGIIVNI-KSNFNDS  189

Query  469  AVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
                  YWLK F+KY   +V +F  D    +Q V+   +DWNG+ NA  FE +FE 
Sbjct  190  G-----YWLKEFAKYRPLDVHVFFMDGD--TQAVVDFNNDWNGFMNASEFEKSFET  238



>ref|XP_008375623.1| PREDICTED: uncharacterized protein LOC103438859 [Malus domestica]
Length=379

 Score =   162 bits (409),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 116/179 (65%), Gaps = 7/179 (4%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            IN+YK+KPYE LR G Y VK PNG LRCPFC GKKKQDYK+K+L QHA+GV KGSANRS 
Sbjct  16   INDYKDKPYERLREGMYMVKCPNGALRCPFCVGKKKQDYKFKELFQHASGVAKGSANRSA  75

Query  301  KQKANHVALAKYLEIDLGDQAEP-----LPQRAVAPE-DNNLYCWPWTGIVVNVSKDNAN  462
            KQKANH+ALA YLE DL  +A+P     LP      E + +LY WPWTGI+ N+     +
Sbjct  76   KQKANHLALAIYLETDLASEADPTELPVLPTPVAHQEKEEDLYVWPWTGIIANIVSQPKD  135

Query  463  GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
               ++   YWL+RF+++   EV     ++ R +  V+   +DW G  NA  FE  FE +
Sbjct  136  PKDLDSR-YWLRRFAQFRPTEVHTLWTEEDRATCAVVYFNADWTGLGNATDFEKMFETD  193



>ref|XP_011467028.1| PREDICTED: factor of DNA methylation 1 [Fragaria vesca subsp. 
vesca]
 ref|XP_011467029.1| PREDICTED: factor of DNA methylation 1 [Fragaria vesca subsp. 
vesca]
Length=640

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 123/179 (69%), Gaps = 11/179 (6%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            INEYK+KPYE+LRSGK KVKGP G LRCPFCAGKKKQDYKYKDLLQH++GV KGSANRS 
Sbjct  21   INEYKDKPYEQLRSGKLKVKGPYGTLRCPFCAGKKKQDYKYKDLLQHSSGVAKGSANRSA  80

Query  301  KQKANHVALAKYLEIDLGDQAE----PLPQRAVA----PEDNNLYCWPWTGIVVNVSKDN  456
             QKANH+ALA YLE +L  +A+    P P + V     PED  LY WPWTG+V N+    
Sbjct  81   VQKANHLALALYLEKELASEADHIQRPAPPKPVVNDEKPED--LYVWPWTGVVANILLSQ  138

Query  457  -ANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAF  630
              +G  + +  YWL +FSKY+  +V  F +++ + +  V+    DWNG+ NA  FE  F
Sbjct  139  PKDGKDLLDSGYWLNKFSKYKPVDVHTFFNEEEQAAGAVVFFSKDWNGFGNATDFEKMF  197



>gb|EPS59185.1| hypothetical protein M569_15623 [Genlisea aurea]
Length=616

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 122/176 (69%), Gaps = 9/176 (5%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I+EYK KPYE L+SG YK+KGPNG LRCPFCAGKKKQDY+Y  L QHA GV KG+A +S 
Sbjct  34   IDEYKAKPYELLKSGFYKIKGPNGVLRCPFCAGKKKQDYQYNHLYQHAIGVAKGTA-KSA  92

Query  301  KQKANHVALAKYLEIDLGDQAEPL-----PQRAVAPEDNNLYCWPWTGIVVNVSKDNANG  465
            KQ+ANH+ALA YLE D   +AEP+     P+++   E   LYCWPW GI+VN+ +    G
Sbjct  93   KQRANHLALANYLEHDKPAEAEPMILPAPPEKSEQGE--LLYCWPWIGIIVNIRRRGQIG  150

Query  466  TA-VEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAF  630
               +    YWL ++SKY+  EV++F D     +Q V++  +DW+G+KNA+ FE +F
Sbjct  151  EGNLGSTSYWLNKYSKYKPLEVELFWDGDESNAQAVMRFGNDWDGFKNALEFEKSF  206



>gb|KEH32486.1| XH/XS domain protein [Medicago truncatula]
Length=629

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 124/177 (70%), Gaps = 18/177 (10%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  309
            Y +KPY+EL+ GKYKVK  NG LRCP+CAGKKKQ++KYKDL+QHATGV KGSANR+ KQK
Sbjct  19   YSDKPYKELKDGKYKVKNLNGTLRCPYCAGKKKQEFKYKDLMQHATGVSKGSANRNAKQK  78

Query  310  ANHVALAKYLEIDLGDQAEPLP----QRAV---APEDNNLYCWPWTGIVVNV-SKDNANG  465
            ANH+ALAK+LE DL ++A+ +P      AV   AP+  N Y WPWTGI+VN+ SK N +G
Sbjct  79   ANHLALAKFLETDLANEADQIPPPPLTEAVNQPAPQVEN-YVWPWTGIIVNIKSKLNDSG  137

Query  466  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
                   YWLK F+KY   +V +F  D    +Q V+   +DWNG+ NA  FE +FE 
Sbjct  138  -------YWLKEFAKYRPLDVHVFFMDGD--TQAVVDFNNDWNGFMNASEFEKSFET  185



>gb|KGN44516.1| hypothetical protein Csa_7G323110 [Cucumis sativus]
Length=561

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 120/177 (68%), Gaps = 6/177 (3%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            IN+Y EKPYE+LR+GK  VK  NG LRCPFC GKKKQDYKYKDLLQHA+GV KGS NR+ 
Sbjct  16   INDYAEKPYEQLRTGKLVVKTANGILRCPFCMGKKKQDYKYKDLLQHASGVSKGSKNRNA  75

Query  301  KQKANHVALAKYLEIDLGDQAE----PLPQRAVAPE-DNNLYCWPWTGIVVNVSKDNANG  465
            KQKANH+ALAKYLE +L  +A+    P P   ++ + +  LY WPW G++VN+       
Sbjct  76   KQKANHLALAKYLENELASEADQTQRPTPPTPISQDSEQELYVWPWMGVIVNIEAGEDRN  135

Query  466  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
            T  +   YW+K+F+KY   +V IF +D    +Q +++  +DWNG+ NA  FE  FE 
Sbjct  136  TVCDSA-YWIKKFAKYRPLDVYIFWNDNEPKAQAIVEFNNDWNGFVNATDFEKLFET  191



>ref|XP_004139640.1| PREDICTED: uncharacterized protein LOC101205093 [Cucumis sativus]
 ref|XP_004168328.1| PREDICTED: uncharacterized LOC101205093 [Cucumis sativus]
Length=632

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 120/177 (68%), Gaps = 6/177 (3%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            IN+Y EKPYE+LR+GK  VK  NG LRCPFC GKKKQDYKYKDLLQHA+GV KGS NR+ 
Sbjct  16   INDYAEKPYEQLRTGKLVVKTANGILRCPFCMGKKKQDYKYKDLLQHASGVSKGSKNRNA  75

Query  301  KQKANHVALAKYLEIDLGDQAE----PLPQRAVAPE-DNNLYCWPWTGIVVNVSKDNANG  465
            KQKANH+ALAKYLE +L  +A+    P P   ++ + +  LY WPW G++VN+       
Sbjct  76   KQKANHLALAKYLENELASEADQTQRPTPPTPISQDSEQELYVWPWMGVIVNIEAGEDRN  135

Query  466  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
            T  +   YW+K+F+KY   +V IF +D    +Q +++  +DWNG+ NA  FE  FE 
Sbjct  136  TVCDSA-YWIKKFAKYRPLDVYIFWNDNEPKAQAIVEFNNDWNGFVNATDFEKLFET  191



>ref|XP_002303841.1| XH domain-containing family protein [Populus trichocarpa]
 gb|EEE78820.1| XH domain-containing family protein [Populus trichocarpa]
Length=626

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 123/174 (71%), Gaps = 14/174 (8%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  309
            YK+KP E+LRSG  +VK  NG LRCPFCAGKKKQDYKYKDLLQHATGV KGSA+RS KQK
Sbjct  19   YKDKPLEDLRSGNLRVK-VNGFLRCPFCAGKKKQDYKYKDLLQHATGVSKGSASRSGKQK  77

Query  310  ANHVALAKYLEIDLGDQAEPLPQRAV------APEDNNLYCWPWTGIVVNVSKDNANGTA  471
            ANH+ALA+YLEI+L ++AE  P++ V       PE   L+ WPW GI+VN+++   N   
Sbjct  78   ANHLALARYLEIELANEAEQTPRQVVPQPIKPPPEQQELFVWPWMGILVNLTEQRDN---  134

Query  472  VEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  633
                +YW+K+F++Y+  E   F +++  ++Q +++   DW+G+ NA  FE  F+
Sbjct  135  ----EYWMKKFAEYKPLEFCTFLNEEDHSTQAIVRFNRDWDGFMNATRFEQLFD  184



>ref|XP_008454609.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
isoform X2 [Cucumis melo]
Length=632

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 120/177 (68%), Gaps = 6/177 (3%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            IN+Y EKPYE+LR+GK  VK  NG LRCPFC GKKKQDYKYKDLLQHA+GV KGS NR+ 
Sbjct  16   INDYAEKPYEQLRTGKLVVKTANGILRCPFCMGKKKQDYKYKDLLQHASGVSKGSKNRNA  75

Query  301  KQKANHVALAKYLEIDLGDQAE----PLPQRAVAPE-DNNLYCWPWTGIVVNVSKDNANG  465
            KQKANH+ALAKYLE +L  +A+    P P   ++ + +  LY WPW G+++N+       
Sbjct  76   KQKANHLALAKYLENELASEADQTQRPTPPTPISQDSEKELYVWPWMGVILNIEAGEDRN  135

Query  466  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
            T  +   YW+K+F+KY   +V IF +D    +Q +++  +DWNG+ NA  FE  FE 
Sbjct  136  TVCDSA-YWIKKFAKYRPLDVYIFWNDNEPKAQAIVEFNNDWNGFVNATDFEKLFET  191



>ref|XP_008454606.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
isoform X1 [Cucumis melo]
 ref|XP_008454607.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
isoform X1 [Cucumis melo]
Length=633

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 120/177 (68%), Gaps = 6/177 (3%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            IN+Y EKPYE+LR+GK  VK  NG LRCPFC GKKKQDYKYKDLLQHA+GV KGS NR+ 
Sbjct  17   INDYAEKPYEQLRTGKLVVKTANGILRCPFCMGKKKQDYKYKDLLQHASGVSKGSKNRNA  76

Query  301  KQKANHVALAKYLEIDLGDQAE----PLPQRAVAPE-DNNLYCWPWTGIVVNVSKDNANG  465
            KQKANH+ALAKYLE +L  +A+    P P   ++ + +  LY WPW G+++N+       
Sbjct  77   KQKANHLALAKYLENELASEADQTQRPTPPTPISQDSEKELYVWPWMGVILNIEAGEDRN  136

Query  466  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
            T  +   YW+K+F+KY   +V IF +D    +Q +++  +DWNG+ NA  FE  FE 
Sbjct  137  TVCDSA-YWIKKFAKYRPLDVYIFWNDNEPKAQAIVEFNNDWNGFVNATDFEKLFET  192



>ref|XP_008461480.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
[Cucumis melo]
 ref|XP_008461481.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
[Cucumis melo]
Length=632

 Score =   159 bits (403),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 118/178 (66%), Gaps = 8/178 (4%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            IN+Y EKPYE+LR+GK  VK  NG LRCPFC GKKKQDYKYKDLLQHA+GV KGS NR+ 
Sbjct  16   INDYAEKPYEQLRTGKLVVKTANGILRCPFCMGKKKQDYKYKDLLQHASGVSKGSKNRNA  75

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP------EDNNLYCWPWTGIVVNVSKDNAN  462
            KQKANH+ALAKYLE +L  +A+   QR   P       +  LY WPW G++VN+      
Sbjct  76   KQKANHLALAKYLENELASEADQ-TQRPTPPTPSSQDSEKELYVWPWMGVIVNIEVGEDR  134

Query  463  GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
             T  +   YW+K+F+KY   +V IF +D    +Q +++  +DWNG+ NA  FE  FE 
Sbjct  135  NTVCDSA-YWIKKFAKYRPLDVFIFWNDNEPKAQAIVEFNNDWNGFVNATDFEKLFET  191



>gb|AES86419.2| XH/XS domain protein [Medicago truncatula]
Length=626

 Score =   156 bits (395),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 116/171 (68%), Gaps = 14/171 (8%)
 Frame = +1

Query  139  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQKANH  318
            KPYEELR+GKYKVK  NG LRCP+C+GKKKQ++KYKDLLQHA+GVGKGSANRS KQKANH
Sbjct  22   KPYEELRAGKYKVKNNNGTLRCPYCSGKKKQEFKYKDLLQHASGVGKGSANRSTKQKANH  81

Query  319  VALAKYLEIDLGDQAEPLPQRA-----VAPEDNNLYCWPWTGIVVNVSKDNANGTAVEEE  483
            +ALAK+L  DL ++A+ +P+ A     V P     Y WPWTGI+VN+SK + +G      
Sbjct  82   LALAKFLRTDLANEADQVPRPALTVAVVQPVQVENYVWPWTGILVNISKSHDSG------  135

Query  484  DYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
             Y  K F+KY+   V  F  D +  S  VI   +DWNG+ NA   E  FE 
Sbjct  136  -YLQKEFAKYKPLAVHTFLMDGN--SVAVIDFNNDWNGFMNASELEKCFET  183



>ref|XP_003604222.1| hypothetical protein MTR_4g006760 [Medicago truncatula]
Length=657

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 116/171 (68%), Gaps = 14/171 (8%)
 Frame = +1

Query  139  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQKANH  318
            KPYEELR+GKYKVK  NG LRCP+C+GKKKQ++KYKDLLQHA+GVGKGSANRS KQKANH
Sbjct  53   KPYEELRAGKYKVKNNNGTLRCPYCSGKKKQEFKYKDLLQHASGVGKGSANRSTKQKANH  112

Query  319  VALAKYLEIDLGDQAEPLPQRA-----VAPEDNNLYCWPWTGIVVNVSKDNANGTAVEEE  483
            +ALAK+L  DL ++A+ +P+ A     V P     Y WPWTGI+VN+SK + +G      
Sbjct  113  LALAKFLRTDLANEADQVPRPALTVAVVQPVQVENYVWPWTGILVNISKSHDSG------  166

Query  484  DYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
             Y  K F+KY+   V  F  D +  S  VI   +DWNG+ NA   E  FE 
Sbjct  167  -YLQKEFAKYKPLAVHTFLMDGN--SVAVIDFNNDWNGFMNASELEKCFET  214



>ref|XP_010265647.1| PREDICTED: factor of DNA methylation 1-like isoform X3 [Nelumbo 
nucifera]
Length=556

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 119/181 (66%), Gaps = 10/181 (6%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            IN+YK+KPYE+L++G +KVK  +   RCPFC G+KKQDY+YKDLLQHA+GVGKGS+NRS 
Sbjct  16   INDYKDKPYEQLKAGMHKVKYSDVAFRCPFCKGRKKQDYRYKDLLQHASGVGKGSSNRSA  75

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVA-------PEDNNLYCWPWTGIVVNV-SKDN  456
            KQKANH+ALAKYLEIDL D   P P + V        PE  +LY WPWTGIVVN+ +K N
Sbjct  76   KQKANHLALAKYLEIDLADA--PGPSQPVTELKPSEHPEHGDLYIWPWTGIVVNILAKQN  133

Query  457  ANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
              G A    ++  K  SKY    V+     +  T   ++    +W G+++A+ FE  FE 
Sbjct  134  EEGRASGSANWLAKELSKYRPLSVQTSWSQQDHTMFAIVDFGKEWTGFRDAMEFEKDFET  193

Query  637  E  639
            +
Sbjct  194  D  194



>ref|XP_010265646.1| PREDICTED: factor of DNA methylation 1-like isoform X2 [Nelumbo 
nucifera]
Length=578

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 119/181 (66%), Gaps = 10/181 (6%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            IN+YK+KPYE+L++G +KVK  +   RCPFC G+KKQDY+YKDLLQHA+GVGKGS+NRS 
Sbjct  16   INDYKDKPYEQLKAGMHKVKYSDVAFRCPFCKGRKKQDYRYKDLLQHASGVGKGSSNRSA  75

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVA-------PEDNNLYCWPWTGIVVNV-SKDN  456
            KQKANH+ALAKYLEIDL D   P P + V        PE  +LY WPWTGIVVN+ +K N
Sbjct  76   KQKANHLALAKYLEIDLADA--PGPSQPVTELKPSEHPEHGDLYIWPWTGIVVNILAKQN  133

Query  457  ANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
              G A    ++  K  SKY    V+     +  T   ++    +W G+++A+ FE  FE 
Sbjct  134  EEGRASGSANWLAKELSKYRPLSVQTSWSQQDHTMFAIVDFGKEWTGFRDAMEFEKDFET  193

Query  637  E  639
            +
Sbjct  194  D  194



>ref|XP_010678965.1| PREDICTED: factor of DNA methylation 1-like [Beta vulgaris subsp. 
vulgaris]
Length=633

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 116/179 (65%), Gaps = 5/179 (3%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I EY E PYE LRSG Y V    G LRCPFCAGKKKQ+Y  KDL QHA+GV KG+A+RS 
Sbjct  16   IEEYAEIPYEALRSGTYNVWSIRGALRCPFCAGKKKQEYALKDLHQHASGVAKGAAHRSA  75

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQ-----RAVAPEDNNLYCWPWTGIVVNVSKDNANG  465
             QKA H+ALA+YLE+DLG  +    Q           +  L CWPW GIVVN+  +   G
Sbjct  76   IQKATHLALARYLEVDLGFGSVQASQPAEPKPEPDEPEEELLCWPWIGIVVNIMNEAETG  135

Query  466  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAEC  642
              + + ++W+K FSKY+   V++F D++ +T++ +++ + + NG+KNA  FE +FE + 
Sbjct  136  KQLADSEFWMKTFSKYKPLGVEVFQDEEEKTAKAIVQFEKELNGHKNAHDFEKSFEVDL  194



>ref|XP_010265641.1| PREDICTED: factor of DNA methylation 1-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010265643.1| PREDICTED: factor of DNA methylation 1-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010265644.1| PREDICTED: factor of DNA methylation 1-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010265645.1| PREDICTED: factor of DNA methylation 1-like isoform X1 [Nelumbo 
nucifera]
Length=633

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 119/181 (66%), Gaps = 10/181 (6%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            IN+YK+KPYE+L++G +KVK  +   RCPFC G+KKQDY+YKDLLQHA+GVGKGS+NRS 
Sbjct  16   INDYKDKPYEQLKAGMHKVKYSDVAFRCPFCKGRKKQDYRYKDLLQHASGVGKGSSNRSA  75

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVA-------PEDNNLYCWPWTGIVVNV-SKDN  456
            KQKANH+ALAKYLEIDL D   P P + V        PE  +LY WPWTGIVVN+ +K N
Sbjct  76   KQKANHLALAKYLEIDLADA--PGPSQPVTELKPSEHPEHGDLYIWPWTGIVVNILAKQN  133

Query  457  ANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
              G A    ++  K  SKY    V+     +  T   ++    +W G+++A+ FE  FE 
Sbjct  134  EEGRASGSANWLAKELSKYRPLSVQTSWSQQDHTMFAIVDFGKEWTGFRDAMEFEKDFET  193

Query  637  E  639
            +
Sbjct  194  D  194



>ref|XP_010537880.1| PREDICTED: factor of DNA methylation 1-like [Tarenaya hassleriana]
Length=633

 Score =   154 bits (389),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 115/169 (68%), Gaps = 7/169 (4%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I+EY EKPY+ L+SGK+KVK  NG LRCPFC+GKKKQDYKYK+L  HA+GV +GSANRS 
Sbjct  16   IDEYSEKPYKLLQSGKFKVK-VNGTLRCPFCSGKKKQDYKYKELFAHASGVARGSANRSA  74

Query  301  KQKANHVALAKYLEIDLGDQAEPLP------QRAVAPEDNNLYCWPWTGIVVNVSKDNAN  462
            KQKANH+ALA YLE DL   AE LP       + + P+  ++Y WPW GIVVN    + +
Sbjct  75   KQKANHLALANYLEKDLAGDAERLPCPPVPLSKQLEPKPGDIYVWPWMGIVVNPVNRSDD  134

Query  463  GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNA  609
              ++ +  YWLKR SK+    V+ F +++     V++K   DWNG+ NA
Sbjct  135  KESLLDSGYWLKRLSKFTPLGVESFWNEQDSEVDVIVKFNRDWNGFVNA  183



>emb|CDX81740.1| BnaC08g38610D [Brassica napus]
Length=515

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 117/177 (66%), Gaps = 7/177 (4%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  309
            Y +KPY +L++G YKVK  NG LRCPFC+GKKKQDYKYK+L+ HA+GV KGS +RS KQK
Sbjct  21   YSQKPYLKLQTGHYKVKKVNGTLRCPFCSGKKKQDYKYKELMAHASGVSKGSVSRSAKQK  80

Query  310  ANHVALAKYLEIDLG--DQAEPLPQR----AVAPEDNNLYCWPWTGIVVNVSKD-NANGT  468
            ANH+ALAKYLE +L     AEPLP+R       P+   +Y WPW GIV+N  K+ + +  
Sbjct  81   ANHLALAKYLETELAGSGHAEPLPRRPQLKETEPKPGEVYVWPWMGIVMNPLKETDDDKE  140

Query  469  AVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
             + +  YWLKR S+++  +V +F   K     VV +  SDW+G+ +A   E  FE E
Sbjct  141  VILDSGYWLKRLSRFKPVDVNVFLVQKDCVVAVVAEFNSDWSGFASATELEKEFERE  197



>ref|XP_006416865.1| hypothetical protein EUTSA_v10007054mg [Eutrema salsugineum]
 gb|ESQ35218.1| hypothetical protein EUTSA_v10007054mg [Eutrema salsugineum]
Length=633

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 114/174 (66%), Gaps = 7/174 (4%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  309
            Y E PY  L++GKYKVK  NG LRCPFC+GKKKQDYKYK+L+ HA+GV KGSANRS KQK
Sbjct  19   YSEIPYLMLQTGKYKVK-VNGNLRCPFCSGKKKQDYKYKELIAHASGVSKGSANRSAKQK  77

Query  310  ANHVALAKYLEIDLGDQAEPLPQRAVAPEDN------NLYCWPWTGIVVNVSKDNANGTA  471
            ANH+ALAKYLE +L   AEP+P+  V   D       ++Y WPW GIV+N  K+  +  A
Sbjct  78   ANHLALAKYLENELAGDAEPVPRPPVPQLDESEAKPGDIYVWPWMGIVINPLKETDDKEA  137

Query  472  VEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  633
            + +  YWLK  S++   EV  F  ++     V+ K  SDW+G+ +A   E  FE
Sbjct  138  LLDSAYWLKELSRFNPIEVNAFWVEQDSAVGVIAKFNSDWSGFASATELEEEFE  191



>ref|XP_009117794.1| PREDICTED: myosin-11-like [Brassica rapa]
 ref|XP_009117795.1| PREDICTED: myosin-11-like [Brassica rapa]
 ref|XP_009117796.1| PREDICTED: myosin-11-like [Brassica rapa]
Length=638

 Score =   143 bits (360),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 118/178 (66%), Gaps = 9/178 (5%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  309
            Y +KPY +L++G YKVK  NG LRCPFC+GKKKQDYKYK+L+ HA+GV KGS +RS KQK
Sbjct  21   YSQKPYLKLQTGHYKVK-VNGTLRCPFCSGKKKQDYKYKELIAHASGVSKGSVSRSAKQK  79

Query  310  ANHVALAKYLEIDL-GDQAEPLPQ------RAVAPEDNNLYCWPWTGIVVNVSKDNANGT  468
            ANH+ALAKYLE +L GD AE LP+          P+  ++Y WPW GIV+N  K+  +  
Sbjct  80   ANHLALAKYLETELAGDHAEGLPRPYLPLSNESEPKPGDVYVWPWMGIVMNPLKETDDDK  139

Query  469  AVEEED-YWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
             V  +  YWLKR S+++  +V +F  ++     VV +  SDW+G+ +A   E  FE E
Sbjct  140  EVLLDSWYWLKRLSRFKPVDVNVFWIEQDCVIAVVAEFNSDWSGFASATELEKEFERE  197



>emb|CDY52860.1| BnaA09g56520D [Brassica napus]
Length=638

 Score =   143 bits (360),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 118/178 (66%), Gaps = 9/178 (5%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  309
            Y +KPY +L++G YKVK  NG LRCPFC+GKKKQDYKYK+L+ HA+GV KGS +RS KQK
Sbjct  21   YSQKPYLKLQTGHYKVK-VNGTLRCPFCSGKKKQDYKYKELIAHASGVSKGSVSRSAKQK  79

Query  310  ANHVALAKYLEIDL-GDQAEPLPQ------RAVAPEDNNLYCWPWTGIVVNVSKDNANGT  468
            ANH+ALAKYLE +L GD AE LP+          P+  ++Y WPW GIV+N  K+  +  
Sbjct  80   ANHLALAKYLETELAGDHAEGLPRPYLPLSNESEPKPGDVYVWPWMGIVMNPLKETDDDK  139

Query  469  AVEEED-YWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
             V  +  YWLKR S+++  +V +F  ++     VV +  SDW+G+ +A   E  FE E
Sbjct  140  EVLLDSWYWLKRLSRFKPVDVNVFWIEQDCVIAVVAEFNSDWSGFASATELEKEFERE  197



>ref|XP_010497500.1| PREDICTED: factor of DNA methylation 1 [Camelina sativa]
 ref|XP_010497504.1| PREDICTED: factor of DNA methylation 1 [Camelina sativa]
Length=636

 Score =   140 bits (352),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 111/180 (62%), Gaps = 10/180 (6%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I++Y E PY  L++G YKVK  NG LRCPFC+GKKKQDYKYK+L  HA+GV KGSA RS 
Sbjct  16   IDDYSETPYMLLQNGSYKVK-VNGQLRCPFCSGKKKQDYKYKELYAHASGVSKGSATRSA  74

Query  301  KQKANHVALAKYLEIDLGDQAEPLP---------QRAVAPEDNNLYCWPWTGIVVNVSKD  453
            KQKANH+ALAK+LE +L   AEP P         +  V P   ++Y WPW GIV+N   D
Sbjct  75   KQKANHLALAKFLENELAGHAEPAPRPPPVPPQFEETVEPNPRDVYVWPWMGIVLNPLTD  134

Query  454  NANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  633
              +  A+   +YWL R SK++  EV  F  ++     V+ K  SDW G+  A   E  FE
Sbjct  135  TDDKEALLSSEYWLNRLSKFKPVEVNAFWVEQDSIVGVIAKFTSDWGGFACATELEKEFE  194



>ref|XP_010459126.1| PREDICTED: factor of DNA methylation 1-like [Camelina sativa]
Length=510

 Score =   136 bits (343),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 111/179 (62%), Gaps = 10/179 (6%)
 Frame = +1

Query  124  NEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVK  303
            ++Y E PY  L++G YKVK  NG LRCPFC+GKKKQDYKYK+L  HA+GV KGSA RS K
Sbjct  17   DDYSETPYMLLQNGSYKVK-VNGQLRCPFCSGKKKQDYKYKELYAHASGVSKGSATRSAK  75

Query  304  QKANHVALAKYLEIDLGDQAEPLP---------QRAVAPEDNNLYCWPWTGIVVNVSKDN  456
            QKANH+ALAK+LE +L   AEP+P         +  V P   ++Y WPW GIV+N     
Sbjct  76   QKANHLALAKFLENELAAHAEPVPRPPPVPPQFEETVEPNPRDVYVWPWMGIVLNPLTAT  135

Query  457  ANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  633
             +  A+ + +YWL R SK++  EV  F  ++     V+ K  SDW G+  A   E  FE
Sbjct  136  DDKEALLDSEYWLNRLSKFKPVEVNAFLVEQDSIVGVIAKFTSDWGGFACATELEKEFE  194



>dbj|BAE99100.1| hypothetical protein [Arabidopsis thaliana]
Length=439

 Score =   133 bits (334),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 109/175 (62%), Gaps = 8/175 (5%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  309
            Y EKPYE+L +G YKVK  +   RCPFCAGKKKQ YKYK+LL HA+GV KGSA+RS KQK
Sbjct  19   YYEKPYEKLMNGDYKVKVKD-TFRCPFCAGKKKQHYKYKELLAHASGVAKGSASRSAKQK  77

Query  310  ANHVALAKYLEIDL-GDQAEPLPQRAVAPED------NNLYCWPWTGIVVNVSKDNANGT  468
            ANH ALAKY+E +L GD   P PQ   +  +      +++Y WPW GIV+N  +   N  
Sbjct  78   ANHFALAKYMENELAGDADVPRPQIPSSSTEQSQAVVDDIYVWPWMGIVINPVRRTDNKN  137

Query  469  AVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  633
             + +  YWLK+ +++   EVK    D+     V+ +  S W+G+K+    E  +E
Sbjct  138  VLLDSAYWLKKLARFNPLEVKTLWLDQESVVAVIPQFNSGWSGFKSVTELEKEYE  192



>ref|XP_010476691.1| PREDICTED: factor of DNA methylation 1-like [Camelina sativa]
Length=636

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 108/177 (61%), Gaps = 10/177 (6%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  309
            Y E PY  L++G YKV   NG LRCPFC+GKKKQDYKYK+L  HATGV KGSA RS KQK
Sbjct  19   YSETPYLLLQNGSYKV-IVNGQLRCPFCSGKKKQDYKYKELYAHATGVSKGSATRSAKQK  77

Query  310  ANHVALAKYLEIDLGDQAEPLP---------QRAVAPEDNNLYCWPWTGIVVNVSKDNAN  462
            ANH+ALAK+LE +L   AEP+P         +  + P   ++Y WPW GIV+N   D  +
Sbjct  78   ANHLALAKFLENELAGHAEPVPRPPPVPPQLEETLEPNPRDVYVWPWMGIVLNPLTDTDD  137

Query  463  GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  633
              A+   +YWL R SK++  EV  F  ++     V+ K  SDW G+  A   E  FE
Sbjct  138  KEALLSSEYWLNRLSKFKPVEVNAFWVEQDSIVGVIAKFTSDWGGFACATELEKEFE  194



>ref|XP_006306990.1| hypothetical protein CARUB_v10008566mg [Capsella rubella]
 ref|XP_006306991.1| hypothetical protein CARUB_v10008566mg [Capsella rubella]
 gb|EOA39888.1| hypothetical protein CARUB_v10008566mg [Capsella rubella]
 gb|EOA39889.1| hypothetical protein CARUB_v10008566mg [Capsella rubella]
Length=633

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 107/176 (61%), Gaps = 7/176 (4%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  309
            Y E PY  L++G YKVK  NG LRCPFC+GKKKQDYKYK+L  HA+GV KGSA RS KQK
Sbjct  19   YSETPYLLLQNGSYKVK-VNGQLRCPFCSGKKKQDYKYKELYAHASGVSKGSATRSAKQK  77

Query  310  ANHVALAKYLEIDLGDQAEPLPQRA------VAPEDNNLYCWPWTGIVVNVSKDNANGTA  471
            ANH+ALAK+L+ +L   AEP+P           P    +Y WPW GIV+N  KD      
Sbjct  78   ANHLALAKFLDNELAGHAEPVPPPPVPQLDKTKPNPGEVYVWPWMGIVLNPLKDADEKEV  137

Query  472  VEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
            +    YW +R SK++  EV  F  ++     V+ K  SDW+G+ NA   E  FE E
Sbjct  138  LLTSAYWFERLSKFKPIEVNAFWVEQDSIVGVIAKFISDWSGFANAAALEKEFENE  193



>ref|NP_178194.1| FACTOR OF DNA METHYLATION 5 [Arabidopsis thaliana]
 sp|Q9SAI1.1|FDM5_ARATH RecName: Full=Factor of DNA methylation 5 [Arabidopsis thaliana]
 gb|AAF14667.1|AC011713_15 Contains similarity to gb|AF136530 transcriptional regulator 
from Zea mays [Arabidopsis thaliana]
 gb|AEE36451.1| XH/XS domain-containing protein [Arabidopsis thaliana]
Length=634

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 109/175 (62%), Gaps = 8/175 (5%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  309
            Y EKPYE+L +G YKVK  +   RCPFCAGKKKQ YKYK+LL HA+GV KGSA+RS KQK
Sbjct  19   YYEKPYEKLMNGDYKVKVKD-TFRCPFCAGKKKQHYKYKELLAHASGVAKGSASRSAKQK  77

Query  310  ANHVALAKYLEIDL-GDQAEPLPQRAVAPED------NNLYCWPWTGIVVNVSKDNANGT  468
            ANH ALAKY+E +L GD   P PQ   +  +      +++Y WPW GIV+N  +   N  
Sbjct  78   ANHFALAKYMENELAGDADVPRPQIPSSSTEQSQAVVDDIYVWPWMGIVINPVRRTDNKN  137

Query  469  AVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  633
             + +  YWLK+ +++   EVK    D+     V+ +  S W+G+K+    E  +E
Sbjct  138  VLLDSAYWLKKLARFNPLEVKTLWLDQESVVAVIPQFNSGWSGFKSVTELEKEYE  192



>ref|XP_002890136.1| XH/XS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66395.1| XH/XS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=635

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 112/178 (63%), Gaps = 9/178 (5%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  309
            Y E PY  LR+G YKVK  NG LRCPFC+GKKKQDYKYK+L  HATGV KGSA+RS KQK
Sbjct  19   YSETPYLLLRNGSYKVK-VNGQLRCPFCSGKKKQDYKYKELYAHATGVSKGSASRSAKQK  77

Query  310  ANHVALAKYLEIDLGDQAEPLPQRA--------VAPEDNNLYCWPWTGIVVNVSKDNANG  465
            ANH+ALAK+LE +L   AEP+P+            P  +++Y WPW  IV+N  K+  + 
Sbjct  78   ANHLALAKFLENELAGYAEPVPRPPVVPPQFDETEPNPHDVYVWPWMAIVLNPLKETDDK  137

Query  466  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
              + +  +WLK  SK++  EV  F  ++     V+ K  SDW+G+ +A   E  FE +
Sbjct  138  ELLLDSAFWLKTLSKFKPIEVNAFWLEQDSIVGVIAKFHSDWSGFASATELEKEFETQ  195



>ref|NP_173043.1| factor of DNA methylation 1 [Arabidopsis thaliana]
 sp|Q9S9P3.1|FDM1_ARATH RecName: Full=Factor of DNA methylation 1; AltName: Full=Protein 
IDN2 PARALOG 1; AltName: Full=Protein IDN2-LIKE 1 [Arabidopsis 
thaliana]
 gb|AAF18488.1|AC010924_1 Contains similarity to gb|AF136530 transcriptional regulator 
from Zea mays. ESTs gb|F14071, gb|Z26823, gb|AI998935 come from 
this gene [Arabidopsis thaliana]
 gb|AEE29382.1| factor of DNA methylation 1 [Arabidopsis thaliana]
Length=634

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 108/179 (60%), Gaps = 9/179 (5%)
 Frame = +1

Query  127  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQ  306
            +Y E PY  LR G YKVK  NG LRCPFCAGKKKQDYKYK+L  HATGV KGSA RS  Q
Sbjct  17   DYSETPYRLLRDGTYKVK-VNGQLRCPFCAGKKKQDYKYKELYAHATGVSKGSATRSALQ  75

Query  307  KANHVALAKYLEIDLGDQAEPLPQRA--------VAPEDNNLYCWPWTGIVVNVSKDNAN  462
            KANH+ALA +LE +L   AEP+P+            P  +N+Y WPW GIVVN  K+  +
Sbjct  76   KANHLALAMFLENELAGYAEPVPRPPVVPPQLDETEPNPHNVYVWPWMGIVVNPLKEADD  135

Query  463  GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
               + +  YWL+  SK++  EV  F  ++     V+ K   DW+G+  A   E  FE +
Sbjct  136  KELLLDSAYWLQTLSKFKPIEVNAFWVEQDSIVGVIAKFNGDWSGFAGATELEKEFETQ  194



>ref|XP_003610364.1| hypothetical protein MTR_4g131310 [Medicago truncatula]
 gb|AES92561.1| XH/XS domain protein [Medicago truncatula]
Length=458

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 108/169 (64%), Gaps = 20/169 (12%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  309
            Y +KPY+EL+ GKYKVK  NG LRCP+CAGKKKQ++KYKDL+QH TGV KGSANR+ KQK
Sbjct  19   YSDKPYKELKDGKYKVKNLNGTLRCPYCAGKKKQEFKYKDLMQHETGVSKGSANRNAKQK  78

