BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF041G16

Length=620
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009771340.1|  PREDICTED: uncharacterized protein LOC104221...    114   5e-26   Nicotiana sylvestris
ref|XP_011089894.1|  PREDICTED: uncharacterized protein LOC105170709    113   9e-26   Sesamum indicum [beniseed]
emb|CDP07119.1|  unnamed protein product                                112   2e-25   Coffea canephora [robusta coffee]
ref|XP_011089303.1|  PREDICTED: uncharacterized protein LOC105170...    108   4e-24   Sesamum indicum [beniseed]
ref|XP_009592141.1|  PREDICTED: uncharacterized protein LOC104089035    108   6e-24   Nicotiana tomentosiformis
ref|XP_010321950.1|  PREDICTED: uncharacterized protein LOC101265...    106   2e-23   Solanum lycopersicum
ref|XP_010321949.1|  PREDICTED: uncharacterized protein LOC101265...    107   2e-23   Solanum lycopersicum
ref|XP_004240679.1|  PREDICTED: uncharacterized protein LOC101265...    107   2e-23   Solanum lycopersicum
ref|XP_006343443.1|  PREDICTED: uncharacterized protein LOC102596732    104   1e-22   Solanum tuberosum [potatoes]
ref|XP_009771341.1|  PREDICTED: uncharacterized protein LOC104221...    103   3e-22   Nicotiana sylvestris
ref|XP_011089306.1|  PREDICTED: uncharacterized protein LOC105170...    102   5e-22   Sesamum indicum [beniseed]
ref|XP_006340158.1|  PREDICTED: uncharacterized protein LOC102578157  98.6    2e-20   Solanum tuberosum [potatoes]
ref|XP_010651156.1|  PREDICTED: uncharacterized protein LOC100257089  97.4    6e-20   Vitis vinifera
emb|CAN77236.1|  hypothetical protein VITISV_024209                   97.4    1e-19   Vitis vinifera
ref|XP_004251127.1|  PREDICTED: uncharacterized protein LOC101256453  96.3    2e-19   Solanum lycopersicum
gb|KJB56107.1|  hypothetical protein B456_009G106300                  93.2    4e-19   Gossypium raimondii
gb|KHG21185.1|  E3 ubiquitin-protein ligase MARCH7                    94.4    7e-19   Gossypium arboreum [tree cotton]
ref|XP_009791385.1|  PREDICTED: uncharacterized protein LOC104238...  94.0    9e-19   Nicotiana sylvestris
gb|KJB56108.1|  hypothetical protein B456_009G106300                  93.2    9e-19   Gossypium raimondii
gb|KJB56106.1|  hypothetical protein B456_009G106300                  93.2    1e-18   Gossypium raimondii
gb|KJB56105.1|  hypothetical protein B456_009G106300                  93.6    1e-18   Gossypium raimondii
gb|KJB56109.1|  hypothetical protein B456_009G106300                  93.2    2e-18   Gossypium raimondii
gb|KJB56110.1|  hypothetical protein B456_009G106300                  92.8    2e-18   Gossypium raimondii
ref|XP_006424589.1|  hypothetical protein CICLE_v10028219mg           89.7    7e-18   
gb|KDO73243.1|  hypothetical protein CISIN_1g010219mg                 90.1    2e-17   Citrus sinensis [apfelsine]
ref|XP_006488111.1|  PREDICTED: uncharacterized protein LOC102606695  89.7    2e-17   Citrus sinensis [apfelsine]
ref|XP_006424588.1|  hypothetical protein CICLE_v10028219mg           89.7    3e-17   Citrus clementina [clementine]
ref|XP_009596995.1|  PREDICTED: uncharacterized protein LOC104093...  89.4    3e-17   Nicotiana tomentosiformis
ref|XP_009791384.1|  PREDICTED: uncharacterized protein LOC104238...  88.2    1e-16   Nicotiana sylvestris
ref|XP_007016718.1|  RING/U-box superfamily protein isoform 1         87.4    2e-16   
ref|XP_007016719.1|  RING/U-box superfamily protein isoform 2         87.4    2e-16   
ref|XP_002530288.1|  protein binding protein, putative                86.3    4e-16   
ref|XP_009596994.1|  PREDICTED: uncharacterized protein LOC104093...  81.6    1e-14   Nicotiana tomentosiformis
gb|KDP44062.1|  hypothetical protein JCGZ_05529                       80.9    3e-14   Jatropha curcas
ref|XP_009335079.1|  PREDICTED: uncharacterized protein LOC103927...  77.0    6e-13   Pyrus x bretschneideri [bai li]
ref|XP_007207622.1|  hypothetical protein PRUPE_ppa020301mg           76.6    7e-13   
gb|KJB26162.1|  hypothetical protein B456_004G228500                  75.9    8e-13   Gossypium raimondii
ref|XP_009335077.1|  PREDICTED: uncharacterized protein LOC103927...  76.6    9e-13   Pyrus x bretschneideri [bai li]
ref|XP_009335078.1|  PREDICTED: uncharacterized protein LOC103927...  76.6    9e-13   Pyrus x bretschneideri [bai li]
gb|KJB26164.1|  hypothetical protein B456_004G228500                  76.3    9e-13   Gossypium raimondii
gb|KJB26161.1|  hypothetical protein B456_004G228500                  75.9    1e-12   Gossypium raimondii
ref|XP_007205129.1|  hypothetical protein PRUPE_ppa005009mg           75.5    2e-12   Prunus persica
gb|KJB16803.1|  hypothetical protein B456_002G248600                  74.7    2e-12   Gossypium raimondii
ref|XP_007027307.1|  Binding protein, putative isoform 6              74.3    2e-12   
gb|KHG08412.1|  putative E3 ubiquitin-protein ligase MARCH10          75.1    3e-12   Gossypium arboreum [tree cotton]
gb|KJB16804.1|  hypothetical protein B456_002G248600                  74.3    3e-12   Gossypium raimondii
ref|XP_010253651.1|  PREDICTED: uncharacterized protein LOC104594...  73.9    4e-12   Nelumbo nucifera [Indian lotus]
ref|XP_010253650.1|  PREDICTED: uncharacterized protein LOC104594...  74.3    4e-12   Nelumbo nucifera [Indian lotus]
ref|XP_007027306.1|  RING/U-box superfamily protein, putative iso...  74.3    4e-12   
ref|XP_008225582.1|  PREDICTED: uncharacterized protein LOC103325214  74.3    5e-12   Prunus mume [ume]
gb|KJB16805.1|  hypothetical protein B456_002G248600                  74.3    5e-12   Gossypium raimondii
gb|KJB16801.1|  hypothetical protein B456_002G248600                  74.3    5e-12   Gossypium raimondii
ref|XP_007027302.1|  Binding protein, putative isoform 1              74.3    5e-12   
ref|XP_009630868.1|  PREDICTED: uncharacterized protein LOC104120...  73.2    1e-11   Nicotiana tomentosiformis
gb|KDP29105.1|  hypothetical protein JCGZ_16494                       73.2    1e-11   Jatropha curcas
ref|XP_009630869.1|  PREDICTED: uncharacterized protein LOC104120...  72.4    2e-11   Nicotiana tomentosiformis
gb|KHG09093.1|  E3 ubiquitin-protein ligase MARCH7                    72.8    2e-11   Gossypium arboreum [tree cotton]
ref|XP_002519545.1|  protein binding protein, putative                72.4    2e-11   
ref|XP_002280929.2|  PREDICTED: uncharacterized protein LOC100265...  71.6    3e-11   Vitis vinifera
ref|XP_010653565.1|  PREDICTED: uncharacterized protein LOC100265...  71.6    4e-11   
ref|XP_009769900.1|  PREDICTED: uncharacterized protein LOC104220...  71.2    4e-11   Nicotiana sylvestris
emb|CAN69885.1|  hypothetical protein VITISV_005071                   71.2    5e-11   Vitis vinifera
ref|XP_009769901.1|  PREDICTED: uncharacterized protein LOC104220...  70.9    5e-11   Nicotiana sylvestris
ref|XP_008385400.1|  PREDICTED: uncharacterized protein LOC103447955  70.9    7e-11   
ref|XP_004148772.1|  PREDICTED: uncharacterized protein LOC101213858  70.9    7e-11   Cucumis sativus [cucumbers]
ref|XP_004166546.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  70.5    7e-11   
ref|XP_008463882.1|  PREDICTED: uncharacterized protein LOC103501...  70.5    9e-11   
ref|XP_008463872.1|  PREDICTED: uncharacterized protein LOC103501...  70.1    1e-10   Cucumis melo [Oriental melon]
ref|XP_009367089.1|  PREDICTED: uncharacterized protein LOC103956...  69.7    1e-10   Pyrus x bretschneideri [bai li]
ref|XP_009367091.1|  PREDICTED: uncharacterized protein LOC103956...  69.3    2e-10   Pyrus x bretschneideri [bai li]
ref|XP_006400834.1|  hypothetical protein EUTSA_v10013381mg           69.3    2e-10   Eutrema salsugineum [saltwater cress]
ref|XP_010098199.1|  hypothetical protein L484_007661                 69.3    2e-10   
ref|XP_006400833.1|  hypothetical protein EUTSA_v10013381mg           68.9    3e-10   
ref|XP_010043740.1|  PREDICTED: uncharacterized protein LOC104432...  68.6    3e-10   Eucalyptus grandis [rose gum]
ref|XP_008243925.1|  PREDICTED: uncharacterized protein LOC103342122  68.6    4e-10   Prunus mume [ume]
ref|XP_007145227.1|  hypothetical protein PHAVU_007G221300g           68.2    4e-10   Phaseolus vulgaris [French bean]
ref|XP_007027305.1|  Binding protein, putative isoform 4              67.8    5e-10   
ref|XP_008359119.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  68.2    5e-10   
ref|XP_011048564.1|  PREDICTED: E3 ubiquitin-protein ligase MARCH...  68.2    5e-10   Populus euphratica
ref|XP_010043741.1|  PREDICTED: uncharacterized protein LOC104432...  67.8    6e-10   Eucalyptus grandis [rose gum]
ref|XP_007027304.1|  Binding protein, putative isoform 3              67.8    6e-10   
ref|XP_008463891.1|  PREDICTED: uncharacterized protein LOC103501...  67.4    7e-10   Cucumis melo [Oriental melon]
ref|XP_007027303.1|  Binding protein, putative isoform 2              67.0    9e-10   
ref|XP_008387645.1|  PREDICTED: uncharacterized protein LOC103450102  64.3    1e-09   
ref|XP_006361814.1|  PREDICTED: uncharacterized protein LOC102593861  66.2    2e-09   Solanum tuberosum [potatoes]
ref|XP_010920401.1|  PREDICTED: uncharacterized protein LOC105044280  66.2    2e-09   Elaeis guineensis
ref|XP_004246665.1|  PREDICTED: uncharacterized protein LOC101249200  65.9    3e-09   Solanum lycopersicum
gb|KJB56111.1|  hypothetical protein B456_009G106300                  64.7    5e-09   Gossypium raimondii
ref|XP_009342773.1|  PREDICTED: uncharacterized protein LOC103934748  65.1    6e-09   Pyrus x bretschneideri [bai li]
gb|KCW49745.1|  hypothetical protein EUGRSUZ_K03240                   63.9    1e-08   Eucalyptus grandis [rose gum]
emb|CDP06734.1|  unnamed protein product                              63.9    1e-08   Coffea canephora [robusta coffee]
gb|AFK33495.1|  unknown                                               61.6    1e-08   Lotus japonicus
gb|KCW49744.1|  hypothetical protein EUGRSUZ_K03240                   63.9    1e-08   Eucalyptus grandis [rose gum]
ref|XP_010037957.1|  PREDICTED: uncharacterized protein LOC104426553  63.5    2e-08   Eucalyptus grandis [rose gum]
ref|XP_002864692.1|  zinc finger family protein                       62.0    4e-08   
gb|AAK32917.1|AF367330_1  AT5g60580/muf9_230                          62.0    5e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568923.1|  RING/U-box domain-containing protein                61.6    6e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_851232.1|  RING/U-box domain-containing protein                61.6    7e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010456560.1|  PREDICTED: E3 ubiquitin-protein ligase MARCH7    61.2    8e-08   
ref|XP_003539714.1|  PREDICTED: probable E3 ubiquitin-protein lig...  61.2    1e-07   Glycine max [soybeans]
gb|KHN32082.1|  hypothetical protein glysoja_028877                   61.2    1e-07   Glycine soja [wild soybean]
ref|XP_006591142.1|  PREDICTED: E3 ubiquitin-protein ligase MARCH...  60.8    1e-07   Glycine max [soybeans]
gb|KHN38770.1|  hypothetical protein glysoja_008319                   60.8    1e-07   Glycine soja [wild soybean]
ref|XP_006381467.1|  hypothetical protein POPTR_0006s13100g           60.5    1e-07   
ref|XP_010443856.1|  PREDICTED: E3 ubiquitin-protein ligase MARCH...  60.5    2e-07   Camelina sativa [gold-of-pleasure]
emb|CDY67417.1|  BnaC09g53890D                                        59.7    3e-07   Brassica napus [oilseed rape]
ref|XP_011468102.1|  PREDICTED: uncharacterized protein LOC101308698  59.3    4e-07   Fragaria vesca subsp. vesca
gb|EYU34440.1|  hypothetical protein MIMGU_mgv1a004524mg              58.9    5e-07   Erythranthe guttata [common monkey flower]
gb|KJB20261.1|  hypothetical protein B456_003G141100                  58.5    5e-07   Gossypium raimondii
gb|KJB20263.1|  hypothetical protein B456_003G141100                  58.5    5e-07   Gossypium raimondii
gb|KJB20268.1|  hypothetical protein B456_003G141100                  58.5    5e-07   Gossypium raimondii
gb|KJB20264.1|  hypothetical protein B456_003G141100                  58.5    7e-07   Gossypium raimondii
gb|KJB20265.1|  hypothetical protein B456_003G141100                  58.5    7e-07   Gossypium raimondii
gb|KJB20266.1|  hypothetical protein B456_003G141100                  58.5    7e-07   Gossypium raimondii
gb|KJB20262.1|  hypothetical protein B456_003G141100                  58.2    8e-07   Gossypium raimondii
gb|KJB20267.1|  hypothetical protein B456_003G141100                  58.2    9e-07   Gossypium raimondii
ref|XP_006378964.1|  hypothetical protein POPTR_0009s01890g           57.8    1e-06   
ref|XP_006854502.1|  hypothetical protein AMTR_s00175p00053490        57.4    2e-06   Amborella trichopoda
ref|XP_002314269.1|  hypothetical protein POPTR_0009s01890g           57.4    2e-06   
ref|XP_011094674.1|  PREDICTED: uncharacterized protein LOC105174...  57.0    2e-06   Sesamum indicum [beniseed]
gb|EYU18838.1|  hypothetical protein MIMGU_mgv1a005388mg              57.0    2e-06   Erythranthe guttata [common monkey flower]
ref|XP_011094675.1|  PREDICTED: uncharacterized protein LOC105174...  57.0    2e-06   Sesamum indicum [beniseed]
ref|XP_007132248.1|  hypothetical protein PHAVU_011G078700g           57.0    3e-06   Phaseolus vulgaris [French bean]
ref|XP_006282160.1|  hypothetical protein CARUB_v10028418mg           56.6    3e-06   Capsella rubella
ref|XP_010483706.1|  PREDICTED: E3 ubiquitin-protein ligase MARCH...  56.2    4e-06   
ref|XP_010483705.1|  PREDICTED: E3 ubiquitin-protein ligase MARCH...  56.2    4e-06   
ref|XP_004505986.1|  PREDICTED: E3 ubiquitin-protein ligase MARCH...  55.8    5e-06   Cicer arietinum [garbanzo]
ref|XP_007016720.1|  RING/U-box superfamily protein isoform 3         55.5    7e-06   
ref|XP_010558263.1|  PREDICTED: uncharacterized protein LOC104826973  55.5    7e-06   Tarenaya hassleriana [spider flower]
ref|XP_009126594.1|  PREDICTED: uncharacterized protein LOC103851...  55.5    7e-06   Brassica rapa
ref|XP_009126595.1|  PREDICTED: uncharacterized protein LOC103851...  55.5    7e-06   Brassica rapa
emb|CDY09194.1|  BnaA02g06200D                                        55.5    8e-06   Brassica napus [oilseed rape]
ref|XP_010689560.1|  PREDICTED: uncharacterized protein LOC104903248  55.1    9e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009126593.1|  PREDICTED: uncharacterized protein LOC103851...  55.1    1e-05   Brassica rapa
ref|XP_009126592.1|  PREDICTED: uncharacterized protein LOC103851...  55.1    1e-05   Brassica rapa
ref|XP_008369756.1|  PREDICTED: uncharacterized protein LOC103433283  54.3    2e-05   
ref|XP_009377416.1|  PREDICTED: uncharacterized protein LOC103966027  53.5    4e-05   Pyrus x bretschneideri [bai li]
ref|XP_004497493.1|  PREDICTED: uncharacterized protein LOC101500530  53.1    4e-05   Cicer arietinum [garbanzo]
gb|KEH30052.1|  RING/U-box protein                                    52.8    5e-05   Medicago truncatula
ref|XP_008369770.1|  PREDICTED: uncharacterized protein LOC103433299  52.4    7e-05   
gb|AES88591.2|  RING/U-box protein                                    52.4    8e-05   Medicago truncatula
ref|XP_003606394.1|  hypothetical protein MTR_4g059540                52.4    8e-05   
gb|KEH30051.1|  RING/U-box protein                                    52.4    9e-05   Medicago truncatula
ref|XP_006836375.1|  hypothetical protein AMTR_s00092p00120720        51.6    1e-04   
ref|XP_008791532.1|  PREDICTED: uncharacterized protein LOC103708...  51.6    1e-04   
ref|XP_008791531.1|  PREDICTED: uncharacterized protein LOC103708...  51.6    2e-04   
ref|XP_008791528.1|  PREDICTED: uncharacterized protein LOC103708...  51.6    2e-04   Phoenix dactylifera
ref|XP_008791529.1|  PREDICTED: uncharacterized protein LOC103708...  51.2    2e-04   
gb|KFK27585.1|  hypothetical protein AALP_AA8G403000                  51.2    2e-04   Arabis alpina [alpine rockcress]
ref|XP_006594143.1|  PREDICTED: E3 ubiquitin-protein ligase MARCH...  50.4    4e-04   Glycine max [soybeans]
ref|XP_009596996.1|  PREDICTED: uncharacterized protein LOC104093...  50.1    4e-04   Nicotiana tomentosiformis
ref|XP_011044364.1|  PREDICTED: uncharacterized protein LOC105139...  50.1    4e-04   Populus euphratica
ref|XP_011044368.1|  PREDICTED: uncharacterized protein LOC105139...  50.1    5e-04   Populus euphratica
ref|XP_011044366.1|  PREDICTED: uncharacterized protein LOC105139...  50.1    5e-04   Populus euphratica
ref|XP_011044365.1|  PREDICTED: uncharacterized protein LOC105139...  50.1    5e-04   Populus euphratica
ref|XP_011044367.1|  PREDICTED: uncharacterized protein LOC105139...  50.1    5e-04   Populus euphratica
ref|XP_009120591.1|  PREDICTED: uncharacterized protein LOC103845...  49.7    6e-04   Brassica rapa
ref|XP_009120590.1|  PREDICTED: uncharacterized protein LOC103845...  49.7    7e-04   Brassica rapa
gb|KDO44228.1|  hypothetical protein CISIN_1g0103781mg                49.7    7e-04   Citrus sinensis [apfelsine]
ref|XP_008806817.1|  PREDICTED: uncharacterized protein LOC103719384  49.7    7e-04   
emb|CDY31533.1|  BnaA10g13380D                                        49.3    8e-04   Brassica napus [oilseed rape]
gb|KDO44229.1|  hypothetical protein CISIN_1g0103781mg                49.3    8e-04   Citrus sinensis [apfelsine]