Query  310  ANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYCWPWTGIVVNVSKDNANGTAVEEEDY  489
            ANH+ALAKYLE DL ++A+ +P  A+A   N     P   +      +N  G   E    
Sbjct  79   ANHLALAKYLETDLVNEADQIPPPALAEAVNQ----PVPQV------ENYVGHGQE----  124

Query  490  WLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
                F+KY   +V +F  D    +Q V+   +DWNG+KNA  FE +FE 
Sbjct  125  ----FAKYRPLDVHVFFMDGD--TQAVVDFNNDWNGFKNASEFEKSFET  167



>gb|AAF02798.1|AF195115_18 F5I10.22 gene product [Arabidopsis thaliana]
 gb|AAB62840.1| A_IG005I10.22 gene product [Arabidopsis thaliana]
 emb|CAB80796.1| AT4g00380 [Arabidopsis thaliana]
Length=662

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 105/178 (59%), Gaps = 8/178 (4%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  309
            Y + PY  LRS  Y     NG LRCPFC GKKKQDYKYK+L  HATGV KGSA RS  QK
Sbjct  18   YSKTPYHLLRSETYYKVKVNGRLRCPFCVGKKKQDYKYKELHAHATGVSKGSATRSALQK  77

Query  310  ANHVALAKYLEIDLGDQAEPLPQRA--------VAPEDNNLYCWPWTGIVVNVSKDNANG  465
            +NH+ALAK+LE DL   AEPLP+            P  +N+Y WPW GIVVN  K+  + 
Sbjct  78   SNHLALAKFLENDLAGYAEPLPRPPVVPPLLDETEPNPHNVYVWPWMGIVVNPLKETDDK  137

Query  466  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
              + +  YWL+  SK++  EV  F  ++     V+ K  SDW+G+  A   E  FE +
Sbjct  138  ELLLDSVYWLQTLSKFKPVEVNAFWVEQDSIVGVIAKFDSDWSGFAAATELEKEFETQ  195



>ref|NP_567176.2| XH/XS domain-containing protein [Arabidopsis thaliana]
 sp|F4JH53.1|FDM2_ARATH RecName: Full=Factor of DNA methylation 2; AltName: Full=Protein 
IDN2 PARALOG 2; AltName: Full=Protein IDN2-LIKE 2 [Arabidopsis 
thaliana]
 gb|AEE81871.1| XH/XS domain-containing protein [Arabidopsis thaliana]
Length=635

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 105/178 (59%), Gaps = 8/178 (4%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  309
            Y + PY  LRS  Y     NG LRCPFC GKKKQDYKYK+L  HATGV KGSA RS  QK
Sbjct  18   YSKTPYHLLRSETYYKVKVNGRLRCPFCVGKKKQDYKYKELHAHATGVSKGSATRSALQK  77

Query  310  ANHVALAKYLEIDLGDQAEPLPQRA--------VAPEDNNLYCWPWTGIVVNVSKDNANG  465
            +NH+ALAK+LE DL   AEPLP+            P  +N+Y WPW GIVVN  K+  + 
Sbjct  78   SNHLALAKFLENDLAGYAEPLPRPPVVPPLLDETEPNPHNVYVWPWMGIVVNPLKETDDK  137

Query  466  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
              + +  YWL+  SK++  EV  F  ++     V+ K  SDW+G+  A   E  FE +
Sbjct  138  ELLLDSVYWLQTLSKFKPVEVNAFWVEQDSIVGVIAKFDSDWSGFAAATELEKEFETQ  195



>ref|XP_009149026.1| PREDICTED: nuclear mitotic apparatus protein 1 [Brassica rapa]
 ref|XP_009149027.1| PREDICTED: nuclear mitotic apparatus protein 1 [Brassica rapa]
Length=636

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 110/179 (61%), Gaps = 13/179 (7%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  309
            Y E PY  L++GKYKVK  NG LRCPFC+ KKKQDYKYK+L+ HA+GV KGSA+RS KQK
Sbjct  19   YSETPYLLLQNGKYKVK-VNGTLRCPFCSNKKKQDYKYKELMAHASGVSKGSASRSAKQK  77

Query  310  ANHVALAKYLEIDLGDQAE----------PLPQRAVAPEDNNLYCWPWTGIVVNVSKDNA  459
            ANH+ALA+YL+ +L   AE           L +    P    +Y WPW GI+V+  K+  
Sbjct  78   ANHLALARYLQNELAGDAEPLPRPPPVPPQLNESEAKP--GEVYVWPWMGIIVSPLKETD  135

Query  460  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
            +  A+ +   WLK  S+++  EV  F  ++     VV K  SDW+G+ +A   E  FE+
Sbjct  136  DKEALLDSACWLKELSRFKPVEVHAFWVEQGLIVGVVAKFNSDWSGFASATELEKEFES  194



>gb|KHN04171.1| hypothetical protein glysoja_032667 [Glycine soja]
Length=491

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 84/132 (64%), Gaps = 12/132 (9%)
 Frame = +1

Query  259  HATGVGKGSANRSVKQKANHVALAKYLEIDLGDQAEP-----LPQRAVAP-EDNNLYCWP  420
            HA+GVGKGSANRS +QKANH+ALAKYLE DL  +AEP     LPQ    P    +LY WP
Sbjct  20   HASGVGKGSANRSAQQKANHLALAKYLETDLACEAEPIQRPALPQAVNQPLHQEDLYVWP  79

Query  421  WTGIVVNVSKDNANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGY  600
            WTGI+VN+      G ++ +  YWLK F+K+   + +IF  D    +  V+   +DWNG+
Sbjct  80   WTGIIVNIK-----GKSI-DSGYWLKEFAKFRPIDFRIFLKDDDLIAGAVVDFNNDWNGF  133

Query  601  KNAILFENAFEA  636
             NA  FE +FEA
Sbjct  134  MNASDFEKSFEA  145



>emb|CDY33370.1| BnaC05g12130D [Brassica napus]
Length=1005

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 113/177 (64%), Gaps = 9/177 (5%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  309
            Y E PY  L++GKYKVK  NG LRCPFC+ KKKQDYKYK+L+ HA+GV KGSA+RS KQK
Sbjct  367  YSETPYLLLQNGKYKVK-VNGTLRCPFCSNKKKQDYKYKELMAHASGVSKGSASRSAKQK  425

Query  310  ANHVALAKYLEIDLGDQAEPLPQRAVAPEDNN--------LYCWPWTGIVVNVSKDNANG  465
            ANH+ALA+YL+ +L   AEPLP+    P   N        +Y WPW GI+++   +  + 
Sbjct  426  ANHLALARYLQNELAGDAEPLPRPPPVPPQLNESEAKPGEVYVWPWMGIIISPLNETDDK  485

Query  466  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
             A+ +   WLK  S+++  EV  F  ++  T  VV K  SDW+G+ +A   E  FE+
Sbjct  486  EALLDPACWLKELSRFKPVEVHAFWVEQGLTVGVVAKFNSDWSGFASATELEKEFES  542



>emb|CBI40115.3| unnamed protein product [Vitis vinifera]
Length=579

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 92/128 (72%), Gaps = 18/128 (14%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I EYKEKPYE+L++GKYKVKG NG LRCPFCAGKKKQDY+YKDLLQHA+GV KGSANRS 
Sbjct  16   IVEYKEKPYEQLKTGKYKVKGTNGTLRCPFCAGKKKQDYRYKDLLQHASGVAKGSANRSA  75

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP-------EDNNLYCW--PWTGIVVNVSKD  453
            KQK NH+ALAKYLE DL  +++  P RAV P       E ++L+ +   WTG +      
Sbjct  76   KQKVNHLALAKYLETDLASESDQAP-RAVEPKPVTRTQEQDDLFVFNNDWTGFM------  128

Query  454  NANGTAVE  477
              N TA E
Sbjct  129  --NATAFE  134



>ref|XP_010937610.1| PREDICTED: factor of DNA methylation 1-like [Elaeis guineensis]
Length=631

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 78/179 (44%), Positives = 109/179 (61%), Gaps = 9/179 (5%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I++Y+ K Y+ L+SGK+KVK  +   RCPFC G+KKQDY++ +LLQHATGV  G++NR  
Sbjct  16   IDDYETKLYQLLKSGKFKVKNEDNTFRCPFCVGRKKQDYRHNELLQHATGV--GASNREA  73

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDN------NLYCWPWTGIVVNVSKDNAN  462
            K KANH ALAK L+ DL D A PL Q     +D+      + + WPW GI+VNV  +  N
Sbjct  74   KVKANHRALAKLLKDDLADAAGPLKQLISIEQDSTSKPKQDQFVWPWMGILVNVPTEWKN  133

Query  463  GTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
            G  V E    LK + S++   +V    + +  T   ++    DW G K+A+ FEN F+A
Sbjct  134  GKQVGESGNRLKEQLSRFNPLKVIPLWNYRGHTGNAIVDFSKDWGGLKDAMSFENYFDA  192



>ref|XP_006389833.1| hypothetical protein EUTSA_v10018261mg [Eutrema salsugineum]
 gb|ESQ27119.1| hypothetical protein EUTSA_v10018261mg [Eutrema salsugineum]
Length=634

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 106/172 (62%), Gaps = 6/172 (3%)
 Frame = +1

Query  136  EKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQKAN  315
            EKPY+ L++GKYKVK      RCPFC+GKKKQ YKYK+LL HATGV KGSA+RS KQKAN
Sbjct  22   EKPYKLLKNGKYKVKLREDTFRCPFCSGKKKQHYKYKELLAHATGVAKGSASRSAKQKAN  81

Query  316  HVALAKYLEIDL-GDQAEPLPQRAV---APE--DNNLYCWPWTGIVVNVSKDNANGTAVE  477
            H+AL KY+E +L GD   P  Q  +    PE  D+++Y WPW GIV+   +   +   + 
Sbjct  82   HLALRKYMENELAGDAQLPRLQLILYKKQPEAVDSDIYVWPWMGIVIRPLRTTDDKNLLL  141

Query  478  EEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  633
            +  YWLK+ S++   EV     ++     VV K  S  +G+ +A   +  +E
Sbjct  142  DSFYWLKKLSRFNPLEVNTLWLEQDSVVAVVSKFNSGMSGFNSATNLDKEYE  193



>gb|EMT06773.1| hypothetical protein F775_17939 [Aegilops tauschii]
Length=631

 Score =   121 bits (303),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 113/179 (63%), Gaps = 7/179 (4%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I+EYK+K Y +LRSGK +V+     LRCPFC GKKKQDY  KDLLQHA+G+G  S  + +
Sbjct  18   IDEYKDKMYAQLRSGKMRVRYGEKALRCPFCLGKKKQDYNGKDLLQHASGIGVASKRKPM  77

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVA----PEDNNL-YCWPWTGIVVNVSKDNANG  465
             ++A H+ALA+YL+ DLG   +P  Q A+     P++  + Y  PWTGI+VN+  D  + 
Sbjct  78   -ERAGHLALAEYLKNDLGISLKPPSQLAIIEHKPPKNEEVKYVCPWTGILVNLPNDLKDI  136

Query  466  TAVEE-EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
              V E ED    + S+++ +EV I  D + +T   +I+   D +G K+AI FEN F AE
Sbjct  137  DCVRENEDRLRSQLSRFKPREVTIVFDTEGQTDHSIIRFAEDLDGLKDAIAFENHFMAE  195



>gb|EEC75682.1| hypothetical protein OsI_12489 [Oryza sativa Indica Group]
Length=568

 Score =   120 bits (300),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 103/178 (58%), Gaps = 6/178 (3%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I  ++EK Y +LR+GK KVK  N   RCPFC GKKKQDY  KDLLQHA+GVG  S +++ 
Sbjct  16   IGVHEEKTYNQLRAGKVKVKHGNNTFRCPFCPGKKKQDYSSKDLLQHASGVGAASKHKA-  74

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVA----PEDNNLYCWPWTGIVVNVSKD-NANG  465
            K KA H+ALA+YL++DL    E  PQ A      P     Y WPW GI+VN+  +    G
Sbjct  75   KVKATHLALARYLKVDLAGSLESSPQLATVEHQPPGSEEKYVWPWMGILVNLPTELKGKG  134

Query  466  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
               E E+    +FS+++  +V I  +        ++K   +WNG K+A+ FE  F  E
Sbjct  135  FVGESEERLRAQFSRFKPLQVTILWNSTDNADYAIVKFAENWNGMKDALAFEKHFNVE  192



>ref|XP_009104485.1| PREDICTED: myosin-9-like [Brassica rapa]
 ref|XP_009104486.1| PREDICTED: myosin-9-like [Brassica rapa]
 ref|XP_009104487.1| PREDICTED: myosin-9-like [Brassica rapa]
Length=639

 Score =   120 bits (301),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 108/179 (60%), Gaps = 7/179 (4%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I +Y EKPY++LR G+ KVK      +CPFC+GKKKQ YKYK+LL HATGV KGSA R+ 
Sbjct  16   IADYSEKPYKQLRDGELKVKVKVDTFKCPFCSGKKKQHYKYKELLAHATGVAKGSAARNC  75

Query  301  KQKANHVALAKYLEIDL-GDQAEPLPQRAVAPED------NNLYCWPWTGIVVNVSKDNA  459
            KQKANH+AL+KYL+ +L GD   P  Q  V   +      N++Y WPW GIV++  + N 
Sbjct  76   KQKANHLALSKYLKNELAGDAEPPRLQLTVYSANQSQAVVNDMYVWPWMGIVISPLRGND  135

Query  460  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
            + + + +  YWLK+ +++   EVK    ++     VV +     +G+ +    E  +E 
Sbjct  136  DKSLLLDSAYWLKKLARFNPLEVKTIWVEEDSAVAVVPRFSGGMDGFTSVTELEKEYEV  194



>emb|CDX67967.1| BnaA07g20070D [Brassica napus]
Length=639

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 108/179 (60%), Gaps = 7/179 (4%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I +Y EKPY++LR G+ KVK      +CPFC+GKKKQ YKYK+LL HATGV KGSA R+ 
Sbjct  16   IADYSEKPYKQLRDGELKVKLKVDTFKCPFCSGKKKQHYKYKELLAHATGVSKGSAARNC  75

Query  301  KQKANHVALAKYLEIDL-GDQAEPLPQRAVAPED------NNLYCWPWTGIVVNVSKDNA  459
            KQKANH+AL+KYL+ +L GD   P  Q  V   +      N++Y WPW GIV++  + N 
Sbjct  76   KQKANHLALSKYLKNELAGDAEPPRLQLTVYSANQSQAVVNDMYVWPWMGIVISPLRGND  135

Query  460  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
            + + + +  YWLK+ +++   EVK    ++     VV +     +G+ +    E  +E 
Sbjct  136  DKSLLLDSAYWLKKLARFNPLEVKTIWVEEDSAVAVVPRFNGGMDGFTSVTELEKEYEV  194



>gb|EMT14402.1| hypothetical protein F775_20219 [Aegilops tauschii]
Length=845

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 107/176 (61%), Gaps = 7/176 (4%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  309
            YK+K Y +LRS K KV+      RCPFC GKKK+DY  KDLLQHA+G+G  +  R  + +
Sbjct  228  YKDKIYAQLRSQKLKVQYGEKIFRCPFCLGKKKRDYNVKDLLQHASGIG-AAQKRKPRVR  286

Query  310  ANHVALAKYLEIDLGDQAEPLPQRAVA----PE-DNNLYCWPWTGIVVNVSKDNANGTAV  474
            A H+ALA+Y++ DLG   EP  Q A+     P+ + + + WPW GI+VN+  D  +   V
Sbjct  287  AAHLALAEYVKNDLGSSLEPSLQLAIVEYKPPKIEQDKFVWPWMGILVNIPADLMDTNFV  346

Query  475  EEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
             E ++ LK + S++   EV I  D K +T   ++K   DW G+K+A+ FEN F  E
Sbjct  347  RESEHMLKSQLSRFRPCEVTILLDSKGQTDHSIVKFAEDWTGFKDALAFENHFIVE  402



>emb|CDX79353.1| BnaC06g19500D [Brassica napus]
Length=639

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 107/179 (60%), Gaps = 7/179 (4%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I +Y EKPY++LR G+ KVK      +CPFC+GKKKQ YKYK+LL HATGV KGSA R+ 
Sbjct  16   IADYSEKPYKQLRDGELKVKLKLDTFKCPFCSGKKKQHYKYKELLAHATGVAKGSAARNC  75

Query  301  KQKANHVALAKYLEIDLGDQAEP--LPQRAVAPEDN-----NLYCWPWTGIVVNVSKDNA  459
            KQKANH+AL+KYL+ +L   AEP  L     + + N     ++Y WPW GIV++  + N 
Sbjct  76   KQKANHLALSKYLKNELAGDAEPPRLQLTVYSSKQNQAVVSDMYVWPWMGIVISPLRGND  135

Query  460  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
            + T + +  YWLK+ +++   EVK    +      VV +     +G+ +    E  +E 
Sbjct  136  DKTLLLDSAYWLKKLARFNPLEVKTIWVEVDSAVAVVPRFSGGMDGFTSVTELEKEYEV  194



>ref|XP_006391023.1| hypothetical protein EUTSA_v10019728mg [Eutrema salsugineum]
 gb|ESQ28309.1| hypothetical protein EUTSA_v10019728mg [Eutrema salsugineum]
Length=621

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 105/172 (61%), Gaps = 6/172 (3%)
 Frame = +1

Query  136  EKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQKAN  315
            E PY+ L+ G YKVK      RCPFC+GKKKQ YKYKDLL HATG+  GSA+RS KQKAN
Sbjct  22   EYPYKLLKKGDYKVKLKEDTFRCPFCSGKKKQHYKYKDLLAHATGLAIGSASRSAKQKAN  81

Query  316  HVALAKYLEIDL-GDQAEPLPQRAVAP-----EDNNLYCWPWTGIVVNVSKDNANGTAVE  477
            H+AL KY+E +L G  A  +P+  +       + +++Y WPW GIV+N  + N +   + 
Sbjct  82   HLALRKYMENELAGGDAHQVPRLQIITSSSSKQSSDIYVWPWMGIVINPLRRNDDKNLLL  141

Query  478  EEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  633
            +  YWLK+ +++   EVK    ++     V+ K  S  +G+K+A   E  +E
Sbjct  142  DSAYWLKKLARFNPLEVKTLWVEQDSVVAVISKFNSGMSGFKSATELEREYE  193



>gb|AAO60001.1| putative XS domain containing protein [Oryza sativa Japonica 
Group]
 gb|ABF97445.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=475

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 100/178 (56%), Gaps = 6/178 (3%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I  ++EK Y +LR+ K KVK  N   RCPFC GKKKQDY  KDLLQHA+GVG  S  R  
Sbjct  16   IGVHEEKTYNQLRAEKVKVKHGNNTFRCPFCPGKKKQDYSSKDLLQHASGVGAAS-KRKA  74

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVA----PEDNNLYCWPWTGIVVNVSKD-NANG  465
            K KA H+ALA+YL++DL    E  PQ A      P     Y WPW GI+VN+  +    G
Sbjct  75   KVKATHLALARYLKVDLAGSLESSPQLATVEHQPPGSEEKYVWPWMGILVNLPTELKGKG  134

Query  466  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
               E E+    +FS+++  +V I  +        ++K   +WNG K+A+ FE  F  E
Sbjct  135  FVGESEERLRAQFSRFKPLQVTILWNSTDNADYAIVKFAENWNGMKDALAFEKHFNVE  192



>ref|XP_006300858.1| hypothetical protein CARUB_v10019950mg [Capsella rubella]
 ref|XP_006300859.1| hypothetical protein CARUB_v10019950mg [Capsella rubella]
 gb|EOA33756.1| hypothetical protein CARUB_v10019950mg [Capsella rubella]
 gb|EOA33757.1| hypothetical protein CARUB_v10019950mg [Capsella rubella]
Length=568

 Score =   117 bits (293),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 107/178 (60%), Gaps = 14/178 (8%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  309
            Y +KPYE +++G YKVK  +   RCPFC+GKKKQ YKYK+LL HA+GV KGSA+RS KQK
Sbjct  19   YSDKPYELIKNGHYKVKVKD-TFRCPFCSGKKKQHYKYKELLAHASGVAKGSASRSAKQK  77

Query  310  ANHVALAKYLEIDLGDQAE-PLPQ---------RAVAPEDNNLYCWPWTGIVVNVSKDNA  459
            ANH ALAKY++ +L   A+ P PQ         +AV    +++Y WPW GIV+N  +   
Sbjct  78   ANHFALAKYMQNELAADADVPRPQIPSSSSKQGQAVV---DDIYVWPWMGIVINPVRRTD  134

Query  460  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  633
            N   + +  YWLK+ +++   EVK    ++     V        +G+K+A   E  +E
Sbjct  135  NNKLLLDSAYWLKKLARFNPLEVKTLWLEQESVVAVFPLFSRGMSGFKSATELEKEYE  192



>ref|XP_008799862.1| PREDICTED: MAR-binding filament-like protein 1 [Phoenix dactylifera]
Length=632

 Score =   117 bits (294),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 111/181 (61%), Gaps = 12/181 (7%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I++Y+ K YE L+SGK+KVK  +   RCPFC G+KKQDY++ +LLQHATG+  G++NR  
Sbjct  16   IDDYETKLYELLKSGKFKVKNEDNTFRCPFCVGRKKQDYRHNELLQHATGL--GASNREA  73

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVA--------PEDNNLYCWPWTGIVVNVSKDN  456
              KANH ALAK L+ DL D+A P P++ ++        P+ ++ + WPW GI+VNV  + 
Sbjct  74   IVKANHRALAKLLKDDLADEAGP-PKQLISIEQNSTSKPKQDDQFVWPWMGILVNVPTEW  132

Query  457  ANGTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  633
             +G  V E    LK + S +   +V    + +  T   ++    DW G K+A+ FEN F+
Sbjct  133  KDGRQVGESGNRLKEQLSGFNPLKVIPLWNYRGHTGNAIVDFSKDWGGLKDAMSFENHFD  192

Query  634  A  636
            A
Sbjct  193  A  193



>ref|XP_006300857.1| hypothetical protein CARUB_v10019950mg [Capsella rubella]
 gb|EOA33755.1| hypothetical protein CARUB_v10019950mg [Capsella rubella]
Length=635

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 107/178 (60%), Gaps = 14/178 (8%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  309
            Y +KPYE +++G YKVK  +   RCPFC+GKKKQ YKYK+LL HA+GV KGSA+RS KQK
Sbjct  19   YSDKPYELIKNGHYKVKVKD-TFRCPFCSGKKKQHYKYKELLAHASGVAKGSASRSAKQK  77

Query  310  ANHVALAKYLEIDLGDQAE-PLPQ---------RAVAPEDNNLYCWPWTGIVVNVSKDNA  459
            ANH ALAKY++ +L   A+ P PQ         +AV    +++Y WPW GIV+N  +   
Sbjct  78   ANHFALAKYMQNELAADADVPRPQIPSSSSKQGQAVV---DDIYVWPWMGIVINPVRRTD  134

Query  460  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  633
            N   + +  YWLK+ +++   EVK    ++     V        +G+K+A   E  +E
Sbjct  135  NNKLLLDSAYWLKKLARFNPLEVKTLWLEQESVVAVFPLFSRGMSGFKSATELEKEYE  192



>ref|XP_010429902.1| PREDICTED: factor of DNA methylation 5-like [Camelina sativa]
 ref|XP_010429903.1| PREDICTED: factor of DNA methylation 5-like [Camelina sativa]
Length=636

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 109/178 (61%), Gaps = 14/178 (8%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  309
            Y EKPYE +++G YKVK  +   RCPFC+GKKKQ YKYK+LL HA+GV KGS++RS KQK
Sbjct  20   YAEKPYELMKNGTYKVKVKD-TFRCPFCSGKKKQHYKYKELLAHASGVAKGSSSRSAKQK  78

Query  310  ANHVALAKYLEIDL-GDQAEPLPQ---------RAVAPEDNNLYCWPWTGIVVNVSKDNA  459
            ANH ALAKY++ +L GD   P PQ         +AV    +++Y WPW GIV+   +   
Sbjct  79   ANHFALAKYMQNELAGDSDLPRPQIPSSSSKQSQAVV---DDVYVWPWMGIVIYPVRRTD  135

Query  460  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  633
            N   + +  YW K+ ++++  EVK    ++     V+ +  S  +G+K+A   E  +E
Sbjct  136  NNYYLLDSAYWSKKLAEFDPLEVKTIWLEQDSVVAVIPQFNSGMSGFKSATELEKEYE  193



>ref|XP_008784591.1| PREDICTED: uncharacterized protein LOC103703501 [Phoenix dactylifera]
 ref|XP_008784593.1| PREDICTED: uncharacterized protein LOC103703501 [Phoenix dactylifera]
Length=625

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 112/182 (62%), Gaps = 19/182 (10%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            ++EY+E  Y  L++G ++VK P+G  RCPFCAGKKKQ+Y YKDLLQHATGVG  S +R  
Sbjct  16   LDEYEEDYYIVLKTGNHRVKNPDGTFRCPFCAGKKKQEYLYKDLLQHATGVG-ASNSRRA  74

Query  301  KQKANHVALAKYLEIDLGD-----QAEPLPQRAVAPE--DNNLYCWPWTGIVVNVSKDNA  459
            K+KA H A A++L+ DL D     Q  P+ Q   AP+  D+ L+ WPW G+++NV     
Sbjct  75   KEKATHRAFARFLKTDLADAAGSSQLSPVEQEQHAPKPCDDELFVWPWMGLLINV-----  129

Query  460  NGTAVEEEDYWL-KRFSKYEAQEVKIFCDD--KSRTSQVVIKLKSDWNGYKNAILFENAF  630
                VEE  + L ++ S +   +V    +   +S     V++   DW+G+K+A+ FEN F
Sbjct  130  ---PVEEGGFKLGEKISDFNPVDVIPLGEGICQSERGAAVVRFNKDWSGFKDAMAFENHF  186

Query  631  EA  636
            +A
Sbjct  187  KA  188



>gb|EMS45500.1| hypothetical protein TRIUR3_12203 [Triticum urartu]
Length=638

 Score =   115 bits (289),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 105/175 (60%), Gaps = 9/175 (5%)
 Frame = +1

Query  130  YKEKPYEELR--SGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVK  303
            YK+K Y +LR  S K KV+      RCPFC GK+KQDY  KDLLQHA+G+G  +  R  +
Sbjct  19   YKDKIYAQLRLRSQKLKVQYGEKIFRCPFCLGKRKQDYNVKDLLQHASGIG-AAQKRKPR  77

Query  304  QKANHVALAKYLEIDLGDQAEPLPQRAVA----PE-DNNLYCWPWTGIVVNVSKDNANGT  468
             +A H+ALA+Y++ DLG   EP  Q A+     P+ +   + WPW GI+VN+  D  +  
Sbjct  78   VRAAHLALAEYVKNDLGSSLEPSLQLAIVEYKPPKIEQEKFVWPWMGILVNLPADLMDTN  137

Query  469  AVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAF  630
             V E ++ LK + S++   EV I  D K +T   +IK   DW G+K+A+ FEN F
Sbjct  138  FVRESEHMLKSQLSRFRPCEVTILLDSKGQTDHSIIKFAEDWTGFKDALAFENHF  192



>ref|XP_008802711.1| PREDICTED: paramyosin, long form-like [Phoenix dactylifera]
 ref|XP_008802712.1| PREDICTED: paramyosin, long form-like [Phoenix dactylifera]
Length=631

 Score =   115 bits (287),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 108/179 (60%), Gaps = 9/179 (5%)
 Frame = +1

Query  124  NEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVK  303
            ++Y+EK Y  L+ GK KVK  +   +CPFCAGKKKQDY YKDLLQHA GV  G++NR+ K
Sbjct  17   DDYEEKFYLYLKDGKLKVKNTDSTYKCPFCAGKKKQDYNYKDLLQHANGV--GASNRTAK  74

Query  304  QKANHVALAKYLEIDLGDQAEPLPQRAVA------PEDNNLYCWPWTGIVVNVSKDNANG  465
             KA+H ALA+YL+ D  + +    Q  +       P+D + + WPW GI+VNV  +  NG
Sbjct  75   VKADHRALARYLKNDFAEASSSSMQLMIVQHHPFKPKDEDQFVWPWMGILVNVPTEYKNG  134

Query  466  TAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
              V E    LK   S++   +V    + +  T   ++    DW G+K+A+ FEN+F+A+
Sbjct  135  RYVGESGNKLKEHLSRFNPLKVHPLWNFRGHTGNAIVDFNKDWTGFKDAMAFENSFDAQ  193



>ref|XP_010472874.1| PREDICTED: factor of DNA methylation 5-like [Camelina sativa]
Length=636

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 108/178 (61%), Gaps = 14/178 (8%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  309
            Y EKPYE +++G YKVK  +   RCPFC+GKKKQ YKYK+LL HA+GV KGS++RS KQK
Sbjct  20   YAEKPYELMKNGNYKVKVKD-TFRCPFCSGKKKQHYKYKELLAHASGVAKGSSSRSAKQK  78

Query  310  ANHVALAKYLEIDL-GDQAEPLPQ---------RAVAPEDNNLYCWPWTGIVVNVSKDNA  459
            ANH ALAKY++ +L GD   P PQ         +AV    +++Y WPW GIV+   +   
Sbjct  79   ANHFALAKYMQNELAGDSDVPRPQIPSSSSKQSQAVV---DDVYVWPWMGIVIYPVRRTD  135

Query  460  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  633
            N   + +  YW K+ + ++  EVK    ++     V+ +  S  +G+K+A   E  +E
Sbjct  136  NNYYLLDSAYWSKKLACFDPFEVKTLWLEQDSVVAVIPQFNSGMSGFKSATELEKEYE  193



>ref|XP_010910789.1| PREDICTED: factor of DNA methylation 1-like [Elaeis guineensis]
Length=625

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 110/182 (60%), Gaps = 19/182 (10%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            ++EY+E  Y  L++GK +V+ P+G  RCPFCAGKKKQ+Y YKDLLQHATGVG  S +R  
Sbjct  16   LDEYEEDYYRVLKTGKQRVRNPDGTFRCPFCAGKKKQEYLYKDLLQHATGVG-ASNSRRA  74

Query  301  KQKANHVALAKYLEIDLGD-----QAEPLPQRAVAPE--DNNLYCWPWTGIVVNVSKDNA  459
            K+KA H A A++L+ DL D     Q  P+ Q   AP+  D+ L+ WPW G+++NV     
Sbjct  75   KEKATHRAFARFLKTDLADAAGCSQFAPVEQEQQAPKPSDDELFVWPWMGVLINV-----  129

Query  460  NGTAVEEEDYWL-KRFSKYEAQEVKIFCDD--KSRTSQVVIKLKSDWNGYKNAILFENAF  630
                 EE  + L ++ S +   +V    +   +S     V++   DW G+K+A+ FEN F
Sbjct  130  ---PAEEGGFKLGEKISDFNPIDVIPLGEGICQSERGAAVVRFNKDWGGFKDAMDFENHF  186

Query  631  EA  636
            +A
Sbjct  187  KA  188



>ref|XP_009416142.1| PREDICTED: uncharacterized protein LOC103996844 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416143.1| PREDICTED: uncharacterized protein LOC103996844 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416144.1| PREDICTED: uncharacterized protein LOC103996844 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416145.1| PREDICTED: uncharacterized protein LOC103996844 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416146.1| PREDICTED: uncharacterized protein LOC103996844 [Musa acuminata 
subsp. malaccensis]
Length=630

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 108/183 (59%), Gaps = 15/183 (8%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            + EY+EK Y  L++G++ V+  +   RCPFC+GKKKQDY YKDLLQHATG+  G++NR  
Sbjct  15   VPEYEEKIYLRLKAGQFIVRNTDKTCRCPFCSGKKKQDYNYKDLLQHATGI--GASNRKG  72

Query  301  KQKANHVALAKYLEIDLGDQA---------EPLPQRAVAPEDNNLYCWPWTGIVVNVSKD  453
            K KA H ALAKYL  D+ D           +P P ++ + +    + WPW G+VVNV  +
Sbjct  73   KVKATHRALAKYLNNDITDTTCSSEQLVVFQPKPSKSTSEDQ---FVWPWMGVVVNVPTE  129

Query  454  NANGTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAF  630
              NG  V E    LK + S++   +V    + +  T   ++    DW G+K+A+ FEN F
Sbjct  130  FKNGQYVGESGNRLKEQLSRFHPLKVHPLWNHRGHTGIAIMDFTKDWTGFKDAMAFENNF  189

Query  631  EAE  639
            EAE
Sbjct  190  EAE  192



>ref|XP_004968083.1| PREDICTED: synaptonemal complex protein 1-like [Setaria italica]
Length=631

 Score =   112 bits (281),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 103/180 (57%), Gaps = 9/180 (5%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I+E + + YE+L+SG  KVK       CPFC  K+K+DY   +LLQHATGVG  +ANR  
Sbjct  16   IDEREAEVYEQLKSGNIKVKDRE-AYSCPFCRDKRKKDYSKSNLLQHATGVG-SAANRQA  73

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNL------YCWPWTGIVVNVSKDNAN  462
            K KA H ALAKYL+ +    +EP  Q  V  E  NL      + WPW G++VNV  +  N
Sbjct  74   KDKATHRALAKYLKDESARSSEPQTQLTVLIEPQNLGNRDDQFVWPWMGVLVNVPTEWKN  133

Query  463  GTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
            G  V E    LK + S +  Q+V    + +  T   +++   DW G+KNA+ FEN FEAE
Sbjct  134  GRQVGESGNRLKEQLSHFCPQKVIPLWNYRGHTGNAIVEFAKDWTGFKNALAFENHFEAE  193



>ref|XP_010417660.1| PREDICTED: factor of DNA methylation 5-like [Camelina sativa]
Length=636

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 106/178 (60%), Gaps = 14/178 (8%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  309
            Y EKPYE +++G YKVK  +   RCPFC+GKKKQ YKYK+LL HA+GV KGS++RS KQK
Sbjct  20   YAEKPYELMKNGNYKVKVKD-TFRCPFCSGKKKQHYKYKELLAHASGVAKGSSSRSAKQK  78

Query  310  ANHVALAKYLEIDL-GDQAEPLPQ---------RAVAPEDNNLYCWPWTGIVVNVSKDNA  459
            ANH ALAKY++ +L GD   P PQ         +AV    +++Y WPW GIV+   +   
Sbjct  79   ANHFALAKYMQNELAGDSDLPRPQIPSSSSKQSQAVV---DDVYVWPWMGIVIYPVRRTD  135

Query  460  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  633
                + +  YW K+ + ++  EVK    ++     V+ +  S  +G+K A   E  +E
Sbjct  136  KNYYLLDSAYWSKKLACFDPFEVKTLWLEQDSVVAVIPQFNSGMSGFKTATELEKEYE  193



>ref|XP_006659121.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503-like 
[Oryza brachyantha]
Length=626

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 106/182 (58%), Gaps = 15/182 (8%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I++Y +K Y +L+SGK  V+  N   RCPFC GKKKQDY+Y +LLQHA GV  G++NR+ 
Sbjct  15   IDDYVDKSYMDLKSGKNVVRLGNEKFRCPFCLGKKKQDYRYNELLQHAVGV--GASNRAP  72

Query  301  KQKANHVALAKYLEIDLGDQAEPLP-QRAVAPE-------DNNLYCWPWTGIVVNVSKDN  456
            K +ANH+ALA  L+ D  D A  LP Q+ VAP        D  +Y WPW GI+ NV  + 
Sbjct  73   KVRANHMALANLLKNDYTDAAGSLPSQQVVAPSNPPRPLPDQEVYVWPWMGILANVPAEQ  132

Query  457  ANGTAVEEEDYWLKRFSKYEAQE-VKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  633
              G         +++ + +       ++C +   T   V++   DW G+KNA+ F+N F+
Sbjct  133  TEGDGAS----LMQQLADFNPLHFTSVYCSEGRYTGYAVVRFSKDWIGFKNALAFQNYFK  188

Query  634  AE  639
            ++
Sbjct  189  SQ  190



>ref|XP_010256908.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like [Nelumbo nucifera]
 ref|XP_010256909.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like [Nelumbo nucifera]
 ref|XP_010256910.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like [Nelumbo nucifera]
Length=642

 Score =   109 bits (273),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 110/181 (61%), Gaps = 8/181 (4%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I E+++K Y++L++G Y+VK      RCPFC GK+K+DY Y ++LQHA G+G GS NRSV
Sbjct  16   IEEHEDKSYKKLKNGNYQVKTSGESFRCPFCPGKRKRDYLYMEILQHAAGLGTGSHNRSV  75

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVA--PEDNNL---YCWPWTGIVVNVSKDNANG  465
            KQKANH+AL KYL+ ++     P  + A    P  +N    + WPWTGIVVN+  +  +G
Sbjct  76   KQKANHLALXKYLKTEIAPVGGPSERAAETKPPTGHNHDEKFVWPWTGIVVNLPIEWKDG  135

Query  466  TAVEEEDYWLK-RFSK--YEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
              V E    L+ + ++  +    V+   + +  +   +++   +W G+ +A+ FE AF+A
Sbjct  136  RYVGESGSRLRDQLARRGFSPVRVQSLWNHRGHSGTALVEFNKNWPGFNDAMSFEKAFQA  195

Query  637  E  639
            +
Sbjct  196  D  196



>tpg|DAA50216.1| TPA: putative XH domain family protein [Zea mays]
Length=687

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 103/175 (59%), Gaps = 7/175 (4%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I E+KE+   +LR+GK  VK      RCPFC GKK+QDY  KDLLQHATG+G  S  RS 
Sbjct  100  IAEHKEEICAQLRAGKLNVKRGEA-FRCPFCPGKKRQDYNLKDLLQHATGIGAAS-KRSA  157

Query  301  KQKANHVALAKYLEIDLGDQAE-PL---PQRAVAPEDNNLYCWPWTGIVVNVSKD-NANG  465
            K KA+H+ LA +LE D+    E PL   P +   P+D  ++ WPW GIVVN+  +     
Sbjct  158  KVKASHLGLAMFLEKDIASTLEQPLQIVPYKPKTPKDEEIFVWPWMGIVVNLQCEFKGKE  217

Query  466  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAF  630
             + E E+    +FS++   +     D K++    ++K   DW+G+K+A+ FEN F
Sbjct  218  CSRESEERLTAQFSRFRPLQATTLRDGKNQQFCAIVKFAKDWSGFKDAMAFENHF  272



>ref|XP_002443867.1| hypothetical protein SORBIDRAFT_07g003550 [Sorghum bicolor]
 gb|EES13362.1| hypothetical protein SORBIDRAFT_07g003550 [Sorghum bicolor]
Length=626

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 106/181 (59%), Gaps = 14/181 (8%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I++Y EK Y +L++GK+  +  +   RCPFC GKKKQDY+Y +LLQHA GV  G++NR+ 
Sbjct  16   IDDYAEKSYADLKAGKFVARLGSDRFRCPFCPGKKKQDYRYNELLQHAVGV--GASNRAA  73

Query  301  KQKANHVALAKYLEIDLGDQAEP-LPQRAVA-------PEDNNLYCWPWTGIVVNVSKDN  456
            K KANH ALAK L++D  D A   LP++A+A        +D  ++ WPW GI+ NV  + 
Sbjct  74   KVKANHQALAKLLKVDHADAAATLLPRQAIALSNPPKPVQDLEVFVWPWMGILANVPAEQ  133

Query  457  ANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
              G         +KR + ++  +V            V++    DW G+KNA+ F+N F++
Sbjct  134  TQGGGA----ILMKRLADFKPVQVTAVYGANGYAGYVIVLFTKDWIGFKNALAFQNYFKS  189

Query  637  E  639
            +
Sbjct  190  Q  190



>ref|NP_001168342.1| putative XH domain family protein [Zea mays]
 gb|ACN27880.1| unknown [Zea mays]
 gb|AFW57328.1| putative XH domain family protein [Zea mays]
Length=626

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 106/180 (59%), Gaps = 14/180 (8%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I++Y +K Y +L+SGK+  +  +   RCPFC GKKKQDY+Y +LLQHA GV  G++NR+ 
Sbjct  16   IDDYADKSYSDLKSGKFVARLGSDRFRCPFCPGKKKQDYRYSELLQHAVGV--GASNRAA  73

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQ-RAVA-------PEDNNLYCWPWTGIVVNVSKDN  456
            K KANH ALAK L+ D  D A  LP  +A+A        +D   + WPWTG++ NV    
Sbjct  74   KVKANHQALAKLLKEDHADAAATLPAWQAIALSNAPKPAQDQEAFVWPWTGVLANVPA--  131

Query  457  ANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
              G A E     +++ ++++  ++   C        VV+    DW G+KNA+ F+N F++
Sbjct  132  --GQAQEGGATLMEQLAEFKPVQITAVCGADGYAGYVVVLFTKDWIGFKNALAFQNCFKS  189



>ref|XP_003559697.1| PREDICTED: factor of DNA methylation 4-like [Brachypodium distachyon]
Length=637

 Score =   106 bits (265),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 102/176 (58%), Gaps = 9/176 (5%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I+E K+K Y +L++GK KVK      RCPFC GKKKQDY  KDLLQHATG+G  +  R  
Sbjct  16   IDECKDKIYAQLQAGKMKVKHSEKTFRCPFCLGKKKQDYNGKDLLQHATGIG-AAPQRKA  74

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVA-----PEDNNLYCWPWTGIVVNVSKDNANG  465
            + +A H+ALA+Y++ DL    EP  Q A+        +   + WPW GI+VNV  +  + 
Sbjct  75   RVRAEHLALAEYMKNDLESLLEPSLQLAIVDYEPLKNEEEKFVWPWMGILVNVPTEGHDV  134

Query  466  TAVEEE-DYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAF  630
              V E  D    + S++   +V I  + K +T+  VIK   DW G+ +A+ FEN F
Sbjct  135  NFVSENADMLRSQLSRFRPCQVTILWNSKGQTA--VIKFNEDWIGFNDALAFENHF  188



>ref|XP_010922973.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like [Elaeis guineensis]
Length=491

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 107/179 (60%), Gaps = 9/179 (5%)
 Frame = +1

Query  124  NEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVK  303
            ++Y+EK Y  L+ GK KVK  +   +CPFCAGKKKQDY YKDLLQHA GV  G++NR  K
Sbjct  17   DDYEEKFYLHLKDGKLKVKNTDSIYKCPFCAGKKKQDYNYKDLLQHANGV--GTSNRKAK  74

Query  304  QKANHVALAKYLEIDLGDQAEPLPQRAVA------PEDNNLYCWPWTGIVVNVSKDNANG  465
             KA H ALA+YL+ DL + +    Q  +       P+D + + WPW GI+VNV  +  NG
Sbjct  75   VKAKHXALARYLKNDLAEASSSSMQLMIVQHHPFKPKDEDQFVWPWMGILVNVPTEYKNG  134

Query  466  TAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
              V E    LK + S++   +V    + +  T   ++    DW G+K+A+ FEN ++A+
Sbjct  135  RYVGESGNRLKEQLSRFNPLKVHALWNYRGHTGNAIVDFNKDWTGFKDAMAFENYYDAQ  193



>ref|XP_010067411.1| PREDICTED: coiled-coil domain-containing protein 39 [Eucalyptus 
grandis]
 gb|KCW65540.1| hypothetical protein EUGRSUZ_G02937 [Eucalyptus grandis]
Length=645

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 106/181 (59%), Gaps = 10/181 (6%)
 Frame = +1

Query  127  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVK  303
            +YKEK YEEL+SG ++VK  +    CP+C  K+K+DY+Y +LLQHA+GVGK S+  RS K
Sbjct  22   DYKEKSYEELKSGNHQVKVSDEAFACPYCPKKRKRDYQYNELLQHASGVGKSSSEKRSAK  81

Query  304  QKANHVALAKYLEIDLGDQAEP--LPQRAVAP---EDNNLYCWPWTGIVVNV-SKDNANG  465
            +KANH+ALAKYLE DL D A P  L     AP     ++ + WPW G+V+N+ +K   +G
Sbjct  82   EKANHLALAKYLEKDLSDVAGPSKLVDEGKAPIGCSHDDKFVWPWKGVVMNIPTKRAEDG  141

Query  466  TAVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
              V E    L+       +    V    + +  +   V++    W G  NA+ FE A+EA
Sbjct  142  RYVGESGSKLRDELTRRGFNPMRVHPLWNYRGHSGSAVVEFNKGWPGLHNAMSFEKAYEA  201

Query  637  E  639
            +
Sbjct  202  D  202



>gb|KCW65539.1| hypothetical protein EUGRSUZ_G02937 [Eucalyptus grandis]
Length=646

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 106/181 (59%), Gaps = 10/181 (6%)
 Frame = +1

Query  127  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVK  303
            +YKEK YEEL+SG ++VK  +    CP+C  K+K+DY+Y +LLQHA+GVGK S+  RS K
Sbjct  22   DYKEKSYEELKSGNHQVKVSDEAFACPYCPKKRKRDYQYNELLQHASGVGKSSSEKRSAK  81

Query  304  QKANHVALAKYLEIDLGDQAEP--LPQRAVAP---EDNNLYCWPWTGIVVNV-SKDNANG  465
            +KANH+ALAKYLE DL D A P  L     AP     ++ + WPW G+V+N+ +K   +G
Sbjct  82   EKANHLALAKYLEKDLSDVAGPSKLVDEGKAPIGCSHDDKFVWPWKGVVMNIPTKRAEDG  141

Query  466  TAVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
              V E    L+       +    V    + +  +   V++    W G  NA+ FE A+EA
Sbjct  142  RYVGESGSKLRDELTRRGFNPMRVHPLWNYRGHSGSAVVEFNKGWPGLHNAMSFEKAYEA  201

Query  637  E  639
            +
Sbjct  202  D  202



>gb|EAY85442.1| hypothetical protein OsI_06823 [Oryza sativa Indica Group]
Length=537

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 104/183 (57%), Gaps = 17/183 (9%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I++Y +K Y +L+SGK  V   N   RCPFC GKKKQDY+Y +LLQHA GV  G++NR+ 
Sbjct  15   IDDYADKCYMDLKSGKPVVSLGNEKFRCPFCLGKKKQDYRYNELLQHAIGV--GASNRAP  72

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQR-AVAP-------EDNNLYCWPWTGIVVNV--SK  450
            K KANH+ALA  L+ D  D A  LP R AV P       +D   Y WPW GI+ NV   K
Sbjct  73   KVKANHMALANLLKNDYADAAGSLPSRQAVGPSNPPRPLQDQEAYVWPWMGILANVPAEK  132

Query  451  DNANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAF  630
               +G ++ ++   L  F+    Q   + C +   T   V+    DW G+ NA+ F N F
Sbjct  133  TKEDGASLMQQ---LANFNPL--QFTAVLCSEGRYTGYAVVGFSKDWIGFTNALAFHNYF  187

Query  631  EAE  639
            +++
Sbjct  188  KSQ  190



>ref|XP_011091511.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Sesamum indicum]
Length=641

 Score =   103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 111/179 (62%), Gaps = 9/179 (5%)
 Frame = +1

Query  127  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVK  303
            +Y+EK YEEL+SGK++VK  +    CP+C  K+K+D++YK+LLQHA+ +G  S++ R+ +
Sbjct  22   DYQEKAYEELKSGKHQVKISDQAYTCPYCPKKRKRDFQYKELLQHASAIGSCSSHKRTAR  81

Query  304  QKANHVALAKYLE----IDLGDQAEPLPQRAVAPEDNN-LYCWPWTGIVVNVSKDNANGT  468
             KANH+ALAKYLE    +D G         A+A +D + L+ WPW GIVVN+  D  +G 
Sbjct  82   DKANHLALAKYLENDTAVDAGPSKPSAEVDALADQDRDELFVWPWIGIVVNIPTDFKDGR  141

Query  469  AVEEEDYWLK-RFSK--YEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
             V E    L+ + ++  +    V+   + +  +   +++ + DW+G+ NA+ FE  +EA
Sbjct  142  YVGESGSKLRDQLTRRGFNPTRVRPLWNYQGHSGTAIVEFQKDWSGFTNAMSFEKFYEA  200



>gb|EEE56772.1| hypothetical protein OsJ_06333 [Oryza sativa Japonica Group]
Length=720

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 104/183 (57%), Gaps = 17/183 (9%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I++Y +K Y +L+SGK  V   N   RCPFC GKKKQDY+Y +LLQHA GV  G++NR+ 
Sbjct  107  IDDYADKCYMDLKSGKPVVSLGNEKFRCPFCLGKKKQDYRYNELLQHAIGV--GASNRAP  164

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQR-AVAP-------EDNNLYCWPWTGIVVNV--SK  450
            K KANH+ALA  L+ D  D A  LP R A+ P       +D   Y WPW GI+ NV   K
Sbjct  165  KVKANHMALANLLKNDYADAAGSLPSRQAIGPSNPPRPLQDQEAYVWPWMGILANVPAEK  224

Query  451  DNANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAF  630
               +G ++ ++   L  F+    Q   + C +   T   V+    DW G+ NA+ F N F
Sbjct  225  TKEDGASLMQQ---LANFNPL--QFTAVLCSEGRYTGYAVVGFSKDWIGFTNALAFHNYF  279

Query  631  EAE  639
            +++
Sbjct  280  KSQ  282



>dbj|BAD21477.1| putative X1 [Oryza sativa Japonica Group]
 dbj|BAH01332.1| unnamed protein product [Oryza sativa Japonica Group]
Length=628

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 104/183 (57%), Gaps = 17/183 (9%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I++Y +K Y +L+SGK  V   N   RCPFC GKKKQDY+Y +LLQHA GV  G++NR+ 
Sbjct  15   IDDYADKCYMDLKSGKPVVSLGNEKFRCPFCLGKKKQDYRYNELLQHAIGV--GASNRAP  72

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQR-AVAP-------EDNNLYCWPWTGIVVNV--SK  450
            K KANH+ALA  L+ D  D A  LP R A+ P       +D   Y WPW GI+ NV   K
Sbjct  73   KVKANHMALANLLKNDYADAAGSLPSRQAIGPSNPPRPLQDQEAYVWPWMGILANVPAEK  132

Query  451  DNANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAF  630
               +G ++ ++   L  F+    Q   + C +   T   V+    DW G+ NA+ F N F
Sbjct  133  TKEDGASLMQQ---LANFNPL--QFTAVLCSEGRYTGYAVVGFSKDWIGFTNALAFHNYF  187

Query  631  EAE  639
            +++
Sbjct  188  KSQ  190



>ref|XP_010940184.1| PREDICTED: factor of DNA methylation 1-like [Elaeis guineensis]
Length=984

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 104/183 (57%), Gaps = 13/183 (7%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I++Y+EK +  L++ K KVK      RCPFC GKKKQDY+Y++LLQHATGV  G++NR  
Sbjct  359  IDDYREKSFWRLKTQKLKVKYSENNYRCPFCVGKKKQDYQYEELLQHATGV--GASNRGG  416

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQ----------RAVAPEDNNLYCWPWTGIVVNVSK  450
            K+KANH ALAK+L   +      +P+          +   P+   L+ WPW G++VN+  
Sbjct  417  KEKANHQALAKFLHELVNGAGSSVPKLNTRQQQQLQQPPQPDQPELFVWPWMGVLVNIQT  476

Query  451  DNANGTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENA  627
            +  NG    E    LK RFS +   +V +    K  +   ++    DWNG+K+A+  E  
Sbjct  477  EWRNGMHAGESGARLKERFSGFNVVKVHVLWGQKGHSGCAILGFNKDWNGFKDAMSLEAH  536

Query  628  FEA  636
            F+A
Sbjct  537  FKA  539



>ref|XP_003569414.1| PREDICTED: factor of DNA methylation 1-like [Brachypodium distachyon]
Length=628

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 99/174 (57%), Gaps = 8/174 (5%)
 Frame = +1

Query  133  KEKPYEELRSGKYKVKGPNGC-LRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  309
            ++K Y  L SG  K+   NG    CPFC GKKK+DY   +LLQHA+GVG  + NR  K+K
Sbjct  20   EDKIYARLISGDLKIN--NGASYSCPFCTGKKKKDYNIHNLLQHASGVG-AAPNRPAKEK  76

Query  310  ANHVALAKYLEIDLGDQAEPLPQRAV---APEDNNLYCWPWTGIVVNVSKDNANGTAVEE  480
            A H ALAK+L+  L    EP PQ  V    P  N  + WPW G++ NV  +  +G  V E
Sbjct  77   ATHRALAKHLKNGLAKPPEPQPQLIVDQPLPNRNEKFVWPWMGVLANVPTEWKDGRQVGE  136

Query  481  EDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
                LK + S++   +V    + +  T   +++   DWNG++NA+ FEN FEAE
Sbjct  137  SGNRLKEQLSRFCPLKVIPLWNFRGHTGNAIVEFAKDWNGFRNALAFENYFEAE  190



>ref|XP_007163408.1| hypothetical protein PHAVU_001G232400g [Phaseolus vulgaris]
 ref|XP_007163409.1| hypothetical protein PHAVU_001G232400g [Phaseolus vulgaris]
 ref|XP_007163410.1| hypothetical protein PHAVU_001G232400g [Phaseolus vulgaris]
 ref|XP_007163411.1| hypothetical protein PHAVU_001G232400g [Phaseolus vulgaris]
 gb|ESW35402.1| hypothetical protein PHAVU_001G232400g [Phaseolus vulgaris]
 gb|ESW35403.1| hypothetical protein PHAVU_001G232400g [Phaseolus vulgaris]
 gb|ESW35404.1| hypothetical protein PHAVU_001G232400g [Phaseolus vulgaris]
 gb|ESW35405.1| hypothetical protein PHAVU_001G232400g [Phaseolus vulgaris]
Length=641

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/182 (37%), Positives = 105/182 (58%), Gaps = 11/182 (6%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  297
            I+EY++K YEEL+SG   +K P+    CP+C  K+K+DY YK+LLQHA+GVG+ S+  R 
Sbjct  17   ISEYEDKSYEELKSGSQNLKTPDETFTCPYCPKKRKRDYLYKELLQHASGVGQSSSQKRK  76

Query  298  VKQKANHVALAKYLEIDL------GDQAEPLPQRAVAPEDNNLYCWPWTGIVVNV-SKDN  456
             + KANH+AL KYLE DL       + ++P+ +   +   N+ + WPW GIVVN+ ++  
Sbjct  77   ARDKANHLALVKYLENDLMNVDVPSNNSKPVDESDSSVNSNDQFVWPWVGIVVNIPTRRT  136

Query  457  ANGTAVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENA  627
             +G  V E    L+   R   +    V    + +  +   +++   +W G  NA+ FE A
Sbjct  137  EDGRCVGESGSRLRDEYRIRGFNPVRVNPLWNFRGHSGTALVEFNKNWPGLDNAMAFERA  196

Query  628  FE  633
            +E
Sbjct  197  YE  198



>ref|XP_011089483.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like [Sesamum indicum]
 ref|XP_011089484.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like [Sesamum indicum]
Length=284

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 100/179 (56%), Gaps = 16/179 (9%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            ++EY ++ YE+L+ G  KVK  +   RCP+C GKKK  Y  KDLLQHA+ VGKGS NR +
Sbjct  16   LDEYVDRCYEQLKDGSRKVKFSDEVYRCPYCPGKKKLVYALKDLLQHASDVGKGSQNRDI  75

Query  301  KQKANHVALAKYLEIDLG--DQAEPLPQRAV-APEDNN---LYCWPWTGIVVNVSKDNAN  462
            K K  H+ L +Y++ DL   D +  L   A+  P  N    L+ WPW GI+ NV   +A 
Sbjct  76   KHKGKHLGLVRYIKDDLAQEDLSSELAGLALEVPTGNGVSELFVWPWMGILANV---DAE  132

Query  463  GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
             ++  + D   + F   +   V++     S     V++ K DW+G+  AI+FE  FE +
Sbjct  133  KSSRLKNDLAERGF---DPVRVRLL----STGGYAVVEFKRDWSGFYRAIMFEKEFEVD  184



>gb|EMS54623.1| hypothetical protein TRIUR3_33647 [Triticum urartu]
Length=693

 Score =   100 bits (250),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 102/181 (56%), Gaps = 15/181 (8%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I++Y EK Y +L+SGK   +      RCPFC GKKKQDY+Y +LLQHA GV  G++NR+ 
Sbjct  84   IDDYAEKAYTDLKSGKLVARFGADRFRCPFCPGKKKQDYRYNELLQHAIGV--GASNRAA  141

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRA----VAP----EDNNLYCWPWTGIVVNVS-KD  453
            K KANH ALA +L+ D  D A  LP R     + P    +D  L+ WPW GI+ NV  + 
Sbjct  142  KVKANHQALASHLKTDHADAAGSLPPRQAEALINPPKPVQDQELFVWPWMGILANVPVEQ  201

Query  454  NANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  633
               G A+  +     +  ++ A    + C D   T   +++   DW G+K+A+ F N ++
Sbjct  202  TQRGGAIVMQQLAGYKPIRFNA----VHCPDGGYTGFAIVRFNKDWIGFKDALGFHNTYK  257

Query  634  A  636
            +
Sbjct  258  S  258



>ref|XP_006435547.1| hypothetical protein CICLE_v10030937mg [Citrus clementina]
 gb|ESR48787.1| hypothetical protein CICLE_v10030937mg [Citrus clementina]
Length=574

 Score =   100 bits (249),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 105/182 (58%), Gaps = 14/182 (8%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQ  306
            Y++K Y++L+SG + VK  +    CP+C  K+KQ+Y YKDLLQHA+GVG  ++N RS K+
Sbjct  19   YEDKSYKKLKSGNHSVKISDEAFTCPYCPKKRKQEYLYKDLLQHASGVGNSTSNKRSAKE  78

Query  307  KANHVALAKYLEIDLGDQAEPL-PQRAVAP----EDNNLYCWPWTGIVVNVSKDNA-NGT  468
            KANH+ALAKYLE DL D   P  P     P      +  + WPWTGIVVN+    A +G 
Sbjct  79   KANHLALAKYLEKDLRDAGSPSKPVNEGDPLTGCSHDEKFVWPWTGIVVNIPTRRAEDGR  138

Query  469  AVEE-----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  633
            +V E      D  ++R   +    V    + +  +   V++   DW G  NA+ FE A+E
Sbjct  139  SVGESGSKLRDELIRR--GFNPTRVHPLWNFRGHSGCAVVEFHKDWPGLHNAMSFEKAYE  196

Query  634  AE  639
            A+
Sbjct  197  AD  198



>ref|XP_006486475.1| PREDICTED: intracellular protein transport protein USO1-like 
isoform X2 [Citrus sinensis]
Length=597

 Score =   100 bits (249),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 105/182 (58%), Gaps = 14/182 (8%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQ  306
            Y++K Y++L+SG + VK  +    CP+C  K+KQ+Y YKDLLQHA+GVG  ++N RS K+
Sbjct  19   YEDKSYKKLKSGNHSVKISDEAFTCPYCPKKRKQEYLYKDLLQHASGVGNSTSNKRSAKE  78

Query  307  KANHVALAKYLEIDLGDQAEPL-PQRAVAP----EDNNLYCWPWTGIVVNVSKDNA-NGT  468
            KANH+ALAKYLE DL D   P  P     P      +  + WPWTGIVVN+    A +G 
Sbjct  79   KANHLALAKYLEKDLRDAGSPSKPVNEGDPLTGCSHDEKFVWPWTGIVVNIPTRRAEDGR  138

Query  469  AVEE-----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  633
            +V E      D  ++R   +    V    + +  +   V++   DW G  NA+ FE A+E
Sbjct  139  SVGESGSKLRDELIRR--GFNPTRVHPLWNFRGHSGCAVVEFHKDWPGLHNAMSFEKAYE  196

Query  634  AE  639
            A+
Sbjct  197  AD  198



>gb|KDO69293.1| hypothetical protein CISIN_1g0065972mg [Citrus sinensis]
Length=574

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 105/182 (58%), Gaps = 14/182 (8%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQ  306
            Y++K Y++L+SG + VK  +    CP+C  K+KQ+Y YKDLLQHA+GVG  ++N RS K+
Sbjct  19   YEDKSYKKLKSGNHSVKISDEAFTCPYCPKKRKQEYLYKDLLQHASGVGNSTSNKRSAKE  78

Query  307  KANHVALAKYLEIDLGDQAEPL-PQRAVAP----EDNNLYCWPWTGIVVNVSKDNA-NGT  468
            KANH+ALAKYLE DL D   P  P     P      +  + WPWTGIVVN+    A +G 
Sbjct  79   KANHLALAKYLEKDLRDAGSPSKPVNEGDPLTGCSHDEKFVWPWTGIVVNIPTRRAEDGR  138

Query  469  AVEE-----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  633
            +V E      D  ++R   +    V    + +  +   V++   DW G  NA+ FE A+E
Sbjct  139  SVGESGSKLRDELIRR--GFNPTRVHPLWNFRGHSGCAVVEFHKDWPGLHNAMSFEKAYE  196

Query  634  AE  639
            A+
Sbjct  197  AD  198



>emb|CAN81646.1| hypothetical protein VITISV_010798 [Vitis vinifera]
Length=349

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/180 (32%), Positives = 98/180 (54%), Gaps = 7/180 (4%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            +++Y+ + Y EL++G  +VK  +   RCP+C  K  +DY+ ++LLQHA+ VG+ S +  V
Sbjct  61   LDDYRYRYYRELQNGSVRVKISDTTFRCPYCPSKDDRDYRCRELLQHASRVGRDSGSGDV  120

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQR----AVAPEDNNLYCWPWTGIVVNVSKDNANGT  468
            K+KA H+AL KYL+  L  +  P   +    + A + +  + WPW GI+ N+     +G 
Sbjct  121  KEKARHLALMKYLDKYLDTKQSPASTKDTESSTANDADGHFVWPWVGIIANIPVQRIDGR  180

Query  469  AVEEEDYWLKRF---SKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
             V E    +K +     +    V    + +  +   +++   DW G+ NAI F+ AFEA+
Sbjct  181  YVGESGTKIKEYLAAQGFNPSRVNPLWNHRGHSGFAIVEFDKDWPGFTNAIAFDKAFEAD  240



>gb|KDO41499.1| hypothetical protein CISIN_1g047081mg [Citrus sinensis]
Length=432

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 108/181 (60%), Gaps = 13/181 (7%)
 Frame = +1

Query  127  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQ  306
            +Y+++ YE+L+SG Y VK  +    CP+C  K+K DY YKDLLQHA+G+G  S+ RS K+
Sbjct  18   DYEDRSYEKLKSGNYNVKISDETFTCPYCPKKRKHDYLYKDLLQHASGIG-NSSKRSAKE  76

Query  307  KANHVALAKYLEIDLGD-QAEPLPQRAVAPED---NNLYCWPWTGIVVNV-SKDNANGTA  471
            KANH+ALAK+LE DL D  ++  P   V P +   +  + WPW GIVVN+ ++   +G +
Sbjct  77   KANHLALAKFLETDLSDVGSQSKPVNGVDPLNVCSDGKFVWPWIGIVVNIPTRRGQDGRS  136

Query  472  VEE-----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
            V E     +D  ++R        V+   + +  +   +++   +W G  NA+ FE +FEA
Sbjct  137  VGESGSKLKDELIRR--GLHPTRVQSLWNFRGHSGCALVQFNKNWPGLDNAMAFEKSFEA  194

Query  637  E  639
            +
Sbjct  195  D  195



>gb|KDO69291.1| hypothetical protein CISIN_1g0065972mg [Citrus sinensis]
 gb|KDO69292.1| hypothetical protein CISIN_1g0065972mg [Citrus sinensis]
Length=639

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 105/182 (58%), Gaps = 14/182 (8%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQ  306
            Y++K Y++L+SG + VK  +    CP+C  K+KQ+Y YKDLLQHA+GVG  ++N RS K+
Sbjct  19   YEDKSYKKLKSGNHSVKISDEAFTCPYCPKKRKQEYLYKDLLQHASGVGNSTSNKRSAKE  78

Query  307  KANHVALAKYLEIDLGDQAEPL-PQRAVAP----EDNNLYCWPWTGIVVNVSKDNA-NGT  468
            KANH+ALAKYLE DL D   P  P     P      +  + WPWTGIVVN+    A +G 
Sbjct  79   KANHLALAKYLEKDLRDAGSPSKPVNEGDPLTGCSHDEKFVWPWTGIVVNIPTRRAEDGR  138

Query  469  AVEE-----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  633
            +V E      D  ++R   +    V    + +  +   V++   DW G  NA+ FE A+E
Sbjct  139  SVGESGSKLRDELIRR--GFNPTRVHPLWNFRGHSGCAVVEFHKDWPGLHNAMSFEKAYE  196

Query  634  AE  639
            A+
Sbjct  197  AD  198



>ref|XP_006435548.1| hypothetical protein CICLE_v10030937mg [Citrus clementina]
 ref|XP_006486474.1| PREDICTED: intracellular protein transport protein USO1-like 
isoform X1 [Citrus sinensis]
 gb|ESR48788.1| hypothetical protein CICLE_v10030937mg [Citrus clementina]
Length=639

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 105/182 (58%), Gaps = 14/182 (8%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQ  306
            Y++K Y++L+SG + VK  +    CP+C  K+KQ+Y YKDLLQHA+GVG  ++N RS K+
Sbjct  19   YEDKSYKKLKSGNHSVKISDEAFTCPYCPKKRKQEYLYKDLLQHASGVGNSTSNKRSAKE  78

Query  307  KANHVALAKYLEIDLGDQAEPL-PQRAVAP----EDNNLYCWPWTGIVVNVSKDNA-NGT  468
            KANH+ALAKYLE DL D   P  P     P      +  + WPWTGIVVN+    A +G 
Sbjct  79   KANHLALAKYLEKDLRDAGSPSKPVNEGDPLTGCSHDEKFVWPWTGIVVNIPTRRAEDGR  138

Query  469  AVEE-----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  633
            +V E      D  ++R   +    V    + +  +   V++   DW G  NA+ FE A+E
Sbjct  139  SVGESGSKLRDELIRR--GFNPTRVHPLWNFRGHSGCAVVEFHKDWPGLHNAMSFEKAYE  196

Query  634  AE  639
            A+
Sbjct  197  AD  198



>emb|CDP00105.1| unnamed protein product [Coffea canephora]
Length=658

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 103/177 (58%), Gaps = 9/177 (5%)
 Frame = +1

Query  136  EKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQKA  312
            +K Y+ L+SGK +VK  +G   CP+C  K+K D+ YKD+LQHA+GVG   S  RS + KA
Sbjct  42   DKSYQALKSGKKEVKVSDGAFTCPYCPKKRKADFLYKDILQHASGVGSSTSKKRSARDKA  101

Query  313  NHVALAKYLEIDLGDQAEP----LPQRAVAPEDNN-LYCWPWTGIVVNVSKDNANGTAVE  477
            NH+ALAKYLE D+   A P    +    +A  D + ++ WPW GIVVN++ D  +G  V 
Sbjct  102  NHLALAKYLEKDMSVTAGPSQATVEVDPLADHDRDEMFVWPWIGIVVNLATDFKDGRYVG  161

Query  478  EEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
            +    L+       +    V+   + +  +   +++   DW G+KNA+ FE A+EA+
Sbjct  162  KSGSNLRDELTSRGFNPTRVRPLWNYQGHSGTALVEFTKDWFGFKNAMSFEKAYEAD  218



>ref|XP_006362466.1| PREDICTED: myosin-2 heavy chain-like isoform X1 [Solanum tuberosum]
Length=653

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 110/186 (59%), Gaps = 13/186 (7%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  297
            I EY EK YE+L+SG + +K  +    CP+C  K+K+D+ YK+L+QHA+GVG  S+N R+
Sbjct  31   IEEYGEKSYEDLKSGSHSLKISDVAYTCPYCPKKRKRDFLYKELIQHASGVGSCSSNKRT  90

Query  298  VKQKANHVALAKYLEID---LGDQAEP--LPQRAVAP----EDNNLYCWPWTGIVVNVSK  450
             ++KANH+ LAKYLE D     D ++P   P     P    + + ++ WPW GIVVN+  
Sbjct  91   AREKANHLGLAKYLETDAAVAADSSKPDAEPDSQTDPLADHDRDEMFVWPWIGIVVNIPT  150

Query  451  DNANGTAVEEEDYWLK-RFSK--YEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFE  621
            +  +G  V E    L+ + ++  +    V+   + +  +   +++   DW+G+ NA+ +E
Sbjct  151  EFKDGRNVGESGSKLRDQLTRRGFNPTRVRPLWNYQGHSGTALVEFNKDWSGFGNAMAYE  210

Query  622  NAFEAE  639
             A+EA+
Sbjct  211  KAYEAD  216



>ref|XP_004307495.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Fragaria vesca subsp. 
vesca]
Length=647

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 108/187 (58%), Gaps = 18/187 (10%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  297
            ++E  E+   EL++GK++VKG +G   CPFC  K+K+D+  KDLLQHA+GVGK +++ RS
Sbjct  21   LDEEVEQYLGELKNGKHRVKGADGVFMCPFCQRKRKRDFNLKDLLQHASGVGKSNSDKRS  80

Query  298  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNVSKDN  456
              +KA H+AL+KYLE DL   AE  P +  A ++  + C       WPW G+V N+    
Sbjct  81   TDEKAKHLALSKYLENDL--IAEGGPSKPAAEDEPPVDCDHDEKLVWPWIGVVANIPTTR  138

Query  457  A-NGTAVEE-----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILF  618
            A +G  V E      D +++R   Y    V    + +  +   V++ K DW GY NA+ F
Sbjct  139  AKDGRFVGESGSKLRDEYIRRG--YNPTRVIPLWNFRGHSGNAVVEFKKDWPGYANAMAF  196

Query  619  ENAFEAE  639
            E A EA+
Sbjct  197  ERAHEAD  203



>ref|XP_006362467.1| PREDICTED: myosin-2 heavy chain-like isoform X2 [Solanum tuberosum]
Length=638

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 110/186 (59%), Gaps = 13/186 (7%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  297
            I EY EK YE+L+SG + +K  +    CP+C  K+K+D+ YK+L+QHA+GVG  S+N R+
Sbjct  16   IEEYGEKSYEDLKSGSHSLKISDVAYTCPYCPKKRKRDFLYKELIQHASGVGSCSSNKRT  75

Query  298  VKQKANHVALAKYLEID---LGDQAEP--LPQRAVAP----EDNNLYCWPWTGIVVNVSK  450
             ++KANH+ LAKYLE D     D ++P   P     P    + + ++ WPW GIVVN+  
Sbjct  76   AREKANHLGLAKYLETDAAVAADSSKPDAEPDSQTDPLADHDRDEMFVWPWIGIVVNIPT  135

Query  451  DNANGTAVEEEDYWLK-RFSK--YEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFE  621
            +  +G  V E    L+ + ++  +    V+   + +  +   +++   DW+G+ NA+ +E
Sbjct  136  EFKDGRNVGESGSKLRDQLTRRGFNPTRVRPLWNYQGHSGTALVEFNKDWSGFGNAMAYE  195

Query  622  NAFEAE  639
             A+EA+
Sbjct  196  KAYEAD  201



>ref|XP_006491885.1| PREDICTED: calponin homology domain-containing protein DDB_G0272472-like 
isoform X2 [Citrus sinensis]
Length=497

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 108/181 (60%), Gaps = 13/181 (7%)
 Frame = +1

Query  127  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQ  306
            +Y+++ YE+L+SG Y VK  +    CP+C  K+K DY YKDLLQHA+G+G  S+ RS K+
Sbjct  18   DYEDRSYEKLKSGNYNVKISDETFTCPYCPKKRKHDYLYKDLLQHASGIG-NSSKRSAKE  76

Query  307  KANHVALAKYLEIDLGD-QAEPLPQRAVAPED---NNLYCWPWTGIVVNV-SKDNANGTA  471
            KANH+ALAK+LE DL D  ++  P   V P +   +  + WPW GIVVN+ ++   +G +
Sbjct  77   KANHLALAKFLETDLSDVGSQSKPVNGVDPLNVCSDGKFVWPWIGIVVNIPTRRGQDGRS  136

Query  472  VEE-----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
            V E     +D  ++R        V+   + +  +   +++   +W G  NA+ FE +FEA
Sbjct  137  VGESGSKLKDELIRR--GLHPTRVQSLWNFRGHSGCALVQFNKNWPGLDNAMAFEKSFEA  194

Query  637  E  639
            +
Sbjct  195  D  195



>ref|XP_002464269.1| hypothetical protein SORBIDRAFT_01g015250 [Sorghum bicolor]
 gb|EER91267.1| hypothetical protein SORBIDRAFT_01g015250 [Sorghum bicolor]
Length=600

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 103/176 (59%), Gaps = 8/176 (5%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I E+KEK Y ++R+GK KVK       CPFC G+K+QDY  KDLLQHATG+G  S+  + 
Sbjct  16   IAEHKEKIYAQIRAGKLKVKR-GQAFGCPFCPGRKRQDYNLKDLLQHATGIG-ASSKHTA  73