>ref|XP_009771340.1| PREDICTED: uncharacterized protein LOC104221895 isoform X1 [Nicotiana 
sylvestris]
Length=512

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 101/160 (63%), Gaps = 10/160 (6%)
 Frame = +2

Query  143  MDREKKETFLSEGEDVQNGGRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMS  322
            M  E+KE  +++   V     RE  I IPK  SSS I +E T  KH R+PNLSLEIP  +
Sbjct  1    MSEEQKEKSMADEGHV---CEREVVIPIPKMESSSAITDERTHAKHWRKPNLSLEIPSRT  57

Query  323  LQNSREEIVQIkklltptptakkVNFLVTPSPSDPRVNGSPGHLP-RAKSSIRNLLPKLN  499
            L  SR+E+ QIK   TPTPT K+VNFL+TPS +D R+  SPG  P R KS+IRNL PKLN
Sbjct  58   LDASRQELAQIKMPSTPTPTPKRVNFLLTPSTADSRITSSPGPSPSRGKSAIRNLFPKLN  117

Query  500  FMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISISRSWSL  619
              S   NLD EK    D G  A  PQ+KV   SISRSWSL
Sbjct  118  LKSR-MNLD-EKITIPDSG-PAVVPQEKV---SISRSWSL  151



>ref|XP_011089894.1| PREDICTED: uncharacterized protein LOC105170709 [Sesamum indicum]
Length=518

 Score =   113 bits (283),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 97/162 (60%), Gaps = 8/162 (5%)
 Frame = +2

Query  143  MDREKKETFLSEGEDVQNGGRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMS  322
            M  E++   + E  D  +       + I K   SSG+  E    KH R+ NL LEIP  +
Sbjct  1    MSAEEENRAIDELRDGSSAAEARVVVPIQKLEKSSGMAAETPNSKHWRKSNLFLEIPTRT  60

Query  323  LQNSREEIVQIkklltptptakkVNFLVTPSPSDPRVNGSPGHLP---RAKSSIRNLLPK  493
            L+ SR+E VQIK   TPTPT K+VNFLVTPSPSD R+NGSP  LP   R KSSIRN+LPK
Sbjct  61   LEVSRQEFVQIKMPPTPTPTPKRVNFLVTPSPSDSRLNGSP--LPSSTRGKSSIRNILPK  118

Query  494  LNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISISRSWSL  619
            LNF    S+ D+EKA  ID     T  QDK    S+SRSWS 
Sbjct  119  LNFKHRASSSDVEKAGSIDSSSLTTVTQDKP---SMSRSWSF  157



>emb|CDP07119.1| unnamed protein product [Coffea canephora]
Length=536

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 94/141 (67%), Gaps = 6/141 (4%)
 Frame = +2

Query  206  RETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptpta  385
            RE  I +PK  SSSGI EE    K+ R+ NL LEIP  ++  S  E VQIK   TPTPT 
Sbjct  30   REVVIPMPKVESSSGITEETGNAKNWRKQNLFLEIPTRTMDASCAEFVQIKMPPTPTPTP  89

Query  386  kkVNFLVTPSPSDPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSN--LDMEKAPDIDLG  556
            K+VNF++TPSPSD R+N SPG    RAKSSI+NLLPKL+F + N N   D++KA + D G
Sbjct  90   KRVNFMLTPSPSDSRLNSSPGPSSSRAKSSIKNLLPKLSFKNRNLNPETDIDKASNFDSG  149

Query  557  CSATAPQDKVVSISISRSWSL  619
             S TA Q+K    S+ RSWSL
Sbjct  150  SSTTASQEKP---SMLRSWSL  167



>ref|XP_011089303.1| PREDICTED: uncharacterized protein LOC105170304 isoform X1 [Sesamum 
indicum]
 ref|XP_011089304.1| PREDICTED: uncharacterized protein LOC105170304 isoform X1 [Sesamum 
indicum]
Length=514

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 97/141 (69%), Gaps = 4/141 (3%)
 Frame = +2

Query  200  GRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptp  379
            G  +    IP   +SSG+ EE +Q K  R+PNL LEIP  SL+ + +E ++IK   TPTP
Sbjct  16   GTTQAVCPIPNLENSSGMNEETSQGKQWRKPNLFLEIPSRSLEVTPQEFMEIKMPPTPTP  75

Query  380  takkVNFLVTPSPSDPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLG  556
            T K+VNF++T SPSD R++GS G    + KSSIR++LP L+F + +SN ++EKA +ID G
Sbjct  76   TPKRVNFVLTRSPSDSRLHGSSGPSSTKGKSSIRSILPWLSFKNRSSNSEVEKAANIDSG  135

Query  557  CSATAPQDKVVSISISRSWSL  619
            CS   PQDK   +SISRSWSL
Sbjct  136  CSTMVPQDK---LSISRSWSL  153



>ref|XP_009592141.1| PREDICTED: uncharacterized protein LOC104089035 [Nicotiana tomentosiformis]
Length=505

 Score =   108 bits (269),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 90/139 (65%), Gaps = 7/139 (5%)
 Frame = +2

Query  206  RETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptpta  385
            RE  I IPK  SSS I EE T  KH R+PNLSLEIP  +L  SR+E+VQIK   TPTPT 
Sbjct  10   REVVIPIPKMESSSAINEERTHAKHWRKPNLSLEIPSRTLDASRQELVQIKMPSTPTPTP  69

Query  386  kkVNFLVTPSPSDPRVNGSPGHLP-RAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCS  562
            K+VNFL+TPS +D R+  SPG  P R K +IRNL PKLN     S + +++   I     
Sbjct  70   KRVNFLLTPSTADSRITSSPGPSPSRGKLAIRNLFPKLNL---KSRMILDEKITIPDSGP  126

Query  563  ATAPQDKVVSISISRSWSL  619
            A  PQ+KV   SISRSWSL
Sbjct  127  AVVPQEKV---SISRSWSL  142



>ref|XP_010321950.1| PREDICTED: uncharacterized protein LOC101265737 isoform X3 [Solanum 
lycopersicum]
Length=456

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 98/163 (60%), Gaps = 6/163 (4%)
 Frame = +2

Query  140  VMDREKKETFLSEGED--VQNGGRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIP  313
            +M  E K+  ++E  D  V++       I IP+  SSSGI EE    K  +RPNL +EIP
Sbjct  1    MMKCEAKDKSMAEVYDEYVRSSVCERVAIQIPQGESSSGITEESEHAKQWKRPNLFVEIP  60

Query  314  MMSLQNSREEIVQIkklltptptakkVNFLVTPSPSDPRVNGSPG-HLPRAKSSIRNLLP  490
              S   + +E VQ+K L TPTPT K+VNFL+TPSPS+ RVN  P     R KSSI+NLLP
Sbjct  61   SKSSDAANQESVQVKMLSTPTPTPKRVNFLLTPSPSNSRVNAFPSPSSCRGKSSIKNLLP  120

Query  491  KLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISISRSWSL  619
            +L+F   N N D EKA   D   SA  PQ+KV   SI RSWS 
Sbjct  121  RLSFKLRNMNSDTEKATLPDSDTSAMVPQEKV---SIPRSWSF  160



>ref|XP_010321949.1| PREDICTED: uncharacterized protein LOC101265737 isoform X2 [Solanum 
lycopersicum]
Length=503

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 98/163 (60%), Gaps = 6/163 (4%)
 Frame = +2

Query  140  VMDREKKETFLSEGED--VQNGGRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIP  313
            +M  E K+  ++E  D  V++       I IP+  SSSGI EE    K  +RPNL +EIP
Sbjct  1    MMKCEAKDKSMAEVYDEYVRSSVCERVAIQIPQGESSSGITEESEHAKQWKRPNLFVEIP  60

Query  314  MMSLQNSREEIVQIkklltptptakkVNFLVTPSPSDPRVNGSPG-HLPRAKSSIRNLLP  490
              S   + +E VQ+K L TPTPT K+VNFL+TPSPS+ RVN  P     R KSSI+NLLP
Sbjct  61   SKSSDAANQESVQVKMLSTPTPTPKRVNFLLTPSPSNSRVNAFPSPSSCRGKSSIKNLLP  120

Query  491  KLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISISRSWSL  619
            +L+F   N N D EKA   D   SA  PQ+KV   SI RSWS 
Sbjct  121  RLSFKLRNMNSDTEKATLPDSDTSAMVPQEKV---SIPRSWSF  160



>ref|XP_004240679.1| PREDICTED: uncharacterized protein LOC101265737 isoform X1 [Solanum 
lycopersicum]
Length=504

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 98/163 (60%), Gaps = 6/163 (4%)
 Frame = +2

Query  140  VMDREKKETFLSEGED--VQNGGRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIP  313
            +M  E K+  ++E  D  V++       I IP+  SSSGI EE    K  +RPNL +EIP
Sbjct  1    MMKCEAKDKSMAEVYDEYVRSSVCERVAIQIPQGESSSGITEESEHAKQWKRPNLFVEIP  60

Query  314  MMSLQNSREEIVQIkklltptptakkVNFLVTPSPSDPRVNGSPG-HLPRAKSSIRNLLP  490
              S   + +E VQ+K L TPTPT K+VNFL+TPSPS+ RVN  P     R KSSI+NLLP
Sbjct  61   SKSSDAANQESVQVKMLSTPTPTPKRVNFLLTPSPSNSRVNAFPSPSSCRGKSSIKNLLP  120

Query  491  KLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISISRSWSL  619
            +L+F   N N D EKA   D   SA  PQ+KV   SI RSWS 
Sbjct  121  RLSFKLRNMNSDTEKATLPDSDTSAMVPQEKV---SIPRSWSF  160



>ref|XP_006343443.1| PREDICTED: uncharacterized protein LOC102596732 [Solanum tuberosum]
Length=508

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 97/163 (60%), Gaps = 6/163 (4%)
 Frame = +2

Query  140  VMDREKKETFLSEGED--VQNGGRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIP  313
            +M  E+K+  ++E  D  V++       I IP+  SSSGI EE    K  +RPNL +EIP
Sbjct  1    MMRCEQKDKSMAEVYDEYVRSNVCERVAIQIPQGKSSSGITEESEHAKQWKRPNLFVEIP  60

Query  314  MMSLQNSREEIVQIkklltptptakkVNFLVTPSPSDPRVNGSPG-HLPRAKSSIRNLLP  490
              S   S +E VQ+K L  PTPT K+VNFL+TPSPS+ R N  P     R KSSI++LLP
Sbjct  61   SKSSDASNQESVQVKMLSAPTPTPKRVNFLLTPSPSNSRANAFPSPSSCRGKSSIKSLLP  120

Query  491  KLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISISRSWSL  619
            +L+F   N N D EKA   D   SA  PQ+KV   SI RSWS 
Sbjct  121  RLSFKLRNMNSDTEKATLPDSDTSAMVPQEKV---SIPRSWSF  160



>ref|XP_009771341.1| PREDICTED: uncharacterized protein LOC104221895 isoform X2 [Nicotiana 
sylvestris]
Length=485

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 86/128 (67%), Gaps = 7/128 (5%)
 Frame = +2

Query  239  SSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSP  418
            SSS I +E T  KH R+PNLSLEIP  +L  SR+E+ QIK   TPTPT K+VNFL+TPS 
Sbjct  3    SSSAITDERTHAKHWRKPNLSLEIPSRTLDASRQELAQIKMPSTPTPTPKRVNFLLTPST  62

Query  419  SDPRVNGSPGHLP-RAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSI  595
            +D R+  SPG  P R KS+IRNL PKLN  S   NLD EK    D G  A  PQ+KV   
Sbjct  63   ADSRITSSPGPSPSRGKSAIRNLFPKLNLKSR-MNLD-EKITIPDSG-PAVVPQEKV---  116

Query  596  SISRSWSL  619
            SISRSWSL
Sbjct  117  SISRSWSL  124



>ref|XP_011089306.1| PREDICTED: uncharacterized protein LOC105170304 isoform X2 [Sesamum 
indicum]
 ref|XP_011089307.1| PREDICTED: uncharacterized protein LOC105170304 isoform X2 [Sesamum 
indicum]
Length=482

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 88/122 (72%), Gaps = 4/122 (3%)
 Frame = +2

Query  257  EEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPSDPRVN  436
            EE +Q K  R+PNL LEIP  SL+ + +E ++IK   TPTPT K+VNF++T SPSD R++
Sbjct  3    EETSQGKQWRKPNLFLEIPSRSLEVTPQEFMEIKMPPTPTPTPKRVNFVLTRSPSDSRLH  62

Query  437  GSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISISRSW  613
            GS G    + KSSIR++LP L+F + +SN ++EKA +ID GCS   PQDK   +SISRSW
Sbjct  63   GSSGPSSTKGKSSIRSILPWLSFKNRSSNSEVEKAANIDSGCSTMVPQDK---LSISRSW  119

Query  614  SL  619
            SL
Sbjct  120  SL  121



>ref|XP_006340158.1| PREDICTED: uncharacterized protein LOC102578157 [Solanum tuberosum]
Length=524

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 98/168 (58%), Gaps = 15/168 (9%)
 Frame = +2

Query  140  VMDREKKETFLSEGEDVQNGGR-----RETGISIPKSLSSSGIIEEITQVKHGRRPNLSL  304
            +M  E KE  ++E  D  N G+     +E  IS PK   SS I EE T  KH R+PNLSL
Sbjct  1    MMSEEHKEKIMAEVVD--NDGKIGVCEKEFVISTPKIERSSTITEETTHAKHWRKPNLSL  58

Query  305  EIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPSDPRV-NGSPGHLP-RAKSSIR  478
            +IP  +L  S +E+VQI      TPT K+VNFL+TPS  D R+   SPG  P R K++IR
Sbjct  59   DIPSRTLDASPQELVQI--KRPFTPTPKRVNFLLTPSTCDSRITTSSPGPSPCRGKATIR  116

Query  479  NLLPKLNFMSHNSNLDMEKAPDIDLG-CSATAPQDKVVSISISRSWSL  619
            NL PKL+  S   N D EK    D G  +A  PQ +   +SISRSWSL
Sbjct  117  NLFPKLSLKSR-MNSDTEKITVPDSGPTAAVVPQQE--KVSISRSWSL  161



>ref|XP_010651156.1| PREDICTED: uncharacterized protein LOC100257089 [Vitis vinifera]
Length=522

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 98/155 (63%), Gaps = 5/155 (3%)
 Frame = +2

Query  158  KETFLSEGEDVQNGGRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSR  337
            +E  ++EG DV + G R   I I +   S+GI EE    +  RR NL LEIP   ++ S 
Sbjct  4    EEKPVAEGHDV-DEGERAVAIPIQEVEDSTGITEETPHFQQWRRQNLFLEIPSREMEASS  62

Query  338  EEIVQIkklltptptakkVNFLVTPSPSDPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHN  514
            ++ V+IK   TP+PT KKVNF +TPSPSD RV GSPG    + KSS ++LLPKL+F + +
Sbjct  63   QDSVRIKMPPTPSPTPKKVNFFLTPSPSDTRVTGSPGPSATKGKSSKKSLLPKLSFKNRS  122

Query  515  SNLDMEKAPDIDLGCSATAPQDKVVSISISRSWSL  619
            +  D +KA ++ LG S+T  ++K    SISRS SL
Sbjct  123  ATSDSDKAANLALGGSSTTSREKP---SISRSLSL  154



>emb|CAN77236.1| hypothetical protein VITISV_024209 [Vitis vinifera]
Length=750

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 98/160 (61%), Gaps = 5/160 (3%)
 Frame = +2

Query  143  MDREKKETFLSEGEDVQNGGRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMS  322
            M    +E  ++EG DV  G  R   I I +   S+GI EE    +  RR NL LEIP   
Sbjct  47   MRMRGEEKPVAEGHDVDEG-ERAVAIPIQEVEDSTGITEETPHFQQWRRQNLFLEIPSRE  105

Query  323  LQNSREEIVQIkklltptptakkVNFLVTPSPSDPRVNGSPG-HLPRAKSSIRNLLPKLN  499
            ++ S ++ V+IK   TP+PT KKVNF +TPSPSD RV GSPG    + KSS ++LLPKL+
Sbjct  106  MEASSQDSVRIKMPPTPSPTPKKVNFFLTPSPSDTRVTGSPGPSATKGKSSKKSLLPKLS  165

Query  500  FMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISISRSWSL  619
            F + ++  D +KA ++ LG S+T  ++K    SISRS SL
Sbjct  166  FKNRSATSDSDKAANLALGGSSTTSREKP---SISRSLSL  202



>ref|XP_004251127.1| PREDICTED: uncharacterized protein LOC101256453 [Solanum lycopersicum]
Length=523

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 93/165 (56%), Gaps = 11/165 (7%)
 Frame = +2

Query  143  MDREKKETFLSEGEDVQNG---GRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIP  313
            M  E KE  ++E  D          +  IS PK   SS I EE T  KH R+PNLSL+IP
Sbjct  1    MSEEHKEKIMAEVVDNDEKIGVCENDFVISTPKIERSSTITEETTHAKHWRKPNLSLDIP  60

Query  314  MMSLQNSREEIVQIkklltptptakkVNFLVTPSPSDPRV-NGSPGHLP-RAKSSIRNLL  487
              +L  S +E+VQI      TPT K+VNFL+TPS  D R+   SPG  P R KS+IRNL 
Sbjct  61   SRTLDASPQELVQI--KRPFTPTPKRVNFLLTPSTCDSRITTSSPGPSPCRGKSTIRNLF  118

Query  488  PKLNFMSHNSNLDMEKAPDIDLG-CSATAPQDKVVSISISRSWSL  619
            PKL+  S   N D EK    D G  +A  PQ +   +SISRSWSL
Sbjct  119  PKLSLKSR-MNSDTEKVTVPDTGPAAAVVPQQE--KVSISRSWSL  160



>gb|KJB56107.1| hypothetical protein B456_009G106300 [Gossypium raimondii]
Length=348

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 86/127 (68%), Gaps = 4/127 (3%)
 Frame = +2

Query  242  SSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPS  421
            S+GI EE T+  H RR NLSLE+P  + ++S +E V IK   TP+ T +KVNFL+TPSPS
Sbjct  34   STGITEETTRSHHWRRSNLSLELPSRTFEDSSQESVIIKMPPTPSLTPRKVNFLLTPSPS  93

Query  422  DPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSIS  598
            D R++GSPG    R KSS+++LLPKL+F   N N D+EKA       S+T+ ++K    S
Sbjct  94   DARISGSPGPSTSRGKSSLKSLLPKLSFKQRNVNSDIEKAAIFAPESSSTSLREKP---S  150

Query  599  ISRSWSL  619
            I+R+ SL
Sbjct  151  IARTLSL  157



>gb|KHG21185.1| E3 ubiquitin-protein ligase MARCH7 [Gossypium arboreum]
Length=512