Query  301  KQKANHVALAKYLEIDLGDQAE-PL---PQRAVAPEDNNLYCWPWTGIVVNVSKDNANGT  468
            K +A+H+ LA +LE D+    + PL   P +   P+D +L+  PW GIVVN+  +   G 
Sbjct  74   KVRASHLGLAMFLEKDIASSLDKPLQIVPYKPKTPKDEDLFVSPWMGIVVNLQCELMKGK  133

Query  469  --AVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAF  630
              + E E+    + S++   +  I  D+K +    +I+     +G+K+A+ FEN F
Sbjct  134  EFSRESEERLTAQLSRFRPLQATILGDEKDQPFCAIIEFAKYLSGFKDAMAFENHF  189



>ref|XP_006846222.1| hypothetical protein AMTR_s00012p00230440 [Amborella trichopoda]
 gb|ERN07897.1| hypothetical protein AMTR_s00012p00230440 [Amborella trichopoda]
Length=641

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 105/181 (58%), Gaps = 12/181 (7%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I+E  E  Y EL+SGK+ +K  +G  RCPFC GKKKQDY++KDLLQHATGVG  S+NR  
Sbjct  16   IDECVENIYSELKSGKHLIKNYDGTFRCPFCKGKKKQDYRHKDLLQHATGVG-ASSNRGT  74

Query  301  KQKANHVALAKYLEIDLGD------QAEPLPQRAVAPEDNNLYCWPWTGIVVNVSKD--N  456
            ++KA H AL K+L+ ++ D      + + LP+     + ++L  +PW GI+VN+  D   
Sbjct  75   EEKAKHQALGKFLKEEVPDEPGHSNEQKELPKPLTMSKSDDLLVFPWMGIIVNIETDYIR  134

Query  457  ANGTAVEEEDYWLK-RFSKYEAQEVKIFC--DDKSRTSQVVIKLKSDWNGYKNAILFENA  627
             +G  V      LK    K + + VK+    + +  T + V+    DW G+ +A+ FE  
Sbjct  135  KDGKYVGLGSTQLKDELEKEKLRPVKVHAKWNHQGHTGKAVVDFHKDWTGHHDAMSFEKH  194

Query  628  F  630
            +
Sbjct  195  Y  195



>ref|XP_006491884.1| PREDICTED: calponin homology domain-containing protein DDB_G0272472-like 
isoform X1 [Citrus sinensis]
Length=633

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 108/181 (60%), Gaps = 13/181 (7%)
 Frame = +1

Query  127  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQ  306
            +Y+++ YE+L+SG Y VK  +    CP+C  K+K DY YKDLLQHA+G+G  S+ RS K+
Sbjct  18   DYEDRSYEKLKSGNYNVKISDETFTCPYCPKKRKHDYLYKDLLQHASGIG-NSSKRSAKE  76

Query  307  KANHVALAKYLEIDLGD-QAEPLPQRAVAPED---NNLYCWPWTGIVVNV-SKDNANGTA  471
            KANH+ALAK+LE DL D  ++  P   V P +   +  + WPW GIVVN+ ++   +G +
Sbjct  77   KANHLALAKFLETDLSDVGSQSKPVNGVDPLNVCSDGKFVWPWIGIVVNIPTRRGQDGRS  136

Query  472  VEE-----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
            V E     +D  ++R        V+   + +  +   +++   +W G  NA+ FE +FEA
Sbjct  137  VGESGSKLKDELIRR--GLHPTRVQSLWNFRGHSGCALVQFNKNWPGLDNAMAFEKSFEA  194

Query  637  E  639
            +
Sbjct  195  D  195



>ref|XP_006431941.1| hypothetical protein CICLE_v10000571mg [Citrus clementina]
 gb|ESR45181.1| hypothetical protein CICLE_v10000571mg [Citrus clementina]
Length=564

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 109/181 (60%), Gaps = 13/181 (7%)
 Frame = +1

Query  127  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQ  306
            +Y++K YE+L+SG Y VK  +    CP+C  K+K DY+YKDLLQHA+G+G  S+ RS K+
Sbjct  18   DYEDKSYEKLKSGNYNVKISDETFTCPYCPKKRKHDYRYKDLLQHASGIG-NSSKRSAKE  76

Query  307  KANHVALAKYLEIDLGD-QAEPLPQRAVAPED---NNLYCWPWTGIVVNV-SKDNANGTA  471
            KANH+ALAK+LE DL D  ++  P   V P +   +  + WPW GIVVN+ ++   +G +
Sbjct  77   KANHLALAKFLETDLSDVGSQSKPVNGVDPLNVCSDGKFVWPWIGIVVNIPTRRGQDGRS  136

Query  472  VEE-----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
            V E     +D  ++R        V+   + +  +   +++   +W G  NA+ FE ++EA
Sbjct  137  VGESGSKLKDELIRR--GLHPTRVQSLWNFRGHSGCALVQFNKNWPGLDNAMAFEKSYEA  194

Query  637  E  639
            +
Sbjct  195  D  195



>gb|EMT17491.1| hypothetical protein F775_14734 [Aegilops tauschii]
Length=1285

 Score = 99.4 bits (246),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 102/182 (56%), Gaps = 15/182 (8%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I++Y EK Y +L+SGK   +      RCPFC GKKKQDY+Y +LLQHA GV  G++NR+ 
Sbjct  16   IDDYAEKAYTDLKSGKLVARFGADRFRCPFCPGKKKQDYRYNELLQHAIGV--GASNRAA  73

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQR-AVA-------PEDNNLYCWPWTGIVVNVSKDN  456
            K KANH ALA +L+ D  D A  LP R AVA        +D  L+ WPW GI+ NV  + 
Sbjct  74   KVKANHQALASHLKTDHADAAGSLPPRQAVALINPPKPVQDQELFVWPWMGILANVPVEQ  133

Query  457  AN-GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  633
               G A+  +     +  ++ A    +   D   T   +++   DW G+K+A+ F N ++
Sbjct  134  TQRGGAIVMQQLAGYKPIRFNA----VHSPDGEYTGFAIVRFNKDWIGFKDALGFHNTYK  189

Query  634  AE  639
            + 
Sbjct  190  SH  191



>ref|XP_007220898.1| hypothetical protein PRUPE_ppa002712mg [Prunus persica]
 gb|EMJ22097.1| hypothetical protein PRUPE_ppa002712mg [Prunus persica]
Length=641

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 98/174 (56%), Gaps = 14/174 (8%)
 Frame = +1

Query  154  LRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQKANHVALA  330
            L++GK+ V+  +G   CPFC  KKK+D+  KDLLQHA+GVGK  S  RS ++KA H ALA
Sbjct  31   LKNGKHSVRSSDGTYICPFCPKKKKRDFVLKDLLQHASGVGKSNSEKRSTEEKAKHSALA  90

Query  331  KYLEIDLGDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNVSKDNA-NGTAVEEED  486
            KYLE DL    E  P + V  ED  + C       WPWTG+VVN+    A +G  V E  
Sbjct  91   KYLEKDLA--TEGGPSKPVGEEDPPIDCDHDEKLVWPWTGVVVNIPTRRADDGRYVGESG  148

Query  487  YWLKRFSK---YEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
              L+   K   +    V    + +  +   V++ + DW GY NA+ FE A+EA+
Sbjct  149  SKLRDDLKRRGFNPTRVHPLWNFRGHSGSAVVEFRKDWPGYVNAMSFERAYEAD  202



>ref|XP_006644407.1| PREDICTED: intracellular protein transport protein USO1-like 
[Oryza brachyantha]
Length=629

 Score = 98.2 bits (243),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 104/180 (58%), Gaps = 10/180 (6%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I++Y+ K Y  L +G++KVK       CPFC+GKKK+ Y   +L+QHA+GVG  + NR  
Sbjct  16   IDDYEGKFYARLVAGEFKVKDGE-SYSCPFCSGKKKKAYNLNNLIQHASGVG-AAPNRQA  73

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVA------PEDNNLYCWPWTGIVVNVSKDNAN  462
            K KA+H ALAK+L+  L   +E LP + V       P  +  + WPW G++VNV  +  +
Sbjct  74   KDKASHRALAKHLKNGLTKSSE-LPAQTVVVEPQPLPSRDEKFVWPWMGVLVNVPTEWKD  132

Query  463  GTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
            G  +      LK + S++   +V    + +  T   +++   DW+G++NA+ FEN FEAE
Sbjct  133  GRQIGRSGNHLKEQLSRFCPLKVIPLWNFRGHTGNAIVEFGKDWHGFRNALAFENYFEAE  192



>ref|XP_004972827.1| PREDICTED: synaptonemal complex protein 1-like isoform X1 [Setaria 
italica]
Length=630

 Score = 97.8 bits (242),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 101/181 (56%), Gaps = 14/181 (8%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I++Y EK Y  L+SGK   +  +   RCPFC GKKKQDY+Y +LLQHA GV  G++NR+ 
Sbjct  20   IDDYSEKSYLNLKSGKLVARLGSDRFRCPFCPGKKKQDYRYNELLQHAVGV--GASNRAA  77

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQ-RAVA-------PEDNNLYCWPWTGIVVNVSKDN  456
            K KANH ALAK L+ D  D A  LP  +A+A        +D  ++ WPW GI+ NV  + 
Sbjct  78   KVKANHQALAKLLKEDHADAAATLPPLQAIALSNPPKSVKDEEVFVWPWMGILTNVPAEQ  137

Query  457  ANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
              G         +K+ + ++  +          T   ++    DW G+KNA+ F+N F++
Sbjct  138  TQGGGA----ILMKQLADFKPLQYTAVYGANGYTGCGIVLFSKDWIGFKNALAFQNFFKS  193

Query  637  E  639
            +
Sbjct  194  Q  194



>ref|XP_003569416.1| PREDICTED: factor of DNA methylation 1-like [Brachypodium distachyon]
Length=630

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 99/180 (55%), Gaps = 10/180 (6%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNG-CLRCPFCAGkkkqdykykdllqHATGVGKGSANRS  297
            I+EY+ K Y  L SG  KV   NG    CPFC+GKKK++Y   +LLQHA+GVG  + NR 
Sbjct  16   IDEYEGKIYASLMSGDLKVN--NGESYSCPFCSGKKKKNYTLHNLLQHASGVG-AAPNRP  72

Query  298  VKQKANHVALAKYLEIDLGDQAEPLPQRAVA-----PEDNNLYCWPWTGIVVNVSKDNAN  462
             K+KA H ALAK+L+  L    EP  Q         P     + WPW G+V NV  +  +
Sbjct  73   EKEKATHRALAKHLKNGLAKSPEPQSQLVDVEPQPLPGRYEKFVWPWMGVVANVPTEWKD  132

Query  463  GTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
            G  + E    LK + S++   +V    + K  T   +I+   DWNG++NA+ F N FEAE
Sbjct  133  GCQIGESGNRLKEQLSRFCPLKVIPLWNFKGHTGNAIIEFGKDWNGFRNALAFGNYFEAE  192



>ref|XP_004972828.1| PREDICTED: synaptonemal complex protein 1-like isoform X2 [Setaria 
italica]
Length=626

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 101/181 (56%), Gaps = 14/181 (8%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I++Y EK Y  L+SGK   +  +   RCPFC GKKKQDY+Y +LLQHA GV  G++NR+ 
Sbjct  16   IDDYSEKSYLNLKSGKLVARLGSDRFRCPFCPGKKKQDYRYNELLQHAVGV--GASNRAA  73

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQ-RAVA-------PEDNNLYCWPWTGIVVNVSKDN  456
            K KANH ALAK L+ D  D A  LP  +A+A        +D  ++ WPW GI+ NV  + 
Sbjct  74   KVKANHQALAKLLKEDHADAAATLPPLQAIALSNPPKSVKDEEVFVWPWMGILTNVPAEQ  133

Query  457  ANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
              G         +K+ + ++  +          T   ++    DW G+KNA+ F+N F++
Sbjct  134  TQGGGA----ILMKQLADFKPLQYTAVYGANGYTGCGIVLFSKDWIGFKNALAFQNFFKS  189

Query  637  E  639
            +
Sbjct  190  Q  190



>ref|XP_004240949.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Solanum lycopersicum]
Length=638

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 65/186 (35%), Positives = 109/186 (59%), Gaps = 13/186 (7%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  297
            I EY EK YE+L+SG   +K  +    CP+C  K+K+D+ YK+L+QHA+GVG  S+N R+
Sbjct  16   IEEYGEKSYEDLKSGSRSLKISDVAYTCPYCPKKRKRDFLYKELVQHASGVGSCSSNKRT  75

Query  298  VKQKANHVALAKYLEID---LGDQAEP--LPQRAVAP----EDNNLYCWPWTGIVVNVSK  450
             ++KANH+ LAKYLE D     D ++P   P     P    + + ++ WPW G+VVN+  
Sbjct  76   AREKANHLGLAKYLETDAAVAADSSKPDAEPDTQTDPLADHDRDEMFVWPWIGVVVNIPT  135

Query  451  DNANGTAVEEEDYWLK-RFSK--YEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFE  621
            +  +G  V E    L+ + ++  +    V+   + +  +   +++   DW+G+ NA+ +E
Sbjct  136  EYKDGRNVGESGSKLRDQLTRRGFNPTRVRPLWNYQGHSGTALVEFNKDWSGFGNAMAYE  195

Query  622  NAFEAE  639
             A+EA+
Sbjct  196  KAYEAD  201



>ref|XP_006431940.1| hypothetical protein CICLE_v10000571mg [Citrus clementina]
 gb|ESR45180.1| hypothetical protein CICLE_v10000571mg [Citrus clementina]
Length=633

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 109/181 (60%), Gaps = 13/181 (7%)
 Frame = +1

Query  127  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQ  306
            +Y++K YE+L+SG Y VK  +    CP+C  K+K DY+YKDLLQHA+G+G  S+ RS K+
Sbjct  18   DYEDKSYEKLKSGNYNVKISDETFTCPYCPKKRKHDYRYKDLLQHASGIG-NSSKRSAKE  76

Query  307  KANHVALAKYLEIDLGD-QAEPLPQRAVAPED---NNLYCWPWTGIVVNV-SKDNANGTA  471
            KANH+ALAK+LE DL D  ++  P   V P +   +  + WPW GIVVN+ ++   +G +
Sbjct  77   KANHLALAKFLETDLSDVGSQSKPVNGVDPLNVCSDGKFVWPWIGIVVNIPTRRGQDGRS  136

Query  472  VEE-----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
            V E     +D  ++R        V+   + +  +   +++   +W G  NA+ FE ++EA
Sbjct  137  VGESGSKLKDELIRR--GLHPTRVQSLWNFRGHSGCALVQFNKNWPGLDNAMAFEKSYEA  194

Query  637  E  639
            +
Sbjct  195  D  195



>ref|XP_009387522.1| PREDICTED: uncharacterized protein LOC103974422 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009387523.1| PREDICTED: uncharacterized protein LOC103974422 [Musa acuminata 
subsp. malaccensis]
Length=641

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 69/209 (33%), Positives = 112/209 (54%), Gaps = 49/209 (23%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            + +Y+E+ Y+ L++G ++++ P+G  RCPFC GKKKQDY++KDLLQHATG+G  S++R  
Sbjct  19   VEDYEEECYQALKTGNHRIRNPDGTFRCPFCTGKKKQDYQFKDLLQHATGIG-ASSSRKG  77

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP-----------------------------  393
             QKA+H A A++L++DL       P  ++ P                             
Sbjct  78   SQKAHHRAFARFLQLDLA------PSLSLPPALKAAFAAAAAGDPSPIQSPPPSSSSYSA  131

Query  394  ----EDNNLYCWPWTGIVVNVSKDNANGTAVEEEDYWLKRFSKYEAQEVKIFCDD----K  549
                 ++ L+ WPW  ++VN     A+G  ++E+   L  F+  +   V +  +D    K
Sbjct  132  SKPPREDELFVWPWMAVLVNAPPGAADGDDLKEK---LSDFNPVDT--VHLHEEDDLNGK  186

Query  550  SRTSQVVIKLKSDWNGYKNAILFENAFEA  636
            S  + V++K   +W G+KNA+ FEN F A
Sbjct  187  STCATVIVKFLKNWGGFKNAMDFENHFRA  215



>ref|XP_007156380.1| hypothetical protein PHAVU_003G281400g [Phaseolus vulgaris]
 gb|ESW28374.1| hypothetical protein PHAVU_003G281400g [Phaseolus vulgaris]
Length=636

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 101/184 (55%), Gaps = 13/184 (7%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVK--GPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-  291
            I+EY++K YEELR+G   VK    NG   CP+C  K+KQDY Y +LLQHA+GVG+ S+  
Sbjct  17   ISEYEDKTYEELRNGVQNVKTSNENGTFICPYCPRKRKQDYLYNELLQHASGVGQSSSKK  76

Query  292  RSVKQKANHVALAKYLEIDLGDQAEPLPQRAVAPE-DNNLYC-----WPWTGIVVNV-SK  450
            R  + KANH+AL KYLE DL D   P        E D+++ C     WPW GIVVN+ + 
Sbjct  77   RKARDKANHLALVKYLEKDLVDVDAPAKDSKPTDESDSSVNCDEQFVWPWIGIVVNIPTS  136

Query  451  DNANGTAVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFE  621
               +G  V E    L+   R   +    V    + +  +   +++   DW G  NA+ FE
Sbjct  137  QTVDGRCVGESGSRLRDDYRSRGFNPVRVNALWNYRGHSGTALVEFSKDWPGLHNALAFE  196

Query  622  NAFE  633
             A+E
Sbjct  197  RAYE  200



>gb|KHN17925.1| hypothetical protein glysoja_017976 [Glycine soja]
Length=640

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 103/184 (56%), Gaps = 15/184 (8%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  297
            I+EY++K YEEL+SG   VK  +    CP+C  K+K+DY YK+LLQHA+GVG+ S+  R 
Sbjct  17   ISEYEDKSYEELKSGSQDVKTSDETFTCPYCPKKRKRDYLYKELLQHASGVGQSSSQKRK  76

Query  298  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPED--------NNLYCWPWTGIVVNV-SK  450
             + KANH+AL KYLE DL +    +P     PED        N+ + WPW G+VVN+ ++
Sbjct  77   ARDKANHLALLKYLEKDLMNV--DVPSNDSKPEDESDPSVNSNDQFAWPWIGVVVNIPTR  134

Query  451  DNANGTAVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFE  621
               +G  V E    L+   R   +    V    + +  +   +++   +W G  NA+ FE
Sbjct  135  RTEDGRCVGESGSRLRDEYRSRGFNPFRVNPLWNFRGHSGTALVEFNKNWPGLHNALAFE  194

Query  622  NAFE  633
             A+E
Sbjct  195  RAYE  198



>ref|XP_003538408.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503-like 
isoform X1 [Glycine max]
 ref|XP_006591339.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503-like 
isoform X2 [Glycine max]
 ref|XP_006591340.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503-like 
isoform X3 [Glycine max]
Length=640

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 103/184 (56%), Gaps = 15/184 (8%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  297
            I+EY++K YEEL+SG   VK  +    CP+C  K+K+DY YK+LLQHA+GVG+ S+  R 
Sbjct  17   ISEYEDKSYEELKSGSQDVKTSDETFTCPYCPKKRKRDYLYKELLQHASGVGQSSSQKRK  76

Query  298  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPED--------NNLYCWPWTGIVVNV-SK  450
             + KANH+AL KYLE DL +    +P     PED        N+ + WPW G+VVN+ ++
Sbjct  77   ARDKANHLALLKYLEKDLMNV--DVPSNDSKPEDESDPSVNSNDQFVWPWIGVVVNIPTR  134

Query  451  DNANGTAVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFE  621
               +G  V E    L+   R   +    V    + +  +   +++   +W G  NA+ FE
Sbjct  135  RTEDGRCVGESGSRLRDEYRSRGFNPFRVNPLWNFRGHSGTALVEFNKNWPGLHNALAFE  194

Query  622  NAFE  633
             A+E
Sbjct  195  RAYE  198



>gb|KDP44945.1| hypothetical protein JCGZ_01445 [Jatropha curcas]
Length=636

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 100/183 (55%), Gaps = 10/183 (5%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  297
            + EY+ + YEEL++G   VK  +    CP+C  K+K+DY YKDLLQHA GVGK  +N RS
Sbjct  16   MEEYEAQSYEELKNGTRSVKISDEIFSCPYCPKKRKRDYLYKDLLQHAVGVGKSPSNKRS  75

Query  298  VKQKANHVALAKYLEIDLGDQAEPL-PQRAVAP----EDNNLYCWPWTGIVVNV---SKD  453
             K+KANH+AL KYLE DLG    P  P+    P    +      WPWTGIVVN+     D
Sbjct  76   AKEKANHLALVKYLEKDLGATGSPSEPKSDTDPLSECDHYEKLVWPWTGIVVNLPTTRTD  135

Query  454  NANGTAVEEEDYWLKRFSK-YEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAF  630
            +          +  +  S+ +    V    + +  +   V++ + DW G  NA+ FE A+
Sbjct  136  DGRFVGASGSKFRDELISRGFNPTRVHPLWNYRGHSGSAVVEFRKDWPGLHNALSFEKAY  195

Query  631  EAE  639
            EA+
Sbjct  196  EAD  198



>ref|XP_002533154.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29235.1| conserved hypothetical protein [Ricinus communis]
Length=640

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 68/185 (37%), Positives = 102/185 (55%), Gaps = 14/185 (8%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGK-GSANRS  297
            ++EY+ + YEEL++G + VK  +    CP+C  K+K++Y Y+DLLQHA+GVG+  S  RS
Sbjct  20   LDEYEAQCYEELKNGTHHVKISDETFTCPYCPKKRKREYLYRDLLQHASGVGRSASKKRS  79

Query  298  VKQKANHVALAKYLEIDLGDQAEPL-PQRAVAPED----NNLYCWPWTGIVVNVSKDNA-  459
             K+KANH+AL KYLE D+ D   P  P+    P D    +    WPWTGIV+N+    A 
Sbjct  80   TKEKANHLALVKYLEKDIADLGSPSKPKGESDPLDSCNHDEKIVWPWTGIVINIPTTKAP  139

Query  460  -----NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFEN  624
                   +  +  D  + R   +    V    + +  +   V++   DW G  NA+ FE 
Sbjct  140  DGRFVGASGSKFRDELISR--GFNPTRVHPLWNYRGHSGSAVVEFHKDWPGLHNALSFEK  197

Query  625  AFEAE  639
            A+EA+
Sbjct  198  AYEAD  202



>gb|ACF22790.1| gene X-like protein, partial [Brachypodium distachyon]
Length=813

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 66/180 (37%), Positives = 95/180 (53%), Gaps = 14/180 (8%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I++Y E+ Y  L+SGK   +      RCPFC GKKKQDY+Y +LLQHA GVG  ++NR+ 
Sbjct  258  IDDYAEQTYLNLKSGKLVARYGADRFRCPFCLGKKKQDYRYNELLQHAVGVG--ASNRAA  315

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRA----VAP----EDNNLYCWPWTGIVVNVSKDN  456
            K KANH+ALA  L+ D  D A  LP R     + P    +D  L+ WPW GI+ NV  + 
Sbjct  316  KVKANHLALANLLKNDYSDAAGSLPSRQADALINPPKPVQDQELFVWPWMGILANVPAEQ  375

Query  457  ANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
                        ++  + +              T   V++  SDW G+K+A+ F N +++
Sbjct  376  TQRDGA----ILMQHLAHFNPSHFDAVHSPDGYTGFAVVRFTSDWIGFKDALAFHNNYKS  431



>ref|XP_010234409.1| PREDICTED: factor of DNA methylation 1-like isoform X2 [Brachypodium 
distachyon]
 ref|XP_010234410.1| PREDICTED: factor of DNA methylation 1-like isoform X2 [Brachypodium 
distachyon]
Length=631

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 66/180 (37%), Positives = 95/180 (53%), Gaps = 14/180 (8%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I++Y E+ Y  L+SGK   +      RCPFC GKKKQDY+Y +LLQHA GVG  ++NR+ 
Sbjct  21   IDDYAEQTYLNLKSGKLVARYGADRFRCPFCLGKKKQDYRYNELLQHAVGVG--ASNRAA  78

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRA----VAP----EDNNLYCWPWTGIVVNVSKDN  456
            K KANH+ALA  L+ D  D A  LP R     + P    +D  L+ WPW GI+ NV  + 
Sbjct  79   KVKANHLALANLLKNDYSDAAGSLPSRQADALINPPKPVQDQELFVWPWMGILANVPAEQ  138

Query  457  ANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
                        ++  + +              T   V++  SDW G+K+A+ F N +++
Sbjct  139  TQRDGA----ILMQHLAHFNPSHFDAVHSPDGYTGFAVVRFTSDWIGFKDALAFHNNYKS  194



>ref|XP_010234408.1| PREDICTED: factor of DNA methylation 1-like isoform X1 [Brachypodium 
distachyon]
Length=632

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 66/180 (37%), Positives = 95/180 (53%), Gaps = 14/180 (8%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I++Y E+ Y  L+SGK   +      RCPFC GKKKQDY+Y +LLQHA GVG  ++NR+ 
Sbjct  22   IDDYAEQTYLNLKSGKLVARYGADRFRCPFCLGKKKQDYRYNELLQHAVGVG--ASNRAA  79

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRA----VAP----EDNNLYCWPWTGIVVNVSKDN  456
            K KANH+ALA  L+ D  D A  LP R     + P    +D  L+ WPW GI+ NV  + 
Sbjct  80   KVKANHLALANLLKNDYSDAAGSLPSRQADALINPPKPVQDQELFVWPWMGILANVPAEQ  139

Query  457  ANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
                        ++  + +              T   V++  SDW G+K+A+ F N +++
Sbjct  140  TQRDGA----ILMQHLAHFNPSHFDAVHSPDGYTGFAVVRFTSDWIGFKDALAFHNNYKS  195



>emb|CDY35897.1| BnaA07g00900D [Brassica napus]
Length=139

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 76/116 (66%), Gaps = 5/116 (4%)
 Frame = +1

Query  139  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQKANH  318
            KPY++LR G+ KVK      +CPFC+ +KKQ YK K+LL HAT V K S  R+ KQKANH
Sbjct  16   KPYKQLRDGELKVKLKEETFKCPFCSERKKQRYKDKELLAHATAVAK-STTRNCKQKANH  74

Query  319  VALAKYLEIDLGDQAEPL----PQRAVAPEDNNLYCWPWTGIVVNVSKDNANGTAV  474
            +AL+KYL  DL   AEP+     Q+  A  ++++Y WPW GIV++  + N +  ++
Sbjct  75   LALSKYLHKDLAGDAEPVISLSKQKQAAVVNDDMYVWPWMGIVISPLRGNDDDKSL  130



>ref|XP_010690719.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010690724.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Beta vulgaris subsp. 
vulgaris]
Length=633

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 104/181 (57%), Gaps = 10/181 (6%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRS  297
            I+EY +K +EEL+ G  ++K       CP+C GK+K+DY+YK+LLQHA+G+G   S  R 
Sbjct  16   IDEYGDKTFEELKKGSSELKVAEEKYTCPYCPGKRKRDYQYKELLQHASGIGNANSKKRR  75

Query  298  VKQKANHVALAKYLEIDLGDQAEPLPQ--RAVAP----EDNNLYCWPWTGIVVNVSKDNA  459
             ++KANH+ LAK+LE ++ +QA    Q     AP    + ++ + WPWTGIVVN+   + 
Sbjct  76   AREKANHLGLAKFLEEEVQNQASSSKQVNNGDAPIAGGDHDDKFVWPWTGIVVNIPTLHK  135

Query  460  NGTAVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAF  630
            +G  V E    L+   R   +  + V    + +  +   V++   DW G+ NA+ FE  +
Sbjct  136  DGRYVGESGSKLRDELRARGFNPKRVHPLWNFRGHSGTAVVEFNKDWMGWNNALAFEKEY  195

Query  631  E  633
            E
Sbjct  196  E  196



>ref|XP_006585879.1| PREDICTED: myosin heavy chain, clone 203-like isoform X1 [Glycine 
max]
 ref|XP_006585880.1| PREDICTED: myosin heavy chain, clone 203-like isoform X2 [Glycine 
max]
 ref|XP_006585881.1| PREDICTED: myosin heavy chain, clone 203-like isoform X3 [Glycine 
max]
 gb|KHN37146.1| hypothetical protein glysoja_038766 [Glycine soja]
Length=641

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 68/185 (37%), Positives = 103/185 (56%), Gaps = 16/185 (9%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdy-kykdllqHATGVGKGSA-NR  294
            I+EYK+K Y+EL+SG  KVK  +    CP+C  ++K+D   YK+LLQHA+GVG+ S+  R
Sbjct  17   ISEYKDKTYQELKSGSQKVKNLDETFTCPYCPKRRKRDDYSYKELLQHASGVGRSSSKKR  76

Query  295  SVKQKANHVALAKYLEIDLGDQAEPLPQRAVAPED--------NNLYCWPWTGIVVNV-S  447
              + KANH+AL KYLE DL   +  +P     PED        +  + WPW GIVVN+ +
Sbjct  77   KARDKANHLALVKYLEKDLV--SVDIPAEVSKPEDESGTSVNSDEQFVWPWIGIVVNIPT  134

Query  448  KDNANGTAVEEEDYWLKRFSK---YEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILF  618
            +   +G +V E    L+   K   +    V    + +  +   +++   DW+G  NA+ F
Sbjct  135  RLTGDGHSVGESGTGLRDEYKSRGFNPVRVTPLWNFRGHSGIALVEFNKDWSGLDNALAF  194

Query  619  ENAFE  633
            E  +E
Sbjct  195  EREYE  199



>ref|XP_010651011.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Vitis vinifera]
 ref|XP_010651012.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Vitis vinifera]
 ref|XP_010651013.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Vitis vinifera]
 emb|CBI16121.3| unnamed protein product [Vitis vinifera]
Length=626

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 57/180 (32%), Positives = 98/180 (54%), Gaps = 7/180 (4%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            +++Y+ + Y EL++G  +VK  +   RCP+C  K  +DY+ ++LLQHA+ VG+ S +  V
Sbjct  16   LDDYRYRYYRELQNGSVRVKISDTTFRCPYCPSKDDRDYRCRELLQHASRVGRDSGSGDV  75

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQR----AVAPEDNNLYCWPWTGIVVNVSKDNANGT  468
            K+KA H+AL KYL+  L  +  P   +    + A + +  + WPW GI+ N+     +G 
Sbjct  76   KEKARHLALMKYLDKYLDTKQSPASTKDTESSTANDADGHFVWPWVGIIANIPVQRIDGR  135

Query  469  AVEEEDYWLKRF---SKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
             V E    +K +     +    V    + +  +   +++   DW G+ NAI F+ AFEA+
Sbjct  136  YVGESGTKIKEYLAAQGFNPSRVNPLWNHRGHSGFAIVEFDKDWPGFTNAIAFDKAFEAD  195



>emb|CDY08088.1| BnaA06g16380D [Brassica napus]
Length=697

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 104/186 (56%), Gaps = 19/186 (10%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  297
            + EY +K Y  L+SGK KVK       CP+C  KKK  ++YKDLLQHA+GVG  +++ RS
Sbjct  71   MEEYGDKIYLSLKSGKLKVKLSPHSFTCPYCPNKKKPSFQYKDLLQHASGVGNSNSDKRS  130

Query  298  VKQKANHVALAKYLEIDLGD--QAEPLPQRAVA-------PEDNNLYCWPWTGIVVNV-S  447
             K+KA+H+ALAKYL+ DL D  QAEP  +R           +D  L C PW G+VVN+ +
Sbjct  131  AKEKASHLALAKYLQQDLADDSQAEPSSKRRKTGDPIQDCDQDEKLVC-PWKGVVVNIPT  189

Query  448  KDNANGTAVEE-----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAI  612
                NG    E      D +++R   +    V+   +    +   +++   DWNG  NA+
Sbjct  190  TKTENGRTAGESGSKLRDEYIQRG--FNPTRVRTLWNHWGFSGTAIVEFNKDWNGLHNAL  247

Query  613  LFENAF  630
            LF+ A+
Sbjct  248  LFDKAY  253



>ref|XP_004161917.1| PREDICTED: uncharacterized LOC101219429 [Cucumis sativus]
Length=631

 Score = 95.1 bits (235),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 101/187 (54%), Gaps = 16/187 (9%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  297
            ++E + K Y+EL++GK  VK  +    CP+C  K+K+D+ YKDLLQHA+GVGK  +N RS
Sbjct  19   MDERESKSYDELKNGKRIVKLSHETFTCPYCTKKRKRDFLYKDLLQHASGVGKSPSNKRS  78

Query  298  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNVSKDN  456
             K+KANH+AL KYLE DL D   P      +  D  + C       WPW GIVVN+    
Sbjct  79   TKEKANHLALLKYLEKDLADAVGPSKPATASNNDPVMDCNHDEKFVWPWRGIVVNIPTRR  138

Query  457  AN------GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILF  618
             +      G+  +  D   +R   +    V    + +  +   +++   DW G  NAI F
Sbjct  139  TDDGRFVGGSGSKFRDELKER--GFNPSRVTPLWNYRGHSGCAIVEFNKDWPGLHNAISF  196

Query  619  ENAFEAE  639
            E A+EA+
Sbjct  197  ERAYEAD  203



>emb|CDY35048.1| BnaA06g10580D [Brassica napus]
Length=598

 Score = 94.7 bits (234),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 76/136 (56%), Gaps = 12/136 (9%)
 Frame = +1

Query  259  HATGVGKGSANRSVKQKANHVALAKYLEIDLGDQAE----------PLPQRAVAPEDNNL  408
            HA+GV KGSA+RS KQKANH+ALA+YL+ +L   AE           L +    P    +
Sbjct  3    HASGVSKGSASRSAKQKANHLALARYLQNELAGDAEPLPRPPPVPPQLNESEAKP--GEV  60

Query  409  YCWPWTGIVVNVSKDNANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSD  588
            Y WPW GI+V+  K+  +  A+ +   WLK  S+++  EV  F  ++     VV K  SD
Sbjct  61   YVWPWMGIIVSPLKETDDKEALLDSACWLKELSRFKPVEVHAFWVEQGLIVGVVAKFNSD  120

Query  589  WNGYKNAILFENAFEA  636
            W+G+ +A   E  FE+
Sbjct  121  WSGFASATELEKEFES  136



>gb|KGN50554.1| hypothetical protein Csa_5G182100 [Cucumis sativus]
Length=781

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 101/187 (54%), Gaps = 16/187 (9%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  297
            ++E + K Y+EL++GK  VK  +    CP+C  K+K+D+ YKDLLQHA+GVGK  +N RS
Sbjct  157  MDERESKSYDELKNGKRIVKLSHETFTCPYCTKKRKRDFLYKDLLQHASGVGKSPSNKRS  216

Query  298  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNVSKDN  456
             K+KANH+AL KYLE DL D   P      +  D  + C       WPW GIVVN+    
Sbjct  217  TKEKANHLALLKYLEKDLADAVGPSKPATASNNDPVMDCNHDEKFVWPWRGIVVNIPTRR  276

Query  457  AN------GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILF  618
             +      G+  +  D   +R   +    V    + +  +   +++   DW G  NAI F
Sbjct  277  TDDGRFVGGSGSKFRDELKER--GFNPSRVTPLWNYRGHSGCAIVEFNKDWPGLHNAISF  334

Query  619  ENAFEAE  639
            E A+EA+
Sbjct  335  ERAYEAD  341



>ref|XP_009357740.1| PREDICTED: myosin heavy chain, cardiac muscle isoform-like [Pyrus 
x bretschneideri]
Length=642

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 100/176 (57%), Gaps = 21/176 (12%)
 Frame = +1

Query  157  RSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQKANHVALAK  333
            ++GKY V+  +G   CPFC  KKK+D+  K+LLQHA+GVGK +++ RS ++KA H+A+ K
Sbjct  32   KNGKYSVRSSDGRYTCPFCPSKKKRDFVLKELLQHASGVGKRTSDKRSTEEKAKHLAVVK  91

Query  334  YLEIDLGDQAEPLPQRAVAPE------DNNLYCWPWTGIVVNVSKDNAN--------GTA  471
            YLE DL   AE  P + VA E       +    WPWTG+VVN+    AN        G+ 
Sbjct  92   YLEKDLA--AEGGPSKHVAEEPPIDCDQDEKLVWPWTGVVVNIPTRRANDGRYVGESGSK  149

Query  472  VEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
            + +E   LKR   +    V    + +  +   V++ + DW GY NA+ FE A++ +
Sbjct  150  LRDE---LKRRG-FNPLRVHPLWNYRGHSGSAVVEFRKDWPGYVNAMSFEKAYDVD  201