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 91/142 (64%), Gaps = 4/142 (3%)
 Frame = +2

Query  197  GGRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltpt  376
            GG  +    + +   S+GI EE T+  H RR NLSLEIP  + ++S +E V IK   TP+
Sbjct  19   GGPSQRTTPVQQVDDSTGITEETTRSHHWRRSNLSLEIPSRTFEDSSQESVIIKMPPTPS  78

Query  377  ptakkVNFLVTPSPSDPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDL  553
             T +KVNFL+TPSPSD R++GSPG    R KSS+++LLPKL+F   N N D+EKA     
Sbjct  79   LTPRKVNFLLTPSPSDARISGSPGPSTSRGKSSLKSLLPKLSFKQRNVNSDIEKAAIFAP  138

Query  554  GCSATAPQDKVVSISISRSWSL  619
              S+T+ ++K    SI+R+ SL
Sbjct  139  ESSSTSLREKP---SIARTLSL  157



>ref|XP_009791385.1| PREDICTED: uncharacterized protein LOC104238660 isoform X2 [Nicotiana 
sylvestris]
Length=496

 Score = 94.0 bits (232),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 96/162 (59%), Gaps = 15/162 (9%)
 Frame = +2

Query  143  MDREKKETFLSEGED--VQNGGRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPM  316
            M  E+KE  ++E  D  V++         IPK  SSSGI EE T  K  RRPNL +EIP 
Sbjct  1    MSCEEKEKSMAEVYDEYVRSKACERVVKPIPKGESSSGITEEATHGKQWRRPNLFVEIPS  60

Query  317  MSLQNSREEIVQIkklltptptakkVNFLVTPSPSDPRVNGSP-GHLPRAKSSIRNLLPK  493
             S   S +E VQ+K L TPTPT K+VNFL+TPS S+ R N  P     R+KSSIRNLLPK
Sbjct  61   KSSDASNQEFVQVKMLPTPTPTPKRVNFLLTPSSSNSRANAFPSPSSCRSKSSIRNLLPK  120

Query  494  LNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISISRSWSL  619
            L+F S N+N D EKA   D         +KV   SISRSWS 
Sbjct  121  LSFKSRNTNSDTEKAALSD---------EKV---SISRSWSF  150



>gb|KJB56108.1| hypothetical protein B456_009G106300 [Gossypium raimondii]
Length=444

 Score = 93.2 bits (230),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 91/142 (64%), Gaps = 4/142 (3%)
 Frame = +2

Query  197  GGRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltpt  376
            GG  +    + +   S+GI EE T+  H RR NLSLE+P  + ++S +E V IK   TP+
Sbjct  19   GGPSQRTTPVQQVDDSTGITEETTRSHHWRRSNLSLELPSRTFEDSSQESVIIKMPPTPS  78

Query  377  ptakkVNFLVTPSPSDPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDL  553
             T +KVNFL+TPSPSD R++GSPG    R KSS+++LLPKL+F   N N D+EKA     
Sbjct  79   LTPRKVNFLLTPSPSDARISGSPGPSTSRGKSSLKSLLPKLSFKQRNVNSDIEKAAIFAP  138

Query  554  GCSATAPQDKVVSISISRSWSL  619
              S+T+ ++K    SI+R+ SL
Sbjct  139  ESSSTSLREKP---SIARTLSL  157



>gb|KJB56106.1| hypothetical protein B456_009G106300 [Gossypium raimondii]
Length=429

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 91/142 (64%), Gaps = 4/142 (3%)
 Frame = +2

Query  197  GGRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltpt  376
            GG  +    + +   S+GI EE T+  H RR NLSLE+P  + ++S +E V IK   TP+
Sbjct  19   GGPSQRTTPVQQVDDSTGITEETTRSHHWRRSNLSLELPSRTFEDSSQESVIIKMPPTPS  78

Query  377  ptakkVNFLVTPSPSDPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDL  553
             T +KVNFL+TPSPSD R++GSPG    R KSS+++LLPKL+F   N N D+EKA     
Sbjct  79   LTPRKVNFLLTPSPSDARISGSPGPSTSRGKSSLKSLLPKLSFKQRNVNSDIEKAAIFAP  138

Query  554  GCSATAPQDKVVSISISRSWSL  619
              S+T+ ++K    SI+R+ SL
Sbjct  139  ESSSTSLREKP---SIARTLSL  157



>gb|KJB56105.1| hypothetical protein B456_009G106300 [Gossypium raimondii]
Length=512

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 91/142 (64%), Gaps = 4/142 (3%)
 Frame = +2

Query  197  GGRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltpt  376
            GG  +    + +   S+GI EE T+  H RR NLSLE+P  + ++S +E V IK   TP+
Sbjct  19   GGPSQRTTPVQQVDDSTGITEETTRSHHWRRSNLSLELPSRTFEDSSQESVIIKMPPTPS  78

Query  377  ptakkVNFLVTPSPSDPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDL  553
             T +KVNFL+TPSPSD R++GSPG    R KSS+++LLPKL+F   N N D+EKA     
Sbjct  79   LTPRKVNFLLTPSPSDARISGSPGPSTSRGKSSLKSLLPKLSFKQRNVNSDIEKAAIFAP  138

Query  554  GCSATAPQDKVVSISISRSWSL  619
              S+T+ ++K    SI+R+ SL
Sbjct  139  ESSSTSLREKP---SIARTLSL  157



>gb|KJB56109.1| hypothetical protein B456_009G106300 [Gossypium raimondii]
Length=510

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 91/142 (64%), Gaps = 4/142 (3%)
 Frame = +2

Query  197  GGRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltpt  376
            GG  +    + +   S+GI EE T+  H RR NLSLE+P  + ++S +E V IK   TP+
Sbjct  19   GGPSQRTTPVQQVDDSTGITEETTRSHHWRRSNLSLELPSRTFEDSSQESVIIKMPPTPS  78

Query  377  ptakkVNFLVTPSPSDPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDL  553
             T +KVNFL+TPSPSD R++GSPG    R KSS+++LLPKL+F   N N D+EKA     
Sbjct  79   LTPRKVNFLLTPSPSDARISGSPGPSTSRGKSSLKSLLPKLSFKQRNVNSDIEKAAIFAP  138

Query  554  GCSATAPQDKVVSISISRSWSL  619
              S+T+ ++K    SI+R+ SL
Sbjct  139  ESSSTSLREKP---SIARTLSL  157



>gb|KJB56110.1| hypothetical protein B456_009G106300 [Gossypium raimondii]
Length=472

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 91/142 (64%), Gaps = 4/142 (3%)
 Frame = +2

Query  197  GGRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltpt  376
            GG  +    + +   S+GI EE T+  H RR NLSLE+P  + ++S +E V IK   TP+
Sbjct  19   GGPSQRTTPVQQVDDSTGITEETTRSHHWRRSNLSLELPSRTFEDSSQESVIIKMPPTPS  78

Query  377  ptakkVNFLVTPSPSDPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDL  553
             T +KVNFL+TPSPSD R++GSPG    R KSS+++LLPKL+F   N N D+EKA     
Sbjct  79   LTPRKVNFLLTPSPSDARISGSPGPSTSRGKSSLKSLLPKLSFKQRNVNSDIEKAAIFAP  138

Query  554  GCSATAPQDKVVSISISRSWSL  619
              S+T+ ++K    SI+R+ SL
Sbjct  139  ESSSTSLREKP---SIARTLSL  157



>ref|XP_006424589.1| hypothetical protein CICLE_v10028219mg [Citrus clementina]
 gb|ESR37829.1| hypothetical protein CICLE_v10028219mg [Citrus clementina]
Length=370

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 82/127 (65%), Gaps = 6/127 (5%)
 Frame = +2

Query  248  GIIEEITQVKHGRRPNLSLEIPMMSLQNSREE--IVQIkklltptptakkVNFLVTPSPS  421
            GI EE + ++H +R NL LEIP  +L  S ++  IV++    +PTPT ++VNF +TP  +
Sbjct  46   GITEETSNLQHWKRRNLFLEIPSRTLAVSSQDSVIVRMPPTPSPTPTPRRVNFNLTPCSA  105

Query  422  DPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSIS  598
            D R+NGSPG    RAKSSI+  LPKLNF   N+NLD+EKA +     S   P+DK +   
Sbjct  106  DARMNGSPGPSSSRAKSSIKGFLPKLNFKYRNTNLDVEKAANQAAETSCATPRDKPL---  162

Query  599  ISRSWSL  619
            ISRS SL
Sbjct  163  ISRSLSL  169



>gb|KDO73243.1| hypothetical protein CISIN_1g010219mg [Citrus sinensis]
Length=515

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 82/127 (65%), Gaps = 6/127 (5%)
 Frame = +2

Query  248  GIIEEITQVKHGRRPNLSLEIP--MMSLQNSREEIVQIkklltptptakkVNFLVTPSPS  421
            GI EE + ++H +R NL LEIP  M+++ +    IV++    +PTPT ++VNF +TP  +
Sbjct  46   GITEETSNLQHWKRRNLFLEIPSRMLAVSSQDSVIVRMPPTPSPTPTPRRVNFNLTPCSA  105

Query  422  DPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSIS  598
            D R+NGSPG    RAKSSI+  LPKLNF   N+NLD+EKA +     S   P+DK +   
Sbjct  106  DARMNGSPGPSSSRAKSSIKGFLPKLNFKYRNTNLDVEKAANQAAETSCATPRDKPL---  162

Query  599  ISRSWSL  619
            ISRS SL
Sbjct  163  ISRSLSL  169



>ref|XP_006488111.1| PREDICTED: uncharacterized protein LOC102606695 [Citrus sinensis]
Length=515

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 82/127 (65%), Gaps = 6/127 (5%)
 Frame = +2

Query  248  GIIEEITQVKHGRRPNLSLEIPMMSLQNSREE--IVQIkklltptptakkVNFLVTPSPS  421
            GI EE + ++H +R NL LEIP  +L  S ++  IV++    +PTPT ++VNF +TP  +
Sbjct  46   GITEETSNLQHWKRRNLFLEIPSRTLAVSSQDSVIVRMPPTPSPTPTPRRVNFNLTPCSA  105

Query  422  DPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSIS  598
            D R+NGSPG    RAKSSI+  LPKLNF   N+NLD+EKA +     S   P+DK +   
Sbjct  106  DARMNGSPGPSSSRAKSSIKGFLPKLNFKYRNTNLDVEKAANQAAETSCATPRDKPL---  162

Query  599  ISRSWSL  619
            ISRS SL
Sbjct  163  ISRSLSL  169



>ref|XP_006424588.1| hypothetical protein CICLE_v10028219mg [Citrus clementina]
 gb|ESR37828.1| hypothetical protein CICLE_v10028219mg [Citrus clementina]
Length=515

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 82/127 (65%), Gaps = 6/127 (5%)
 Frame = +2

Query  248  GIIEEITQVKHGRRPNLSLEIPMMSLQNSREE--IVQIkklltptptakkVNFLVTPSPS  421
            GI EE + ++H +R NL LEIP  +L  S ++  IV++    +PTPT ++VNF +TP  +
Sbjct  46   GITEETSNLQHWKRRNLFLEIPSRTLAVSSQDSVIVRMPPTPSPTPTPRRVNFNLTPCSA  105

Query  422  DPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSIS  598
            D R+NGSPG    RAKSSI+  LPKLNF   N+NLD+EKA +     S   P+DK +   
Sbjct  106  DARMNGSPGPSSSRAKSSIKGFLPKLNFKYRNTNLDVEKAANQAAETSCATPRDKPL---  162

Query  599  ISRSWSL  619
            ISRS SL
Sbjct  163  ISRSLSL  169



>ref|XP_009596995.1| PREDICTED: uncharacterized protein LOC104093001 isoform X2 [Nicotiana 
tomentosiformis]
Length=497

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 94/162 (58%), Gaps = 15/162 (9%)
 Frame = +2

Query  143  MDREKKETFLSEGED--VQNGGRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPM  316
            M  E+KE  ++E  D  V++         IPK  SSSGI EE T  K  RRPNL +EIP 
Sbjct  1    MSCEEKEKSMAEVYDEYVRSKACERVVKPIPKGESSSGITEEATHGKQWRRPNLFVEIPS  60

Query  317  MSLQNSREEIVQIkklltptptakkVNFLVTPSPSDPRVNGSP-GHLPRAKSSIRNLLPK  493
             S   S +E VQ+K L TPTPT K+VNFL+ PS S+ R N  P     R+KSSIRNLLPK
Sbjct  61   KSSDASNQEFVQVKMLPTPTPTPKRVNFLLMPSSSNSRANAFPSPSSCRSKSSIRNLLPK  120

Query  494  LNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISISRSWSL  619
            L+F   N+N D EKA   D         +KV   SISRSWS 
Sbjct  121  LSFKLRNTNSDTEKAALSD---------EKV---SISRSWSF  150



>ref|XP_009791384.1| PREDICTED: uncharacterized protein LOC104238660 isoform X1 [Nicotiana 
sylvestris]
Length=500

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 96/166 (58%), Gaps = 19/166 (11%)
 Frame = +2

Query  143  MDREKKETFLSEGED--VQNGGRRETGISIPK----SLSSSGIIEEITQVKHGRRPNLSL  304
            M  E+KE  ++E  D  V++         IPK      SSSGI EE T  K  RRPNL +
Sbjct  1    MSCEEKEKSMAEVYDEYVRSKACERVVKPIPKVKDKGESSSGITEEATHGKQWRRPNLFV  60

Query  305  EIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPSDPRVNGSP-GHLPRAKSSIRN  481
            EIP  S   S +E VQ+K L TPTPT K+VNFL+TPS S+ R N  P     R+KSSIRN
Sbjct  61   EIPSKSSDASNQEFVQVKMLPTPTPTPKRVNFLLTPSSSNSRANAFPSPSSCRSKSSIRN  120

Query  482  LLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISISRSWSL  619
            LLPKL+F S N+N D EKA   D         +KV   SISRSWS 
Sbjct  121  LLPKLSFKSRNTNSDTEKAALSD---------EKV---SISRSWSF  154



>ref|XP_007016718.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY34337.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
Length=508

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 95/162 (59%), Gaps = 9/162 (6%)
 Frame = +2

Query  143  MDREKKETFLSEGEDVQNGGRRETGISIP--KSLSSSGIIEEITQVKHGRRPNLSLEIPM  316
            M  EKK   +  GE    G   +  +S+P  +   S+GI EE T   H +R NL LEIP 
Sbjct  1    MGTEKK---VVSGEHEVGGAASQGTVSVPVQQVEDSTGITEETTHAHHWKRSNLILEIPS  57

Query  317  MSLQNSREEIVQIkklltptptakkVNFLVTPSPSDPRV-NGSPGHLPRAKSSIRNLLPK  493
             +L++S +E V IK    P+ T +KVNFL+TPSPSD R+         R KSS+++LLPK
Sbjct  58   RTLEDSSQESVVIKMPPAPSLTPRKVNFLLTPSPSDARISGSPGPSSSRGKSSLKSLLPK  117

Query  494  LNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISISRSWSL  619
            L+F   + NLD+EKA +     S+T+ ++K    SISR+ SL
Sbjct  118  LSFKHRSINLDIEKAANFAPESSSTSLREKP---SISRTLSL  156



>ref|XP_007016719.1| RING/U-box superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY34338.1| RING/U-box superfamily protein isoform 2 [Theobroma cacao]
Length=514

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 95/162 (59%), Gaps = 9/162 (6%)
 Frame = +2

Query  143  MDREKKETFLSEGEDVQNGGRRETGISIP--KSLSSSGIIEEITQVKHGRRPNLSLEIPM  316
            M  EKK   +  GE    G   +  +S+P  +   S+GI EE T   H +R NL LEIP 
Sbjct  1    MGTEKK---VVSGEHEVGGAASQGTVSVPVQQVEDSTGITEETTHAHHWKRSNLILEIPS  57

Query  317  MSLQNSREEIVQIkklltptptakkVNFLVTPSPSDPRV-NGSPGHLPRAKSSIRNLLPK  493
             +L++S +E V IK    P+ T +KVNFL+TPSPSD R+         R KSS+++LLPK
Sbjct  58   RTLEDSSQESVVIKMPPAPSLTPRKVNFLLTPSPSDARISGSPGPSSSRGKSSLKSLLPK  117

Query  494  LNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISISRSWSL  619
            L+F   + NLD+EKA +     S+T+ ++K    SISR+ SL
Sbjct  118  LSFKHRSINLDIEKAANFAPESSSTSLREKP---SISRTLSL  156



>ref|XP_002530288.1| protein binding protein, putative [Ricinus communis]
 gb|EEF32095.1| protein binding protein, putative [Ricinus communis]
Length=495

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 82/126 (65%), Gaps = 4/126 (3%)
 Frame = +2

Query  245  SGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPSD  424
            +GI+EE  Q +  ++ NL LEIP  +L +  ++ V IK   TP+PT +KVNFL+TP+ SD
Sbjct  32   TGIVEEANQARQWKQKNLFLEIPSRTLDDPSQDSVVIKMPPTPSPTPRKVNFLLTPTSSD  91

Query  425  PRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISI  601
             R  GSPG    R KSS+R+LLPKL+F S  S LD EKA ++    S T P++K    SI
Sbjct  92   ARACGSPGPSSTRGKSSLRSLLPKLSFKSRISMLDAEKAANLAPDSSCTMPREKP---SI  148

Query  602  SRSWSL  619
            SRS SL
Sbjct  149  SRSLSL  154



>ref|XP_009596994.1| PREDICTED: uncharacterized protein LOC104093001 isoform X1 [Nicotiana 
tomentosiformis]
Length=505

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 79/128 (62%), Gaps = 13/128 (10%)
 Frame = +2

Query  239  SSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSP  418
            SSSGI EE T  K  RRPNL +EIP  S   S +E VQ+K L TPTPT K+VNFL+ PS 
Sbjct  43   SSSGITEEATHGKQWRRPNLFVEIPSKSSDASNQEFVQVKMLPTPTPTPKRVNFLLMPSS  102

Query  419  SDPRVNGSP-GHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSI  595
            S+ R N  P     R+KSSIRNLLPKL+F   N+N D EKA   D         +KV   
Sbjct  103  SNSRANAFPSPSSCRSKSSIRNLLPKLSFKLRNTNSDTEKAALSD---------EKV---  150

Query  596  SISRSWSL  619
            SISRSWS 
Sbjct  151  SISRSWSF  158



>gb|KDP44062.1| hypothetical protein JCGZ_05529 [Jatropha curcas]
Length=513

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 83/134 (62%), Gaps = 4/134 (3%)
 Frame = +2

Query  221  SIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNF  400
            ++ K   S+GI+EE       +R NL LEIP  ++++  ++ V IK   TP+PT +KVNF
Sbjct  24   TVHKVEDSTGIVEEANHAHQWKRRNLFLEIPSRTMEDPVQDSVVIKIPPTPSPTPRKVNF  83

Query  401  LVTPSPSDPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQ  577
             +TP+ +D R  GSPG    R KSS+R+LLPKL+F S  S  D EKA ++    S T P+
Sbjct  84   FLTPNSTDARACGSPGPSSSRGKSSLRSLLPKLSFKSRISTTDAEKAANLAPDSSCTLPR  143