>ref|XP_004147687.1| PREDICTED: uncharacterized protein LOC101219429 [Cucumis sativus]
Length=643

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 101/187 (54%), Gaps = 16/187 (9%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  297
            ++E + K Y+EL++GK  VK  +    CP+C  K+K+D+ YKDLLQHA+GVGK  +N RS
Sbjct  19   MDERESKSYDELKNGKRIVKLSHETFTCPYCTKKRKRDFLYKDLLQHASGVGKSPSNKRS  78

Query  298  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNVSKDN  456
             K+KANH+AL KYLE DL D   P      +  D  + C       WPW GIVVN+    
Sbjct  79   TKEKANHLALLKYLEKDLADAVGPSKPATASNNDPVMDCNHDEKFVWPWRGIVVNIPTRR  138

Query  457  AN------GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILF  618
             +      G+  +  D   +R   +    V    + +  +   +++   DW G  NAI F
Sbjct  139  TDDGRFVGGSGSKFRDELKER--GFNPSRVTPLWNYRGHSGCAIVEFNKDWPGLHNAISF  196

Query  619  ENAFEAE  639
            E A+EA+
Sbjct  197  ERAYEAD  203



>ref|XP_009149803.1| PREDICTED: myosin-11 [Brassica rapa]
Length=647

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 104/186 (56%), Gaps = 19/186 (10%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  297
            + EY +K Y  L+SGK KVK       CP+C  KKK  ++YKDLLQHA+GVG  +++ R+
Sbjct  21   MEEYGDKIYLSLKSGKLKVKLSPHSFTCPYCPNKKKPSFQYKDLLQHASGVGNSNSDKRT  80

Query  298  VKQKANHVALAKYLEIDLGD--QAEPLPQRAVA-------PEDNNLYCWPWTGIVVNV-S  447
             K+KA+H+ALAKYL+ DL D  QAEP  +R           +D  L C PW G+VVN+ +
Sbjct  81   AKEKASHLALAKYLQQDLADDSQAEPSSKRRKTGDPIQDCDQDEKLVC-PWKGVVVNIPT  139

Query  448  KDNANGTAVEE-----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAI  612
                NG    E      D +++R   +    V+   +    +   +++   DWNG  NA+
Sbjct  140  TKTENGRTAGESGSKLRDEYIQRG--FNPTRVRTLWNHWGFSGTAIVEFNKDWNGLHNAL  197

Query  613  LFENAF  630
            LF+ A+
Sbjct  198  LFDKAY  203



>gb|KHN07563.1| hypothetical protein glysoja_019670 [Glycine soja]
Length=566

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 102/184 (55%), Gaps = 15/184 (8%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  297
            I+EY++K YEEL++G   V+       CP+C  K+KQDY YK+LLQHA+GVG+ S+  R 
Sbjct  17   ISEYEDKSYEELKNGSQDVRTSGKTFTCPYCPKKRKQDYLYKELLQHASGVGQSSSQKRK  76

Query  298  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPED--------NNLYCWPWTGIVVNV-SK  450
             + KANH+AL KYL+ DL +    +P     PED        N+ + WPW G+VVN+ ++
Sbjct  77   ARDKANHLALVKYLKKDLMNV--DVPSNDSKPEDESDPSVNSNDQFVWPWIGVVVNIPTR  134

Query  451  DNANGTAVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFE  621
               +G  V E    L+   R   +    V    + +  +   +++   +W G  NA+ FE
Sbjct  135  RTEDGRCVGESGSRLRDEYRSRGFNPVRVNPLWNFRGHSGTALVEFNKNWPGLHNALAFE  194

Query  622  NAFE  633
             A+E
Sbjct  195  RAYE  198



>ref|XP_007009302.1| XH/XS domain-containing protein isoform 5 [Theobroma cacao]
 gb|EOY18112.1| XH/XS domain-containing protein isoform 5 [Theobroma cacao]
Length=561

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 106/187 (57%), Gaps = 18/187 (10%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRS  297
            + EY++K YE+L++GK+ +K       CP+C  KKK+DY YK+LLQHA+GVG   S  RS
Sbjct  1    MEEYEDKSYEKLKNGKHNIKVSEETYTCPYCPKKKKRDYLYKELLQHASGVGNSNSEKRS  60

Query  298  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPED-------NNLYCWPWTGIVVNV-SKD  453
             K+KANH+AL KYLE DL   A     +  A ED       +    WPWTGIVVN+ ++ 
Sbjct  61   AKEKANHLALVKYLEKDLV--AVGSSSKTAAEEDPLSGYDHDEKIVWPWTGIVVNIPTRR  118

Query  454  NANGTAVEE-----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILF  618
            + +G +V E      D  ++R   +    V    + +  +   V++   DW G  NA+ F
Sbjct  119  SEDGRSVGESGSKLRDELIRRG--FNPIRVLPLWNYRGHSGTAVVEFHKDWPGLHNALSF  176

Query  619  ENAFEAE  639
            E A++A+
Sbjct  177  EKAYQAD  183



>ref|XP_010658558.1| PREDICTED: protein INVOLVED IN DE NOVO 2 isoform X1 [Vitis vinifera]
Length=656

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 100/179 (56%), Gaps = 11/179 (6%)
 Frame = +1

Query  136  EKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQKA  312
            +K YEEL++G + VK       CP+C+ KKK+DY YK+LLQHA GVGK S+  RS+K KA
Sbjct  23   DKSYEELKNGNHHVKTSGESFSCPYCSKKKKRDYLYKELLQHAIGVGKSSSEKRSMKDKA  82

Query  313  NHVALAKYLEIDL-------GDQAEPLPQRAVAPEDNNLYCWPWTGIVVNVSKDNANGTA  471
            NH+ALAKYLE D+       G  ++P  +  +  + + ++ WPWTG+VVN+  +  +G  
Sbjct  83   NHLALAKYLEKDIMDVDGPSGGPSKPKSEAPLGCDHDEMFVWPWTGVVVNIPTELRDGRY  142

Query  472  VEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
            +      L+       +    V    + +  +    ++   DW G  NA+ FE  +EA+
Sbjct  143  IGGSGSKLRDELTARGFNPIRVHPLWNYRGHSGCAAVEFNKDWPGLHNAMSFEKEYEAD  201



>ref|XP_007009301.1| XH/XS domain-containing protein, putative isoform 4, partial 
[Theobroma cacao]
 gb|EOY18111.1| XH/XS domain-containing protein, putative isoform 4, partial 
[Theobroma cacao]
Length=567

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 106/187 (57%), Gaps = 18/187 (10%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRS  297
            + EY++K YE+L++GK+ +K       CP+C  KKK+DY YK+LLQHA+GVG   S  RS
Sbjct  12   MEEYEDKSYEKLKNGKHNIKVSEETYTCPYCPKKKKRDYLYKELLQHASGVGNSNSEKRS  71

Query  298  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPED-------NNLYCWPWTGIVVNV-SKD  453
             K+KANH+AL KYLE DL   A     +  A ED       +    WPWTGIVVN+ ++ 
Sbjct  72   AKEKANHLALVKYLEKDLV--AVGSSSKTAAEEDPLSGYDHDEKIVWPWTGIVVNIPTRR  129

Query  454  NANGTAVEE-----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILF  618
            + +G +V E      D  ++R   +    V    + +  +   V++   DW G  NA+ F
Sbjct  130  SEDGRSVGESGSKLRDELIRRG--FNPIRVLPLWNYRGHSGTAVVEFHKDWPGLHNALSF  187

Query  619  ENAFEAE  639
            E A++A+
Sbjct  188  EKAYQAD  194



>ref|XP_007009300.1| XH/XS domain-containing protein, putative isoform 3 [Theobroma 
cacao]
 gb|EOY18110.1| XH/XS domain-containing protein, putative isoform 3 [Theobroma 
cacao]
Length=566

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 106/187 (57%), Gaps = 18/187 (10%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRS  297
            + EY++K YE+L++GK+ +K       CP+C  KKK+DY YK+LLQHA+GVG   S  RS
Sbjct  16   MEEYEDKSYEKLKNGKHNIKVSEETYTCPYCPKKKKRDYLYKELLQHASGVGNSNSEKRS  75

Query  298  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPED-------NNLYCWPWTGIVVNV-SKD  453
             K+KANH+AL KYLE DL   A     +  A ED       +    WPWTGIVVN+ ++ 
Sbjct  76   AKEKANHLALVKYLEKDLV--AVGSSSKTAAEEDPLSGYDHDEKIVWPWTGIVVNIPTRR  133

Query  454  NANGTAVEE-----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILF  618
            + +G +V E      D  ++R   +    V    + +  +   V++   DW G  NA+ F
Sbjct  134  SEDGRSVGESGSKLRDELIRRG--FNPIRVLPLWNYRGHSGTAVVEFHKDWPGLHNALSF  191

Query  619  ENAFEAE  639
            E A++A+
Sbjct  192  EKAYQAD  198



>ref|XP_002278500.1| PREDICTED: protein INVOLVED IN DE NOVO 2 isoform X2 [Vitis vinifera]
 emb|CBI31664.3| unnamed protein product [Vitis vinifera]
Length=641

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 100/179 (56%), Gaps = 11/179 (6%)
 Frame = +1

Query  136  EKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQKA  312
            +K YEEL++G + VK       CP+C+ KKK+DY YK+LLQHA GVGK S+  RS+K KA
Sbjct  23   DKSYEELKNGNHHVKTSGESFSCPYCSKKKKRDYLYKELLQHAIGVGKSSSEKRSMKDKA  82

Query  313  NHVALAKYLEIDL----GDQAEPLPQRAVAP---EDNNLYCWPWTGIVVNVSKDNANGTA  471
            NH+ALAKYLE D+    G    P   ++ AP   + + ++ WPWTG+VVN+  +  +G  
Sbjct  83   NHLALAKYLEKDIMDVDGPSGGPSKPKSEAPLGCDHDEMFVWPWTGVVVNIPTELRDGRY  142

Query  472  VEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
            +      L+       +    V    + +  +    ++   DW G  NA+ FE  +EA+
Sbjct  143  IGGSGSKLRDELTARGFNPIRVHPLWNYRGHSGCAAVEFNKDWPGLHNAMSFEKEYEAD  201



>ref|XP_007009298.1| XH/XS domain-containing protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY18108.1| XH/XS domain-containing protein, putative isoform 1 [Theobroma 
cacao]
Length=640

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 106/187 (57%), Gaps = 18/187 (10%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRS  297
            + EY++K YE+L++GK+ +K       CP+C  KKK+DY YK+LLQHA+GVG   S  RS
Sbjct  16   MEEYEDKSYEKLKNGKHNIKVSEETYTCPYCPKKKKRDYLYKELLQHASGVGNSNSEKRS  75

Query  298  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPED-------NNLYCWPWTGIVVNV-SKD  453
             K+KANH+AL KYLE DL   A     +  A ED       +    WPWTGIVVN+ ++ 
Sbjct  76   AKEKANHLALVKYLEKDL--VAVGSSSKTAAEEDPLSGYDHDEKIVWPWTGIVVNIPTRR  133

Query  454  NANGTAVEE-----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILF  618
            + +G +V E      D  ++R   +    V    + +  +   V++   DW G  NA+ F
Sbjct  134  SEDGRSVGESGSKLRDELIRRG--FNPIRVLPLWNYRGHSGTAVVEFHKDWPGLHNALSF  191

Query  619  ENAFEAE  639
            E A++A+
Sbjct  192  EKAYQAD  198



>ref|XP_007009299.1| XH/XS domain-containing protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY18109.1| XH/XS domain-containing protein, putative isoform 2 [Theobroma 
cacao]
Length=638

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 106/187 (57%), Gaps = 18/187 (10%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRS  297
            + EY++K YE+L++GK+ +K       CP+C  KKK+DY YK+LLQHA+GVG   S  RS
Sbjct  16   MEEYEDKSYEKLKNGKHNIKVSEETYTCPYCPKKKKRDYLYKELLQHASGVGNSNSEKRS  75

Query  298  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPED-------NNLYCWPWTGIVVNV-SKD  453
             K+KANH+AL KYLE DL   A     +  A ED       +    WPWTGIVVN+ ++ 
Sbjct  76   AKEKANHLALVKYLEKDL--VAVGSSSKTAAEEDPLSGYDHDEKIVWPWTGIVVNIPTRR  133

Query  454  NANGTAVEE-----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILF  618
            + +G +V E      D  ++R   +    V    + +  +   V++   DW G  NA+ F
Sbjct  134  SEDGRSVGESGSKLRDELIRRG--FNPIRVLPLWNYRGHSGTAVVEFHKDWPGLHNALSF  191

Query  619  ENAFEAE  639
            E A++A+
Sbjct  192  EKAYQAD  198



>ref|XP_008371804.1| PREDICTED: WEB family protein At4g27595, chloroplastic [Malus 
domestica]
Length=642

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 100/176 (57%), Gaps = 21/176 (12%)
 Frame = +1

Query  157  RSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQKANHVALAK  333
            ++GK+ V+  +G   CPFC  KKK+D+  K+LLQHA+GVGK +++ RS ++KA H+A+ K
Sbjct  32   KNGKHSVRSSDGRYTCPFCPSKKKRDFVLKELLQHASGVGKSTSDKRSTEEKAKHLAVVK  91

Query  334  YLEIDLGDQAEPLPQRAVAPE------DNNLYCWPWTGIVVNVSKDNAN--------GTA  471
            YLE DL   AE  P + VA E       +    WPWTG+VVN+    AN        G+ 
Sbjct  92   YLEKDLA--AEGGPSKTVAEEPPIDCDQDEKLVWPWTGVVVNIPTRRANDGRFVGESGSK  149

Query  472  VEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
            + +E   LKR   +    V    + +  +   +++ + DW GY NA+ FE A++ +
Sbjct  150  LRDE---LKRRG-FNPLRVHPLWNYRGHSGSAIVEFRKDWPGYVNAMSFEKAYDVD  201



>ref|XP_006599359.1| PREDICTED: uncharacterized protein PFB0765w-like [Glycine max]
Length=659

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 98/185 (53%), Gaps = 14/185 (8%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRS-  297
            I+EY++K YEEL +G   VK  +    CP+C  K+K+DY Y +LLQHA+GVG+ S+  + 
Sbjct  38   ISEYEDKSYEELNNGSQNVKTSDETFTCPYCPKKRKRDYLYNELLQHASGVGQNSSQMTK  97

Query  298  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNN--------LYCWPWTGIVVNVSKD  453
             + KANH+AL KYLE DL      +P +   P D N         + WPW GIVVN+   
Sbjct  98   ARDKANHLALVKYLEKDL--MTVDVPSKDSKPVDENEPSVNSDEQFVWPWIGIVVNIPTR  155

Query  454  NANGTAVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFEN  624
              +G  V E    L+   R   +    V    + +  +   +++ K DW G  NA+ FE 
Sbjct  156  WIDGHYVGESGTKLRDEYRSRGFNPVRVTPLWNFRGHSGIALVEFKKDWPGLDNALAFER  215

Query  625  AFEAE  639
             +E +
Sbjct  216  TYELD  220



>gb|KHN27026.1| hypothetical protein glysoja_039182 [Glycine soja]
Length=637

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 67/183 (37%), Positives = 97/183 (53%), Gaps = 14/183 (8%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRS-  297
            I+EY++K YEEL +G   VK  +    CP+C  K+K+DY Y +LLQHA+GVG+ S+  + 
Sbjct  17   ISEYEDKSYEELNNGSQNVKTSDETFTCPYCPKKRKRDYLYNELLQHASGVGQNSSQMTK  76

Query  298  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNN--------LYCWPWTGIVVNVSKD  453
             + KANH+AL KYLE DL      +P +   P D N         + WPW GIVVN+   
Sbjct  77   ARDKANHLALVKYLEKDL--MTVDVPSKDSKPVDENEPSVNSDEQFVWPWIGIVVNIPTR  134

Query  454  NANGTAVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFEN  624
              +G  V E    L+   R   +    V    + +  +   +++ K DW G  NA+ FE 
Sbjct  135  WIDGHYVGESGTKLRDEYRSRGFNPVRVTPLWNFRGHSGIALVEFKKDWPGLDNALAFER  194

Query  625  AFE  633
             +E
Sbjct  195  TYE  197



>gb|KHG15173.1| Forkhead-associated domain-containing 1 [Gossypium arboreum]
Length=645

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 71/194 (37%), Positives = 107/194 (55%), Gaps = 27/194 (14%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  297
            + EY++K YE+L++G YK+K  N    CPFC  KKKQD+ YKDLLQHA+GVGK +++ RS
Sbjct  16   MEEYEDKYYEKLKNGNYKIKVSNEKYTCPFCPKKKKQDFLYKDLLQHASGVGKSNSDKRS  75

Query  298  VKQKANHVALAKYLEIDL--------------GDQAEPLPQRAVAPEDNNLYCWPWTGIV  435
             ++KANH+AL KYLE DL               +  +PL       + +    WPWTG+V
Sbjct  76   AREKANHLALFKYLENDLRGTVGSSSSSAAAAAEVEDPLS----GCDHDEKIVWPWTGVV  131

Query  436  VNVSKD------NANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNG  597
            VN+         +  G+  +  D  ++R   +    V    + +  +   V++ + DW G
Sbjct  132  VNIPTQKLEDGRSVGGSGSKLRDELIRRG--FNPLRVHPLWNYRGHSGTAVVEFRKDWPG  189

Query  598  YKNAILFENAFEAE  639
              NA+ FE A+EA+
Sbjct  190  LHNALSFEKAYEAD  203



>ref|XP_008461675.1| PREDICTED: flagellar attachment zone protein 1 [Cucumis melo]
 ref|XP_008461676.1| PREDICTED: flagellar attachment zone protein 1 [Cucumis melo]
Length=643

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 101/187 (54%), Gaps = 16/187 (9%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  297
            ++E + K Y+EL++GK  VK  +    CP+C  K+K+D+ YKDLLQHA+GVG   +N RS
Sbjct  19   MDERESKSYDELKNGKRIVKLSHETFTCPYCTKKRKRDFLYKDLLQHASGVGNSPSNKRS  78

Query  298  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNVSKDN  456
             K+KANH+AL KYLE DL D   P      + +D  + C       WPW GIVVN+    
Sbjct  79   TKEKANHLALLKYLEKDLADTVGPSKPATASNKDPVMDCNHDEKFVWPWRGIVVNIPTRR  138

Query  457  AN------GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILF  618
             +      G+  +  D   +R   +    V    + +  +   +++   DW G  NAI F
Sbjct  139  TDDGRFVGGSGSKFRDELKER--GFNPTRVTPLWNYRGHSGCAIVEFNKDWPGLHNAISF  196

Query  619  ENAFEAE  639
            E A+EA+
Sbjct  197  ERAYEAD  203



>ref|XP_008343538.1| PREDICTED: myosin-2 heavy chain-like [Malus domestica]
Length=643

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 96/175 (55%), Gaps = 18/175 (10%)
 Frame = +1

Query  157  RSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQKANHVALAK  333
            ++GK+ V+  +G   CPFC  KKK+    KDLLQHA+GVGK  S  RS ++KA H+A+ K
Sbjct  32   KNGKHSVRNSDGTYTCPFCPNKKKRGSVRKDLLQHASGVGKSTSEKRSTEEKAKHLAVVK  91

Query  334  YLEIDLGDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNVSKDNAN-GTAVEE---  480
            YLE DL   AE  P + V  E+  + C       WPWTG+VVN+    AN G  V E   
Sbjct  92   YLENDLA--AEGGPSKRVGEEEPPIDCDHDEKLVWPWTGVVVNIPTRRANDGRYVGESGS  149

Query  481  --EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
               D  ++R   +    V    + +  +   +++ + DW GY NA+ FE A++ +
Sbjct  150  KLRDELIRRG--FNPLRVHPLWNFRGHSGSAIVEFRKDWPGYVNAMSFEKAYDVD  202



>gb|KJB76093.1| hypothetical protein B456_012G071000 [Gossypium raimondii]
Length=645

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 71/194 (37%), Positives = 107/194 (55%), Gaps = 27/194 (14%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  297
            + EY++K YE+L++G YK+K  N    CPFC  KKKQD+ YKDLLQHA+GVGK +++ RS
Sbjct  16   MEEYEDKYYEKLKNGNYKIKISNEKYTCPFCPKKKKQDFLYKDLLQHASGVGKSNSDKRS  75

Query  298  VKQKANHVALAKYLEIDL--------------GDQAEPLPQRAVAPEDNNLYCWPWTGIV  435
             ++KANH+AL KYLE DL               +  +PL       + +    WPWTG+V
Sbjct  76   AREKANHLALFKYLENDLRGTVGSSSSSAAAAAEAEDPLS----GCDHDEKIVWPWTGVV  131

Query  436  VNVSKD------NANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNG  597
            VN+         +  G+  +  D  ++R   +    V    + +  +   V++ + DW G
Sbjct  132  VNIPTQKLEDGRSVGGSGSKLRDELIRRG--FNPLRVHPLWNYRGHSGTAVVEFRKDWPG  189

Query  598  YKNAILFENAFEAE  639
              NA+ FE A+EA+
Sbjct  190  LHNALSFEKAYEAD  203



>ref|XP_008354129.1| PREDICTED: myosin-2 heavy chain-like [Malus domestica]
Length=643

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 96/175 (55%), Gaps = 18/175 (10%)
 Frame = +1

Query  157  RSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQKANHVALAK  333
            ++GK+ V+  +G   CPFC  KKK+    KDLLQHA+GVGK  S  RS ++KA H+A+ K
Sbjct  32   KNGKHSVRNSDGTYTCPFCPNKKKRGSVRKDLLQHASGVGKSTSEKRSTEEKAKHLAVVK  91

Query  334  YLEIDLGDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNVSKDNAN-GTAVEE---  480
            YLE DL   AE  P + V  E+  + C       WPWTG+VVN+    AN G  V E   
Sbjct  92   YLENDLA--AEGGPSKRVGEEEPPIDCDHDEKLVWPWTGVVVNIPTRRANDGRYVGESGS  149

Query  481  --EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
               D  ++R   +    V    + +  +   +++ + DW GY NA+ FE A++ +
Sbjct  150  KLRDELIRRG--FNPLRVHPLWNFRGHSGSAIVEFRKDWPGYVNAMSFEKAYDVD  202



>ref|XP_009343557.1| PREDICTED: myosin heavy chain, cardiac muscle isoform-like [Pyrus 
x bretschneideri]
Length=646

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 67/177 (38%), Positives = 98/177 (55%), Gaps = 17/177 (10%)
 Frame = +1

Query  154  LRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGK-GSANRSVKQKANHVALA  330
            L++GK+ V+  +G   CPFC  KKK+ +  KDLLQHA+GVGK  S  RS ++KA H+A+ 
Sbjct  31   LKNGKHSVRNSDGTYTCPFCPNKKKRGFVRKDLLQHASGVGKRTSEKRSTEEKAKHLAVV  90

Query  331  KYLEIDL-GDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNVSKDNAN-GTAVEE-  480
            KYLE DL  + AE  P + V  E   + C       WPWTG+VVN+    AN G  V E 
Sbjct  91   KYLENDLAAEAAEGGPSKPVGEEKPPIDCDQDEKLVWPWTGVVVNIPTRRANDGRYVGES  150

Query  481  ----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
                 D  ++R   +    V    + +  +   +++ + DW GY NA+ FE A++ +
Sbjct  151  GSKLRDELIRRG--FNPLRVHPLWNFRGHSGSAIVEFRKDWPGYVNAMSFEKAYDVD  205



>ref|XP_006846214.1| hypothetical protein AMTR_s00012p00226630 [Amborella trichopoda]
 gb|ERN07889.1| hypothetical protein AMTR_s00012p00226630 [Amborella trichopoda]
Length=638

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 99/178 (56%), Gaps = 15/178 (8%)
 Frame = +1

Query  145  YEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQKANHVA  324
            YEEL SGK+ ++  NG  RCPFC GKKKQ Y YKDLLQHA+GVG  S++R  ++K  H A
Sbjct  24   YEELTSGKHFLRNSNGTFRCPFCIGKKKQAYAYKDLLQHASGVG-SSSSRKTQEKGKHRA  82

Query  325  LAKYLEIDLGDQAEPL--------PQRAVAPEDNNLYCWPWTGIVVNVSK--DNANGTAV  474
            LAK+L+ ++ D  EP         P    A +D  ++ +PW GI+VN+    D  +   V
Sbjct  83   LAKFLKAEVADDPEPSNGSKEIQKPLSKSASDD--IFVYPWMGIIVNIETGYDQKSSKYV  140

Query  475  EEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAF-EAEC  642
                  LK +F +++  +V    + +      ++    DW G+ NA+ FE  F E +C
Sbjct  141  GLGANQLKAQFERFQPVKVHPIWNYQGHLGIAIVDFHKDWTGHHNAMSFEKYFAEIQC  198



>gb|EYU18986.1| hypothetical protein MIMGU_mgv1a011844mg [Erythranthe guttata]
Length=269

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 94/179 (53%), Gaps = 18/179 (10%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            + EY ++ YE+L+    K+K  +   RCP+C GKKK  Y +KD+LQHA+ V KGS N+ +
Sbjct  16   MEEYVDRCYEQLKVETQKLKFSDTLYRCPYCPGKKKIVYPFKDILQHASDVAKGSQNKDI  75

Query  301  KQKANHVALAKYL--EIDLGDQAEPLPQRAVAPEDN-----NLYCWPWTGIVVNVSKDNA  459
            K K  H+ L KYL  E+D  D +  L    +  +       +L+ WPW GIV N      
Sbjct  76   KHKGKHLGLVKYLKSEVDHEDLSSELTALTLVDQQEGNGVKDLFVWPWMGIVANFE----  131

Query  460  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
              +  + +D   KR    +A  V+      S +   V++ K DW+G+  AI+FE  FE 
Sbjct  132  --SVSKLKDVLAKR--GVDAVRVRQLS---SGSKYAVVEFKKDWSGFYGAIMFEKGFEV  183



>ref|XP_011027214.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Populus euphratica]
Length=749

 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 106/184 (58%), Gaps = 11/184 (6%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFC-AGkkkqdykykdllqHATGVGKG-SANR  294
            ++ Y+++ YEEL++G ++VK  +    CP+C   K+K+DY Y+DLLQHATGVGK  S  R
Sbjct  127  MDNYEDRSYEELKNGNHQVKISDETFACPYCPTKKRKRDYVYQDLLQHATGVGKSLSEKR  186

Query  295  SVKQKANHVALAKYLEIDL---GDQAEPL--PQRAVAPEDNNLYCWPWTGIVVNVSKDNA  459
            + K+KA+H+AL KYLE DL   G  ++P    +   +   N+ + WPWTGI VN+    A
Sbjct  187  TAKEKADHLALVKYLEKDLAAAGSSSKPAGKTENPSSCSQNDKFVWPWTGIAVNLPTRRA  246

Query  460  -NGTAVEEEDYWLKRFSK---YEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENA  627
             +G  V E     +   K   ++   V    + +  +   +++   DW G  NAI FE A
Sbjct  247  EDGRFVGESGSKFRDELKSRGFKPTRVHPLWNFRGHSGTAIVEFNKDWPGLHNAISFEKA  306

Query  628  FEAE  639
            +EA+
Sbjct  307  YEAD  310


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRS  297
            ++EY+ + YEEL+ GK +VK  +    CPFC  KK+Q   YKDLLQHA+GVGK  S  RS
Sbjct  18   MDEYENEAYEELKDGKLRVKISDETFACPFCPQKKRQACLYKDLLQHASGVGKSRSEKRS  77

Query  298  VKQKANHVALAKYLEIDL  351
             K+KANH+AL KYLE DL
Sbjct  78   TKEKANHLALVKYLEKDL  95



>gb|EEC71144.1| hypothetical protein OsI_02969 [Oryza sativa Indica Group]
Length=629

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 100/179 (56%), Gaps = 8/179 (4%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I+EY +K Y  L +G++KVK       CPFC+GKKK+D+   +L+QHA+GVG  S NR  
Sbjct  16   IDEYADKFYARLVAGEFKVKDGQ-SYSCPFCSGKKKKDFNINNLIQHASGVGAAS-NRQA  73

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVA-----PEDNNLYCWPWTGIVVNVSKDNANG  465
            K KA H ALAK+L+  L   +    Q AV      P  +  + WPW G++VNV  +  +G
Sbjct  74   KDKATHRALAKHLKNGLTKSSGQQSQTAVVEPQPLPNRDEKFVWPWMGVLVNVPTEWKDG  133

Query  466  TAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
              +      LK + S++   ++    + +  +   +++   DW+G++NA+ FE+ F  E
Sbjct  134  RQIGRSGNHLKEQLSRFCPLKIIPLWNFRGHSGNAIVEFGKDWHGFRNALAFEDYFGKE  192



>ref|NP_001043655.1| Os01g0633200 [Oryza sativa Japonica Group]
 gb|AAF21887.1|AF101045_2 putative transcription factor X1 [Oryza sativa Japonica Group]
 dbj|BAB90725.1| putative X1 [Oryza sativa Japonica Group]
 dbj|BAF05569.1| Os01g0633200 [Oryza sativa Japonica Group]
 dbj|BAG91243.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55041.1| hypothetical protein OsJ_02725 [Oryza sativa Japonica Group]
Length=629

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 100/179 (56%), Gaps = 8/179 (4%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I+EY +K Y  L +G++KVK       CPFC+GKKK+D+   +L+QHA+GVG  S NR  
Sbjct  16   IDEYADKFYARLVAGEFKVKDGQ-SYSCPFCSGKKKKDFNINNLIQHASGVGAAS-NRQA  73

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVA-----PEDNNLYCWPWTGIVVNVSKDNANG  465
            K KA H ALAK+L+  L   +    Q AV      P  +  + WPW G++VNV  +  +G
Sbjct  74   KDKATHRALAKHLKNGLTKSSGQQSQTAVVEPQPLPNRDEKFVWPWMGVLVNVPTEWKDG  133

Query  466  TAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
              +      LK + S++   ++    + +  +   +++   DW+G++NA+ FE+ F  E
Sbjct  134  RQIGRSGNHLKEQLSRFCPLKIIPLWNFRGHSGNAIVEFGKDWHGFRNALAFEDYFGKE  192



>gb|KJB67636.1| hypothetical protein B456_010G201400 [Gossypium raimondii]
Length=514

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 105/188 (56%), Gaps = 20/188 (11%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVG-KGSANRS  297
            + EY++K YE+L++GKY V   +    CP+C    KQ Y+YKDLLQHA+GVG   SA R 
Sbjct  16   MEEYEDKSYEKLKNGKYTVMVSDETYTCPYCPKSNKQKYRYKDLLQHASGVGNSSSAKRK  75

Query  298  VKQKANHVALAKYLEIDLGD-QAEPLPQRAVAPEDNNLYC-------WPWTGIVVNV-SK  450
             + KANH+ALA+YLE DL    + P P   V  ED    C       WP TGIVVN+ ++
Sbjct  76   PRVKANHLALARYLETDLVPVVSSPKP---VVEEDPPSGCDHDEKIVWPCTGIVVNIPTR  132

Query  451  DNANGTAVEE-----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAIL  615
             +A+G +V E      D  ++R   +    V    + +  +   V++ +  W G  NA+ 
Sbjct  133  RSADGRSVGESGSKLRDELIRR--GFNPVRVHPLWNFRGHSGTAVVEFRKGWPGLHNALS  190

Query  616  FENAFEAE  639
            FE A+EA+
Sbjct  191  FEKAYEAD  198



>ref|XP_008233634.1| PREDICTED: LOW QUALITY PROTEIN: CAP-Gly domain-containing linker 
protein 1 [Prunus mume]
Length=633

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 90/176 (51%), Gaps = 26/176 (15%)
 Frame = +1

Query  154  LRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQKANHVALA  330
            L++GK+ V+  +G   CPFC          K  LQHA+GV K  S  RS ++KA H ALA
Sbjct  31   LKNGKHNVRSSDGTYICPFCP--------KKSXLQHASGVEKSNSEKRSAEEKAKHSALA  82

Query  331  KYLEIDLGDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNVSKDNA-NGTAVEE--  480
            KYLE DL    E  P + V  ED  + C       WPWTG+VVN+    A +G  V E  
Sbjct  83   KYLEKDLA--TEGGPSKPVGEEDPPVDCDHDEKLVWPWTGVVVNIPTRRADDGRYVGESG  140

Query  481  ---EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
                D  ++R   +    V    + +  +   V++ + DW GY NA+ FE A+EA+
Sbjct  141  SKLRDDLIRR--GFNPTRVHPLWNFRGHSGSAVVEFRKDWPGYVNAMSFERAYEAD  194



>ref|XP_006292435.1| hypothetical protein CARUB_v10018651mg [Capsella rubella]
 gb|EOA25333.1| hypothetical protein CARUB_v10018651mg [Capsella rubella]
Length=647

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 69/189 (37%), Positives = 101/189 (53%), Gaps = 18/189 (10%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRS  297
            ++EY +K Y  L+ GK KVK       CP+C  KKK  ++YKDLLQHA+GVG   S  RS
Sbjct  21   MDEYGDKMYLNLKGGKVKVKLSPQAFVCPYCPNKKKPSFQYKDLLQHASGVGNSNSEKRS  80

Query  298  VKQKANHVALAKYLEIDLGD---QAEPLPQRAVAP------EDNNLYCWPWTGIVVNVSK  450
             K+KA+H+AL KYL+ DL D    AEP  +R          + +    WPW GIVVN+  
Sbjct  81   AKEKASHLALVKYLQQDLADSASDAEPSSKRQKNGNPIQDCDHDEKLVWPWKGIVVNIPT  140

Query  451  DNA-NGTAVEE-----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAI  612
              A +G +  E      D +++R   +    V+   +    +   +++   DWNG  NA+
Sbjct  141  TKALDGRSAGESGSKLRDGYIQRG--FNPTRVRPLWNHWGHSGTAIVEFNKDWNGLHNAL  198

Query  613  LFENAFEAE  639
            LF+ A+  +
Sbjct  199  LFDKAYRVD  207



>ref|XP_002456013.1| hypothetical protein SORBIDRAFT_03g028860 [Sorghum bicolor]
 gb|EES01133.1| hypothetical protein SORBIDRAFT_03g028860 [Sorghum bicolor]
Length=629

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 94/178 (53%), Gaps = 7/178 (4%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I++Y+ K Y  L SG  KVK       C FC+ KKK +Y    L+QHA+GV   + NR  
Sbjct  16   IDDYEGKVYASLMSGGLKVKNNGENYSCLFCSSKKKNNYSKSSLVQHASGVS-AAPNRKA  74

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRA-VAPE----DNNLYCWPWTGIVVNVSKDNANG  465
            K+KA H AL KYL+ DL   +EP P    V P+     +  + WPW GI+VNV  +  +G
Sbjct  75   KEKAAHRALFKYLKNDLAKSSEPQPLVIPVEPQPLQNRDEKFVWPWMGILVNVPTEWKDG  134

Query  466  TAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
              + E    LK + S +   +V      +  T   +++   DWNG++NA  FE+ F A
Sbjct  135  RQIGESGNRLKEQLSHFCPLKVIPLWTFRGHTGNAIVEFGKDWNGFRNARTFESHFAA  192



>gb|AGT17258.1| X1 protein [Saccharum hybrid cultivar R570]
 gb|AGT17260.1| X1 protein [Saccharum hybrid cultivar R570]
Length=629

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 93/178 (52%), Gaps = 7/178 (4%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I++Y+ K Y  L SG  KVK       C FC+ KKK +Y    L+QHA+GV   + NR  
Sbjct  16   IDDYEGKIYARLMSGDLKVKNNGENYSCLFCSSKKKNNYSKSSLVQHASGVS-AAPNRKA  74

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRA-VAPE----DNNLYCWPWTGIVVNVSKDNANG  465
            K+KA H AL KYL+ DL    EP P    V P+     +  + WPW GI+VNV  +  +G
Sbjct  75   KEKAAHRALFKYLKNDLTKSPEPRPHVIPVEPQPLQNRDEKFVWPWMGILVNVPTEWKDG  134

Query  466  TAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
              + E    LK + S +   +V      +  T   +++   DWNG++NA  FE+ F A
Sbjct  135  RQIGESGNRLKEQLSHFCPLKVIPLWTFRGHTGNAIVEFGKDWNGFRNARTFESHFAA  192



>ref|XP_002316281.2| XH/XS domain-containing family protein [Populus trichocarpa]
 gb|EEF02452.2| XH/XS domain-containing family protein [Populus trichocarpa]
Length=749

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 102/180 (57%), Gaps = 11/180 (6%)
 Frame = +1