Query  578  DKVVSISISRSWSL  619
            +K    SISRS SL
Sbjct  144  EKP---SISRSLSL  154



>ref|XP_009335079.1| PREDICTED: uncharacterized protein LOC103927843 isoform X3 [Pyrus 
x bretschneideri]
Length=474

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 86/141 (61%), Gaps = 5/141 (4%)
 Frame = +2

Query  200  GRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptp  379
            G+ E  + + K   S  + EE  QV   +R NL LEIPM + ++  ++ V IK   TP+P
Sbjct  17   GQGEVDVPLDKVEDSVVVAEEAPQVHPWKRQNLHLEIPMRTSEDCVQDFVAIKMPPTPSP  76

Query  380  takkVNFLVTPSPSDPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLG  556
            T +KVNFL+TP   D R++GSPG    + KSSI++LLPKL+F  + S  D EKA ++   
Sbjct  77   TPRKVNFLLTPGSVDGRMSGSPGPSSAKGKSSIKSLLPKLSF-KYRSTADAEKASNLASE  135

Query  557  CSATAPQDKVVSISISRSWSL  619
             S+T  ++K    SISRS SL
Sbjct  136  GSSTGVREKA---SISRSLSL  153



>ref|XP_007207622.1| hypothetical protein PRUPE_ppa020301mg [Prunus persica]
 gb|EMJ08821.1| hypothetical protein PRUPE_ppa020301mg [Prunus persica]
Length=504

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 85/138 (62%), Gaps = 4/138 (3%)
 Frame = +2

Query  209  ETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptak  388
            + G SI K   ++ IIEE    +  RR NL L+IP  SL++++E+ V+I    TP+ T K
Sbjct  20   KAGPSIQKGGDAAEIIEEAPPGQPWRRQNLILQIPSRSLEDAKEDFVRINMPPTPSLTPK  79

Query  389  kVNFLVTPSPSDPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSA  565
            +VNF   PSPS  +++G PG    +AKS+I++LLPKL+F   N+  +++KA  + LG   
Sbjct  80   RVNFSPLPSPSLAKISGLPGPSSSKAKSTIKSLLPKLSFKHRNTTSEIQKAATLALGGLP  139

Query  566  TAPQDKVVSISISRSWSL  619
               ++K +   ISR+WS 
Sbjct  140  AGTREKPL---ISRTWSF  154



>gb|KJB26162.1| hypothetical protein B456_004G228500 [Gossypium raimondii]
Length=377

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 92/156 (59%), Gaps = 13/156 (8%)
 Frame = +2

Query  170  LSEGEDVQNGGRRET-GISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEI  346
            ++E  DV +  RR T  + I +   S+GI EE    ++ +R NL LEIP  SL +S +E 
Sbjct  12   VTEEHDVGDAARRGTVSVPIQQVEDSAGITEETADARNWKRTNLFLEIPSRSLDDSSQES  71

Query  347  VQIkklltptptakkVNFLVTPSPSDPRVN-GSPGHLPRAKSSIRNLLPKLNFMSHNSNL  523
            V +K   TP+ T +KVNF +TPSPSD R+N  S G       S+R+LLPKL+F + + + 
Sbjct  72   VTVKMPQTPSLTPRKVNFHLTPSPSDARINGSSSGPSSSKGKSLRSLLPKLSFKARSISS  131

Query  524  DMEKAPDIDLGCSATAPQDKVVSI----SISRSWSL  619
            D+EKA ++       AP+  + S+    S+SR+ SL
Sbjct  132  DIEKAANL-------APESSITSLKEKPSMSRTLSL  160



>ref|XP_009335077.1| PREDICTED: uncharacterized protein LOC103927843 isoform X1 [Pyrus 
x bretschneideri]
Length=530

 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 86/141 (61%), Gaps = 5/141 (4%)
 Frame = +2

Query  200  GRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptp  379
            G+ E  + + K   S  + EE  QV   +R NL LEIPM + ++  ++ V IK   TP+P
Sbjct  17   GQGEVDVPLDKVEDSVVVAEEAPQVHPWKRQNLHLEIPMRTSEDCVQDFVAIKMPPTPSP  76

Query  380  takkVNFLVTPSPSDPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLG  556
            T +KVNFL+TP   D R++GSPG    + KSSI++LLPKL+F  + S  D EKA ++   
Sbjct  77   TPRKVNFLLTPGSVDGRMSGSPGPSSAKGKSSIKSLLPKLSF-KYRSTADAEKASNLASE  135

Query  557  CSATAPQDKVVSISISRSWSL  619
             S+T  ++K    SISRS SL
Sbjct  136  GSSTGVREKA---SISRSLSL  153



>ref|XP_009335078.1| PREDICTED: uncharacterized protein LOC103927843 isoform X2 [Pyrus 
x bretschneideri]
Length=528

 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 86/141 (61%), Gaps = 5/141 (4%)
 Frame = +2

Query  200  GRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptp  379
            G+ E  + + K   S  + EE  QV   +R NL LEIPM + ++  ++ V IK   TP+P
Sbjct  17   GQGEVDVPLDKVEDSVVVAEEAPQVHPWKRQNLHLEIPMRTSEDCVQDFVAIKMPPTPSP  76

Query  380  takkVNFLVTPSPSDPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLG  556
            T +KVNFL+TP   D R++GSPG    + KSSI++LLPKL+F  + S  D EKA ++   
Sbjct  77   TPRKVNFLLTPGSVDGRMSGSPGPSSAKGKSSIKSLLPKLSF-KYRSTADAEKASNLASE  135

Query  557  CSATAPQDKVVSISISRSWSL  619
             S+T  ++K    SISRS SL
Sbjct  136  GSSTGVREKA---SISRSLSL  153



>gb|KJB26164.1| hypothetical protein B456_004G228500 [Gossypium raimondii]
Length=443

 Score = 76.3 bits (186),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 92/156 (59%), Gaps = 13/156 (8%)
 Frame = +2

Query  170  LSEGEDVQNGGRRET-GISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEI  346
            ++E  DV +  RR T  + I +   S+GI EE    ++ +R NL LEIP  SL +S +E 
Sbjct  12   VTEEHDVGDAARRGTVSVPIQQVEDSAGITEETADARNWKRTNLFLEIPSRSLDDSSQES  71

Query  347  VQIkklltptptakkVNFLVTPSPSDPRVN-GSPGHLPRAKSSIRNLLPKLNFMSHNSNL  523
            V +K   TP+ T +KVNF +TPSPSD R+N  S G       S+R+LLPKL+F + + + 
Sbjct  72   VTVKMPQTPSLTPRKVNFHLTPSPSDARINGSSSGPSSSKGKSLRSLLPKLSFKARSISS  131

Query  524  DMEKAPDIDLGCSATAPQDKVVSI----SISRSWSL  619
            D+EKA ++       AP+  + S+    S+SR+ SL
Sbjct  132  DIEKAANL-------APESSITSLKEKPSMSRTLSL  160



>gb|KJB26161.1| hypothetical protein B456_004G228500 [Gossypium raimondii]
Length=514

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 92/156 (59%), Gaps = 13/156 (8%)
 Frame = +2

Query  170  LSEGEDVQNGGRRET-GISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEI  346
            ++E  DV +  RR T  + I +   S+GI EE    ++ +R NL LEIP  SL +S +E 
Sbjct  12   VTEEHDVGDAARRGTVSVPIQQVEDSAGITEETADARNWKRTNLFLEIPSRSLDDSSQES  71

Query  347  VQIkklltptptakkVNFLVTPSPSDPRVN-GSPGHLPRAKSSIRNLLPKLNFMSHNSNL  523
            V +K   TP+ T +KVNF +TPSPSD R+N  S G       S+R+LLPKL+F + + + 
Sbjct  72   VTVKMPQTPSLTPRKVNFHLTPSPSDARINGSSSGPSSSKGKSLRSLLPKLSFKARSISS  131

Query  524  DMEKAPDIDLGCSATAPQDKVVSI----SISRSWSL  619
            D+EKA ++       AP+  + S+    S+SR+ SL
Sbjct  132  DIEKAANL-------APESSITSLKEKPSMSRTLSL  160



>ref|XP_007205129.1| hypothetical protein PRUPE_ppa005009mg [Prunus persica]
 gb|EMJ06328.1| hypothetical protein PRUPE_ppa005009mg [Prunus persica]
Length=482

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 86/144 (60%), Gaps = 5/144 (3%)
 Frame = +2

Query  191  QNGGRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkkllt  370
            +N  +    + + K   S G+ EE  QV   +R NL LEIP  + ++  E+ V IK   T
Sbjct  21   ENSTQGTIAVPVHKIEDSMGVTEEAPQVHPWKRQNLYLEIPSRTSEDCVEDFVAIKMPPT  80

Query  371  ptptakkVNFLVTPSPSDPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDI  547
            P+PT +KVNFL+TP   D RV+GSPG    + KSSI+ L PKL+F  + S+ D+EKA ++
Sbjct  81   PSPTPRKVNFLLTPGSIDARVSGSPGPSSAKGKSSIKALFPKLSF-KYRSSSDIEKASNL  139

Query  548  DLGCSATAPQDKVVSISISRSWSL  619
                S+T  ++K    SISRS SL
Sbjct  140  ASEGSSTGAREKP---SISRSLSL  160



>gb|KJB16803.1| hypothetical protein B456_002G248600 [Gossypium raimondii]
Length=363

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = +2

Query  242  SSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPS  421
            S+ IIEE    +H R+ +L LEIP  S+++ REE V+I   LTPT T ++VNF   PSP 
Sbjct  34   STEIIEETPHDQHRRQDDLVLEIPNRSVEDVREEFVRIDMTLTPTATPRRVNFSPMPSPI  93

Query  422  DPRVNGSPGH-LPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSIS  598
              R + SP +  P++K S++ LLPKL+F   N+NL++EKA  + LG S+   Q K     
Sbjct  94   FNRFDESPIYSSPKSKPSLKGLLPKLSFKYRNTNLEIEKAAILALGGSSADIQGKP---R  150

Query  599  ISRSWSL  619
            I R++SL
Sbjct  151  IPRTFSL  157



>ref|XP_007027307.1| Binding protein, putative isoform 6 [Theobroma cacao]
 gb|EOY07809.1| Binding protein, putative isoform 6 [Theobroma cacao]
Length=380

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 83/127 (65%), Gaps = 4/127 (3%)
 Frame = +2

Query  242  SSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPS  421
            S+ IIEE+   +H +  +L LEIP  +L+++RE+ V+I   LTPT T K+VNF   PSP 
Sbjct  38   STEIIEEMPLGQHRKPDDLVLEIPPRTLEDAREDFVRIDMALTPTATPKRVNFSPMPSPI  97

Query  422  DPRVNGSPGHLP-RAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSIS  598
              R + SP H   + KS++++LLPKL+F S N+NL++EKA  + LG S+   + K     
Sbjct  98   FSRFDDSPVHSSFKNKSALKSLLPKLSFKSRNTNLEIEKAAILALGGSSAEIRGKP---R  154

Query  599  ISRSWSL  619
            ISR++SL
Sbjct  155  ISRTFSL  161



>gb|KHG08412.1| putative E3 ubiquitin-protein ligase MARCH10 [Gossypium arboreum]
Length=518

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 81/127 (64%), Gaps = 4/127 (3%)
 Frame = +2

Query  242  SSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPS  421
            S+ IIEE    +H R+ +L LEIP  S+++ REE V+I   LTPT T ++VNF   PSP 
Sbjct  34   STEIIEETPHDQHRRQDDLVLEIPNRSVEDVREEFVRIDMTLTPTATPRRVNFSPMPSPI  93

Query  422  DPRVNGSPGH-LPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSIS  598
              R + SP +  P++K S+++LLPKL+F   N+NL++EKA  + LG S+   Q K     
Sbjct  94   FNRFDESPVYSSPKSKPSLKSLLPKLSFKYRNTNLEIEKAAILALGGSSADIQGKP---R  150

Query  599  ISRSWSL  619
            I R++SL
Sbjct  151  IPRTFSL  157



>gb|KJB16804.1| hypothetical protein B456_002G248600 [Gossypium raimondii]
Length=433

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = +2

Query  242  SSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPS  421
            S+ IIEE    +H R+ +L LEIP  S+++ REE V+I   LTPT T ++VNF   PSP 
Sbjct  34   STEIIEETPHDQHRRQDDLVLEIPNRSVEDVREEFVRIDMTLTPTATPRRVNFSPMPSPI  93

Query  422  DPRVNGSPGH-LPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSIS  598
              R + SP +  P++K S++ LLPKL+F   N+NL++EKA  + LG S+   Q K     
Sbjct  94   FNRFDESPIYSSPKSKPSLKGLLPKLSFKYRNTNLEIEKAAILALGGSSADIQGKP---R  150

Query  599  ISRSWSL  619
            I R++SL
Sbjct  151  IPRTFSL  157



>ref|XP_010253651.1| PREDICTED: uncharacterized protein LOC104594842 isoform X2 [Nelumbo 
nucifera]
Length=428

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 71/121 (59%), Gaps = 7/121 (6%)
 Frame = +2

Query  245  SGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPSD  424
            +GI EE   V H R+ NL LEIP      SR + V I    T +PT  +VNF  TPSP+ 
Sbjct  33   TGITEEAPSVHHWRKQNLFLEIP------SRIDFVTIDMPPTKSPTPTRVNFPSTPSPAS  86

Query  425  PRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISI  601
             R+ GSPG    + KS+I++LLP+L+F   +S  D+EKA  + LG S+   +   +S S+
Sbjct  87   ARIYGSPGPSSSKGKSTIKSLLPRLSFKYRSSTTDIEKAATLALGASSAGREKTSISRSL  146

Query  602  S  604
            S
Sbjct  147  S  147



>ref|XP_010253650.1| PREDICTED: uncharacterized protein LOC104594842 isoform X1 [Nelumbo 
nucifera]
Length=511

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 71/121 (59%), Gaps = 7/121 (6%)
 Frame = +2

Query  245  SGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPSD  424
            +GI EE   V H R+ NL LEIP      SR + V I    T +PT  +VNF  TPSP+ 
Sbjct  33   TGITEEAPSVHHWRKQNLFLEIP------SRIDFVTIDMPPTKSPTPTRVNFPSTPSPAS  86

Query  425  PRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISI  601
             R+ GSPG    + KS+I++LLP+L+F   +S  D+EKA  + LG S+   +   +S S+
Sbjct  87   ARIYGSPGPSSSKGKSTIKSLLPRLSFKYRSSTTDIEKAATLALGASSAGREKTSISRSL  146

Query  602  S  604
            S
Sbjct  147  S  147



>ref|XP_007027306.1| RING/U-box superfamily protein, putative isoform 5 [Theobroma 
cacao]
 gb|EOY07808.1| RING/U-box superfamily protein, putative isoform 5 [Theobroma 
cacao]
Length=461

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 83/127 (65%), Gaps = 4/127 (3%)
 Frame = +2

Query  242  SSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPS  421
            S+ IIEE+   +H +  +L LEIP  +L+++RE+ V+I   LTPT T K+VNF   PSP 
Sbjct  38   STEIIEEMPLGQHRKPDDLVLEIPPRTLEDAREDFVRIDMALTPTATPKRVNFSPMPSPI  97

Query  422  DPRVNGSPGHLP-RAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSIS  598
              R + SP H   + KS++++LLPKL+F S N+NL++EKA  + LG S+   + K     
Sbjct  98   FSRFDDSPVHSSFKNKSALKSLLPKLSFKSRNTNLEIEKAAILALGGSSAEIRGKP---R  154

Query  599  ISRSWSL  619
            ISR++SL
Sbjct  155  ISRTFSL  161



>ref|XP_008225582.1| PREDICTED: uncharacterized protein LOC103325214 [Prunus mume]
Length=482

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 85/144 (59%), Gaps = 5/144 (3%)
 Frame = +2

Query  191  QNGGRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkkllt  370
            +N  +    + + K   S G+ EE  QV   +R NL LEIP  + ++  E  V IK   T
Sbjct  21   ENSTQGTIAVPVHKIEDSMGVTEEAPQVHPWKRQNLYLEIPSRTSEDCAENFVAIKMPPT  80

Query  371  ptptakkVNFLVTPSPSDPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDI  547
            P+PT +KVNFL+TP   D RV+GSPG    + KSSI+ L PKL+F  + S+ D+EKA ++
Sbjct  81   PSPTPRKVNFLLTPGSIDARVSGSPGPSSAKGKSSIKALFPKLSF-KYRSSSDIEKASNL  139

Query  548  DLGCSATAPQDKVVSISISRSWSL  619
                S+T  ++K    SISRS SL
Sbjct  140  ASEGSSTGVREKP---SISRSLSL  160



>gb|KJB16805.1| hypothetical protein B456_002G248600 [Gossypium raimondii]
Length=510

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = +2

Query  242  SSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPS  421
            S+ IIEE    +H R+ +L LEIP  S+++ REE V+I   LTPT T ++VNF   PSP 
Sbjct  34   STEIIEETPHDQHRRQDDLVLEIPNRSVEDVREEFVRIDMTLTPTATPRRVNFSPMPSPI  93

Query  422  DPRVNGSPGH-LPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSIS  598
              R + SP +  P++K S++ LLPKL+F   N+NL++EKA  + LG S+   Q K     
Sbjct  94   FNRFDESPIYSSPKSKPSLKGLLPKLSFKYRNTNLEIEKAAILALGGSSADIQGKP---R  150

Query  599  ISRSWSL  619
            I R++SL
Sbjct  151  IPRTFSL  157



>gb|KJB16801.1| hypothetical protein B456_002G248600 [Gossypium raimondii]
 gb|KJB16802.1| hypothetical protein B456_002G248600 [Gossypium raimondii]
Length=514

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = +2

Query  242  SSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPS  421
            S+ IIEE    +H R+ +L LEIP  S+++ REE V+I   LTPT T ++VNF   PSP 
Sbjct  34   STEIIEETPHDQHRRQDDLVLEIPNRSVEDVREEFVRIDMTLTPTATPRRVNFSPMPSPI  93

Query  422  DPRVNGSPGH-LPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSIS  598
              R + SP +  P++K S++ LLPKL+F   N+NL++EKA  + LG S+   Q K     
Sbjct  94   FNRFDESPIYSSPKSKPSLKGLLPKLSFKYRNTNLEIEKAAILALGGSSADIQGKP---R  150

Query  599  ISRSWSL  619
            I R++SL
Sbjct  151  IPRTFSL  157



>ref|XP_007027302.1| Binding protein, putative isoform 1 [Theobroma cacao]
 gb|EOY07804.1| Binding protein, putative isoform 1 [Theobroma cacao]
Length=523

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 83/127 (65%), Gaps = 4/127 (3%)
 Frame = +2

Query  242  SSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPS  421
            S+ IIEE+   +H +  +L LEIP  +L+++RE+ V+I   LTPT T K+VNF   PSP 
Sbjct  38   STEIIEEMPLGQHRKPDDLVLEIPPRTLEDAREDFVRIDMALTPTATPKRVNFSPMPSPI  97

Query  422  DPRVNGSPGHLP-RAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSIS  598
              R + SP H   + KS++++LLPKL+F S N+NL++EKA  + LG S+   + K     
Sbjct  98   FSRFDDSPVHSSFKNKSALKSLLPKLSFKSRNTNLEIEKAAILALGGSSAEIRGKP---R  154