Query  133  KEKPYEELRSGKYKVKGPNGCLRCPFC-AGkkkqdykykdllqHATGVGKG-SANRSVKQ  306
            ++K YEEL++G ++VK  +    CP+C   K+K+DY Y+DLLQHATGVGK  S  R+ K+
Sbjct  131  EDKSYEELKNGNHQVKISDETFTCPYCPTKKRKRDYAYQDLLQHATGVGKSLSEKRTAKE  190

Query  307  KANHVALAKYLEIDL---GDQAEPL--PQRAVAPEDNNLYCWPWTGIVVNVSKDNA-NGT  468
            KA+H+AL KYLE DL   G  ++P    +   +   N+ + WPWTGI VN+    A +G 
Sbjct  191  KADHLALVKYLEKDLAAAGSSSKPAGKTENLSSCSQNDKFVWPWTGIAVNLPTRRAEDGR  250

Query  469  AVEEEDYWLKRFSK---YEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
             V E     +   K   +    V    + +  +   V++   DW G  NAI FE A+EA+
Sbjct  251  FVGESGSKFRDELKSRGFNPTRVHPLWNFRGHSGTAVVEFNKDWPGLHNAISFEKAYEAD  310


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRS  297
            ++EY+ + YEEL+ GK +VK  +    CPFC  KK+Q Y YKDLLQHA+GVGK  S  RS
Sbjct  18   MDEYENEAYEELKDGKLRVKISDETFACPFCPQKKRQAYLYKDLLQHASGVGKSRSQKRS  77

Query  298  VKQKANHVALAKYLEIDL  351
             K+KANH+AL KYLE DL
Sbjct  78   TKEKANHLALVKYLEKDL  95



>gb|AGT16789.1| hypothetical protein SHCRBa_009_B01_R_10 [Saccharum hybrid cultivar 
R570]
Length=629

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 93/178 (52%), Gaps = 7/178 (4%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I++Y+ K Y  L SG  KVK       C FC+ KKK +Y    L+QHA+GV   + NR  
Sbjct  16   IDDYEGKIYARLMSGDLKVKKNGENYSCLFCSSKKKNNYSKSSLVQHASGVS-AAPNRKA  74

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRA-VAPE----DNNLYCWPWTGIVVNVSKDNANG  465
            K+KA H AL KYL+ DL    EP P    V P+     +  + WPW G++VNV  +  +G
Sbjct  75   KEKAAHRALFKYLKNDLAKSPEPRPHVIPVEPQPLQNRDEKFVWPWMGVLVNVPTEWKDG  134

Query  466  TAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
              + E    LK + S +   +V      +  T   +++   DWNG++NA  FE+ F A
Sbjct  135  RQIGESGNRLKEQLSHFCPLKVIPLWTFRGHTGNAIVEFGKDWNGFRNARTFESHFAA  192



>ref|XP_009799105.1| PREDICTED: golgin candidate 4 [Nicotiana sylvestris]
 ref|XP_009799106.1| PREDICTED: golgin candidate 4 [Nicotiana sylvestris]
Length=639

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 109/182 (60%), Gaps = 17/182 (9%)
 Frame = +1

Query  145  YEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQKANHV  321
            YE+L+ G + +K  +    CP+C  K+K+D+ YK+L+QHA+GVG G++N R+ + KANH+
Sbjct  24   YEDLKRGNHSLKISDVAYTCPYCPKKRKRDFGYKELVQHASGVGSGNSNKRTARDKANHL  83

Query  322  ALAKYLEIDL---GD--------QAEPLPQ-RAVAPEDNN-LYCWPWTGIVVNVSKDNAN  462
            ALAKYLE D+   GD         A+P PQ   +A  D + ++ WPW GIVVN+  +  +
Sbjct  84   ALAKYLENDVVVAGDSSNDSSKPDAKPDPQADPLADHDRDEMFVWPWIGIVVNILTEYKD  143

Query  463  GTAVEEEDYWLK-RFSK--YEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  633
            G  V E    L+ + ++  +    V+   + +  +   +++   DW+G+ NA+ FE A+E
Sbjct  144  GRYVGESGSKLRDQLARRGFNPTRVRPLWNYQGHSGTALVEFNKDWSGFGNAMSFEKAYE  203

Query  634  AE  639
            A+
Sbjct  204  AD  205



>gb|KJB67635.1| hypothetical protein B456_010G201400 [Gossypium raimondii]
Length=640

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 105/188 (56%), Gaps = 20/188 (11%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVG-KGSANRS  297
            + EY++K YE+L++GKY V   +    CP+C    KQ Y+YKDLLQHA+GVG   SA R 
Sbjct  16   MEEYEDKSYEKLKNGKYTVMVSDETYTCPYCPKSNKQKYRYKDLLQHASGVGNSSSAKRK  75

Query  298  VKQKANHVALAKYLEIDLGD-QAEPLPQRAVAPEDNNLYC-------WPWTGIVVNV-SK  450
             + KANH+ALA+YLE DL    + P P   V  ED    C       WP TGIVVN+ ++
Sbjct  76   PRVKANHLALARYLETDLVPVVSSPKP---VVEEDPPSGCDHDEKIVWPCTGIVVNIPTR  132

Query  451  DNANGTAVEE-----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAIL  615
             +A+G +V E      D  ++R   +    V    + +  +   V++ +  W G  NA+ 
Sbjct  133  RSADGRSVGESGSKLRDELIRRG--FNPVRVHPLWNFRGHSGTAVVEFRKGWPGLHNALS  190

Query  616  FENAFEAE  639
            FE A+EA+
Sbjct  191  FEKAYEAD  198



>ref|XP_006404228.1| hypothetical protein EUTSA_v10010188mg [Eutrema salsugineum]
 ref|XP_006404229.1| hypothetical protein EUTSA_v10010188mg [Eutrema salsugineum]
 ref|XP_006404230.1| hypothetical protein EUTSA_v10010188mg [Eutrema salsugineum]
 gb|ESQ45681.1| hypothetical protein EUTSA_v10010188mg [Eutrema salsugineum]
 gb|ESQ45682.1| hypothetical protein EUTSA_v10010188mg [Eutrema salsugineum]
 gb|ESQ45683.1| hypothetical protein EUTSA_v10010188mg [Eutrema salsugineum]
Length=646

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 99/187 (53%), Gaps = 20/187 (11%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRS  297
            + EY++K Y  L+ GK KVK       CP+C  KKK  ++YKDLLQHA+GVG   S  RS
Sbjct  21   MEEYEDKIYLNLKGGKLKVKLSPQAFVCPYCPNKKKPSFQYKDLLQHASGVGNSNSEKRS  80

Query  298  VKQKANHVALAKYLEIDLGD---QAEPLPQRAVAP------EDNNLYCWPWTGIVVNVSK  450
             K+KA+H+AL KYL+ DL D   +AEP  +R          + +    +PW G+VVN+  
Sbjct  81   AKEKASHLALVKYLQQDLADSAAEAEPSSKRKKTENAIQDCDQDEKLVYPWKGVVVNIPT  140

Query  451  DNA-NGTAVEE------EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNA  609
              A NG    E      ++Y LK F+      V+        +   +++   DWNG  N 
Sbjct  141  TKAPNGRPAGESGSNLRDEYTLKGFN---PTRVRTLWSHWGFSGTAIVEFNKDWNGLHNG  197

Query  610  ILFENAF  630
            +LF+ A+
Sbjct  198  LLFDKAY  204



>gb|AGT16810.1| transcription factor [Saccharum hybrid cultivar R570]
Length=629

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/178 (36%), Positives = 93/178 (52%), Gaps = 7/178 (4%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I++Y+ K Y  L SG  KVK       C FC+ KKK +Y    L+QHA+GV   + NR  
Sbjct  16   IDDYEGKIYARLMSGDLKVKKNGENYSCLFCSSKKKNNYSKSSLVQHASGVS-AAPNRKA  74

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRA-VAPE----DNNLYCWPWTGIVVNVSKDNANG  465
            K+KA H +L KYL+ DL    EP P    V P+     +  + WPW G++VNV  +  +G
Sbjct  75   KEKAAHRSLFKYLKNDLAKSPEPRPHVIPVEPQPLQNRDEKFVWPWMGVLVNVPTEWKDG  134

Query  466  TAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
              + E    LK + S +   +V      +  T   +++   DWNG++NA  FE+ F A
Sbjct  135  RQIGESGNRLKEQLSHFCPLKVIPLWTFRGHTGNAIVEFGKDWNGFRNARTFESHFAA  192



>gb|KHG06632.1| KilA-N domain-containing protein [Gossypium arboreum]
Length=640

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 105/189 (56%), Gaps = 22/189 (12%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVG-KGSANRS  297
            + EY++K YE+L++GKY V   +    CP+C    KQ Y+YKDLLQHA+GVG   SA R 
Sbjct  16   MEEYEDKSYEKLKNGKYTVMVSDETYTCPYCPKSNKQKYRYKDLLQHASGVGNSSSAKRK  75

Query  298  VKQKANHVALAKYLEIDLGDQAEPL--PQRAVAPEDNNLYC-------WPWTGIVVNV-S  447
             + KANH+ALA+YLE D+     P+    + V  ED    C       WP TGIVVN+ +
Sbjct  76   PRVKANHLALARYLETDVV----PVVSSSKPVVEEDPPSGCDHDEKIVWPCTGIVVNIPT  131

Query  448  KDNANGTAVEE-----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAI  612
            K +A+G +V E      D  ++R   +    V    + +  +   V++ +  W G  NA+
Sbjct  132  KRSADGRSVGESGSKLRDELIRRG--FNPVRVHPLWNFRGHSGTAVVEFRKGWPGLHNAL  189

Query  613  LFENAFEAE  639
             FE A+EA+
Sbjct  190  SFEKAYEAD  198



>ref|XP_010520104.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like [Tarenaya hassleriana]
Length=620

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 95/175 (54%), Gaps = 10/175 (6%)
 Frame = +1

Query  139  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQKAN  315
            K Y  L+ G+ +VK  +    CPFC   K++   YKDLLQHA+GVG  S+  RS KQKA+
Sbjct  11   KLYNNLKRGRLEVKVSSKTFICPFCPMNKRRVCLYKDLLQHASGVGNSSSKKRSAKQKAS  70

Query  316  HVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYCWPWTGIVVNV----SKDN--ANGTAVE  477
            H AL KYL+ DL D A  L       ED   + WPW GIV N+    ++D   A  +  +
Sbjct  71   HRALFKYLQNDLADSA-TLSNPHEFSEDGERFVWPWKGIVANIPISMTQDGRWAGESGSK  129

Query  478  EEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAEC  642
              D +++R   +    V+   DD   +   +++  + WNG  +A+ F+ A++A+ 
Sbjct  130  LRDEFIQR--GFSPVRVRTLWDDYGHSGTAIVEFDNCWNGLNHALQFDKAYQADA  182



>ref|XP_006595902.1| PREDICTED: uncharacterized protein LOC100790814 isoform X3 [Glycine 
max]
Length=1073

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 96/180 (53%), Gaps = 11/180 (6%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdyky-kdllqHATGVGKGSAN-RSVK  303
            Y  K YE L+ G + VK       CP+C  KK++     +++L+HA+GVG+ S+  RS  
Sbjct  455  YVHKSYEALKKGSHNVKTSEMTFSCPYCPNKKRKRDYVYREILEHASGVGQSSSEKRSAI  514

Query  304  QKANHVALAKYLEIDLGDQAEPLPQRAV--APEDN--NLYCWPWTGIVVNV-SKDNANGT  468
            +KANH+AL KYLE DL     P P+ A   +P  N    + WPWTGIVVN+ ++    G 
Sbjct  515  EKANHLALMKYLEKDLMIVDGP-PKTADEGSPPFNFEKQFVWPWTGIVVNIPTRLTEEGC  573

Query  469  AVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
             V E    L+   R   +  Q V+I  +    +   V++   +W G  NA+ FE A+E +
Sbjct  574  CVGESGSKLRDEYRSRGFNPQRVRILSNFCGHSGTAVVEFNKNWTGLDNALAFERAYELD  633


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 57/91 (63%), Gaps = 2/91 (2%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdy-kykdllqHATGVGKG-SANR  294
            I  Y EK YEEL+ G + VK  +   RCP+C+ KK      Y+++L+HA+GVG+  S  R
Sbjct  332  IGRYAEKFYEELKRGIHNVKTSDETFRCPYCSNKKINRDYVYREILEHASGVGQSKSQKR  391

Query  295  SVKQKANHVALAKYLEIDLGDQAEPLPQRAV  387
            S  +KANH+AL KYL+ DL +   P P + +
Sbjct  392  SFIEKANHLALVKYLKKDLMNVGAPCPSKPM  422


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSA-NRSVKQ  306
            Y EK Y+EL+ G + V+  +  L CP+C  K+KQDY Y++LL+HA+GVG+ S+  R V++
Sbjct  171  YVEKFYKELKKGNHMVQTSDLTLCCPYCPKKRKQDYVYRELLEHASGVGQSSSEKRHVRE  230

Query  307  KANHVALAKYLEIDL  351
            KA H+AL KYL+ DL
Sbjct  231  KATHLALMKYLKNDL  245


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 52/75 (69%), Gaps = 2/75 (3%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQ  306
            Y +  YEEL+ G + VK  +    CP+C  ++KQDY Y++LL+HA  VG+ S+  RS ++
Sbjct  55   YVDTSYEELKKGSHSVKTSDVTFICPYCP-RRKQDYLYRELLEHAYMVGRSSSEKRSARE  113

Query  307  KANHVALAKYLEIDL  351
            +ANH+AL KYLE DL
Sbjct  114  RANHLALVKYLENDL  128



>gb|KHN20923.1| hypothetical protein glysoja_009231 [Glycine soja]
Length=1080

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 96/180 (53%), Gaps = 11/180 (6%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdyky-kdllqHATGVGKGSAN-RSVK  303
            Y  K YE L+ G + VK       CP+C  KK++     +++L+HA+GVG+ S+  RS  
Sbjct  536  YVHKSYEALKKGSHNVKTSEMTFSCPYCPNKKRKRDYVYREILEHASGVGQSSSEKRSAI  595

Query  304  QKANHVALAKYLEIDLGDQAEPLPQRAV--APEDN--NLYCWPWTGIVVNV-SKDNANGT  468
            +KANH+AL KYLE DL     P P+ A   +P  N    + WPWTGIVVN+ ++    G 
Sbjct  596  EKANHLALMKYLEKDLMIVDGP-PKTADEGSPPFNFEKQFVWPWTGIVVNIPTRLTEEGC  654

Query  469  AVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
             V E    L+   R   +  Q V+I  +    +   V++   +W G  NA+ FE A+E +
Sbjct  655  CVGESGSKLRDEYRSRGFNPQRVRILSNFCGHSGTAVVEFNKNWTGLDNALAFERAYELD  714


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 57/91 (63%), Gaps = 2/91 (2%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdy-kykdllqHATGVGKG-SANR  294
            I  Y EK YEEL+ G + VK  +   RCP+C+ KK      Y+++L+HA+GVG+  S  R
Sbjct  413  IGRYAEKFYEELKRGIHNVKTSDETFRCPYCSNKKINRDYVYREILEHASGVGQSKSQKR  472

Query  295  SVKQKANHVALAKYLEIDLGDQAEPLPQRAV  387
            S  +KANH+AL KYL+ DL +   P P + +
Sbjct  473  SFIEKANHLALVKYLKKDLMNVGAPCPSKPM  503


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 54/76 (71%), Gaps = 2/76 (3%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQ  306
            Y +  Y+EL+ G YKV   +    CP+C  ++KQDYKY++LL HA+GVG+ S+  RS K+
Sbjct  20   YVDISYQELKKGSYKVMRSDETFICPYCP-ERKQDYKYRELLNHASGVGRSSSEKRSAKE  78

Query  307  KANHVALAKYLEIDLG  354
            KANH+AL KYLE DL 
Sbjct  79   KANHLALVKYLEKDLA  94


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSA-NRSVKQ  306
            Y EK Y+EL+ G + V+  +  L CP+C  K+KQDY Y++LL+HA+GVG+ S+  R V++
Sbjct  252  YVEKFYKELKKGNHMVQTSDLTLCCPYCPKKRKQDYVYRELLEHASGVGQSSSEKRHVRE  311

Query  307  KANHVALAKYLEIDL  351
            KA H+AL KYL+ DL
Sbjct  312  KATHLALMKYLKNDL  326


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 52/75 (69%), Gaps = 2/75 (3%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQ  306
            Y +  YEEL+ G + VK  +    CP+C  ++KQDY Y++LL+HA  VG+ S+  RS ++
Sbjct  136  YVDTSYEELKKGSHSVKTSDVTFICPYCP-RRKQDYLYRELLEHAYMVGRSSSEKRSARE  194

Query  307  KANHVALAKYLEIDL  351
            +ANH+AL KYLE DL
Sbjct  195  RANHLALVKYLENDL  209



>ref|XP_010426360.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Camelina sativa]
 ref|XP_010426361.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Camelina sativa]
Length=648

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 104/191 (54%), Gaps = 21/191 (11%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRS  297
            ++EY +K Y  L+ GK KVK       CP+C  KKK  ++YKDLLQHA+GVG   S  RS
Sbjct  21   MDEYGDKMYLNLKGGKLKVKLSPQAFLCPYCPNKKKPSFQYKDLLQHASGVGNSNSEKRS  80

Query  298  VKQKANHVALAKYLEIDLGDQ----AEPLPQR-----AVA--PEDNNLYCWPWTGIVVNV  444
             K+KA+H+AL KYL+ DL D     AEP  +R     A+    +D  L C PW GIVVN+
Sbjct  81   AKEKASHLALVKYLQQDLADSASDAAEPSAKRQKNGNAIQDCDQDEKLVC-PWKGIVVNI  139

Query  445  -SKDNANGTAVEE-----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKN  606
             +    +G +  E      D +++R   +    V+   +    +   +++   DWNG  N
Sbjct  140  PTTKGVDGRSAGESGSKLRDEYIQRG--FNPTRVRPLWNYWGHSGTAIVEFNKDWNGLHN  197

Query  607  AILFENAFEAE  639
            A+LF+ A+  +
Sbjct  198  ALLFDKAYRVD  208



>ref|XP_003545257.1| PREDICTED: uncharacterized protein LOC100790814 isoform X1 [Glycine 
max]
 ref|XP_006595901.1| PREDICTED: uncharacterized protein LOC100790814 isoform X2 [Glycine 
max]
Length=1154

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 96/180 (53%), Gaps = 11/180 (6%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdyky-kdllqHATGVGKGSAN-RSVK  303
            Y  K YE L+ G + VK       CP+C  KK++     +++L+HA+GVG+ S+  RS  
Sbjct  536  YVHKSYEALKKGSHNVKTSEMTFSCPYCPNKKRKRDYVYREILEHASGVGQSSSEKRSAI  595

Query  304  QKANHVALAKYLEIDLGDQAEPLPQRAV--APEDN--NLYCWPWTGIVVNV-SKDNANGT  468
            +KANH+AL KYLE DL     P P+ A   +P  N    + WPWTGIVVN+ ++    G 
Sbjct  596  EKANHLALMKYLEKDLMIVDGP-PKTADEGSPPFNFEKQFVWPWTGIVVNIPTRLTEEGC  654

Query  469  AVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
             V E    L+   R   +  Q V+I  +    +   V++   +W G  NA+ FE A+E +
Sbjct  655  CVGESGSKLRDEYRSRGFNPQRVRILSNFCGHSGTAVVEFNKNWTGLDNALAFERAYELD  714


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 57/91 (63%), Gaps = 2/91 (2%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdy-kykdllqHATGVGKG-SANR  294
            I  Y EK YEEL+ G + VK  +   RCP+C+ KK      Y+++L+HA+GVG+  S  R
Sbjct  413  IGRYAEKFYEELKRGIHNVKTSDETFRCPYCSNKKINRDYVYREILEHASGVGQSKSQKR  472

Query  295  SVKQKANHVALAKYLEIDLGDQAEPLPQRAV  387
            S  +KANH+AL KYL+ DL +   P P + +
Sbjct  473  SFIEKANHLALVKYLKKDLMNVGAPCPSKPM  503


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 54/76 (71%), Gaps = 2/76 (3%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQ  306
            Y +  Y+EL+ G YKV   +    CP+C  ++KQDYKY++LL HA+GVG+ S+  RS K+
Sbjct  20   YVDISYQELKKGSYKVMRSDETFICPYCP-ERKQDYKYRELLNHASGVGRSSSEKRSAKE  78

Query  307  KANHVALAKYLEIDLG  354
            KANH+AL KYLE DL 
Sbjct  79   KANHLALVKYLEKDLA  94


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSA-NRSVKQ  306
            Y EK Y+EL+ G + V+  +  L CP+C  K+KQDY Y++LL+HA+GVG+ S+  R V++
Sbjct  252  YVEKFYKELKKGNHMVQTSDLTLCCPYCPKKRKQDYVYRELLEHASGVGQSSSEKRHVRE  311

Query  307  KANHVALAKYLEIDL  351
            KA H+AL KYL+ DL
Sbjct  312  KATHLALMKYLKNDL  326


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 52/75 (69%), Gaps = 2/75 (3%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQ  306
            Y +  YEEL+ G + VK  +    CP+C  ++KQDY Y++LL+HA  VG+ S+  RS ++
Sbjct  136  YVDTSYEELKKGSHSVKTSDVTFICPYCP-RRKQDYLYRELLEHAYMVGRSSSEKRSARE  194

Query  307  KANHVALAKYLEIDL  351
            +ANH+AL KYLE DL
Sbjct  195  RANHLALVKYLENDL  209



>ref|XP_009589398.1| PREDICTED: golgin candidate 4 [Nicotiana tomentosiformis]
 ref|XP_009589399.1| PREDICTED: golgin candidate 4 [Nicotiana tomentosiformis]
Length=638

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 108/178 (61%), Gaps = 13/178 (7%)
 Frame = +1

Query  145  YEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQKANHV  321
            YE+L+ G + +K  +    CP+C  K+K+D+ YK+L+QHA+GVG  ++N R+ + KANH+
Sbjct  24   YEDLKRGNHSLKISDVAYTCPYCPKKRKRDFGYKELVQHASGVGSCNSNKRTARDKANHL  83

Query  322  ALAKYLEIDL---GD----QAEPLPQ-RAVAPEDNN-LYCWPWTGIVVNVSKDNANGTAV  474
            ALAKYLE D+   GD     A+P PQ   +A  D + ++ WPW GIVVN+  +  +G  V
Sbjct  84   ALAKYLENDVAVAGDSSKPDAKPDPQADPLADHDRDEMFVWPWIGIVVNILTEYKDGRYV  143

Query  475  EEEDYWLK-RFSK--YEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
             E    L+ + ++  +    V+   + +  +   +++   DW+G+ NA+ FE A+EA+
Sbjct  144  GESGSKLRDQLARRGFNPTRVRPLWNYQGHSGTALVEFNKDWSGFGNAMSFEKAYEAD  201



>ref|XP_009150181.1| PREDICTED: uncharacterized protein LOC103873521 [Brassica rapa]
Length=643

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 101/186 (54%), Gaps = 19/186 (10%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQ  306
            + +K Y  L+SGK KVK      +CP+C  KKK  ++YKDLLQHA+GVG   S  R+ K 
Sbjct  24   HADKIYPTLKSGKLKVKLSPQAFKCPYCPNKKKPSFQYKDLLQHASGVGNSNSEKRTSKD  83

Query  307  KANHVALAKYLEIDLGDQAEPLP----QRAVAP-----EDNNLYCWPWTGIVVNV-SKDN  456
            KA+H+AL KYL+ DL D A   P    Q+   P     +D  L C PW G+VVN+ ++  
Sbjct  84   KASHLALVKYLQQDLSDSAAAEPSSKRQKTGDPIQDCDQDEKLVC-PWKGVVVNIPTRKT  142

Query  457  ANGTAVEE-----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFE  621
             +G +  E      D +++R   +    V+   +    +   ++    DWNG  NA+LF+
Sbjct  143  QDGRSAGESGSKLRDEYIQRG--FNPTRVRPLWNHWGFSGTAIVDFNRDWNGLHNALLFD  200

Query  622  NAFEAE  639
             A++ +
Sbjct  201  KAYQVD  206



>ref|XP_004503147.1| PREDICTED: myosin-11-like isoform X1 [Cicer arietinum]
 ref|XP_004503148.1| PREDICTED: myosin-11-like isoform X2 [Cicer arietinum]
 ref|XP_004503149.1| PREDICTED: myosin-11-like isoform X3 [Cicer arietinum]
Length=635

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 61/184 (33%), Positives = 102/184 (55%), Gaps = 18/184 (10%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  297
            I++Y++K YEEL++G   VK  +    CP+C  K+K+DY Y +LLQHA+GVG+ S+  R 
Sbjct  16   ISDYEDKCYEELKNGSQNVKTSDEKFTCPYCPKKRKRDYLYNELLQHASGVGQSSSQKRK  75

Query  298  VKQKANHVALAKYLEIDLG-----DQAEPLPQRAVAPEDNNLYCWPWTGIVVNVSKDN--  456
             ++KA H+AL KYL+ DL       + EP  +   A + +  + WPW GI+VN+      
Sbjct  76   AREKATHLALVKYLQKDLMSVDAPSEPEPADKTDNAIDSDEQFVWPWIGIIVNIPTSRAA  135

Query  457  ------ANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILF  618
                  A+G+ + +E Y  + F+ +    +  F   +  +   +++   +W G  NA+ F
Sbjct  136  DGRSVGASGSKLRDE-YRRRGFNPFRVNPLWNF---RGHSGTALVEFNKNWPGLDNALAF  191

Query  619  ENAF  630
            E A+
Sbjct  192  EKAY  195



>ref|NP_190436.2| XH/XS domain-containing protein [Arabidopsis thaliana]
 ref|NP_974403.1| XH/XS domain-containing protein [Arabidopsis thaliana]
 sp|Q8VZ79.1|IDN2_ARATH RecName: Full=Protein INVOLVED IN DE NOVO 2; AltName: Full=Protein 
RNA-DIRECTED DNA METHYLATION 12 [Arabidopsis thaliana]
 gb|AAL38360.1| putative protein [Arabidopsis thaliana]
 gb|AAN15455.1| putative protein [Arabidopsis thaliana]
 gb|AEE78442.1| XH/XS domain-containing protein [Arabidopsis thaliana]
 gb|AEE78443.1| XH/XS domain-containing protein [Arabidopsis thaliana]
Length=647

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 103/188 (55%), Gaps = 22/188 (12%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  297
            ++EY +K Y  L+ GK KV+       CP+C  KKK  ++YKDLLQHA+GVG  +++ RS
Sbjct  21   MDEYGDKMYLNLKGGKLKVRLSPQAFICPYCPNKKKTSFQYKDLLQHASGVGNSNSDKRS  80

Query  298  VKQKANHVALAKYLEIDLGD---QAEPLPQRAVAP------EDNNLYCWPWTGIVVNVSK  450
             K+KA+H+AL KYL+ DL D   +AEP  +R          + +    +PW GIVVN+  
Sbjct  81   AKEKASHLALVKYLQQDLADSASEAEPSSKRQKNGNPIQDCDHDEKLVYPWKGIVVNIPT  140

Query  451  DNA--------NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKN  606
              A        +G+ + +E Y L+ F+      V+   +    +   +++   DWNG  N
Sbjct  141  TKAQDGRSAGESGSKLRDE-YILRGFN---PTRVRPLWNYLGHSGTAIVEFNKDWNGLHN  196

Query  607  AILFENAF  630
             +LF+ A+
Sbjct  197  GLLFDKAY  204



>emb|CAB62356.1| putative protein [Arabidopsis thaliana]
Length=644

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 103/188 (55%), Gaps = 22/188 (12%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  297
            ++EY +K Y  L+ GK KV+       CP+C  KKK  ++YKDLLQHA+GVG  +++ RS
Sbjct  21   MDEYGDKMYLNLKGGKLKVRLSPQAFICPYCPNKKKTSFQYKDLLQHASGVGNSNSDKRS  80

Query  298  VKQKANHVALAKYLEIDLGD---QAEPLPQRAVAP------EDNNLYCWPWTGIVVNVSK  450
             K+KA+H+AL KYL+ DL D   +AEP  +R          + +    +PW GIVVN+  
Sbjct  81   AKEKASHLALVKYLQQDLADSASEAEPSSKRQKNGNPIQDCDHDEKLVYPWKGIVVNIPT  140

Query  451  DNA--------NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKN  606
              A        +G+ + +E Y L+ F+      V+   +    +   +++   DWNG  N
Sbjct  141  TKAQDGRSAGESGSKLRDE-YILRGFN---PTRVRPLWNYLGHSGTAIVEFNKDWNGLHN  196

Query  607  AILFENAF  630
             +LF+ A+
Sbjct  197  GLLFDKAY  204



>gb|KEH34701.1| XH/XS domain protein [Medicago truncatula]
Length=640

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 102/190 (54%), Gaps = 20/190 (11%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  297
            I EY+EK YEEL+SG   VK  +    CP+C  K+K+DY Y +LLQHA+GVG+ S+  R 
Sbjct  16   IGEYEEKCYEELKSGSQNVKTSDEKFTCPYCPKKRKRDYLYNELLQHASGVGQSSSQKRK  75

Query  298  VKQKANHVALAKYLEIDLGDQAEPL-PQRAVAP--------EDNNLYCWPWTGIVVNVSK  450
             ++KA H+AL KYLE DL +   P  P    A         + +  + WPW GI+VN+  
Sbjct  76   PREKATHLALVKYLEKDLMNIDTPSKPTENCADNGDTDTSIDSDEQFVWPWIGIIVNIPT  135

Query  451  DNA-NGTAVE------EEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNA  609
              A +G AV        ++Y  + F+ Y    +  F   +  +   +++   +W G  NA
Sbjct  136  SRAQDGRAVGASGSKLRDEYRRRGFNPYRVNPLWNF---RGHSGTALVEFYKNWPGLDNA  192

Query  610  ILFENAFEAE  639
            + FE A+ ++
Sbjct  193  LAFEKAYASD  202



>ref|XP_003616411.1| Transcription factor X1-like protein [Medicago truncatula]
 gb|AES99369.1| XH/XS domain protein [Medicago truncatula]
Length=1122

 Score = 86.7 bits (213),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 68/196 (35%), Positives = 94/196 (48%), Gaps = 29/196 (15%)
 Frame = +1

Query  139  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANR-SVKQKAN  315
            K Y EL+ G +KVK       CP+C  K+K DY+Y +LL HA GVG+  A R SV +KAN
Sbjct  490  KSYAELKKGVHKVKTSEDTFSCPYCP-KRKCDYRYSELLNHALGVGQSDAQRRSVLEKAN  548

Query  316  HVALAKYLEIDLGDQAEPLP----------------QRAVAPEDNNL-------YCWPWT  426
            H+AL KYLE DL       P                Q    P + N+       + WPWT
Sbjct  549  HLALVKYLEKDLMTMNVERPLKPANKYLENNLMNVEQNRTKPVNENILVNSERQFVWPWT  608

Query  427  GIVVNV-SKDNANGTAVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWN  594
            GIVVN+ +    +G  + E    L+   R   +  + V+   +    T   V++    W 
Sbjct  609  GIVVNIPTSQTEDGRCIGESGSKLRDEYRIRGFNPRRVRTLWNSWGHTGAAVVEFNKSWL  668

Query  595  GYKNAILFENAFEAEC  642
            G  NA+ FE A+E +C
Sbjct  669  GLYNALAFERAYELDC  684


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 55/82 (67%), Gaps = 5/82 (6%)
 Frame = +1

Query  145  YEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQKANHV  321
            YEEL++GK KVK       CP+C  ++KQDYK  +LL HATG+G+ S+  RS K+K +H+
Sbjct  25   YEELKTGKQKVKTSAETFSCPYCP-ERKQDYKLNELLNHATGIGRSSSEKRSAKEKGSHL  83

Query  322  ALAKYLEIDLGDQ---AEPLPQ  378
            AL KYLE DL  +   + P+ Q
Sbjct  84   ALVKYLEQDLNSKDGASRPIDQ  105


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 67/111 (60%), Gaps = 10/111 (9%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQ  306
            Y +K Y+EL++   KV+  +    CP+C   KK DY Y+++L+HA+GVG+ S+  RSV++
Sbjct  247  YVDKLYQELKNRSLKVRISDDAFTCPYCPKMKKPDYVYREILEHASGVGQSSSQKRSVRE  306

Query  307  KANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYCWPWTGIVVNVSKDNA  459
            KA H+AL KYL+ D+     P P + V   D+       +G ++   ++NA
Sbjct  307  KATHLALMKYLKQDII--YVPAPSKPVTEGDS-------SGAMIQSREENA  348


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 47/81 (58%), Gaps = 2/81 (2%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQ  306
            Y +  YEEL++G   VK  +G   CP+C  +K+     + L  HA  VG+ S+  RS ++
Sbjct  131  YVDTAYEELKNGTRNVKTSDGTFICPYCPNRKQDYLYRELLE-HAFMVGRSSSEKRSARE  189

Query  307  KANHVALAKYLEIDLGDQAEP  369
            +ANH+AL KYLE D+     P
Sbjct  190  RANHLALLKYLEKDITSMPGP  210



>ref|XP_010503501.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like [Camelina sativa]
 ref|XP_010503502.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like [Camelina sativa]
Length=648

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 70/191 (37%), Positives = 102/191 (53%), Gaps = 21/191 (11%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRS  297
            ++EY +K Y  L+ GK KVK       CP+C  KKK  ++YKDLLQHA+GVG   S  +S
Sbjct  21   MDEYGDKMYLNLKGGKLKVKLSPQAFLCPYCPTKKKPSFQYKDLLQHASGVGNSNSEKKS  80

Query  298  VKQKANHVALAKYLEIDLGDQ----AEPLPQR-----AVA--PEDNNLYCWPWTGIVVNV  444
             K+KA+H+AL KYL+ DL D     AEP  +R     A+     D  L C PW GIVVN+
Sbjct  81   AKEKASHLALVKYLQQDLADSASDAAEPSAKRQKNGNAIQDCDHDEKLVC-PWKGIVVNI  139

Query  445  -SKDNANGTAVEE-----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKN  606
             +    +G +  E      D +++R   +    V+        +   +++   DWNG  N
Sbjct  140  PTTKGVDGRSAGESGSKLRDEYIQRG--FNPTRVRPLWSHWGHSGTAIVEFNKDWNGLHN  197

Query  607  AILFENAFEAE  639
            A+LF+ A+  +
Sbjct  198  ALLFDKAYRVD  208



>gb|KHN41100.1| hypothetical protein glysoja_013442 [Glycine soja]
Length=1115

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 97/180 (54%), Gaps = 11/180 (6%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdyky-kdllqHATGVGKGSAN-RSVK  303
            Y  K YE L+ G + VK       CP+C  KK++     +++L+HA+GVG+ S+  RS  
Sbjct  498  YVHKSYEALKKGSHNVKTSEMTFSCPYCPNKKRKRDYLYREILEHASGVGQSSSEKRSAI  557

Query  304  QKANHVALAKYLEIDLGDQAEPLPQRAV--APEDN--NLYCWPWTGIVVNV-SKDNANGT  468
            +KANH+AL KYLE DL     P P+ A   +P  N    + WPWTG+VVN+ ++   +G 
Sbjct  558  EKANHLALMKYLEKDLMIVDGP-PKTADEGSPPFNFEKQFVWPWTGVVVNIPTRLTEDGR  616

Query  469  AVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
             V E    L+   R   +  + V+I  +    +   V++   +W G  NA+ FE A+E +
Sbjct  617  CVGESGSKLRDEYRSRGFNPRRVRILSNFCVHSGTAVVEFNKNWTGLDNALAFERAYELD  676


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 53/88 (60%), Gaps = 2/88 (2%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdyky-kdllqHATGVGKG-SANRSVK  303
            Y E  YEEL+ G + VK  +   RCP+C  KK       +++L+HA+GVG+  S  RS  
Sbjct  378  YAENFYEELKRGIHNVKTSDETFRCPYCPNKKINRDYAYREILEHASGVGQSKSQKRSFI  437

Query  304  QKANHVALAKYLEIDLGDQAEPLPQRAV  387
            +KANH+AL KYL+ DL +   P P + +
Sbjct  438  EKANHLALVKYLKRDLMNVGAPCPSKPM  465


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQ  306
            Y +  Y+EL+ G YKV   +    CP+C  ++KQDYKY++LL HA+GVG+ S+  R+ K+
Sbjct  20   YVDISYQELKKGSYKVMRSDETFICPYCP-ERKQDYKYRELLNHASGVGRSSSEKRTAKE  78