Query  599  ISRSWSL  619
            ISR++SL
Sbjct  155  ISRTFSL  161



>ref|XP_009630868.1| PREDICTED: uncharacterized protein LOC104120747 isoform X1 [Nicotiana 
tomentosiformis]
Length=513

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 76/128 (59%), Gaps = 6/128 (5%)
 Frame = +2

Query  242  SSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptpta-kkVNFLVTPSP  418
            SS I++E+   +  R+ NL LE+P  ++    E+ V+I  L        K+VNF   PSP
Sbjct  37   SSEIVQELQLCEWQRQQNLLLEVPERTVDGPIEDFVRINMLSPSPTQTPKRVNFSPLPSP  96

Query  419  SDPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSI  595
            S  +VNGSPG  L RAKSSI++LLPKL+F   N   D+EKA  + LG S+   QD+    
Sbjct  97   SHVKVNGSPGPSLSRAKSSIKSLLPKLSFKFRNRTTDIEKAAMLALGASSQT-QDRT---  152

Query  596  SISRSWSL  619
            SI R+ S+
Sbjct  153  SIFRTLSV  160



>gb|KDP29105.1| hypothetical protein JCGZ_16494 [Jatropha curcas]
Length=512

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 75/122 (61%), Gaps = 3/122 (2%)
 Frame = +2

Query  224  IPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFL  403
            I K   S+ IIEE T+ +  R+ +  LEIP  +L+++REE V ++    P+PT ++VNF 
Sbjct  27   IKKIGDSTEIIEENTESQQQRQQDFVLEIPTRTLEDAREEFVPVQMPAAPSPTPRRVNFS  86

Query  404  VTPSPSDPRVNGSPGHLP--RAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQ  577
              PSPS  + N  P   P  + KS+IR+LLPKL+F   N+ LD+EKA  + LG S  A +
Sbjct  87   PIPSPSFLKTN-DPLDPPTSKTKSTIRSLLPKLSFKYRNTTLDIEKAAILALGGSFVATE  145

Query  578  DK  583
             K
Sbjct  146  KK  147



>ref|XP_009630869.1| PREDICTED: uncharacterized protein LOC104120747 isoform X2 [Nicotiana 
tomentosiformis]
Length=435

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 76/128 (59%), Gaps = 6/128 (5%)
 Frame = +2

Query  242  SSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptpta-kkVNFLVTPSP  418
            SS I++E+   +  R+ NL LE+P  ++    E+ V+I  L        K+VNF   PSP
Sbjct  37   SSEIVQELQLCEWQRQQNLLLEVPERTVDGPIEDFVRINMLSPSPTQTPKRVNFSPLPSP  96

Query  419  SDPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSI  595
            S  +VNGSPG  L RAKSSI++LLPKL+F   N   D+EKA  + LG S+   QD+    
Sbjct  97   SHVKVNGSPGPSLSRAKSSIKSLLPKLSFKFRNRTTDIEKAAMLALGASSQT-QDRT---  152

Query  596  SISRSWSL  619
            SI R+ S+
Sbjct  153  SIFRTLSV  160



>gb|KHG09093.1| E3 ubiquitin-protein ligase MARCH7 [Gossypium arboreum]
Length=508

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 92/160 (58%), Gaps = 13/160 (8%)
 Frame = +2

Query  158  KETFLSEGEDVQNGGRRET-GISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNS  334
            +E  ++E  D     RR T  + I +   S+GI EE    ++ +R NL LEIP  SL +S
Sbjct  4    EEKTVTEEHDAGAAARRGTVSVPIQQVEDSAGITEETADARNWKRTNLFLEIPSRSLDDS  63

Query  335  REEIVQIkklltptptakkVNFLVTPSPSDPRVN-GSPGHLPRAKSSIRNLLPKLNFMSH  511
             ++ V +K   TP+ T +KVNF +TPSPSD R+N  S G       S+R+LLPKL+F + 
Sbjct  64   SQDSVTVKMPQTPSLTPRKVNFHLTPSPSDGRINGSSSGPSSSKGKSLRSLLPKLSFKAR  123

Query  512  NSNLDMEKAPDIDLGCSATAPQDKVVSI----SISRSWSL  619
            + + D+EKA ++       AP+  + S+    S+SR+ SL
Sbjct  124  SISSDIEKAANL-------APESSITSLKEKPSMSRTLSL  156



>ref|XP_002519545.1| protein binding protein, putative [Ricinus communis]
 gb|EEF42959.1| protein binding protein, putative [Ricinus communis]
Length=512

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 74/115 (64%), Gaps = 1/115 (1%)
 Frame = +2

Query  242  SSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPS  421
            S+ IIEE T+ +  RR +L LE+P  +L+ +R++ V I+  +TP  T K+VNF   PSPS
Sbjct  32   STEIIEEHTEDQQRRRLDLVLEVPSRTLEEARDDFVAIQMPVTPNHTPKRVNFSPFPSPS  91

Query  422  DPRVNGSPGHLP-RAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDK  583
              ++N SP   P + KS+IR+LLPKL+F   N+  D+EKA  + LG S+   + K
Sbjct  92   LFKINDSPDPSPSKNKSTIRSLLPKLSFKYRNTTSDIEKAAILALGGSSVEIEKK  146



>ref|XP_002280929.2| PREDICTED: uncharacterized protein LOC100265508 isoform X2 [Vitis 
vinifera]
 emb|CBI32724.3| unnamed protein product [Vitis vinifera]
Length=516

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 72/115 (63%), Gaps = 1/115 (1%)
 Frame = +2

Query  242  SSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPS  421
            SS I+EE  + +  R  NL LEIP  + + S E+ V+I    TP  T K+VNF   PSPS
Sbjct  32   SSEIMEEAPRGQQQRHQNLILEIPSRTHEGSTEDFVRINMPPTPNSTPKRVNFSPMPSPS  91

Query  422  DPRVNGSPGHLP-RAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDK  583
              ++N SPG  P + +SSI++LLPKL+F   +S  ++EKA  + LG S+T  ++K
Sbjct  92   YTKINVSPGPSPSKGRSSIKSLLPKLSFKYRSSTSEIEKAAILALGASSTGTREK  146



>ref|XP_010653565.1| PREDICTED: uncharacterized protein LOC100265508 isoform X1 [Vitis 
vinifera]
 ref|XP_010653566.1| PREDICTED: uncharacterized protein LOC100265508 isoform X1 [Vitis 
vinifera]
Length=532

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 78/133 (59%), Gaps = 3/133 (2%)
 Frame = +2

Query  194  NGGRRETGISIP--KSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkkll  367
            NGG     +  P  K   SS I+EE  + +  R  NL LEIP  + + S E+ V+I    
Sbjct  14   NGGACNNTLDPPIQKVGISSEIMEEAPRGQQQRHQNLILEIPSRTHEGSTEDFVRINMPP  73

Query  368  tptptakkVNFLVTPSPSDPRVNGSPGHLP-RAKSSIRNLLPKLNFMSHNSNLDMEKAPD  544
            TP  T K+VNF   PSPS  ++N SPG  P + +SSI++LLPKL+F   +S  ++EKA  
Sbjct  74   TPNSTPKRVNFSPMPSPSYTKINVSPGPSPSKGRSSIKSLLPKLSFKYRSSTSEIEKAAI  133

Query  545  IDLGCSATAPQDK  583
            + LG S+T  ++K
Sbjct  134  LALGASSTGTREK  146



>ref|XP_009769900.1| PREDICTED: uncharacterized protein LOC104220688 isoform X1 [Nicotiana 
sylvestris]
Length=513

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 65/109 (60%), Gaps = 2/109 (2%)
 Frame = +2

Query  242  SSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptpta-kkVNFLVTPSP  418
            SS I+EE+   +  R+ NL LE+P   +    E+ V+I  L        K+VNF   PSP
Sbjct  37   SSEIVEELQLCERQRQLNLLLEVPERIVDGPIEDFVRINMLSPSPTQTPKRVNFSPLPSP  96

Query  419  SDPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCS  562
            S  +VNGSPG  L RAKSSI++LLPKL+F   N   D+EKA  + LG S
Sbjct  97   SHVKVNGSPGPSLSRAKSSIKSLLPKLSFKFRNRTTDIEKAAMLALGAS  145



>emb|CAN69885.1| hypothetical protein VITISV_005071 [Vitis vinifera]
Length=457

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 72/115 (63%), Gaps = 1/115 (1%)
 Frame = +2

Query  242  SSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPS  421
            SS I+EE  + +  R  NL LEIP  + + S E+ V+I    TP  T K+VNF   PSPS
Sbjct  32   SSEIMEEXPRGQQQRHQNLILEIPSRTHEGSTEDFVRINMPPTPNSTPKRVNFSPMPSPS  91

Query  422  DPRVNGSPGHLP-RAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDK  583
              ++N SPG  P + +SSI++LLPKL+F   +S  ++EKA  + LG S+T  ++K
Sbjct  92   YTKINVSPGPSPSKGRSSIKSLLPKLSFKYRSSTSEIEKAAILALGASSTGTREK  146



>ref|XP_009769901.1| PREDICTED: uncharacterized protein LOC104220688 isoform X2 [Nicotiana 
sylvestris]
Length=435

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 65/109 (60%), Gaps = 2/109 (2%)
 Frame = +2

Query  242  SSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptpta-kkVNFLVTPSP  418
            SS I+EE+   +  R+ NL LE+P   +    E+ V+I  L        K+VNF   PSP
Sbjct  37   SSEIVEELQLCERQRQLNLLLEVPERIVDGPIEDFVRINMLSPSPTQTPKRVNFSPLPSP  96

Query  419  SDPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCS  562
            S  +VNGSPG  L RAKSSI++LLPKL+F   N   D+EKA  + LG S
Sbjct  97   SHVKVNGSPGPSLSRAKSSIKSLLPKLSFKFRNRTTDIEKAAMLALGAS  145



>ref|XP_008385400.1| PREDICTED: uncharacterized protein LOC103447955 [Malus domestica]
Length=535

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 84/141 (60%), Gaps = 5/141 (4%)
 Frame = +2

Query  200  GRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptp  379
            G+ E  + + K   S  + EE  QV   +R NL LEIP  + ++  ++ V IK   TP+P
Sbjct  78   GQGEVDVPLDKVEDSVVVAEEAPQVHPWKRQNLHLEIPTRTSEDCVQDFVAIKMPPTPSP  137

Query  380  takkVNFLVTPSPSDPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLG  556
            T +KVNFL+T    D R++GSPG    + KSSI++LLPKL+F  + S  D EKA ++   
Sbjct  138  TPRKVNFLLTSGSVDGRMSGSPGPSSAKGKSSIKSLLPKLSF-KYRSTADAEKASNLASE  196

Query  557  CSATAPQDKVVSISISRSWSL  619
             S+T  ++K    SISRS SL
Sbjct  197  GSSTGVREKA---SISRSLSL  214



>ref|XP_004148772.1| PREDICTED: uncharacterized protein LOC101213858 [Cucumis sativus]
 gb|KGN64734.1| hypothetical protein Csa_1G084330 [Cucumis sativus]
Length=485

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 82/146 (56%), Gaps = 14/146 (10%)
 Frame = +2

Query  200  GRRETGISIP---KSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkkllt  370
            G RE  ISIP      +++GI EE       +R NL LEIP  + ++S ++   IK   T
Sbjct  15   GSREEPISIPIQKDEGTAAGITEEKEHSHQWKRSNLVLEIPSRTPESSPQDYHAIKMPQT  74

Query  371  ptptakkVNFLVTPSPSDPRVN---GSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAP  541
            P      VNFL+TPSPS+ R+N          R KSSIR+L PKL+F+ H S+ D+EK  
Sbjct  75   PRK----VNFLLTPSPSEVRINGSGSPGPSSSRGKSSIRSLFPKLSFI-HRSSSDVEKVA  129

Query  542  DIDLGCSATAPQDKVVSISISRSWSL  619
            ++ L  S+   Q+K    SISRS SL
Sbjct  130  NLALEGSSNGAQEKP---SISRSLSL  152



>ref|XP_004166546.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101231491 
[Cucumis sativus]
Length=485

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 82/146 (56%), Gaps = 14/146 (10%)
 Frame = +2

Query  200  GRRETGISIP---KSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkkllt  370
            G RE  ISIP      +++GI EE       +R NL LEIP  + ++S ++   IK   T
Sbjct  15   GSREEPISIPIQKDEGTAAGITEEKEHSHQWKRSNLVLEIPSRTPESSPQDYHAIKMPQT  74

Query  371  ptptakkVNFLVTPSPSDPRVN---GSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAP  541
            P      VNFL+TPSPS+ R+N          R KSSIR+L PKL+F+ H S+ D+EK  
Sbjct  75   PRK----VNFLLTPSPSEVRINGSGSPGPSSSRGKSSIRSLFPKLSFI-HRSSSDVEKVA  129

Query  542  DIDLGCSATAPQDKVVSISISRSWSL  619
            ++ L  S+   Q+K    SISRS SL
Sbjct  130  NLALEGSSNGAQEKP---SISRSLSL  152



>ref|XP_008463882.1| PREDICTED: uncharacterized protein LOC103501900 isoform X2 [Cucumis 
melo]
Length=485

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 81/146 (55%), Gaps = 14/146 (10%)
 Frame = +2

Query  200  GRRETGISIP---KSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkkllt  370
            G R+  ISIP      +++GI EE       +R NL LEIP  + ++S ++   IK   T
Sbjct  15   GSRDEPISIPIQKDEGTAAGITEEKEHSHQWKRSNLVLEIPSRTPESSPQDYHAIKMPQT  74

Query  371  ptptakkVNFLVTPSPSDPRVN---GSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAP  541
            P      VNFL+TPSPSD R+N          R KSSIR+L PKL+F+ H S+ D+EK  
Sbjct  75   PRK----VNFLLTPSPSDVRINGSGSPGPSSSRGKSSIRSLFPKLSFI-HRSSSDVEKVA  129

Query  542  DIDLGCSATAPQDKVVSISISRSWSL  619
            ++ L  S    Q+K    SISRS SL
Sbjct  130  NLALEGSLNGAQEKP---SISRSLSL  152



>ref|XP_008463872.1| PREDICTED: uncharacterized protein LOC103501900 isoform X1 [Cucumis 
melo]
Length=486

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 81/146 (55%), Gaps = 14/146 (10%)
 Frame = +2

Query  200  GRRETGISIP---KSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkkllt  370
            G R+  ISIP      +++GI EE       +R NL LEIP  + ++S ++   IK   T
Sbjct  15   GSRDEPISIPIQKDEGTAAGITEEKEHSHQWKRSNLVLEIPSRTPESSPQDYHAIKMPQT  74

Query  371  ptptakkVNFLVTPSPSDPRVN---GSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAP  541
            P      VNFL+TPSPSD R+N          R KSSIR+L PKL+F+ H S+ D+EK  
Sbjct  75   PRK----VNFLLTPSPSDVRINGSGSPGPSSSRGKSSIRSLFPKLSFI-HRSSSDVEKVA  129

Query  542  DIDLGCSATAPQDKVVSISISRSWSL  619
            ++ L  S    Q+K    SISRS SL
Sbjct  130  NLALEGSLNGAQEKP---SISRSLSL  152



>ref|XP_009367089.1| PREDICTED: uncharacterized protein LOC103956779 isoform X1 [Pyrus 
x bretschneideri]
Length=474

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 84/141 (60%), Gaps = 5/141 (4%)
 Frame = +2

Query  200  GRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptp  379
            G+ E  + + K   S G+ EE  Q+   +R NL LEIP  + ++  +E V IK   TP+P
Sbjct  17   GQGEVVVPLHKVEDSVGVAEEAPQIHPWKRKNLHLEIPARTSEDFVKEFVAIKMPPTPSP  76

Query  380  takkVNFLVTPSPSDPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLG  556
            T +KVNFL+TP   D R++ SPG    + KSSI+++ PKL+F  + S+   EKA ++   
Sbjct  77   TPRKVNFLLTPGSVDGRMSDSPGPSSAKGKSSIKSIFPKLSF-KYRSSAGAEKASNLAAE  135

Query  557  CSATAPQDKVVSISISRSWSL  619
             S+T  ++K    SISRS SL
Sbjct  136  GSSTGAREKA---SISRSQSL  153



>ref|XP_009367091.1| PREDICTED: uncharacterized protein LOC103956779 isoform X2 [Pyrus 
x bretschneideri]
Length=472

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 84/141 (60%), Gaps = 5/141 (4%)
 Frame = +2

Query  200  GRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptp  379
            G+ E  + + K   S G+ EE  Q+   +R NL LEIP  + ++  +E V IK   TP+P
Sbjct  17   GQGEVVVPLHKVEDSVGVAEEAPQIHPWKRKNLHLEIPARTSEDFVKEFVAIKMPPTPSP  76

Query  380  takkVNFLVTPSPSDPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLG  556
            T +KVNFL+TP   D R++ SPG    + KSSI+++ PKL+F  + S+   EKA ++   
Sbjct  77   TPRKVNFLLTPGSVDGRMSDSPGPSSAKGKSSIKSIFPKLSF-KYRSSAGAEKASNLAAE  135

Query  557  CSATAPQDKVVSISISRSWSL  619
             S+T  ++K    SISRS SL
Sbjct  136  GSSTGAREKA---SISRSQSL  153



>ref|XP_006400834.1| hypothetical protein EUTSA_v10013381mg [Eutrema salsugineum]
 gb|ESQ42287.1| hypothetical protein EUTSA_v10013381mg [Eutrema salsugineum]
Length=488

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 79/132 (60%), Gaps = 8/132 (6%)
 Frame = +2

Query  230  KSLSSSGIIEEIT-QVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLV  406
            K+  SS IIEEI+   +  RR NLSL+IP  +   S E+ V IK   TP+PT ++VNF +
Sbjct  25   KAEGSSAIIEEISANAQQWRRKNLSLQIPSRATGLSPEDSVVIKMPPTPSPTPRRVNFSL  84

Query  407  TPSPSDPRVNGSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAP-DIDLGCSATAPQDK  583
            T S   P    S    PR KSS++NL+PK+ F   +SN D+EK   D+   CS +A Q+K
Sbjct  85   TSSSPGPGPTSSSSVPPRGKSSLKNLIPKVGFKPKHSNTDIEKGQGDV---CSPSALQEK  141

Query  584  VVSISISRSWSL  619
                SISRS SL
Sbjct  142  A---SISRSLSL  150



>ref|XP_010098199.1| hypothetical protein L484_007661 [Morus notabilis]
 gb|EXB74655.1| hypothetical protein L484_007661 [Morus notabilis]
Length=502

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 80/153 (52%), Gaps = 10/153 (7%)
 Frame = +2

Query  179  GEDVQNGGRRETGISIP----KSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEI  346
             E +Q     +T  S+P    K+  S  I EE  Q    +R NL LEIP      S  + 
Sbjct  7    AEQLQQRSSEQTSASLPLQNQKAEGSMNITEETQQAHPWKRQNLFLEIPSRPSDASSPDF  66

Query  347  VQIkklltptpta-kkVNFLVTPSPSDPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSN  520
            V IK   T      +KVNFL+TP  +  R NGSPG    RAKSSI+ L PKL+F S  S+
Sbjct  67   VGIKMPSTTPSPTPRKVNFLLTPDSAAARTNGSPGPSSSRAKSSIKGLFPKLSFKSRTSS  126