Query  307  KANHVALAKYLEIDL  351
            KANH+AL KYLE DL
Sbjct  79   KANHLALVKYLEKDL  93


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQ  306
            Y +K Y+EL+ G + V+  +  L CP+C  K+K+DY Y++LL+HA+GVG+ S+  R V++
Sbjct  251  YVDKFYKELKKGNHIVQTSDQTLSCPYCPRKRKRDYVYRELLEHASGVGQSSSQKRHVRE  310

Query  307  KANHVALAKYLEIDLGDQAEP  369
            K  H+AL KYL+ DL    +P
Sbjct  311  KTTHLALMKYLKNDLKYMNDP  331



>ref|XP_009610609.1| PREDICTED: uncharacterized protein LOC104104271 isoform X5 [Nicotiana 
tomentosiformis]
Length=962

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 96/181 (53%), Gaps = 17/181 (9%)
 Frame = +1

Query  142  PYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQKANH  318
            PYE+L+SG Y +  P       +C  K+K+++ YKDL+ H   VG  S+N R+   KANH
Sbjct  577  PYEKLKSGNYSLNIPAVAYTFAYCPKKRKREFMYKDLMFHVREVGSCSSNKRTAIDKANH  636

Query  319  VALAKYLEIDLGDQAEPL-PQRAVAPEDNNL--------YCWPWTGIVVNVSKDNANGTA  471
            + LAKY E D+   A P  P     P+ + L        + WPW  +VVN+  +  +G  
Sbjct  637  LTLAKYFENDVALAASPSKPDTLGDPQVDTLLDYDRAEMFVWPWIAVVVNLPTEFKDGRY  696

Query  472  VEE-----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
            V E     +D  ++R   +    V+   +D   +   +++ K DW+G+ NAILFE A+EA
Sbjct  697  VGESGSNLKDQLIRR--GFNPTRVRTLWNDLGHSGIALVEFKKDWSGFSNAILFEKAYEA  754

Query  637  E  639
            +
Sbjct  755  D  755


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 53/83 (64%), Gaps = 1/83 (1%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I +YKEK YEELR G    K  +    CP+C  K  +   Y+DLLQHA+G+GK S  R+ 
Sbjct  16   IEDYKEKSYEELRCGNQSFKISDVAYTCPYCQEKSGRHLFYEDLLQHASGIGK-SKIRTA  74

Query  301  KQKANHVALAKYLEIDLGDQAEP  369
            + +ANH+ALAKYLE D+   A P
Sbjct  75   RDRANHLALAKYLENDVAGAAIP  97


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +1

Query  139  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQKAN  315
            K YE+ RSG +  K  N    CP+C   +++ + YKDLLQHA G+G   S  R+ + K N
Sbjct  178  KYYEDSRSGNHSPKISNMAFACPYCPETRERVFSYKDLLQHANGIGSSNSLKRTARDKVN  237

Query  316  HVALAKYLEIDLGDQA  363
            H+ALAK LE D+   A
Sbjct  238  HLALAKRLEKDVAGSA  253



>ref|XP_006575506.1| PREDICTED: uncharacterized protein LOC100806426 isoform X4 [Glycine 
max]
Length=1037

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 97/180 (54%), Gaps = 11/180 (6%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdyky-kdllqHATGVGKGSAN-RSVK  303
            Y  K YE L+ G + VK       CP+C  KK++     +++L+HA+GVG+ S+  RS  
Sbjct  419  YVHKSYEALKKGSHNVKTSEMTFSCPYCPNKKRKRDYLYREILEHASGVGQSSSEKRSAI  478

Query  304  QKANHVALAKYLEIDLGDQAEPLPQRAV--APEDN--NLYCWPWTGIVVNV-SKDNANGT  468
            +KANH+AL KYLE DL     P P+ A   +P  N    + WPWTG+VVN+ ++   +G 
Sbjct  479  EKANHLALIKYLEKDLMIVDGP-PKTADEGSPPFNFEKQFVWPWTGVVVNIPTRLTEDGR  537

Query  469  AVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
             V E    L+   R   +  + V+I  +    +   V++   +W G  NA+ FE A+E +
Sbjct  538  CVGESGSKLRDEYRSRGFNPRRVRILSNFCVHSGTAVVEFNKNWTGLDNALAFERAYELD  597


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 53/88 (60%), Gaps = 2/88 (2%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdyky-kdllqHATGVGKG-SANRSVK  303
            Y E  YEEL+ G + VK  +   RCP+C  KK       +++L+HA+GVG+  S  RS  
Sbjct  299  YAENFYEELKRGIHNVKTSDETFRCPYCPNKKINRDYAYREILEHASGVGQSKSQKRSFI  358

Query  304  QKANHVALAKYLEIDLGDQAEPLPQRAV  387
            +KANH+AL KYL+ DL +   P P + +
Sbjct  359  EKANHLALVKYLKRDLMNVGAPCPSKPM  386


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQ  306
            Y +K Y+EL+ G + V+  +  L CP+C  K+K+DY Y++LL+HA+GVG+ S+  R V++
Sbjct  135  YVDKFYKELKKGNHIVQTSDQTLSCPYCPRKRKRDYVYRELLEHASGVGQSSSQKRHVRE  194

Query  307  KANHVALAKYLEIDLGDQAEP  369
            K  H+AL KYL+ DL    +P
Sbjct  195  KTTHLALMKYLKNDLKYMNDP  215



>dbj|BAJ90280.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=631

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 85/160 (53%), Gaps = 22/160 (14%)
 Frame = +1

Query  202  CPFCAGkkkqdykykdllqHATGVGKGSANRSVKQKANHVALAKYLEIDLGDQAE-----  366
            CPFC GKK + Y  + LLQH++GVG  + NR  K KA+H ALAK+L+ D+   +E     
Sbjct  42   CPFCTGKKNKGYNMQSLLQHSSGVG-AAPNRPAKDKASHRALAKHLKNDVAKPSEPQQQQ  100

Query  367  ---------PLPQRAVAPEDNNLYCWPWTGIVVNVSKDNANGTAVEEEDYWLK-RFSKYE  516
                     PLP R      +  + WPW G++VNV  +  +G  V E    LK   S++ 
Sbjct  101  PQQIVVEPQPLPNR------HEKFVWPWMGVLVNVPTEWKDGRQVGESGTRLKGELSQFC  154

Query  517  AQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
              +V    + +  T   +++   DWNG++NA+ FE  FEA
Sbjct  155  PLKVIPLWNFRGHTGNAIVEFAKDWNGFRNALAFEQYFEA  194



>ref|XP_006575503.1| PREDICTED: uncharacterized protein LOC100806426 isoform X1 [Glycine 
max]
 ref|XP_006575504.1| PREDICTED: uncharacterized protein LOC100806426 isoform X2 [Glycine 
max]
Length=1153

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 97/180 (54%), Gaps = 11/180 (6%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdyky-kdllqHATGVGKGSAN-RSVK  303
            Y  K YE L+ G + VK       CP+C  KK++     +++L+HA+GVG+ S+  RS  
Sbjct  535  YVHKSYEALKKGSHNVKTSEMTFSCPYCPNKKRKRDYLYREILEHASGVGQSSSEKRSAI  594

Query  304  QKANHVALAKYLEIDLGDQAEPLPQRAV--APEDN--NLYCWPWTGIVVNV-SKDNANGT  468
            +KANH+AL KYLE DL     P P+ A   +P  N    + WPWTG+VVN+ ++   +G 
Sbjct  595  EKANHLALIKYLEKDLMIVDGP-PKTADEGSPPFNFEKQFVWPWTGVVVNIPTRLTEDGR  653

Query  469  AVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
             V E    L+   R   +  + V+I  +    +   V++   +W G  NA+ FE A+E +
Sbjct  654  CVGESGSKLRDEYRSRGFNPRRVRILSNFCVHSGTAVVEFNKNWTGLDNALAFERAYELD  713


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 53/88 (60%), Gaps = 2/88 (2%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdyky-kdllqHATGVGKG-SANRSVK  303
            Y E  YEEL+ G + VK  +   RCP+C  KK       +++L+HA+GVG+  S  RS  
Sbjct  415  YAENFYEELKRGIHNVKTSDETFRCPYCPNKKINRDYAYREILEHASGVGQSKSQKRSFI  474

Query  304  QKANHVALAKYLEIDLGDQAEPLPQRAV  387
            +KANH+AL KYL+ DL +   P P + +
Sbjct  475  EKANHLALVKYLKRDLMNVGAPCPSKPM  502


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQ  306
            Y +  Y+EL+ G YKV   +    CP+C  ++KQDYKY++LL HA+GVG+ S+  R+ K+
Sbjct  20   YVDISYQELKKGSYKVMRSDETFICPYCP-ERKQDYKYRELLNHASGVGRSSSEKRTAKE  78

Query  307  KANHVALAKYLEIDL  351
            KANH+AL KYLE DL
Sbjct  79   KANHLALVKYLEKDL  93


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQ  306
            Y +K Y+EL+ G + V+  +  L CP+C  K+K+DY Y++LL+HA+GVG+ S+  R V++
Sbjct  251  YVDKFYKELKKGNHIVQTSDQTLSCPYCPRKRKRDYVYRELLEHASGVGQSSSQKRHVRE  310

Query  307  KANHVALAKYLEIDLGDQAEP  369
            K  H+AL KYL+ DL    +P
Sbjct  311  KTTHLALMKYLKNDLKYMNDP  331



>ref|XP_009610603.1| PREDICTED: uncharacterized protein LOC104104271 isoform X1 [Nicotiana 
tomentosiformis]
Length=1201

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 96/181 (53%), Gaps = 17/181 (9%)
 Frame = +1

Query  142  PYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQKANH  318
            PYE+L+SG Y +  P       +C  K+K+++ YKDL+ H   VG  S+N R+   KANH
Sbjct  577  PYEKLKSGNYSLNIPAVAYTFAYCPKKRKREFMYKDLMFHVREVGSCSSNKRTAIDKANH  636

Query  319  VALAKYLEIDLGDQAEPL-PQRAVAPEDNNL--------YCWPWTGIVVNVSKDNANGTA  471
            + LAKY E D+   A P  P     P+ + L        + WPW  +VVN+  +  +G  
Sbjct  637  LTLAKYFENDVALAASPSKPDTLGDPQVDTLLDYDRAEMFVWPWIAVVVNLPTEFKDGRY  696

Query  472  VEE-----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
            V E     +D  ++R   +    V+   +D   +   +++ K DW+G+ NAILFE A+EA
Sbjct  697  VGESGSNLKDQLIRR--GFNPTRVRTLWNDLGHSGIALVEFKKDWSGFSNAILFEKAYEA  754

Query  637  E  639
            +
Sbjct  755  D  755


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 53/83 (64%), Gaps = 1/83 (1%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I +YKEK YEELR G    K  +    CP+C  K  +   Y+DLLQHA+G+GK S  R+ 
Sbjct  16   IEDYKEKSYEELRCGNQSFKISDVAYTCPYCQEKSGRHLFYEDLLQHASGIGK-SKIRTA  74

Query  301  KQKANHVALAKYLEIDLGDQAEP  369
            + +ANH+ALAKYLE D+   A P
Sbjct  75   RDRANHLALAKYLENDVAGAAIP  97


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +1

Query  139  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQKAN  315
            K YE+ RSG +  K  N    CP+C   +++ + YKDLLQHA G+G   S  R+ + K N
Sbjct  178  KYYEDSRSGNHSPKISNMAFACPYCPETRERVFSYKDLLQHANGIGSSNSLKRTARDKVN  237

Query  316  HVALAKYLEIDLGDQA  363
            H+ALAK LE D+   A
Sbjct  238  HLALAKRLEKDVAGSA  253



>ref|XP_009610606.1| PREDICTED: uncharacterized protein LOC104104271 isoform X3 [Nicotiana 
tomentosiformis]
 ref|XP_009610607.1| PREDICTED: uncharacterized protein LOC104104271 isoform X3 [Nicotiana 
tomentosiformis]
Length=1176

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 96/181 (53%), Gaps = 17/181 (9%)
 Frame = +1

Query  142  PYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQKANH  318
            PYE+L+SG Y +  P       +C  K+K+++ YKDL+ H   VG  S+N R+   KANH
Sbjct  577  PYEKLKSGNYSLNIPAVAYTFAYCPKKRKREFMYKDLMFHVREVGSCSSNKRTAIDKANH  636

Query  319  VALAKYLEIDLGDQAEPL-PQRAVAPEDNNL--------YCWPWTGIVVNVSKDNANGTA  471
            + LAKY E D+   A P  P     P+ + L        + WPW  +VVN+  +  +G  
Sbjct  637  LTLAKYFENDVALAASPSKPDTLGDPQVDTLLDYDRAEMFVWPWIAVVVNLPTEFKDGRY  696

Query  472  VEE-----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
            V E     +D  ++R   +    V+   +D   +   +++ K DW+G+ NAILFE A+EA
Sbjct  697  VGESGSNLKDQLIRR--GFNPTRVRTLWNDLGHSGIALVEFKKDWSGFSNAILFEKAYEA  754

Query  637  E  639
            +
Sbjct  755  D  755


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 53/83 (64%), Gaps = 1/83 (1%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I +YKEK YEELR G    K  +    CP+C  K  +   Y+DLLQHA+G+GK S  R+ 
Sbjct  16   IEDYKEKSYEELRCGNQSFKISDVAYTCPYCQEKSGRHLFYEDLLQHASGIGK-SKIRTA  74

Query  301  KQKANHVALAKYLEIDLGDQAEP  369
            + +ANH+ALAKYLE D+   A P
Sbjct  75   RDRANHLALAKYLENDVAGAAIP  97


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +1

Query  139  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQKAN  315
            K YE+ RSG +  K  N    CP+C   +++ + YKDLLQHA G+G   S  R+ + K N
Sbjct  178  KYYEDSRSGNHSPKISNMAFACPYCPETRERVFSYKDLLQHANGIGSSNSLKRTARDKVN  237

Query  316  HVALAKYLEIDLGDQA  363
            H+ALAK LE D+   A
Sbjct  238  HLALAKRLEKDVAGSA  253



>ref|XP_002875916.1| XH/XS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52175.1| XH/XS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=647

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 105/192 (55%), Gaps = 24/192 (13%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  297
            ++EY +K Y  L+ GK KV+       CP+C  KKK  ++YKDLLQHA+GVG  +++ RS
Sbjct  21   MDEYGDKMYLNLKGGKLKVRLSPQAFVCPYCPNKKKPSFQYKDLLQHASGVGNSNSDKRS  80

Query  298  VKQKANHVALAKYLEIDLGD---QAEPLPQRAV-------APEDNNLYCWPWTGIVVNVS  447
             K+KA+H+AL KYL+ DL D   +AEP  +R           +D  L  +PW GIVVN+ 
Sbjct  81   AKEKASHLALVKYLQQDLADSAVEAEPSSKRQKNGNPIQDCDQDEKL-VYPWKGIVVNIP  139

Query  448  KDNA--------NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYK  603
               A        +G+ + +E Y L+ F+      V+   +    +   +++   DWNG  
Sbjct  140  TTKAQDGRSAGESGSKLRDE-YILRGFN---PTRVRPLWNYWGHSGTAIVEFNKDWNGLH  195

Query  604  NAILFENAFEAE  639
            N +LF+ A+  +
Sbjct  196  NGLLFDKAYRVD  207



>ref|XP_009610604.1| PREDICTED: uncharacterized protein LOC104104271 isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009610605.1| PREDICTED: uncharacterized protein LOC104104271 isoform X2 [Nicotiana 
tomentosiformis]
Length=1189

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 96/181 (53%), Gaps = 17/181 (9%)
 Frame = +1

Query  142  PYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQKANH  318
            PYE+L+SG Y +  P       +C  K+K+++ YKDL+ H   VG  S+N R+   KANH
Sbjct  577  PYEKLKSGNYSLNIPAVAYTFAYCPKKRKREFMYKDLMFHVREVGSCSSNKRTAIDKANH  636

Query  319  VALAKYLEIDLGDQAEPL-PQRAVAPEDNNL--------YCWPWTGIVVNVSKDNANGTA  471
            + LAKY E D+   A P  P     P+ + L        + WPW  +VVN+  +  +G  
Sbjct  637  LTLAKYFENDVALAASPSKPDTLGDPQVDTLLDYDRAEMFVWPWIAVVVNLPTEFKDGRY  696

Query  472  VEE-----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
            V E     +D  ++R   +    V+   +D   +   +++ K DW+G+ NAILFE A+EA
Sbjct  697  VGESGSNLKDQLIRR--GFNPTRVRTLWNDLGHSGIALVEFKKDWSGFSNAILFEKAYEA  754

Query  637  E  639
            +
Sbjct  755  D  755


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 53/83 (64%), Gaps = 1/83 (1%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I +YKEK YEELR G    K  +    CP+C  K  +   Y+DLLQHA+G+GK S  R+ 
Sbjct  16   IEDYKEKSYEELRCGNQSFKISDVAYTCPYCQEKSGRHLFYEDLLQHASGIGK-SKIRTA  74

Query  301  KQKANHVALAKYLEIDLGDQAEP  369
            + +ANH+ALAKYLE D+   A P
Sbjct  75   RDRANHLALAKYLENDVAGAAIP  97


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +1

Query  139  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQKAN  315
            K YE+ RSG +  K  N    CP+C   +++ + YKDLLQHA G+G   S  R+ + K N
Sbjct  178  KYYEDSRSGNHSPKISNMAFACPYCPETRERVFSYKDLLQHANGIGSSNSLKRTARDKVN  237

Query  316  HVALAKYLEIDLGDQA  363
            H+ALAK LE D+   A
Sbjct  238  HLALAKRLEKDVAGSA  253



>ref|XP_006575505.1| PREDICTED: uncharacterized protein LOC100806426 isoform X3 [Glycine 
max]
Length=1076

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 97/180 (54%), Gaps = 11/180 (6%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdyky-kdllqHATGVGKGSAN-RSVK  303
            Y  K YE L+ G + VK       CP+C  KK++     +++L+HA+GVG+ S+  RS  
Sbjct  535  YVHKSYEALKKGSHNVKTSEMTFSCPYCPNKKRKRDYLYREILEHASGVGQSSSEKRSAI  594

Query  304  QKANHVALAKYLEIDLGDQAEPLPQRAV--APEDN--NLYCWPWTGIVVNV-SKDNANGT  468
            +KANH+AL KYLE DL     P P+ A   +P  N    + WPWTG+VVN+ ++   +G 
Sbjct  595  EKANHLALIKYLEKDLMIVDGP-PKTADEGSPPFNFEKQFVWPWTGVVVNIPTRLTEDGR  653

Query  469  AVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
             V E    L+   R   +  + V+I  +    +   V++   +W G  NA+ FE A+E +
Sbjct  654  CVGESGSKLRDEYRSRGFNPRRVRILSNFCVHSGTAVVEFNKNWTGLDNALAFERAYELD  713


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 53/88 (60%), Gaps = 2/88 (2%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdyky-kdllqHATGVGKG-SANRSVK  303
            Y E  YEEL+ G + VK  +   RCP+C  KK       +++L+HA+GVG+  S  RS  
Sbjct  415  YAENFYEELKRGIHNVKTSDETFRCPYCPNKKINRDYAYREILEHASGVGQSKSQKRSFI  474

Query  304  QKANHVALAKYLEIDLGDQAEPLPQRAV  387
            +KANH+AL KYL+ DL +   P P + +
Sbjct  475  EKANHLALVKYLKRDLMNVGAPCPSKPM  502


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQ  306
            Y +  Y+EL+ G YKV   +    CP+C  ++KQDYKY++LL HA+GVG+ S+  R+ K+
Sbjct  20   YVDISYQELKKGSYKVMRSDETFICPYCP-ERKQDYKYRELLNHASGVGRSSSEKRTAKE  78

Query  307  KANHVALAKYLEIDL  351
            KANH+AL KYLE DL
Sbjct  79   KANHLALVKYLEKDL  93


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQ  306
            Y +K Y+EL+ G + V+  +  L CP+C  K+K+DY Y++LL+HA+GVG+ S+  R V++
Sbjct  251  YVDKFYKELKKGNHIVQTSDQTLSCPYCPRKRKRDYVYRELLEHASGVGQSSSQKRHVRE  310

Query  307  KANHVALAKYLEIDLGDQAEP  369
            K  H+AL KYL+ DL    +P
Sbjct  311  KTTHLALMKYLKNDLKYMNDP  331



>ref|XP_009610608.1| PREDICTED: uncharacterized protein LOC104104271 isoform X4 [Nicotiana 
tomentosiformis]
Length=1167

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 96/181 (53%), Gaps = 17/181 (9%)
 Frame = +1

Query  142  PYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQKANH  318
            PYE+L+SG Y +  P       +C  K+K+++ YKDL+ H   VG  S+N R+   KANH
Sbjct  577  PYEKLKSGNYSLNIPAVAYTFAYCPKKRKREFMYKDLMFHVREVGSCSSNKRTAIDKANH  636

Query  319  VALAKYLEIDLGDQAEPL-PQRAVAPEDNNL--------YCWPWTGIVVNVSKDNANGTA  471
            + LAKY E D+   A P  P     P+ + L        + WPW  +VVN+  +  +G  
Sbjct  637  LTLAKYFENDVALAASPSKPDTLGDPQVDTLLDYDRAEMFVWPWIAVVVNLPTEFKDGRY  696

Query  472  VEE-----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
            V E     +D  ++R   +    V+   +D   +   +++ K DW+G+ NAILFE A+EA
Sbjct  697  VGESGSNLKDQLIRR--GFNPTRVRTLWNDLGHSGIALVEFKKDWSGFSNAILFEKAYEA  754

Query  637  E  639
            +
Sbjct  755  D  755


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 53/83 (64%), Gaps = 1/83 (1%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I +YKEK YEELR G    K  +    CP+C  K  +   Y+DLLQHA+G+GK S  R+ 
Sbjct  16   IEDYKEKSYEELRCGNQSFKISDVAYTCPYCQEKSGRHLFYEDLLQHASGIGK-SKIRTA  74

Query  301  KQKANHVALAKYLEIDLGDQAEP  369
            + +ANH+ALAKYLE D+   A P
Sbjct  75   RDRANHLALAKYLENDVAGAAIP  97


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +1

Query  139  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQKAN  315
            K YE+ RSG +  K  N    CP+C   +++ + YKDLLQHA G+G   S  R+ + K N
Sbjct  178  KYYEDSRSGNHSPKISNMAFACPYCPETRERVFSYKDLLQHANGIGSSNSLKRTARDKVN  237

Query  316  HVALAKYLEIDLGDQA  363
            H+ALAK LE D+   A
Sbjct  238  HLALAKRLEKDVAGSA  253



>emb|CDY05861.1| BnaC08g20380D [Brassica napus]
Length=661

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 96/181 (53%), Gaps = 34/181 (19%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RS  297
            + EY +K Y  L+SGK KVK       CP C  KKK  ++YKDLLQHA+GVGK +++ R+
Sbjct  114  MEEYGDKIYLSLKSGKLKVKLSPHSFTCPCCPNKKKPSFQYKDLLQHASGVGKSNSDKRT  173

Query  298  VKQKANHVALAKYLEIDLGD--QAEPLPQRAVA-------PEDNNLYCWPWTGIVVNV-S  447
             K+KA+H ALAKYL+ DL D  QAEP  +R           +D  L C PW G+VVN+ +
Sbjct  174  AKEKASHRALAKYLQQDLADDSQAEPSSKRRKTGDPIQDCDQDEKLVC-PWKGVVVNIPT  232

Query  448  KDNANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENA  627
                NG    E        SK   + ++                + DWNG  NA+LF+ A
Sbjct  233  TKTENGRTAGES------GSKLRDEYIQ----------------RGDWNGLHNALLFDKA  270

Query  628  F  630
            +
Sbjct  271  Y  271



>gb|EMT07790.1| hypothetical protein F775_28070 [Aegilops tauschii]
Length=636

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 66/184 (36%), Positives = 100/184 (54%), Gaps = 18/184 (10%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNG-CLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQ  306
            Y+ K +  L SG  K +  NG    CPFC G+K +DY  + LLQH++GVG  + NR  K 
Sbjct  19   YEGKIHARLVSGDLKFR--NGDSYSCPFCTGRKNKDYNMQSLLQHSSGVG-AAPNRPAKD  75

Query  307  KANHVALAKYLEIDLGDQAEPL--------PQR-AVAPE----DNNLYCWPWTGIVVNVS  447
            KA+H ALAK+L+  +   +EP         PQ+ AV P+     +  + WPW G++VNV 
Sbjct  76   KASHRALAKHLKNGVAKPSEPQQIAIEPQQPQQIAVEPQPLPNRHEKFVWPWMGVLVNVP  135

Query  448  KDNANGTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFEN  624
             +  +G  V E    LK   S++   +V    + +  T   +++   +WNG++NA+ FE 
Sbjct  136  TEWKDGRQVGESGNRLKGELSQFCPLKVIPLWNFRGHTGNAIVEFAKNWNGFRNALAFEK  195

Query  625  AFEA  636
             FEA
Sbjct  196  YFEA  199



>ref|XP_006424841.1| hypothetical protein CICLE_v10029911mg [Citrus clementina]
 gb|ESR38081.1| hypothetical protein CICLE_v10029911mg [Citrus clementina]
Length=732

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 99/185 (54%), Gaps = 13/185 (7%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            + +Y+ K Y +L+ G  KV+      RCPFC GKK+ DY YK+LLQHA+ VG+ S +R  
Sbjct  117  LKDYEYKKYNQLKKGDLKVEVSETAYRCPFCRGKKETDYLYKELLQHASDVGR-SRSRGA  175

Query  301  KQKANHVAL----AKYLEIDLGDQAEPLPQ----RAVAPEDNNLYCWPWTGIVVNV-SKD  453
            ++KA H+AL    +KYL +    Q EP       +    + + L  +PW GIV N+ ++ 
Sbjct  176  REKAQHLALEKYVSKYLVVKDRSQLEPGTSSECLKITDHQPDQLLVYPWVGIVANIKTQR  235

Query  454  NANGTAVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFEN  624
              +G  V E    L+   R   +   +V      +  +   V++   DW G+KNAI+FE 
Sbjct  236  GEDGRYVGESGSKLRDEFRSKGFNPLKVHPLWSRRGHSGFAVVEFYKDWAGFKNAIMFEK  295

Query  625  AFEAE  639
            +FE +
Sbjct  296  SFEVD  300



>ref|XP_009791210.1| PREDICTED: uncharacterized protein LOC104238532 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009791211.1| PREDICTED: uncharacterized protein LOC104238532 isoform X1 [Nicotiana 
sylvestris]
Length=1189

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 96/181 (53%), Gaps = 17/181 (9%)
 Frame = +1

Query  142  PYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQKANH  318
            PYE+L+SG Y +  P       +C  K+K+++ YKDL+ H   VG  S+N R+   KANH
Sbjct  577  PYEKLKSGNYSLNIPAVAYTFAYCPKKRKREFMYKDLMFHVREVGSCSSNKRTAIDKANH  636

Query  319  VALAKYLEIDLGDQAEPL-PQRAVAPEDNNL--------YCWPWTGIVVNVSKDNANGTA  471
            + LAKY E D+   A P  P     P+ + L        + WPW  +VVN+  +  +G  
Sbjct  637  LTLAKYFENDVVLAASPSKPDTLGDPQVDTLADYDRAEIFVWPWIAVVVNLPTEFKDGRY  696

Query  472  VEE-----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
            V E     +D  ++R   +    V+   +D   +   +++ K DW+G+ NAILFE A+EA
Sbjct  697  VGESGSNLKDQLIRR--GFNPTRVRTLWNDLGHSGIALVEFKKDWSGFSNAILFEKAYEA  754

Query  637  E  639
            +
Sbjct  755  D  755


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 53/83 (64%), Gaps = 1/83 (1%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I +YKEK YEELR G    K  +    CP+C  K  +   Y+DLLQHA+G+GK S  R+ 
Sbjct  16   IEDYKEKSYEELRCGNQSFKISDVAYTCPYCQEKSGRHLFYEDLLQHASGIGK-SKIRTA  74

Query  301  KQKANHVALAKYLEIDLGDQAEP  369
            + +ANH+ALAKYLE D+   A P
Sbjct  75   RDRANHLALAKYLENDVAGAAIP  97


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query  139  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQKAN  315
            K YE+ RSG + +K  N    CP+C   +++ + YKDLLQHA G+G   S  R+ + KAN
Sbjct  178  KYYEDSRSGNHSLKISNMAFACPYCPETRERVFSYKDLLQHANGIGSSNSLKRTTRDKAN  237

Query  316  HVALAKYLEIDLGDQA  363
            H+ALAK LE D+   A
Sbjct  238  HLALAKRLEKDVAGSA  253



>ref|XP_009791212.1| PREDICTED: uncharacterized protein LOC104238532 isoform X2 [Nicotiana 
sylvestris]
Length=1179

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 96/181 (53%), Gaps = 17/181 (9%)
 Frame = +1

Query  142  PYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQKANH  318
            PYE+L+SG Y +  P       +C  K+K+++ YKDL+ H   VG  S+N R+   KANH
Sbjct  577  PYEKLKSGNYSLNIPAVAYTFAYCPKKRKREFMYKDLMFHVREVGSCSSNKRTAIDKANH  636

Query  319  VALAKYLEIDLGDQAEPL-PQRAVAPEDNNL--------YCWPWTGIVVNVSKDNANGTA  471
            + LAKY E D+   A P  P     P+ + L        + WPW  +VVN+  +  +G  
Sbjct  637  LTLAKYFENDVVLAASPSKPDTLGDPQVDTLADYDRAEIFVWPWIAVVVNLPTEFKDGRY  696

Query  472  VEE-----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
            V E     +D  ++R   +    V+   +D   +   +++ K DW+G+ NAILFE A+EA
Sbjct  697  VGESGSNLKDQLIRR--GFNPTRVRTLWNDLGHSGIALVEFKKDWSGFSNAILFEKAYEA  754

Query  637  E  639
            +
Sbjct  755  D  755


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 53/83 (64%), Gaps = 1/83 (1%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I +YKEK YEELR G    K  +    CP+C  K  +   Y+DLLQHA+G+GK S  R+ 
Sbjct  16   IEDYKEKSYEELRCGNQSFKISDVAYTCPYCQEKSGRHLFYEDLLQHASGIGK-SKIRTA  74

Query  301  KQKANHVALAKYLEIDLGDQAEP  369
            + +ANH+ALAKYLE D+   A P
Sbjct  75   RDRANHLALAKYLENDVAGAAIP  97


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query  139  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQKAN  315
            K YE+ RSG + +K  N    CP+C   +++ + YKDLLQHA G+G   S  R+ + KAN
Sbjct  178  KYYEDSRSGNHSLKISNMAFACPYCPETRERVFSYKDLLQHANGIGSSNSLKRTTRDKAN  237

Query  316  HVALAKYLEIDLGDQA  363
            H+ALAK LE D+   A
Sbjct  238  HLALAKRLEKDVAGSA  253



>ref|XP_009791219.1| PREDICTED: uncharacterized protein LOC104238532 isoform X5 [Nicotiana 
sylvestris]
Length=962

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 96/181 (53%), Gaps = 17/181 (9%)
 Frame = +1

Query  142  PYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQKANH  318
            PYE+L+SG Y +  P       +C  K+K+++ YKDL+ H   VG  S+N R+   KANH
Sbjct  577  PYEKLKSGNYSLNIPAVAYTFAYCPKKRKREFMYKDLMFHVREVGSCSSNKRTAIDKANH  636

Query  319  VALAKYLEIDLGDQAEPL-PQRAVAPEDNNL--------YCWPWTGIVVNVSKDNANGTA  471
            + LAKY E D+   A P  P     P+ + L        + WPW  +VVN+  +  +G  
Sbjct  637  LTLAKYFENDVVLAASPSKPDTLGDPQVDTLADYDRAEIFVWPWIAVVVNLPTEFKDGRY  696

Query  472  VEE-----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
            V E     +D  ++R   +    V+   +D   +   +++ K DW+G+ NAILFE A+EA
Sbjct  697  VGESGSNLKDQLIRR--GFNPTRVRTLWNDLGHSGIALVEFKKDWSGFSNAILFEKAYEA  754

Query  637  E  639
            +
Sbjct  755  D  755


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 53/83 (64%), Gaps = 1/83 (1%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I +YKEK YEELR G    K  +    CP+C  K  +   Y+DLLQHA+G+GK S  R+ 
Sbjct  16   IEDYKEKSYEELRCGNQSFKISDVAYTCPYCQEKSGRHLFYEDLLQHASGIGK-SKIRTA  74

Query  301  KQKANHVALAKYLEIDLGDQAEP  369
            + +ANH+ALAKYLE D+   A P
Sbjct  75   RDRANHLALAKYLENDVAGAAIP  97


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query  139  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQKAN  315
            K YE+ RSG + +K  N    CP+C   +++ + YKDLLQHA G+G   S  R+ + KAN
Sbjct  178  KYYEDSRSGNHSLKISNMAFACPYCPETRERVFSYKDLLQHANGIGSSNSLKRTTRDKAN  237

Query  316  HVALAKYLEIDLGDQA  363
            H+ALAK LE D+   A
Sbjct  238  HLALAKRLEKDVAGSA  253



>ref|XP_009791213.1| PREDICTED: uncharacterized protein LOC104238532 isoform X3 [Nicotiana 
sylvestris]
 ref|XP_009791214.1| PREDICTED: uncharacterized protein LOC104238532 isoform X3 [Nicotiana 
sylvestris]
 ref|XP_009791215.1| PREDICTED: uncharacterized protein LOC104238532 isoform X3 [Nicotiana 
sylvestris]
 ref|XP_009791216.1| PREDICTED: uncharacterized protein LOC104238532 isoform X3 [Nicotiana 
sylvestris]
 ref|XP_009791217.1| PREDICTED: uncharacterized protein LOC104238532 isoform X3 [Nicotiana 
sylvestris]
Length=1176

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 96/181 (53%), Gaps = 17/181 (9%)
 Frame = +1

Query  142  PYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQKANH  318
            PYE+L+SG Y +  P       +C  K+K+++ YKDL+ H   VG  S+N R+   KANH
Sbjct  577  PYEKLKSGNYSLNIPAVAYTFAYCPKKRKREFMYKDLMFHVREVGSCSSNKRTAIDKANH  636

Query  319  VALAKYLEIDLGDQAEPL-PQRAVAPEDNNL--------YCWPWTGIVVNVSKDNANGTA  471
            + LAKY E D+   A P  P     P+ + L        + WPW  +VVN+  +  +G  
Sbjct  637  LTLAKYFENDVVLAASPSKPDTLGDPQVDTLADYDRAEIFVWPWIAVVVNLPTEFKDGRY  696

Query  472  VEE-----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
            V E     +D  ++R   +    V+   +D   +   +++ K DW+G+ NAILFE A+EA
Sbjct  697  VGESGSNLKDQLIRR--GFNPTRVRTLWNDLGHSGIALVEFKKDWSGFSNAILFEKAYEA  754

Query  637  E  639
            +
Sbjct  755  D  755


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 53/83 (64%), Gaps = 1/83 (1%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I +YKEK YEELR G    K  +    CP+C  K  +   Y+DLLQHA+G+GK S  R+ 
Sbjct  16   IEDYKEKSYEELRCGNQSFKISDVAYTCPYCQEKSGRHLFYEDLLQHASGIGK-SKIRTA  74

Query  301  KQKANHVALAKYLEIDLGDQAEP  369
            + +ANH+ALAKYLE D+   A P
Sbjct  75   RDRANHLALAKYLENDVAGAAIP  97


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query  139  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQKAN  315
            K YE+ RSG + +K  N    CP+C   +++ + YKDLLQHA G+G   S  R+ + KAN
Sbjct  178  KYYEDSRSGNHSLKISNMAFACPYCPETRERVFSYKDLLQHANGIGSSNSLKRTTRDKAN  237

Query  316  HVALAKYLEIDLGDQA  363
            H+ALAK LE D+   A
Sbjct  238  HLALAKRLEKDVAGSA  253



>ref|XP_009791218.1| PREDICTED: uncharacterized protein LOC104238532 isoform X4 [Nicotiana 
sylvestris]
Length=1167

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 96/181 (53%), Gaps = 17/181 (9%)
 Frame = +1

Query  142  PYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQKANH  318
            PYE+L+SG Y +  P       +C  K+K+++ YKDL+ H   VG  S+N R+   KANH
Sbjct  577  PYEKLKSGNYSLNIPAVAYTFAYCPKKRKREFMYKDLMFHVREVGSCSSNKRTAIDKANH  636

Query  319  VALAKYLEIDLGDQAEPL-PQRAVAPEDNNL--------YCWPWTGIVVNVSKDNANGTA  471
            + LAKY E D+   A P  P     P+ + L        + WPW  +VVN+  +  +G  
Sbjct  637  LTLAKYFENDVVLAASPSKPDTLGDPQVDTLADYDRAEIFVWPWIAVVVNLPTEFKDGRY  696