Query  521  LDMEKAPDIDLGCSATAPQDKVVSISISRSWSL  619
             D+EKA ++    SA   ++K    +I+RS SL
Sbjct  127  -DIEKAENLPSEASAAGTREKP---AIARSLSL  155



>ref|XP_006400833.1| hypothetical protein EUTSA_v10013381mg [Eutrema salsugineum]
 gb|ESQ42286.1| hypothetical protein EUTSA_v10013381mg [Eutrema salsugineum]
Length=487

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 77/128 (60%), Gaps = 8/128 (6%)
 Frame = +2

Query  242  SSGIIEEIT-QVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSP  418
            SS IIEEI+   +  RR NLSL+IP  +   S E+ V IK   TP+PT ++VNF +T S 
Sbjct  28   SSAIIEEISANAQQWRRKNLSLQIPSRATGLSPEDSVVIKMPPTPSPTPRRVNFSLTSSS  87

Query  419  SDPRVNGSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAP-DIDLGCSATAPQDKVVSI  595
              P    S    PR KSS++NL+PK+ F   +SN D+EK   D+   CS +A Q+K    
Sbjct  88   PGPGPTSSSSVPPRGKSSLKNLIPKVGFKPKHSNTDIEKGQGDV---CSPSALQEKA---  141

Query  596  SISRSWSL  619
            SISRS SL
Sbjct  142  SISRSLSL  149



>ref|XP_010043740.1| PREDICTED: uncharacterized protein LOC104432868 isoform X1 [Eucalyptus 
grandis]
 gb|KCW85731.1| hypothetical protein EUGRSUZ_B02493 [Eucalyptus grandis]
Length=513

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 62/161 (39%), Positives = 86/161 (53%), Gaps = 7/161 (4%)
 Frame = +2

Query  143  MDREKKETFLSEGEDVQNGGRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMS  322
            M+ E K +   +G+ +   G     I I K     G  +E  Q  H ++ NL L+IP   
Sbjct  1    METEDKVSEKVQGDVIT--GEATVVIPIHKVEDLMGTAQEAPQAHHWKKQNLFLDIPSRK  58

Query  323  LQNSREEIVQIkklltptptakkVNFLVTPSPSDPRVN-GSPG-HLPRAKSSIRNLLPKL  496
            +    ++ V IK   TP  T K+VNFL+TPS ++ R N  SPG    R KSSI+NLLPK+
Sbjct  59   MGTWTQDSVIIKMPPTPGATPKRVNFLLTPSSNEARNNIASPGPSSSRGKSSIKNLLPKM  118

Query  497  NFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISISRSWSL  619
            +F+  NS  D EKA + D   S T  ++K    SI+RS S 
Sbjct  119  SFIHRNSAADTEKATNPDPDASITGLREKP---SIARSLSF  156



>ref|XP_008243925.1| PREDICTED: uncharacterized protein LOC103342122 [Prunus mume]
Length=512

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 81/138 (59%), Gaps = 4/138 (3%)
 Frame = +2

Query  209  ETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptak  388
            + G SI K   ++ IIEE    +  RR NL L+IP  SL++++E+ V+I    TP+ T K
Sbjct  20   KAGPSIQKGGDAAEIIEEAPPGQPWRRQNLILQIPSRSLEDAKEDFVRINMPPTPSLTPK  79

Query  389  kVNFLVTPSPSDPRV-NGSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSA  565
            +VNF   PSPS  ++         +AKS+I++LLPKL+F   N+  +++KA  + LG   
Sbjct  80   RVNFSPLPSPSLAKISGSPGPSSSKAKSTIKSLLPKLSFKHRNTTSEIQKAATLALGGLP  139

Query  566  TAPQDKVVSISISRSWSL  619
               ++K +   ISR+WS 
Sbjct  140  AGTREKPL---ISRTWSF  154



>ref|XP_007145227.1| hypothetical protein PHAVU_007G221300g [Phaseolus vulgaris]
 gb|ESW17221.1| hypothetical protein PHAVU_007G221300g [Phaseolus vulgaris]
Length=510

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 83/143 (58%), Gaps = 8/143 (6%)
 Frame = +2

Query  194  NGGRRETG----ISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkk  361
            N G   TG    I I K  +SS IIEE  + +HG R N  ++IP +S +  +E+ V+I  
Sbjct  14   NQGHGTTGNRVDIPIQKGPASSEIIEEFPRDQHGTRQNFIVDIPAISQEELKEDYVRI--  71

Query  362  lltptptakkVNFLVTPSPSDPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKA  538
             +  TP  ++V F   PSP  PR   SPG    + +S+I+  LPKL+F   N++L++EKA
Sbjct  72   NMPLTPPPRRVVFSPCPSPVYPRSKESPGPSSSKNRSNIKTFLPKLSFKFRNTSLEIEKA  131

Query  539  PDIDLGCSAT-APQDKVVSISIS  604
              + LG SAT AP+   +S ++S
Sbjct  132  AFLALGGSATVAPKKPFLSRTLS  154



>ref|XP_007027305.1| Binding protein, putative isoform 4 [Theobroma cacao]
 gb|EOY07807.1| Binding protein, putative isoform 4 [Theobroma cacao]
Length=386

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 76/116 (66%), Gaps = 4/116 (3%)
 Frame = +2

Query  275  KHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPSDPRVNGSPGHL  454
            +H +  +L LEIP  +L+++RE+ V+I   LTPT T K+VNF   PSP   R + SP H 
Sbjct  5    QHRKPDDLVLEIPPRTLEDAREDFVRIDMALTPTATPKRVNFSPMPSPIFSRFDDSPVHS  64

Query  455  P-RAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISISRSWSL  619
              + KS++++LLPKL+F S N+NL++EKA  + LG S+   + K     ISR++SL
Sbjct  65   SFKNKSALKSLLPKLSFKSRNTNLEIEKAAILALGGSSAEIRGKP---RISRTFSL  117



>ref|XP_008359119.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103422843 
[Malus domestica]
Length=476

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 85/143 (59%), Gaps = 9/143 (6%)
 Frame = +2

Query  200  GRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptp  379
            G+ E  + + K   S G+ EE  QV   +R NL LEIP  + ++  ++ V IK   TP+P
Sbjct  17   GQGEVVVPLHKVEDSVGVAEEAPQVHPWKRQNLHLEIPTRTSEDCVKDFVAIKMPPTPSP  76

Query  380  takkVNFLVTPSPSDPRVNGSPGHLP---RAKSSIRNLLPKLNFMSHNSNLDMEKAPDID  550
            T +KVNFL+TP   D R++ SP  +P   + KSSI+++ PKL+F  + S+ D EKA ++ 
Sbjct  77   TPRKVNFLLTPGSVDGRMSDSP--VPSSAKGKSSIKSIFPKLSF-KYRSSADAEKASNLA  133

Query  551  LGCSATAPQDKVVSISISRSWSL  619
               S+T  + K    SISRS SL
Sbjct  134  AEGSSTGARXKA---SISRSLSL  153



>ref|XP_011048564.1| PREDICTED: E3 ubiquitin-protein ligase MARCH7-like [Populus euphratica]
Length=501

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 85/150 (57%), Gaps = 9/150 (6%)
 Frame = +2

Query  176  EGEDVQNGGRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQI  355
            EGE+  N        SIPK+ SS+ I E+  + +H R   LSLEI   SL+++R + V I
Sbjct  11   EGENFSN----PDDPSIPKAGSSTEITEDNPEGQHQRHRELSLEIQSNSLEDARFDFVTI  66

Query  356  kklltptptakkVNFLVTPSPSDPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDME  532
            +    P+ T K+VNF   PSPS  ++N  P     + KS+IR+LLPKL+F   N  LD+E
Sbjct  67   QTPPIPSSTPKRVNFSPMPSPSFAQMNEPPDPSSSKIKSNIRSLLPKLSFKYRNGTLDIE  126

Query  533  KAPD-IDLGCSATAPQDKVVSISISRSWSL  619
            KA   + LG S+   + K     ISR+ SL
Sbjct  127  KAATMLALGGSSETTRQKPF---ISRTLSL  153



>ref|XP_010043741.1| PREDICTED: uncharacterized protein LOC104432868 isoform X2 [Eucalyptus 
grandis]
Length=496

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 73/126 (58%), Gaps = 5/126 (4%)
 Frame = +2

Query  248  GIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPSDP  427
            G  +E  Q  H ++ NL L+IP   +    ++ V IK   TP  T K+VNFL+TPS ++ 
Sbjct  17   GTAQEAPQAHHWKKQNLFLDIPSRKMGTWTQDSVIIKMPPTPGATPKRVNFLLTPSSNEA  76

Query  428  RVN-GSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISI  601
            R N  SPG    R KSSI+NLLPK++F+  NS  D EKA + D   S T  ++K    SI
Sbjct  77   RNNIASPGPSSSRGKSSIKNLLPKMSFIHRNSAADTEKATNPDPDASITGLREKP---SI  133

Query  602  SRSWSL  619
            +RS S 
Sbjct  134  ARSLSF  139



>ref|XP_007027304.1| Binding protein, putative isoform 3 [Theobroma cacao]
 gb|EOY07806.1| Binding protein, putative isoform 3 [Theobroma cacao]
Length=496

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 76/116 (66%), Gaps = 4/116 (3%)
 Frame = +2

Query  275  KHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPSDPRVNGSPGHL  454
            +H +  +L LEIP  +L+++RE+ V+I   LTPT T K+VNF   PSP   R + SP H 
Sbjct  5    QHRKPDDLVLEIPPRTLEDAREDFVRIDMALTPTATPKRVNFSPMPSPIFSRFDDSPVHS  64

Query  455  P-RAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISISRSWSL  619
              + KS++++LLPKL+F S N+NL++EKA  + LG S+   + K     ISR++SL
Sbjct  65   SFKNKSALKSLLPKLSFKSRNTNLEIEKAAILALGGSSAEIRGKP---RISRTFSL  117



>ref|XP_008463891.1| PREDICTED: uncharacterized protein LOC103501900 isoform X3 [Cucumis 
melo]
Length=460

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 74/130 (57%), Gaps = 11/130 (8%)
 Frame = +2

Query  239  SSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSP  418
            +++GI EE       +R NL LEIP  + ++S ++   IK   TP      VNFL+TPSP
Sbjct  5    TAAGITEEKEHSHQWKRSNLVLEIPSRTPESSPQDYHAIKMPQTPRK----VNFLLTPSP  60

Query  419  SDPRVN---GSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVV  589
            SD R+N          R KSSIR+L PKL+F+ H S+ D+EK  ++ L  S    Q+K  
Sbjct  61   SDVRINGSGSPGPSSSRGKSSIRSLFPKLSFI-HRSSSDVEKVANLALEGSLNGAQEKP-  118

Query  590  SISISRSWSL  619
              SISRS SL
Sbjct  119  --SISRSLSL  126



>ref|XP_007027303.1| Binding protein, putative isoform 2 [Theobroma cacao]
 gb|EOY07805.1| Binding protein, putative isoform 2 [Theobroma cacao]
Length=419

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 76/116 (66%), Gaps = 4/116 (3%)
 Frame = +2

Query  275  KHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPSDPRVNGSPGHL  454
            +H +  +L LEIP  +L+++RE+ V+I   LTPT T K+VNF   PSP   R + SP H 
Sbjct  5    QHRKPDDLVLEIPPRTLEDAREDFVRIDMALTPTATPKRVNFSPMPSPIFSRFDDSPVHS  64

Query  455  P-RAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISISRSWSL  619
              + KS++++LLPKL+F S N+NL++EKA  + LG S+   + K     ISR++SL
Sbjct  65   SFKNKSALKSLLPKLSFKSRNTNLEIEKAAILALGGSSAEIRGKP---RISRTFSL  117



>ref|XP_008387645.1| PREDICTED: uncharacterized protein LOC103450102 [Malus domestica]
Length=206

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 82/153 (54%), Gaps = 8/153 (5%)
 Frame = +2

Query  176  EGEDVQNGGRRETGISIPKSLS---SSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEI  346
            +G   +NGG   T  + P +     S+ IIEE       RR NL L+IP  +L++++E  
Sbjct  5    DGTFAKNGGGIFTNEAEPSTYMDGVSTEIIEEAPPGHLWRRQNLVLQIPSRTLEDAKENF  64

Query  347  VQIkklltptptakkVNFLVTPSPSDPRVNGSPG--HLPRAKSSIRNLLPKLNFMSHNSN  520
            V+I    TP+PT K+VNF   PSPS  ++N SPG        ++ R+LLP+L+F + N+ 
Sbjct  65   VRINMPPTPSPTPKRVNFSPLPSPSLAKINXSPGPSXSKTKSTTKRSLLPRLSFKNXNTT  124

Query  521  LDMEKAPDIDLGCSATAPQDKVVSISISRSWSL  619
             D+EKA    LG       +K    S  R+WS 
Sbjct  125  SDIEKAATRALGGLPAGTHEKP---STPRAWSF  154



>ref|XP_006361814.1| PREDICTED: uncharacterized protein LOC102593861 [Solanum tuberosum]
Length=516

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 69/115 (60%), Gaps = 3/115 (3%)
 Frame = +2

Query  242  SSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPS  421
            SS I+EE+ Q+   +   L LE+P  ++    E+ V+I    +P  T K+V F  +PSP+
Sbjct  39   SSEIVEEL-QLCELQMKQLPLEVPERTIDGQTEDFVRIDMSTSPVQTPKRVIFSPSPSPN  97

Query  422  DPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDK  583
              R+N SP   LP AKSSI++LLPKL+F   N   D+EK+  + LG S   PQDK
Sbjct  98   HVRLNESPSPSLPWAKSSIKSLLPKLSFKFRNKTTDIEKSAMLALGVSPL-PQDK  151



>ref|XP_010920401.1| PREDICTED: uncharacterized protein LOC105044280 [Elaeis guineensis]
Length=497

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 61/98 (62%), Gaps = 1/98 (1%)
 Frame = +2

Query  245  SGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPSD  424
            SG+IE++T V  G+RPNLS+EIP  S+  S   +V+     TP   + +VN L T SP+ 
Sbjct  12   SGVIEDLTSVHQGKRPNLSIEIPPRSMGVSSMNLVKKYIPSTPGSVSTRVNNLPTCSPAS  71

Query  425  PRVNGSP-GHLPRAKSSIRNLLPKLNFMSHNSNLDMEK  535
             R+  SP     +A+ SI+NLLP L+F   +S L++EK
Sbjct  72   ARIQASPCSSSSKARPSIKNLLPGLSFKFRSSALEIEK  109



>ref|XP_004246665.1| PREDICTED: uncharacterized protein LOC101249200 [Solanum lycopersicum]
Length=515

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 69/115 (60%), Gaps = 3/115 (3%)
 Frame = +2

Query  242  SSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPS  421
            SS I+EE+ Q+   +   L LE+P  ++    E+ V+I    +P  T K+V F  +PSP+
Sbjct  38   SSEIVEEL-QLCELQTKQLPLEVPERTIDGQTEDFVRIDMSTSPVQTPKRVIFSPSPSPN  96

Query  422  DPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDK  583
              R+N SP   LP AKSSI++LLPK++F   N   D+EKA  + LG S   PQDK
Sbjct  97   HVRLNESPSPSLPWAKSSIKSLLPKISFKLRNKTSDIEKAAMLALGVSPL-PQDK  150



>gb|KJB56111.1| hypothetical protein B456_009G106300 [Gossypium raimondii]
 gb|KJB56112.1| hypothetical protein B456_009G106300 [Gossypium raimondii]
 gb|KJB56113.1| hypothetical protein B456_009G106300 [Gossypium raimondii]
 gb|KJB56114.1| hypothetical protein B456_009G106300 [Gossypium raimondii]
Length=440

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 53/77 (69%), Gaps = 4/77 (5%)
 Frame = +2

Query  392  VNFLVTPSPSDPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSAT  568
            VNFL+TPSPSD R++GSPG    R KSS+++LLPKL+F   N N D+EKA       S+T
Sbjct  12   VNFLLTPSPSDARISGSPGPSTSRGKSSLKSLLPKLSFKQRNVNSDIEKAAIFAPESSST  71

Query  569  APQDKVVSISISRSWSL  619
            + ++K    SI+R+ SL
Sbjct  72   SLREKP---SIARTLSL  85



>ref|XP_009342773.1| PREDICTED: uncharacterized protein LOC103934748 [Pyrus x bretschneideri]
Length=520

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 74/128 (58%), Gaps = 5/128 (4%)
 Frame = +2

Query  242  SSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPS  421
            S+ IIEE       RR NL L+IP  +L++++E  V+I    TP+PT K+VNF   PSPS
Sbjct  30   STEIIEEAPPGHLWRRQNLVLQIPSRTLEDAKENFVRINMPPTPSPTPKRVNFSPLPSPS  89

Query  422  DPRVNGSPG--HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSI  595
              ++N SPG        ++ R+LLP+L+F + N+ LD+EKA    LG      ++K    
Sbjct  90   LAKINESPGPSSSKTKSTTKRSLLPRLSFKNWNTTLDIEKAAARALGGLPAGTREKP---  146

Query  596  SISRSWSL  619
            S  R+WS 
Sbjct  147  STPRAWSF  154



>gb|KCW49745.1| hypothetical protein EUGRSUZ_K03240 [Eucalyptus grandis]
Length=429

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 76/146 (52%), Gaps = 4/146 (3%)
 Frame = +2

Query  185  DVQNGGRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkkl  364
            D  N      G   P+  S+  IIEEI    H  R  L LE+P  + +  RE+   I   
Sbjct  14   DNVNAPEAGAGCPAPEVRSAPEIIEEIPDAGHQGREGLVLEVPPRTSEFGREDTAVIDIP  73

Query  365  ltptptakkVNFLVTPSPSDPRVNGSPGHLP-RAKSSIRNLLPKLNFMSHNSNLDMEKAP  541
             TP  T ++VNF   PSPS  +V+G+    P   +++++ LLPKL+F   N+  D+EKA 
Sbjct  74   PTPNLTPRRVNFSPMPSPSFAKVDGTSAPSPSNRRATMKTLLPKLSFKFRNNTFDIEKAA  133

Query  542  DIDLGCSATAPQDKVVSISISRSWSL  619
             + LG S    +++ +   I R++SL
Sbjct  134  MLALGASPARRRERPL---IPRTFSL  156



>emb|CDP06734.1| unnamed protein product [Coffea canephora]
Length=514

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 80/136 (59%), Gaps = 12/136 (9%)
 Frame = +2

Query  224  IPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFL  403
            I K   SS I+EE T  +H R   ++++IP  +   S ++ V+I    +PTP    VNF 
Sbjct  42   IQKVRESSEIVEESTSSQHQRNEIVTVDIPKTTADGSIDDFVRINVPPSPTPKK--VNFS  99

Query  404  VTPSPSDPRVNGSPGHLP----RAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATA  571
              PSP   R NGSP  LP    + K+S+++LLPKL+F   N++ ++EKA  + LG S   
Sbjct  100  PLPSPGHIRFNGSP--LPSSSNKGKASMKSLLPKLSFKFRNTDSEIEKAAMLALG-SPLG  156

Query  572  PQDKVVSISISRSWSL  619
            PQ+K    SI+R++SL
Sbjct  157  PQEKR---SITRTFSL  169



>gb|AFK33495.1| unknown [Lotus japonicus]
Length=209

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 85/150 (57%), Gaps = 7/150 (5%)
 Frame = +2

Query  170  LSEGEDVQNGGRRE--TGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREE  343
             S+  + Q  G  E    I I K L S  I EE+T  ++  RPN+ LEIP ++ + +RE+
Sbjct  8    FSKDNNNQGAGTIEDKVDIQIQKDLVSPEITEELTSGQYETRPNIILEIPTITQEEARED  67

Query  344  IVQIkklltptptakkVNFLVTPSPSDPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSN  520
             ++I   + PTP+ ++V F    SP   R N SPG    +++S+I+  LPKL+F   N++
Sbjct  68   YLRI--DIPPTPSPRRVIFPPCLSPGFSRANESPGPSSSKSRSTIKTFLPKLSFKFLNTS  125

Query  521  LDMEKAPDIDLGCSATAPQDKVVSISISRS  610
             D+EKA  + L     AP+   +S ++SR+
Sbjct  126  SDIEKAAFLAL--EGFAPKKPFLSRTLSRT  153



>gb|KCW49744.1| hypothetical protein EUGRSUZ_K03240 [Eucalyptus grandis]
Length=483

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 76/146 (52%), Gaps = 4/146 (3%)
 Frame = +2

Query  185  DVQNGGRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkkl  364
            D  N      G   P+  S+  IIEEI    H  R  L LE+P  + +  RE+   I   
Sbjct  14   DNVNAPEAGAGCPAPEVRSAPEIIEEIPDAGHQGREGLVLEVPPRTSEFGREDTAVIDIP  73

Query  365  ltptptakkVNFLVTPSPSDPRVNGSPGHLP-RAKSSIRNLLPKLNFMSHNSNLDMEKAP  541
             TP  T ++VNF   PSPS  +V+G+    P   +++++ LLPKL+F   N+  D+EKA 
Sbjct  74   PTPNLTPRRVNFSPMPSPSFAKVDGTSAPSPSNRRATMKTLLPKLSFKFRNNTFDIEKAA  133

Query  542  DIDLGCSATAPQDKVVSISISRSWSL  619
             + LG S    +++ +   I R++SL
Sbjct  134  MLALGASPARRRERPL---IPRTFSL  156



>ref|XP_010037957.1| PREDICTED: uncharacterized protein LOC104426553 [Eucalyptus grandis]
 gb|KCW49743.1| hypothetical protein EUGRSUZ_K03240 [Eucalyptus grandis]
Length=514

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 76/146 (52%), Gaps = 4/146 (3%)
 Frame = +2

Query  185  DVQNGGRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkkl  364
            D  N      G   P+  S+  IIEEI    H  R  L LE+P  + +  RE+   I   
Sbjct  14   DNVNAPEAGAGCPAPEVRSAPEIIEEIPDAGHQGREGLVLEVPPRTSEFGREDTAVIDIP  73

Query  365  ltptptakkVNFLVTPSPSDPRVNGSPGHLP-RAKSSIRNLLPKLNFMSHNSNLDMEKAP  541
             TP  T ++VNF   PSPS  +V+G+    P   +++++ LLPKL+F   N+  D+EKA 
Sbjct  74   PTPNLTPRRVNFSPMPSPSFAKVDGTSAPSPSNRRATMKTLLPKLSFKFRNNTFDIEKAA  133

Query  542  DIDLGCSATAPQDKVVSISISRSWSL  619
             + LG S    +++ +   I R++SL
Sbjct  134  MLALGASPARRRERPL---IPRTFSL  156



>ref|XP_002864692.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40951.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=491

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 72/127 (57%), Gaps = 7/127 (6%)
 Frame = +2

Query  242  SSGIIEEIT-QVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSP  418
            SS I EE +  V+  RR NLSL+IP  +   S E+ V IK   TP+PT ++VNF +T S 
Sbjct  28   SSAITEETSANVQQWRRKNLSLQIPSRAAGLSPEDSVVIKMPPTPSPTPRRVNFSLTSSS  87

Query  419  SDPRVNGSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSIS  598
              P    S   LPR KSS++NLLPK       SN D+EK       CS +A Q+K    S
Sbjct  88   PGPTPTSS-SVLPRGKSSLKNLLPKAGCKPKISNTDIEKGQGN--ACSPSASQEKA---S  141

Query  599  ISRSWSL  619
            ISRS SL
Sbjct  142  ISRSLSL  148



>gb|AAK32917.1|AF367330_1 AT5g60580/muf9_230 [Arabidopsis thaliana]
 gb|AAM70570.1| AT5g60580/muf9_230 [Arabidopsis thaliana]
Length=383

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 71/127 (56%), Gaps = 7/127 (6%)
 Frame = +2

Query  242  SSGIIEEIT-QVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSP  418
            SS I E+ +  V+  RR NLSL+IP  +   S E+ V IK   TP+PT ++VNF +T S 
Sbjct  28   SSAITEDTSANVQQWRRKNLSLQIPSRAAGLSPEDSVVIKMPPTPSPTPRRVNFALTSSS  87

Query  419  SDPRVNGSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSIS  598
              P    S   LPR KSS++NLLPK       SN D+EK       CS  A Q+K    S
Sbjct  88   PGPTPTSS-SVLPRGKSSLKNLLPKAGCKPKTSNTDIEKGQGN--ACSPPASQEKA---S  141

Query  599  ISRSWSL  619
            ISRS SL
Sbjct  142  ISRSLSL  148



>ref|NP_568923.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 ref|NP_851231.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 dbj|BAB08241.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED97347.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AED97349.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=487

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 71/127 (56%), Gaps = 7/127 (6%)
 Frame = +2

Query  242  SSGIIEEIT-QVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSP  418
            SS I E+ +  V+  RR NLSL+IP  +   S E+ V IK   TP+PT ++VNF +T S 
Sbjct  28   SSAITEDTSANVQQWRRKNLSLQIPSRAAGLSPEDSVVIKMPPTPSPTPRRVNFALTSSS  87

Query  419  SDPRVNGSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSIS  598
              P    S   LPR KSS++NLLPK       SN D+EK       CS  A Q+K    S
Sbjct  88   PGPTPTSS-SVLPRGKSSLKNLLPKAGCKPKTSNTDIEKGQGN--ACSPPASQEKA---S  141

Query  599  ISRSWSL  619
            ISRS SL
Sbjct  142  ISRSLSL  148



>ref|NP_851232.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 ref|NP_001032112.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AED97348.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AED97350.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=494

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 71/127 (56%), Gaps = 7/127 (6%)
 Frame = +2

Query  242  SSGIIEEIT-QVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSP  418
            SS I E+ +  V+  RR NLSL+IP  +   S E+ V IK   TP+PT ++VNF +T S 
Sbjct  28   SSAITEDTSANVQQWRRKNLSLQIPSRAAGLSPEDSVVIKMPPTPSPTPRRVNFALTSSS  87

Query  419  SDPRVNGSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSIS  598
              P    S   LPR KSS++NLLPK       SN D+EK       CS  A Q+K    S
Sbjct  88   PGPTPTSS-SVLPRGKSSLKNLLPKAGCKPKTSNTDIEKGQGN--ACSPPASQEKA---S  141

Query  599  ISRSWSL  619
            ISRS SL
Sbjct  142  ISRSLSL  148



>ref|XP_010456560.1| PREDICTED: E3 ubiquitin-protein ligase MARCH7 [Camelina sativa]
 ref|XP_010456567.1| PREDICTED: E3 ubiquitin-protein ligase MARCH7 [Camelina sativa]
 ref|XP_010456573.1| PREDICTED: E3 ubiquitin-protein ligase MARCH7 [Camelina sativa]
Length=492

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 71/128 (55%), Gaps = 6/128 (5%)
 Frame = +2

Query  242  SSGIIEEIT--QVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPS  415
            SS I EE +   V+  RR NLSL+IP  +   S E+ V IK   TP+PT ++VNF +T +
Sbjct  29   SSAITEETSSSNVQQWRRKNLSLQIPSRATGLSSEDSVVIKMPPTPSPTPRRVNFSLTST  88

Query  416  PSDPRVNGSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSI  595
               P        LPRAKSS++NLLPK       SN D+EK      G +A++P       
Sbjct  89   SPGPVPPTPSSALPRAKSSLKNLLPKAGCKPKTSNTDIEKGQ----GNNASSPSALQEKA  144

Query  596  SISRSWSL  619
            SI+RS SL
Sbjct  145  SIARSLSL  152



>ref|XP_003539714.1| PREDICTED: probable E3 ubiquitin-protein ligase MARCH10-like 
[Glycine max]
Length=514

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 86/164 (52%), Gaps = 17/164 (10%)
 Frame = +2

Query  152  EKKETFLSEGEDVQNGGRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQN  331
            E+K   +SE  D     RR   + + K  +  GI EE T V   +R NL LEIP  + + 
Sbjct  5    EEKPMTVSEEHDA-GSCRRTVSLPVQKVDNPMGITEETTHVPPRKRQNLLLEIPSRTEEC  63

Query  332  SREEI---VQIkklltptptakkVNFLVTPSPSDPRVNGSPG-HLPRAKSSIRNLLPKLN  499
            S+E +   +       PTPT K+VNFLV+    DP    SPG    R+KSSIR+LLPKL+
Sbjct  64   SQEFVAIKIPPTPSSNPTPTPKRVNFLVSSHSVDPPTYNSPGPSTSRSKSSIRSLLPKLS  123

Query  500  FMSHNSNLDMEKAPDIDLGCSATAPQDKVVSI----SISRSWSL  619
            F  + + +D+EK        +A AP+     I    SISRS SL
Sbjct  124  F-RYRTPIDIEKP-------NAAAPEISSSGIGEKSSISRSLSL  159



>gb|KHN32082.1| hypothetical protein glysoja_028877 [Glycine soja]
Length=509

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 86/164 (52%), Gaps = 17/164 (10%)
 Frame = +2

Query  152  EKKETFLSEGEDVQNGGRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQN  331
            E+K   +SE  D     RR   + + K  +  GI EE T V   +R NL LEIP  + + 
Sbjct  5    EEKPMTVSEEHDA-GSCRRTVSLPVQKVDNPMGITEETTHVPPRKRQNLLLEIPSRTEEC  63

Query  332  SREEI---VQIkklltptptakkVNFLVTPSPSDPRVNGSPG-HLPRAKSSIRNLLPKLN  499
            S+E +   +       PTPT K+VNFLV+    DP    SPG    R+KSSIR+LLPKL+
Sbjct  64   SQEFVAIKIPPTPSSNPTPTPKRVNFLVSSHSVDPPTYNSPGPSTSRSKSSIRSLLPKLS  123

Query  500  FMSHNSNLDMEKAPDIDLGCSATAPQDKVVSI----SISRSWSL  619
            F  + + +D+EK        +A AP+     I    SISRS SL
Sbjct  124  F-RYRTPIDIEKP-------NAAAPEISSSGIGEKSSISRSLSL  159



>ref|XP_006591142.1| PREDICTED: E3 ubiquitin-protein ligase MARCH7-like [Glycine max]
Length=523

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 84/164 (51%), Gaps = 17/164 (10%)
 Frame = +2

Query  152  EKKETFLSEGEDVQNGGRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQN  331
            E+K   +SE  D  +  RR   + + K      I EE T V   +R NL LEIP  + ++
Sbjct  5    EEKPVTVSEEHDA-SSCRRTVSLPVQKVDDPMAITEETTHVPPRKRQNLLLEIPSRTEES  63

Query  332  SREEI---VQIkklltptptakkVNFLVTPSPSDPRVNGSPG-HLPRAKSSIRNLLPKLN  499
            S+E +   +       PTPT K+VNFLV+    DP    SPG    R KSSIRNLLPKL+
Sbjct  64   SQEFVAIKMPPTPSSNPTPTPKRVNFLVSSRSVDPPTYHSPGPSTSRGKSSIRNLLPKLS  123

Query  500  FMSHNSNLDMEK----APDIDLGCSATAPQDKVVSISISRSWSL  619
            F  + +  D+EK    AP++    +   P       SISRS SL
Sbjct  124  F-RYRTPADIEKPNTAAPEVSSTGTGEKP-------SISRSLSL  159



>gb|KHN38770.1| hypothetical protein glysoja_008319 [Glycine soja]
Length=524

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 84/164 (51%), Gaps = 17/164 (10%)
 Frame = +2

Query  152  EKKETFLSEGEDVQNGGRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQN  331
            E+K   +SE  D  +  RR   + + K      I EE T V   +R NL LEIP  + ++
Sbjct  5    EEKPVTVSEEHDA-SSCRRTVSLPVQKVDDPMAITEETTHVPPRKRQNLLLEIPSRTEES  63

Query  332  SREEI---VQIkklltptptakkVNFLVTPSPSDPRVNGSPG-HLPRAKSSIRNLLPKLN  499
            S+E +   +       PTPT K+VNFLV+    DP    SPG    R KSSIRNLLPKL+
Sbjct  64   SQEFVAIKMPPTPSSNPTPTPKRVNFLVSSRSVDPPTYHSPGPSTSRGKSSIRNLLPKLS  123

Query  500  FMSHNSNLDMEK----APDIDLGCSATAPQDKVVSISISRSWSL  619
            F  + +  D+EK    AP++    +   P       SISRS SL
Sbjct  124  F-RYRTPADIEKPNTAAPEVSSTGTGEKP-------SISRSLSL  159



>ref|XP_006381467.1| hypothetical protein POPTR_0006s13100g [Populus trichocarpa]
 gb|ERP59264.1| hypothetical protein POPTR_0006s13100g [Populus trichocarpa]
Length=504

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 74/130 (57%), Gaps = 3/130 (2%)
 Frame = +2

Query  224  IPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFL  403
            IPK   S+ I E+  + +H R   LSL I   SL+++R + V I+    P+ T K+V F 
Sbjct  23   IPKVGRSTEITEDNPEGQHQRHRELSLGIQSNSLEDARFDFVTIQTPPIPSSTPKRVIFS  82

Query  404  VTPSPSDPRVNGSPGHLP-RAKSSIRNLLPKLNFMSHNSNLDMEKAPDI--DLGCSATAP  574
              PSPS  ++N  P  L  + KS+IR+LLPKL+F   NS LD+EKA  +    G S T  
Sbjct  83   PMPSPSFAQMNEPPDPLSSKIKSNIRSLLPKLSFKYRNSTLDIEKAAAMLAQGGSSETTK  142

Query  575  QDKVVSISIS  604
            Q   +S ++S
Sbjct  143  QKPFISRTLS  152



>ref|XP_010443856.1| PREDICTED: E3 ubiquitin-protein ligase MARCH7-like [Camelina 
sativa]
 ref|XP_010443858.1| PREDICTED: E3 ubiquitin-protein ligase MARCH7-like [Camelina 
sativa]
 ref|XP_010443859.1| PREDICTED: E3 ubiquitin-protein ligase MARCH7-like [Camelina 
sativa]
Length=490

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 73/129 (57%), Gaps = 8/129 (6%)
 Frame = +2

Query  242  SSGIIEEIT--QVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPS  415
            SS I EE +   V+  RR NLSL+IP  +   S E+ V IK   TP+PT ++VNF +T +
Sbjct  28   SSAITEETSAANVQQWRRKNLSLQIPSRTTGLSSEDSVVIKMPPTPSPTPRRVNFSLTST  87

Query  416  PSDPRVNGSPGH-LPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVS  592
               P V  +P   LPRAKSS++NLLPK       SN D+EK        +A++P      
Sbjct  88   SPGPVVPPTPSSALPRAKSSLKNLLPKAGCKPKISNTDIEKGQG-----NASSPSALQEK  142

Query  593  ISISRSWSL  619
             SI+RS SL
Sbjct  143  ASIARSLSL  151



>emb|CDY67417.1| BnaC09g53890D, partial [Brassica napus]
Length=511

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 73/129 (57%), Gaps = 19/129 (15%)
 Frame = +2

Query  239  SSSGIIEEIT-QVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPS  415
            SSS I EE +  V+  RR NLSL+IP  +   S E+ V IK   TP+PT ++VNF +T  
Sbjct  64   SSSAITEETSANVQQWRRNNLSLQIPSRATNLSPEDSVVIKMPPTPSPTPRRVNFSLT--  121

Query  416  PSDPRVNGSPGHLP-RAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVS  592
                  + SPG  P R KSS++NL+PK+ F    SN D+EK   +D+ C   A       
Sbjct  122  ------SISPGPAPPRTKSSLKNLIPKVGFKPKLSNTDVEKG-QVDVSCQEKA-------  167

Query  593  ISISRSWSL  619
             SISRS SL
Sbjct  168  -SISRSLSL  175



>ref|XP_011468102.1| PREDICTED: uncharacterized protein LOC101308698 [Fragaria vesca 
subsp. vesca]
Length=506

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 76/128 (59%), Gaps = 4/128 (3%)
 Frame = +2

Query  239  SSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSP  418
            +S  IIEE       RR NL+L+IP  +L +++E+ V+I    TP+PT K+VNF   PSP
Sbjct  32   NSPEIIEETPPEHPWRRQNLALQIPSRTLADAKEDFVRIDMPPTPSPTPKRVNFSPLPSP  91

Query  419  SDPRV-NGSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSI  595
               +V         + K++I++LLPKL+F   N+  ++ KA  + LG + TA + + +  
Sbjct  92   YLNKVSGSPGPSSSKTKTTIKSLLPKLSFKYRNTTSEIRKAATLALGGTPTATRQRPI--  149

Query  596  SISRSWSL  619
             ISR++SL
Sbjct  150  -ISRTFSL  156



>gb|EYU34440.1| hypothetical protein MIMGU_mgv1a004524mg [Erythranthe guttata]
Length=522

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 89/168 (53%), Gaps = 13/168 (8%)
 Frame = +2

Query  143  MDREKKETFLSEGEDVQNGGRRETGISIPKSLS-SSGIIEEIT-----QVKHGRRPNLSL  304
            MD  + + F  E E+  +       +S P SL+  +G + EI        +   R  L L
Sbjct  1    MDPAEGKAFTKESEEGFSKNDCAVNLSPPPSLAHKAGELSEIVVEESSSSQQQLRQELVL  60

Query  305  EIP--MMSLQNSREEIVQIkklltptptakkVNFLVTPSPSDPRVNGSPG-HLPRAKSSI  475
             IP    +++ S E+ V +    +  PT K+VNF   PSP+  R++GSPG    + KS++
Sbjct  61   NIPKSTNTIEESIEDYVAVNTPPSTFPTPKRVNFSPLPSPNRARLDGSPGPSTSKGKSAM  120

Query  476  RNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISISRSWSL  619
            +N LPKL+F   NSN D+EKA  + LG S   P+ +    SISR++SL
Sbjct  121  KNFLPKLSFKFRNSNSDIEKAAMLALGVS---PEIR-GKPSISRTFSL  164



>gb|KJB20261.1| hypothetical protein B456_003G141100 [Gossypium raimondii]
Length=347

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 70/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  251  IIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPSDPR  430
            I EE   V + RR  L LEIP  +L+   +E V IK   TP+ T ++VNF +TPSPSD R
Sbjct  26   ITEETACVHNRRRSGLVLEIPSRTLEEPFQESVAIKIPPTPSLTPRRVNFFLTPSPSDAR  85