Query  472  VEE-----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
            V E     +D  ++R   +    V+   +D   +   +++ K DW+G+ NAILFE A+EA
Sbjct  697  VGESGSNLKDQLIRR--GFNPTRVRTLWNDLGHSGIALVEFKKDWSGFSNAILFEKAYEA  754

Query  637  E  639
            +
Sbjct  755  D  755


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 53/83 (64%), Gaps = 1/83 (1%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I +YKEK YEELR G    K  +    CP+C  K  +   Y+DLLQHA+G+GK S  R+ 
Sbjct  16   IEDYKEKSYEELRCGNQSFKISDVAYTCPYCQEKSGRHLFYEDLLQHASGIGK-SKIRTA  74

Query  301  KQKANHVALAKYLEIDLGDQAEP  369
            + +ANH+ALAKYLE D+   A P
Sbjct  75   RDRANHLALAKYLENDVAGAAIP  97


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query  139  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQKAN  315
            K YE+ RSG + +K  N    CP+C   +++ + YKDLLQHA G+G   S  R+ + KAN
Sbjct  178  KYYEDSRSGNHSLKISNMAFACPYCPETRERVFSYKDLLQHANGIGSSNSLKRTTRDKAN  237

Query  316  HVALAKYLEIDLGDQA  363
            H+ALAK LE D+   A
Sbjct  238  HLALAKRLEKDVAGSA  253



>ref|XP_010678966.1| PREDICTED: factor of DNA methylation 5-like [Beta vulgaris subsp. 
vulgaris]
Length=555

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I EY EK Y+  + G Y V+ P G  RCPFC  KKKQ   +K LLQHA+GVG+GSA R  
Sbjct  16   IEEYSEKVYQAFQIGTYIVQNPGGNFRCPFCPDKKKQACSFKTLLQHASGVGRGSARRRA  75

Query  301  KQKANHVALAKYLEIDLG  354
             QKA H+ALA+YLE+DLG
Sbjct  76   DQKARHLALARYLEVDLG  93



>gb|EMT16668.1| hypothetical protein F775_11900 [Aegilops tauschii]
Length=674

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 93/180 (52%), Gaps = 17/180 (9%)
 Frame = +1

Query  124  NEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVK  303
            ++Y +K Y +L+SG+   +      RCPFC GK+   Y       HA GVG  ++N + +
Sbjct  21   HDYADKAYTDLKSGRLVARFGADRFRCPFCPGKEDYRYNELLQ--HAIGVG--ASNHAAE  76

Query  304  QKANHVALAKYLEIDLGDQAEPLPQRA----VAP----EDNNLYCWPWTGIVVNVS-KDN  456
             K NH+ALA +L+ D  + A  LP R     + P    +D  L+ WPW  I+ NV+ ++ 
Sbjct  77   VKTNHLALANHLKTDYANAAGSLPPRQDEALMNPPRPVQDQELFVWPWMRILANVAVEET  136

Query  457  ANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
              G A+  +     +  +++A    + C D   T   +++ K DW G+K+ + F N +++
Sbjct  137  QRGGAIIMQQLAGFKPIRFDA----VHCPDGGYTGFAIVRFKKDWIGFKDTLGFHNYYKS  192



>ref|XP_010108755.1| hypothetical protein L484_011413 [Morus notabilis]
 gb|EXC20169.1| hypothetical protein L484_011413 [Morus notabilis]
Length=681

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 69/204 (34%), Positives = 104/204 (51%), Gaps = 33/204 (16%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRS  297
            ++E  E+ Y+EL+SGK+ VK  +G   CP+C  KKKQ+Y Y+DLLQHA+GVG   S  RS
Sbjct  41   MDESVEEAYKELKSGKHHVKLWDGTFTCPYCQKKKKQNYLYRDLLQHASGVGNSPSDKRS  100

Query  298  VKQKANHVALAKYLEIDLGDQAEP------------------------LPQRAVAPEDNN  405
             KQK  H+ALAK+LE DL     P                             V+ ++++
Sbjct  101  AKQKITHLALAKFLEKDLAGGVGPSEPAGEEKAPAPAPASAPAAAPAPAAAPVVSCDNDD  160

Query  406  LYCWPWTGIVVNV----SKDN--ANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQV  567
             + WPW GI VN+    ++D   A G+  +  D  + R   +    V+   + +  +   
Sbjct  161  KFVWPWIGIAVNLPITQTEDGRFAGGSGSKFRDELISR--GFNPTRVRPLWNYRGHSGTA  218

Query  568  VIKLKSDWNGYKNAILFENAFEAE  639
            V++    W G  NA+ FE A+EA+
Sbjct  219  VVEFNKGWPGLHNALSFERAYEAD  242



>gb|KDO72840.1| hypothetical protein CISIN_1g038527mg [Citrus sinensis]
Length=630

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 99/185 (54%), Gaps = 13/185 (7%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            + +Y+ K Y +L+ G  KV+      RCPFC GKK+ DY YK+LLQHA+ VG+ S +R  
Sbjct  15   LKDYEYKKYNQLKKGDLKVEVSETAYRCPFCRGKKETDYLYKELLQHASDVGR-SRSRGA  73

Query  301  KQKANHVAL----AKYLEIDLGDQAEPLPQ----RAVAPEDNNLYCWPWTGIVVNV-SKD  453
            ++KA H+AL    +KYL +    Q EP       +    + + L  +PW GIV N+ ++ 
Sbjct  74   REKAQHLALEKYVSKYLVVKDRSQLEPGTSSECLKITDHQPDQLLVYPWVGIVANIKTQR  133

Query  454  NANGTAVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFEN  624
              +G  V E    L+   R   +   +V      +  +   V++   DW G+KNAI+FE 
Sbjct  134  GEDGRYVGESGSKLRDEFRSKGFNPLKVHPLWSRRGHSGFAVVEFYKDWAGFKNAIMFEK  193

Query  625  AFEAE  639
            +FE +
Sbjct  194  SFEVD  198



>ref|XP_006488337.1| PREDICTED: myosin-2 heavy chain-like isoform X1 [Citrus sinensis]
 ref|XP_006488338.1| PREDICTED: myosin-2 heavy chain-like isoform X2 [Citrus sinensis]
Length=630

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 99/185 (54%), Gaps = 13/185 (7%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            + +Y+ K Y +L+ G  KV+      RCPFC GKK+ DY YK+LLQHA+ VG+ S +R  
Sbjct  15   LKDYEYKKYNQLKKGDLKVEVSETAYRCPFCRGKKETDYLYKELLQHASDVGR-SRSRGA  73

Query  301  KQKANHVAL----AKYLEIDLGDQAEPLPQ----RAVAPEDNNLYCWPWTGIVVNV-SKD  453
            ++KA H+AL    +KYL +    Q EP       +    + + L  +PW GIV N+ ++ 
Sbjct  74   REKAQHLALEKYVSKYLVVKDRSQLEPGTSSECLKITDHQPDQLLVYPWVGIVANIKTQR  133

Query  454  NANGTAVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFEN  624
              +G  V E    L+   R   +   +V      +  +   V++   DW G+KNAI+FE 
Sbjct  134  GEDGRYVGESGSKLRDEFRSKGFNPLKVHPLWSRRGHSGFAVVEFYKDWAGFKNAIMFEK  193

Query  625  AFEAE  639
            +FE +
Sbjct  194  SFEVD  198



>gb|AAB94013.1| gene X-like protein [Sorghum bicolor]
Length=895

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 86/165 (52%), Gaps = 7/165 (4%)
 Frame = +1

Query  160  SGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQKANHVALAKYL  339
            SG  KVK       C FC+ KKK +Y    L+QHA+GV   + NR  K+KA H AL KYL
Sbjct  2    SGGLKVKNNGENYSCLFCSSKKKNNYSKSSLVQHASGVS-AAPNRKAKEKAAHRALFKYL  60

Query  340  EIDLGDQAEPLPQRA-VAPE----DNNLYCWPWTGIVVNVSKDNANGTAVEEEDYWLK-R  501
            + DL   +EP P    V P+     +  + WPW GI+VNV  +  +G  + E    LK +
Sbjct  61   KNDLAKSSEPQPLVIPVEPQPLQNRDEKFVWPWMGILVNVPTEWKDGRQIGESGNRLKEQ  120

Query  502  FSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
             S +   +V      +  T   +++   DWNG++NA  FE+ F A
Sbjct  121  LSHFCPLKVIPLWTFRGHTGNAIVEFGKDWNGFRNARTFESHFAA  165



>gb|EMS57088.1| hypothetical protein TRIUR3_02882 [Triticum urartu]
Length=771

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 94/186 (51%), Gaps = 19/186 (10%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  309
            Y  K    L SG  K +  +    CPFC G+K +DY  + LLQH++GVG  + NR  K K
Sbjct  19   YGAKIQARLLSGDLKFRNGD-SYSCPFCTGRKNKDYNMQSLLQHSSGVG-AAPNRPAKDK  76

Query  310  ANHVALAKYLEIDLGDQAEPLPQRAVA----------------PEDNNLYCWPWTGIVVN  441
            A+H ALAK+L+  +   ++P   + +A                P  +  + WPW G++VN
Sbjct  77   ASHRALAKHLKNGVAKPSDPQQAQQIAVEPQQPQQIAVEPQPLPNRHEKFVWPWMGVLVN  136

Query  442  VSKDNANGTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILF  618
            V  +  +G  V E    LK   S++   +V    + +  T   +++   +WNG++NA+ F
Sbjct  137  VPTEWKDGRQVGESGNRLKGELSQFCPLKVIPLWNFRGHTGNAIVEFAKNWNGFRNALAF  196

Query  619  ENAFEA  636
            E  FEA
Sbjct  197  EKYFEA  202



>gb|EEE62370.1| hypothetical protein OsJ_17159 [Oryza sativa Japonica Group]
Length=691

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 53/171 (31%), Positives = 84/171 (49%), Gaps = 7/171 (4%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            +  Y    Y  L +G  KV       +CPFC+ +K     +  L  HA  VG    +R  
Sbjct  85   LEAYGSDTYALLEAGDIKVMNDKNMYQCPFCSDEKNDYNAHGLLQ-HALAVGSAD-DRPA  142

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYCWPWTGIVVNVSKDNANGTAVEE  480
            K+KANH ALA +L+ D  + + PL Q     + N+L+ WPW GI+VN+  +    +A   
Sbjct  143  KEKANHRALALHLKDDTAESSRPLSQPPQHSK-NDLFVWPWMGIIVNMPAEYVGKSANRL  201

Query  481  EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  633
            +++    FS Y   +V         +   +I+   DW+ ++NA+ FE+ FE
Sbjct  202  KEH----FSCYHPSKVYSVYSKGRPSGNAIIEFGKDWSSFRNALQFESEFE  248



>gb|AAL35831.2|AF434705_1 putative transcription factor X1 [Triticum monococcum]
Length=639

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 95/187 (51%), Gaps = 21/187 (11%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNG-CLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQ  306
            Y  K    L SG  K +  NG    CPFC G+K +DY  + LLQH++GVG  + NR  K 
Sbjct  19   YGAKIQARLLSGDLKFR--NGDSYSCPFCTGRKNKDYNMQSLLQHSSGVG-AAPNRPAKD  75

Query  307  KANHVALAKYLEIDLGDQAEPLPQRAVA----------------PEDNNLYCWPWTGIVV  438
            KA+H ALAK+L+  +   ++P   + +A                P  +  + WPW G++V
Sbjct  76   KASHRALAKHLKNGVAKPSDPQQAQQIAVEPQQPQQISVEPQPLPNRHEKFVWPWMGVLV  135

Query  439  NVSKDNANGTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAIL  615
            NV  +  +G  V E    LK   S++   +V    + +  T   +++   +WNG++NA+ 
Sbjct  136  NVPTEWKDGRQVGESGNRLKGELSQFCPLKVIPLWNFRGHTGNAIVEFAKNWNGFRNALA  195

Query  616  FENAFEA  636
            FE  FEA
Sbjct  196  FEKYFEA  202



>emb|CDY37917.1| BnaA06g19000D [Brassica napus]
Length=579

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 95/181 (52%), Gaps = 34/181 (19%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQ  306
            + +K Y  L+SGK KVK      +CP+C  KKK  ++YKDLLQHA+GVG   S  R+ K 
Sbjct  24   HADKIYPTLKSGKLKVKLSPQAFKCPYCPNKKKPSFQYKDLLQHASGVGNSNSEKRTSKD  83

Query  307  KANHVALAKYLEIDLGDQAEPLP----QRAVAP-----EDNNLYCWPWTGIVVNV-SKDN  456
            KA+H+AL KYL+ DL D A   P    Q+   P     +D  L C PW G+VVN+ ++  
Sbjct  84   KASHLALVKYLQQDLSDSAAAEPSSKRQKTGDPIQDCDQDEKLVC-PWKGVVVNIPTRKT  142

Query  457  ANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
             +G +  E        SK   + ++                + DWNG  NA+LF+ A++ 
Sbjct  143  QDGRSAGES------GSKLRDEYIQ----------------RGDWNGLHNALLFDKAYQV  180

Query  637  E  639
            +
Sbjct  181  D  181



>ref|NP_001054677.1| Os05g0153200 [Oryza sativa Japonica Group]
 gb|AAU44158.1| putative transcription factor [Oryza sativa Japonica Group]
 dbj|BAF16591.1| Os05g0153200 [Oryza sativa Japonica Group]
Length=617

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/168 (32%), Positives = 84/168 (50%), Gaps = 7/168 (4%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  309
            Y    Y  L +G  KV       +CPFC+ +K     +  L  HA  VG  + +R  K+K
Sbjct  14   YGSDTYALLEAGDIKVMNDKNMYQCPFCSDEKNDYNAHGLLQ-HALAVG-SADDRPAKEK  71

Query  310  ANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYCWPWTGIVVNVSKDNANGTAVEEEDY  489
            ANH ALA +L+ D  + + PL Q     + N+L+ WPW GI+VN+  +    +A   +++
Sbjct  72   ANHRALALHLKDDTAESSRPLSQPPQHSK-NDLFVWPWMGIIVNMPAEYVGKSANRLKEH  130

Query  490  WLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  633
                FS Y   +V         +   +I+   DW+ ++NA+ FE+ FE
Sbjct  131  ----FSCYHPSKVYSVYSKGRPSGNAIIEFGKDWSSFRNALQFESEFE  174



>gb|EPS61376.1| hypothetical protein M569_13419, partial [Genlisea aurea]
Length=626

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 62/173 (36%), Positives = 103/173 (60%), Gaps = 9/173 (5%)
 Frame = +1

Query  145  YEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVG-KGSANRSVKQKANHV  321
            YEE+++GK+ V+  +    CPFC+ K+K+D++YKDLLQHA+ +G +GS  RS  +KA+H+
Sbjct  18   YEEMKNGKHMVRVSDEAFSCPFCSKKRKRDFQYKDLLQHASAIGTQGSQKRSSLEKASHL  77

Query  322  ALAKYLEIDL-GDQAEPLPQ---RAVAPEDN-NLYCWPWTGIVVNVSKDNANGTAVEEED  486
            AL KYL+ ++  D   P P     A+A +D   ++ WPW GI+VN+  +  +G  V    
Sbjct  78   ALLKYLQNEIAADNGAPKPSLETDALADQDREEMFVWPWIGIIVNIPTEFKDGRFVGNSG  137

Query  487  YWLKR--FSK-YEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
              L+    SK +    V+   + +  +    ++ + DW+G+ NA+ FE  +EA
Sbjct  138  SKLRDQLASKGFNPIRVRPLWNYQGHSGTATVEFRKDWSGFGNAMAFEKEYEA  190



>gb|KHG17770.1| suppressor of gene silencing 3 -like protein [Gossypium arboreum]
Length=999

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 96/174 (55%), Gaps = 20/174 (11%)
 Frame = +1

Query  160  SGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVG-KGSANRSVKQKANHVALAKY  336
            +GK+ VK  +    CP+C   +K+ Y+Y DL+QHA+GVG   SA R+   KANH+ALAKY
Sbjct  391  NGKHIVKASDETYTCPYCP--EKKIYRYLDLVQHASGVGNSSSARRTPIMKANHLALAKY  448

Query  337  LEIDLGDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNV-SKDNANGTAVEE----  480
            LE  L      L  +  A ED    C       WPWTGIVVN+ ++ + +G  V E    
Sbjct  449  LEKGLVPLVSSL--KPAAQEDPLSGCDHDEKIVWPWTGIVVNIPTRKSEDGRTVGESGSR  506

Query  481  -EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
              D  ++R   +    V+   ++   +   V++ + DW+G  NA+ FENA+EA+
Sbjct  507  LRDELIRR--GFNPIRVRPLWNNCGHSGIAVVEFRKDWSGLHNALSFENAYEAD  558


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 105/186 (56%), Gaps = 16/186 (9%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVG-KGSANRS  297
            + +Y+++ YE L+ G+  VK  +    CP+C  KKK+ Y+Y+DLLQHA+GVG   SA R 
Sbjct  1    MGKYEDRCYETLKKGRCIVKVSDKTYICPYCPPKKKRYYRYEDLLQHASGVGDSSSAKRR  60

Query  298  VKQKANHVALAKYLE---IDLGDQAEPLPQRAV--APEDNNLYCWPWTGIVVNVS-KDNA  459
               KA+H ALAKYL+   + L   ++   Q       +D+    WPWTGIVVN+  + + 
Sbjct  61   PIVKASHRALAKYLKKNHVPLVSSSKLSAQEDTPSGHDDDEKIVWPWTGIVVNIPIRKSE  120

Query  460  NGTAVEE-----EDYWLKR-FSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFE  621
            NG +V +     +D  ++R F+      ++ +      +   V++ + DW G  +A+ FE
Sbjct  121  NGQSVGKSGSKLKDELIRRGFNPITVHPLRNY---HGHSGTAVVEFQKDWQGLHHALSFE  177

Query  622  NAFEAE  639
            NA++A+
Sbjct  178  NAYKAD  183



>emb|CDX77918.1| BnaC03g53010D [Brassica napus]
Length=584

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 66/189 (35%), Positives = 97/189 (51%), Gaps = 39/189 (21%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRS  297
            + E+ +K Y  L+SGK KVK       CP+C  KKK  ++YKDLLQHA+GVG   S  R+
Sbjct  21   MEEHADKIYLTLKSGKLKVKLSPQAFTCPYCPNKKKPSFQYKDLLQHASGVGNSNSEKRT  80

Query  298  VKQKANHVALAKYLEIDLGD-QAEPLPQRAVA-------PEDNNLYCWPWTGIVVNV-SK  450
             K+KA+H+AL KYL+ DL D +AEP  +R           +D  L C PW G+VVN+ ++
Sbjct  81   SKEKASHLALVKYLQEDLADSEAEPSSKRQKTGDPIQDCDQDEKLVC-PWKGVVVNIPTR  139

Query  451  DNANGTAVEE------EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAI  612
               +G +  E      ++Y  + F+                           WNG  NA+
Sbjct  140  KTQDGRSAGESGSKLRDEYIQRGFNPTRVH----------------------WNGLHNAL  177

Query  613  LFENAFEAE  639
            LF+ A++ +
Sbjct  178  LFDKAYQVD  186



>gb|KJB67633.1| hypothetical protein B456_010G201300 [Gossypium raimondii]
Length=725

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 96/175 (55%), Gaps = 22/175 (13%)
 Frame = +1

Query  160  SGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVG-KGSANRSVKQKANHVALAKY  336
            +GK+ VK  +    CP+C   +K+ Y+Y DL+QHA+GVG   SA R+   KANH+ALAKY
Sbjct  117  NGKHIVKASDETYTCPYCP--EKKIYRYLDLVQHASGVGNSSSARRTPIMKANHLALAKY  174

Query  337  LEIDLGDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNV-SKDNANGTAVEE----  480
            LE  L      L  +  A ED    C       WPWTGIVVN+ ++ + +G  V E    
Sbjct  175  LEKGLVPLVSSL--KPAAQEDPLSGCDHDEKIVWPWTGIVVNIPTRKSEDGRTVGESGSK  232

Query  481  -EDYWLKR-FSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
              D  ++R F+    + +   CD    +   V++   DW+G  NA+ FENA+EA+
Sbjct  233  LRDELIRRGFNPIRVRPLWNNCD---HSGIAVVEFHKDWSGLHNALSFENAYEAD  284



>gb|EAY96594.1| hypothetical protein OsI_18500 [Oryza sativa Indica Group]
Length=617

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 87/174 (50%), Gaps = 19/174 (11%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSVKQK  309
            Y    Y  L +G  KV       +CPFC+ +K     +  L  HA  VG  + +R  K+K
Sbjct  14   YGSDTYALLEAGDIKVMNDKNMYQCPFCSDEKNDYNAHGLLQ-HALAVG-SADDRPAKEK  71

Query  310  ANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYCWPWTGIVVNVSKDNANGTAVEEEDY  489
            ANH ALA +L+ D  + + PL Q     + N+L+ WPW GI+VN+  +    +A   +++
Sbjct  72   ANHRALALHLKDDTAESSRPLSQPPQHSK-NDLFVWPWMGIIVNMPAEYVGKSANRLKEH  130

Query  490  WL-----KRFSKYEAQEVKIFCDDKSRTS-QVVIKLKSDWNGYKNAILFENAFE  633
            +L     K +S Y           K R S   +I+   DW+ ++NA+ FE+ FE
Sbjct  131  FLCYHPSKVYSVY----------SKGRPSGNAIIEFGKDWSSFRNALQFESEFE  174



>gb|KJB67632.1| hypothetical protein B456_010G201300 [Gossypium raimondii]
Length=999

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 96/175 (55%), Gaps = 22/175 (13%)
 Frame = +1

Query  160  SGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVG-KGSANRSVKQKANHVALAKY  336
            +GK+ VK  +    CP+C   +K+ Y+Y DL+QHA+GVG   SA R+   KANH+ALAKY
Sbjct  391  NGKHIVKASDETYTCPYCP--EKKIYRYLDLVQHASGVGNSSSARRTPIMKANHLALAKY  448

Query  337  LEIDLGDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNV-SKDNANGTAVEE----  480
            LE  L      L  +  A ED    C       WPWTGIVVN+ ++ + +G  V E    
Sbjct  449  LEKGLVPLVSSL--KPAAQEDPLSGCDHDEKIVWPWTGIVVNIPTRKSEDGRTVGESGSK  506

Query  481  -EDYWLKR-FSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
              D  ++R F+    + +   CD    +   V++   DW+G  NA+ FENA+EA+
Sbjct  507  LRDELIRRGFNPIRVRPLWNNCD---HSGIAVVEFHKDWSGLHNALSFENAYEAD  558


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 65/186 (35%), Positives = 105/186 (56%), Gaps = 16/186 (9%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVG-KGSANRS  297
            + +Y+++ YE L+ G+  VK  +    CP+C  KKKQ Y+Y+DLLQHA+GVG   SA R 
Sbjct  1    MGKYEDRCYETLKKGRCIVKVSDKTYICPYCPPKKKQYYRYEDLLQHASGVGDSSSAKRR  60

Query  298  VKQKANHVALAKYLEIDLGD--QAEPLPQRAVAP---EDNNLYCWPWTGIVVNVS-KDNA  459
               KA+H ALAKYL+ +      +  L  +   P   +D+    WPWTGIVVN+  + + 
Sbjct  61   PIVKASHRALAKYLKKNHVPVVSSSKLSAQEDTPSGHDDDEKIVWPWTGIVVNIPIQKSE  120

Query  460  NGTAVEE-----EDYWLKR-FSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFE  621
            NG +V +     +D  ++R F+      ++ +      +   V++ + DW G  +A+ FE
Sbjct  121  NGQSVGKSGSKLKDELIRRGFNPITVHPLRNY---HGHSGTAVVEFQKDWQGLHHALSFE  177

Query  622  NAFEAE  639
            NA++A+
Sbjct  178  NAYKAD  183



>ref|XP_007141865.1| hypothetical protein PHAVU_008G232300g [Phaseolus vulgaris]
 gb|ESW13859.1| hypothetical protein PHAVU_008G232300g [Phaseolus vulgaris]
Length=1146

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 88/179 (49%), Gaps = 14/179 (8%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdyky-kdllqHATGVGKGSAN-RSVK  303
            Y  K YE L+   + VK       CP+C  KK++     +++L+HA+GVG+ S+  RS  
Sbjct  533  YVHKSYEALKKVSHIVKTSEMTFACPYCPNKKRKRDYVYREILEHASGVGQSSSQKRSAT  592

Query  304  QKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYCWPWTGIVVNV-------SKDNAN  462
            +KANH+AL KYL+ DL +   P P           + WPW GI+VN+        +   +
Sbjct  593  EKANHLALMKYLQKDLMNVDGP-PITVDEGNAEEQFVWPWAGILVNIPTRQTEDGRVGGS  651

Query  463  GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  639
            G+ + +E     R   +    V+   D    +   V++   DW G  NA+ FE A+E +
Sbjct  652  GSKLRDE----HRSRGFNPCRVRTLSDVCGHSGTAVMEFNKDWTGLDNALAFERAYELD  706


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 55/76 (72%), Gaps = 2/76 (3%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQ  306
            Y +  Y+EL+ G YKVK  +    CP+C  ++KQDYKY++LL HA+GVG+ S+  R+ K+
Sbjct  20   YVDISYQELKKGSYKVKSSDETFICPYCP-ERKQDYKYRELLNHASGVGRSSSGKRTAKE  78

Query  307  KANHVALAKYLEIDLG  354
            KANH+AL KYLE DL 
Sbjct  79   KANHLALVKYLEKDLA  94


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 55/81 (68%), Gaps = 1/81 (1%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQ  306
            Y +K Y+EL+ G + V+       CP+C  K+KQDY Y++LL HA+GVG+ S+  RSV++
Sbjct  250  YVDKFYKELKKGNHIVQTSEETFSCPYCPKKRKQDYVYRELLDHASGVGQSSSQKRSVRE  309

Query  307  KANHVALAKYLEIDLGDQAEP  369
            KA H+AL KYL+ DL    +P
Sbjct  310  KATHLALMKYLKNDLMHMNDP  330


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 74/135 (55%), Gaps = 6/135 (4%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdy-kykdllqHATGVGKG-SANR  294
            I  Y +K YEEL+ G++ VK  +    CP+C  KK      Y+++L+HA+GVG+  S  R
Sbjct  410  IGRYVDKFYEELKKGRHCVKTSDETFTCPYCPNKKLNRDYVYREILEHASGVGQSRSQKR  469

Query  295  SVKQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYCWPWTGIVVNVSKDNANGTAV  474
            S  ++ANH+AL KYL+ D+ +     P + +  +       P   ++ + S+ + N +A 
Sbjct  470  SFFERANHLALEKYLKKDVMNVGASFPSKPM--DQGTTTATPGETVMGHYSQKDNNISAT  527

Query  475  EEEDYWLKRFSKYEA  519
            +   +++ +   YEA
Sbjct  528  QISGWYVHK--SYEA  540


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 52/75 (69%), Gaps = 2/75 (3%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQ  306
            Y +  YEEL+ G Y VK  +    CP+C  ++KQDY Y++LL+HA  VG+ S+  RS ++
Sbjct  134  YVDTSYEELKKGSYNVKTSDVTFICPYCP-RRKQDYLYRELLEHAYMVGRSSSEKRSARE  192

Query  307  KANHVALAKYLEIDL  351
            +ANH+AL KYLE DL
Sbjct  193  RANHLALVKYLENDL  207



>emb|CDP09063.1| unnamed protein product [Coffea canephora]
Length=629

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 91/187 (49%), Gaps = 19/187 (10%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            + +Y  + Y +L+ G  K++       CPFC GK  +         HA+GV KGS  R +
Sbjct  15   VEDYSIQWYAKLKDGHEKLQVSGEEYSCPFCPGKVHKYSLKDLYQ-HASGVSKGSTKRKM  73

Query  301  KQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNL--------YCWPWTGIVVNVSKDN  456
            K +  H+ L +Y++ D+ D  +PL +      D+ +        + +PW GIV N+  + 
Sbjct  74   KDRGKHLGLVRYMDSDV-DIKKPLAESIKKKADDPIASAGPSEKFVYPWMGIVANIPSEK  132

Query  457  ANGTAVEE------EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILF  618
             +G  V +      +D+ LK F+  + Q +  +      +   +I+   DW G+ NA+ F
Sbjct  133  RDGRYVGDSGSKLRDDFTLKGFNPLKVQPLWNWT---GFSGYAIIEFNKDWPGFCNAMAF  189

Query  619  ENAFEAE  639
            E +FEAE
Sbjct  190  EKSFEAE  196



>ref|XP_010520107.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like [Tarenaya hassleriana]
 ref|XP_010520108.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like [Tarenaya hassleriana]
 ref|XP_010520109.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like [Tarenaya hassleriana]
Length=645

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 94/181 (52%), Gaps = 18/181 (10%)
 Frame = +1

Query  139  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQKAN  315
            K YE+L+ GK  VK       CP+C  KKK  Y+YKDLLQHA+GVG   S  RSVK+KA+
Sbjct  30   KIYEKLKGGKPVVKVSPQDFVCPYCPKKKKSSYQYKDLLQHASGVGNSNSEKRSVKEKAS  89

Query  316  HVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNVS-KDNANGTA  471
            H+ALAKYL  DL D     P  AV   D    C        PW GIVVN+      +G +
Sbjct  90   HLALAKYLGKDLADST--TPSTAVKSSDPLQGCDHYEKLVSPWKGIVVNIPITKTEDGRS  147

Query  472  VEE-----EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
              E      D +++R   Y    V+   +    +   +++   +W G  NA+LFE  ++A
Sbjct  148  TGESGSKLRDEYIQRG--YNPVRVRPLWNYMGHSGTAIVEFNKEWTGLHNALLFEKEYQA  205

Query  637  E  639
            +
Sbjct  206  D  206



>ref|XP_004490889.1| PREDICTED: uncharacterized protein LOC101499007 isoform X1 [Cicer 
arietinum]
 ref|XP_004490890.1| PREDICTED: uncharacterized protein LOC101499007 isoform X2 [Cicer 
arietinum]
 ref|XP_004490891.1| PREDICTED: uncharacterized protein LOC101499007 isoform X3 [Cicer 
arietinum]
Length=1122

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 90/190 (47%), Gaps = 27/190 (14%)
 Frame = +1

Query  139  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANR-SVKQKAN  315
            K YEEL+ G  KVK       CP+C  K+K DYKY +LL HA GVG+  A R SV +KAN
Sbjct  490  KSYEELKKGSLKVKTSEETFACPYCP-KRKWDYKYNELLNHALGVGQSDAQRRSVLEKAN  548

Query  316  HVALAKYLEIDLGDQ---------------------AEPLPQRAVAPEDNNLYCWPWTGI  432
            H+AL KYL+ DL +                       +P  +  +     N + WPWTGI
Sbjct  549  HLALVKYLKKDLMNMEYRIKPVNKYLEKDLMNVEHPTKPTNKGRLLVSSENQFVWPWTGI  608

Query  433  VVNV-SKDNANGTAVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGY  600
            VVN+ ++   +G    E    L+   R   +    V+   +    T   V++    W G 
Sbjct  609  VVNIPTRQTEDGRCFGESGSKLRDEYRSKGFNPCRVRTLWNSWGHTGAAVVEFNKSWLGL  668

Query  601  KNAILFENAF  630
             NA+ FE A+
Sbjct  669  HNALAFEKAY  678


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 53/76 (70%), Gaps = 2/76 (3%)
 Frame = +1

Query  145  YEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQKANHV  321
            YEEL+ G++KVK       CP+C  ++K DYKY +LL HATGVG+ S++ RS K+K +H+
Sbjct  25   YEELKQGRHKVKTSAETFTCPYCP-ERKHDYKYNELLNHATGVGRSSSDKRSAKEKGSHL  83

Query  322  ALAKYLEIDLGDQAEP  369
            AL KYLE DL  +  P
Sbjct  84   ALVKYLEEDLPSKDSP  99


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 54/88 (61%), Gaps = 5/88 (6%)
 Frame = +1

Query  139  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdyky-kdllqHATGVG-KGSANRSVKQKA  312
            K YE+L+ G   VK  +    CP+C  KK++     +++L+HA+GVG   S NRS  +KA
Sbjct  372  KSYEQLKKGIQNVKSSDDTFICPYCPNKKRKRDYAYREILEHASGVGWSSSQNRSAIEKA  431

Query  313  NHVALAKYLEIDL---GDQAEPLPQRAV  387
            NH+AL KYL+ DL   G  +EP+ +  +
Sbjct  432  NHLALVKYLKKDLINVGGSSEPMDEGTI  459


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKG-SANRSVKQ  306
            Y +K Y+EL+ G   V+  +    CP+C   +K  Y+Y++LL+HA+GVG+  S  RSV++
Sbjct  249  YVDKFYKELKKGSLNVRISDAAFTCPYCPKMRKPTYEYRELLEHASGVGQSCSQKRSVRE  308

Query  307  KANHVALAKYLEIDL  351
            KA H+AL KYL+ D+
Sbjct  309  KATHLALVKYLKNDI  323


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 68/123 (55%), Gaps = 6/123 (5%)
 Frame = +1

Query  130  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSAN-RSVKQ  306
            Y +  YEEL++G    K  +G   CP+C  K+KQDY Y++LL+HA  VG+ S+  RS ++
Sbjct  131  YVDTAYEELKNGTQNAKTSDGNFICPYCP-KRKQDYAYRELLEHAFMVGRSSSEKRSARE  189

Query  307  KANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYCWPWTGIVVNVSKDNANGTAVEEED  486
            +ANH+AL KYLE D+   + P P + V  +  NL     T + V     N +    E + 
Sbjct  190  RANHLALLKYLEKDV--VSMPGPSKPVE-KGTNLISQEQT-VTVTAHNSNKDTDTSESQI  245

Query  487  YWL  495
             W 
Sbjct  246  SWF  248



>ref|NP_001146275.1| putative transcription factor [Zea mays]
 gb|AAM22636.1|AF434193_1 X1 [Zea mays]
 gb|ACL53618.1| unknown [Zea mays]
 gb|ACN27531.1| unknown [Zea mays]
 tpg|DAA58437.1| TPA: putative XH domain family protein isoform 1 [Zea mays]
 tpg|DAA58438.1| TPA: putative XH domain family protein isoform 2 [Zea mays]
 tpg|DAA58439.1| TPA: putative XH domain family protein isoform 3 [Zea mays]
Length=628

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 91/179 (51%), Gaps = 10/179 (6%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I++Y+ K Y  L SG  K+        CPFC+  KK++Y    L+QHA+GV   + NR  
Sbjct  16   IDDYEGKIYARLMSGDLKLNKNGENYICPFCS-SKKKNYSKSSLVQHASGVS-AAPNREA  73

Query  301  KQKANHVALAKYLEIDL------GDQAEPLPQRAVAPEDNNLYCWPWTGIVVNVSKDNAN  462
            K+KA H AL KYL+  L      G  A P+  + +   D   + WPW G++VNV  +  +
Sbjct  74   KEKAVHRALFKYLKNGLAKSPEPGSHATPVEPQPLQNRDEK-FVWPWMGVLVNVPTEWKD  132

Query  463  GTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
            G  + E    LK + S +    V      +  T   +++   DWNG++NA  FE+ F A
Sbjct  133  GRQIGESGNRLKEQLSHFCPLRVIPLWTFRGHTGNAIVEFGKDWNGFRNARTFESHFAA  191



>tpg|DAA58436.1| TPA: putative XH domain family protein [Zea mays]
Length=489

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 91/179 (51%), Gaps = 10/179 (6%)
 Frame = +1

Query  121  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllqHATGVGKGSANRSV  300
            I++Y+ K Y  L SG  K+        CPFC+  KK++Y    L+QHA+GV   + NR  
Sbjct  16   IDDYEGKIYARLMSGDLKLNKNGENYICPFCS-SKKKNYSKSSLVQHASGVS-AAPNREA  73

Query  301  KQKANHVALAKYLEIDL------GDQAEPLPQRAVAPEDNNLYCWPWTGIVVNVSKDNAN  462
            K+KA H AL KYL+  L      G  A P+  + +   D   + WPW G++VNV  +  +
Sbjct  74   KEKAVHRALFKYLKNGLAKSPEPGSHATPVEPQPLQNRDEK-FVWPWMGVLVNVPTEWKD  132

Query  463  GTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  636
            G  + E    LK + S +    V      +  T   +++   DWNG++NA  FE+ F A
Sbjct  133  GRQIGESGNRLKEQLSHFCPLRVIPLWTFRGHTGNAIVEFGKDWNGFRNARTFESHFAA  191



Lambda      K        H        a         alpha
   0.316    0.132    0.409    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 960833956375