Query  431  VN-GSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVV  589
            +   S     R KSS+++LLPK++F   N N D+EKA + +   S+++ ++K V
Sbjct  86   ITGSSGPSSSRGKSSLKSLLPKVSFKHRNPNSDIEKAANFEPESSSSSQREKPV  139



>gb|KJB20263.1| hypothetical protein B456_003G141100 [Gossypium raimondii]
Length=412

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 70/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  251  IIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPSDPR  430
            I EE   V + RR  L LEIP  +L+   +E V IK   TP+ T ++VNF +TPSPSD R
Sbjct  26   ITEETACVHNRRRSGLVLEIPSRTLEEPFQESVAIKIPPTPSLTPRRVNFFLTPSPSDAR  85

Query  431  VN-GSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVV  589
            +   S     R KSS+++LLPK++F   N N D+EKA + +   S+++ ++K V
Sbjct  86   ITGSSGPSSSRGKSSLKSLLPKVSFKHRNPNSDIEKAANFEPESSSSSQREKPV  139



>gb|KJB20268.1| hypothetical protein B456_003G141100 [Gossypium raimondii]
Length=329

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 70/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  251  IIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPSDPR  430
            I EE   V + RR  L LEIP  +L+   +E V IK   TP+ T ++VNF +TPSPSD R
Sbjct  8    ITEETACVHNRRRSGLVLEIPSRTLEEPFQESVAIKIPPTPSLTPRRVNFFLTPSPSDAR  67

Query  431  VN-GSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVV  589
            +   S     R KSS+++LLPK++F   N N D+EKA + +   S+++ ++K V
Sbjct  68   ITGSSGPSSSRGKSSLKSLLPKVSFKHRNPNSDIEKAANFEPESSSSSQREKPV  121



>gb|KJB20264.1| hypothetical protein B456_003G141100 [Gossypium raimondii]
Length=385

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 70/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  251  IIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPSDPR  430
            I EE   V + RR  L LEIP  +L+   +E V IK   TP+ T ++VNF +TPSPSD R
Sbjct  26   ITEETACVHNRRRSGLVLEIPSRTLEEPFQESVAIKIPPTPSLTPRRVNFFLTPSPSDAR  85

Query  431  VN-GSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVV  589
            +   S     R KSS+++LLPK++F   N N D+EKA + +   S+++ ++K V
Sbjct  86   ITGSSGPSSSRGKSSLKSLLPKVSFKHRNPNSDIEKAANFEPESSSSSQREKPV  139



>gb|KJB20265.1| hypothetical protein B456_003G141100 [Gossypium raimondii]
Length=419

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 70/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  251  IIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPSDPR  430
            I EE   V + RR  L LEIP  +L+   +E V IK   TP+ T ++VNF +TPSPSD R
Sbjct  26   ITEETACVHNRRRSGLVLEIPSRTLEEPFQESVAIKIPPTPSLTPRRVNFFLTPSPSDAR  85

Query  431  VN-GSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVV  589
            +   S     R KSS+++LLPK++F   N N D+EKA + +   S+++ ++K V
Sbjct  86   ITGSSGPSSSRGKSSLKSLLPKVSFKHRNPNSDIEKAANFEPESSSSSQREKPV  139



>gb|KJB20266.1| hypothetical protein B456_003G141100 [Gossypium raimondii]
Length=502

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 70/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  251  IIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPSDPR  430
            I EE   V + RR  L LEIP  +L+   +E V IK   TP+ T ++VNF +TPSPSD R
Sbjct  26   ITEETACVHNRRRSGLVLEIPSRTLEEPFQESVAIKIPPTPSLTPRRVNFFLTPSPSDAR  85

Query  431  VN-GSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVV  589
            +   S     R KSS+++LLPK++F   N N D+EKA + +   S+++ ++K V
Sbjct  86   ITGSSGPSSSRGKSSLKSLLPKVSFKHRNPNSDIEKAANFEPESSSSSQREKPV  139



>gb|KJB20262.1| hypothetical protein B456_003G141100 [Gossypium raimondii]
Length=497

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 70/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  251  IIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPSDPR  430
            I EE   V + RR  L LEIP  +L+   +E V IK   TP+ T ++VNF +TPSPSD R
Sbjct  26   ITEETACVHNRRRSGLVLEIPSRTLEEPFQESVAIKIPPTPSLTPRRVNFFLTPSPSDAR  85

Query  431  VN-GSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVV  589
            +   S     R KSS+++LLPK++F   N N D+EKA + +   S+++ ++K V
Sbjct  86   ITGSSGPSSSRGKSSLKSLLPKVSFKHRNPNSDIEKAANFEPESSSSSQREKPV  139



>gb|KJB20267.1| hypothetical protein B456_003G141100 [Gossypium raimondii]
Length=479

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 70/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  251  IIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPSDPR  430
            I EE   V + RR  L LEIP  +L+   +E V IK   TP+ T ++VNF +TPSPSD R
Sbjct  8    ITEETACVHNRRRSGLVLEIPSRTLEEPFQESVAIKIPPTPSLTPRRVNFFLTPSPSDAR  67

Query  431  VN-GSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVV  589
            +   S     R KSS+++LLPK++F   N N D+EKA + +   S+++ ++K V
Sbjct  68   ITGSSGPSSSRGKSSLKSLLPKVSFKHRNPNSDIEKAANFEPESSSSSQREKPV  121



>ref|XP_006378964.1| hypothetical protein POPTR_0009s01890g [Populus trichocarpa]
 gb|ERP56761.1| hypothetical protein POPTR_0009s01890g [Populus trichocarpa]
Length=519

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 91/158 (58%), Gaps = 7/158 (4%)
 Frame = +2

Query  149  REKKETFLSEGEDVQNGGRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQ  328
            R  +E  ++EGE  Q  G   +  ++ K   S  I+EE    +H +R NL LEIP  +L+
Sbjct  2    RTNQEKPVNEGE--QGVGVCSSQEAVGKVEHSIEIVEETDTFQHWKRRNLFLEIPSRTLE  59

Query  329  NSREEIVQIkklltptptakkVNFLVTPSPSDPR-VNGSPGHLPRAKSSIRNLLPKLNFM  505
            +S  + V I+   TP+P+ +KVNFL+TPS  D R          + KSS+++LLPKL+F 
Sbjct  60   DSSRDSVVIRMPPTPSPSPRKVNFLLTPSSVDARASGSPAPSSSKGKSSLKSLLPKLSFK  119

Query  506  SHNSNLDMEKAPDIDLGCSATAPQDKVVSISISRSWSL  619
            S NS LD+EKA  +    S+  P+ K    SISRS SL
Sbjct  120  SRNSTLDIEKAATLAPDASSI-PRKKP---SISRSLSL  153



>ref|XP_006854502.1| hypothetical protein AMTR_s00175p00053490 [Amborella trichopoda]
 gb|ERN15969.1| hypothetical protein AMTR_s00175p00053490 [Amborella trichopoda]
Length=490

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 53/100 (53%), Gaps = 13/100 (13%)
 Frame = +2

Query  242  SSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPS  421
            S+GI EEI  V   R+PNL LEIP  SL+                  + ++N   TPSP+
Sbjct  27   STGISEEIPSVHQRRKPNLLLEIPPRSLEGGSSS------------GSVRINMPPTPSPT  74

Query  422  DPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKA  538
              RV+ SP   LP+ KSSIRN+LP  +F S     D E+A
Sbjct  75   YARVSLSPSTSLPKGKSSIRNILPWPSFKSRGIAFDNERA  114



>ref|XP_002314269.1| hypothetical protein POPTR_0009s01890g [Populus trichocarpa]
 gb|EEE88224.1| hypothetical protein POPTR_0009s01890g [Populus trichocarpa]
Length=521

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 88/158 (56%), Gaps = 5/158 (3%)
 Frame = +2

Query  149  REKKETFLSEGEDVQNGGRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQ  328
            R  +E  ++EGE        +  +   K   S  I+EE    +H +R NL LEIP  +L+
Sbjct  2    RTNQEKPVNEGEQGVGVCSSQEAVGKVKVEHSIEIVEETDTFQHWKRRNLFLEIPSRTLE  61

Query  329  NSREEIVQIkklltptptakkVNFLVTPSPSDPR-VNGSPGHLPRAKSSIRNLLPKLNFM  505
            +S  + V I+   TP+P+ +KVNFL+TPS  D R          + KSS+++LLPKL+F 
Sbjct  62   DSSRDSVVIRMPPTPSPSPRKVNFLLTPSSVDARASGSPAPSSSKGKSSLKSLLPKLSFK  121

Query  506  SHNSNLDMEKAPDIDLGCSATAPQDKVVSISISRSWSL  619
            S NS LD+EKA  +    S+  P+ K    SISRS SL
Sbjct  122  SRNSTLDIEKAATLAPDASSI-PRKKP---SISRSLSL  155



>ref|XP_011094674.1| PREDICTED: uncharacterized protein LOC105174317 isoform X1 [Sesamum 
indicum]
Length=514

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 69/116 (59%), Gaps = 5/116 (4%)
 Frame = +2

Query  275  KHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPSDPRVNGSPG-H  451
            K  R   L L+IP   ++ S E+ + I   L+P PT K+VNF   PSP+  R  GSPG  
Sbjct  48   KQERGEELILKIPKAMIEGSMEDSMTINMPLSPAPTPKRVNFSPLPSPNRLRFIGSPGPS  107

Query  452  LPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISISRSWSL  619
              + KS+++N LPKLNF   N+N ++EK   + LG S   P+ +   ISI+R++SL
Sbjct  108  SSKGKSAMKNFLPKLNFKFRNTNSEIEKDAMLALGAS---PEMR-GKISIARTFSL  159



>gb|EYU18838.1| hypothetical protein MIMGU_mgv1a005388mg [Erythranthe guttata]
Length=485

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 73/133 (55%), Gaps = 6/133 (5%)
 Frame = +2

Query  224  IPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFL  403
            IPK   SSG+ +E +Q K  ++PNL LEIP  + +   +E VQI      TPT K+VNF 
Sbjct  27   IPKMDESSGVAKETSQGKQWKKPNLFLEIPNRTSEMPLQEFVQINMPPLTTPTPKRVNFF  86

Query  404  V-TPSPSDPRVNGSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQD  580
            + +   SD R+        ++ SSIR+LLPKL+F    S+ D+EKA   +   S  A Q 
Sbjct  87   ISSSPSSDSRLTAPSSTRGKSSSSIRSLLPKLSFKFRGSDSDLEKA---ESAPSTVANQG  143

Query  581  KVVSISISRSWSL  619
                  +SRSWS 
Sbjct  144  N--KPPVSRSWSF  154



>ref|XP_011094675.1| PREDICTED: uncharacterized protein LOC105174317 isoform X2 [Sesamum 
indicum]
Length=512

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 69/116 (59%), Gaps = 5/116 (4%)
 Frame = +2

Query  275  KHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPSDPRVNGSPG-H  451
            K  R   L L+IP   ++ S E+ + I   L+P PT K+VNF   PSP+  R  GSPG  
Sbjct  48   KQERGEELILKIPKAMIEGSMEDSMTINMPLSPAPTPKRVNFSPLPSPNRLRFIGSPGPS  107

Query  452  LPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISISRSWSL  619
              + KS+++N LPKLNF   N+N ++EK   + LG S   P+ +   ISI+R++SL
Sbjct  108  SSKGKSAMKNFLPKLNFKFRNTNSEIEKDAMLALGAS---PEMR-GKISIARTFSL  159



>ref|XP_007132248.1| hypothetical protein PHAVU_011G078700g [Phaseolus vulgaris]
 ref|XP_007132249.1| hypothetical protein PHAVU_011G078700g [Phaseolus vulgaris]
 gb|ESW04242.1| hypothetical protein PHAVU_011G078700g [Phaseolus vulgaris]
 gb|ESW04243.1| hypothetical protein PHAVU_011G078700g [Phaseolus vulgaris]
Length=516

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 76/143 (53%), Gaps = 7/143 (5%)
 Frame = +2

Query  203  RRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEI---VQIkklltp  373
            RR   + + K     GI EE + V   +R NL LEIP  + ++S++ +   +       P
Sbjct  18   RRTVSLPVQKVDDPMGITEETSHVPPRKRQNLLLEIPSRTEESSQDFVAIKMPPTPNSNP  77

Query  374  tptakkVNFLVTPSPSDPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDID  550
            TPT K+VNFLV+    DP  + SPG    R KS+IR+LLPKL+F       D+EKA    
Sbjct  78   TPTPKRVNFLVSSRSVDPPTHNSPGPSTSRGKSAIRSLLPKLSFRYRTPAADVEKANTAA  137

Query  551  LGCSATAPQDKVVSISISRSWSL  619
               S++   +K    SI+RS SL
Sbjct  138  PELSSSGIVEKP---SIARSLSL  157



>ref|XP_006282160.1| hypothetical protein CARUB_v10028418mg [Capsella rubella]
 gb|EOA15058.1| hypothetical protein CARUB_v10028418mg [Capsella rubella]
Length=494

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 72/129 (56%), Gaps = 11/129 (9%)
 Frame = +2

Query  242  SSGIIEEIT-QVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSP  418
            SS I EE +  V+  RR NLSL+IP  +   S ++ V IK   TP+PT ++VNF +T S 
Sbjct  28   SSAITEEASANVQQWRRKNLSLQIPSRATGLSSQDSVVIKMPPTPSPTPRRVNFSLTSSS  87

Query  419  SDPRVNGSP--GHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVS  592
              P   G P    L R KSS++NLLPK       SN D+EK       CS +A Q+K   
Sbjct  88   PGP---GPPTSSALLRGKSSLKNLLPKAGCKPKTSNTDIEKGQGN--ACSPSALQEKA--  140

Query  593  ISISRSWSL  619
             SI+RS SL
Sbjct  141  -SIARSLSL  148



>ref|XP_010483706.1| PREDICTED: E3 ubiquitin-protein ligase MARCH7-like isoform X2 
[Camelina sativa]
 ref|XP_010483707.1| PREDICTED: E3 ubiquitin-protein ligase MARCH7-like isoform X2 
[Camelina sativa]
Length=490

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 73/129 (57%), Gaps = 8/129 (6%)
 Frame = +2

Query  242  SSGIIEEIT-QVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSP  418
            SS I EE +  V+  RR NLSL+IP  +   S E+ V IK   TP+PT ++VNF +T + 
Sbjct  28   SSAITEETSANVQQWRRKNLSLQIPSRATGLSSEDSVVIKMPPTPSPTPRRVNFSLTSTS  87

Query  419  SDPR-VNGSPGH-LPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVS  592
            + P  V  +P   LPR KSS++NLLPK       SN D+EK        +A++P      
Sbjct  88   TSPGPVPPTPSSALPRGKSSLKNLLPKAGCKPKISNTDIEKGQG-----NASSPSALQEK  142

Query  593  ISISRSWSL  619
             SI+RS SL
Sbjct  143  ASIARSLSL  151



>ref|XP_010483705.1| PREDICTED: E3 ubiquitin-protein ligase MARCH7-like isoform X1 
[Camelina sativa]
Length=491

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 73/129 (57%), Gaps = 8/129 (6%)
 Frame = +2

Query  242  SSGIIEEIT-QVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSP  418
            SS I EE +  V+  RR NLSL+IP  +   S E+ V IK   TP+PT ++VNF +T + 
Sbjct  29   SSAITEETSANVQQWRRKNLSLQIPSRATGLSSEDSVVIKMPPTPSPTPRRVNFSLTSTS  88

Query  419  SDPR-VNGSPGH-LPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVS  592
            + P  V  +P   LPR KSS++NLLPK       SN D+EK        +A++P      
Sbjct  89   TSPGPVPPTPSSALPRGKSSLKNLLPKAGCKPKISNTDIEKGQG-----NASSPSALQEK  143

Query  593  ISISRSWSL  619
             SI+RS SL
Sbjct  144  ASIARSLSL  152



>ref|XP_004505986.1| PREDICTED: E3 ubiquitin-protein ligase MARCH7-like isoform X1 
[Cicer arietinum]
 ref|XP_004505987.1| PREDICTED: E3 ubiquitin-protein ligase MARCH7-like isoform X2 
[Cicer arietinum]
Length=515

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 86/165 (52%), Gaps = 14/165 (8%)
 Frame = +2

Query  143  MDREKKETFLSEGEDVQNGGRRETGISIP---KSLSSSGIIEEITQVKHGRRPNLSLEIP  313
            M  E+K     E +DV         +S+P   K     GI EE   V   ++ NL LEIP
Sbjct  1    MSFEEKNHVTQEPDDVSC----RIAVSLPVAHKDDDPMGITEETAHVPPRKKQNLLLEIP  56

Query  314  MMSLQNSREEIVQIkklltptpta--kkVNFLVTPSPSDPRVNGSP-GHLPRAKSSIRNL  484
              + +   ++ V IK  +TP+PT   K+VNFLV+    D  +N SP     + KSSIRN+
Sbjct  57   SRTPEECSQDFVSIKMPMTPSPTPTPKRVNFLVSSHSVDAPINNSPRSATSKGKSSIRNI  116

Query  485  LPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISISRSWSL  619
            LPKL+F  + +  D+EKA       S+  P++K +   ISRS SL
Sbjct  117  LPKLSF-RYRTPADIEKANTPTPEVSSLGPREKPL---ISRSLSL  157



>ref|XP_007016720.1| RING/U-box superfamily protein isoform 3 [Theobroma cacao]
 gb|EOY34339.1| RING/U-box superfamily protein isoform 3 [Theobroma cacao]
Length=437

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 4/77 (5%)
 Frame = +2

Query  392  VNFLVTPSPSDPRVNGSPGHLP-RAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSAT  568
            VNFL+TPSPSD R++GSPG    R KSS+++LLPKL+F   + NLD+EKA +     S+T
Sbjct  12   VNFLLTPSPSDARISGSPGPSSSRGKSSLKSLLPKLSFKHRSINLDIEKAANFAPESSST  71

Query  569  APQDKVVSISISRSWSL  619
            + ++K    SISR+ SL
Sbjct  72   SLREKP---SISRTLSL  85



>ref|XP_010558263.1| PREDICTED: uncharacterized protein LOC104826973 [Tarenaya hassleriana]
Length=513

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 84/159 (53%), Gaps = 12/159 (8%)
 Frame = +2

Query  167  FLSEGEDVQNGGRRETGISIPKSLSSSG-----IIEEITQVKHGRRPNLSLEIPMMSLQN  331
             + E + V +  ++E G + P+   S       I EE+   +  R+  L    P  + ++
Sbjct  1    MMDEKKSVGSEEKQEKGETGPRDDDSPAQRDGEITEEMLLGQRQRKEGLIFGTPPRTPED  60

Query  332  SREEIVQIkklltptptakkVNFLVTPSPSDPRVNGSPGHLP-RAKSSIRNLLPKLNFM-  505
             RE+ +++      +P AKKVNF    SP    ++ SPG  P R + +++NLLPKL+F  
Sbjct  61   VREDFMRVNVSTASSPIAKKVNFSPMSSPKFGNLDVSPGPSPSRNRPNLKNLLPKLSFKN  120

Query  506  -SHNSNLDMEKAPDIDLGCSATAPQDKVVSISISRSWSL  619
             + NS LD+EKA  + +G SA+  +DK     + R+WSL
Sbjct  121  RATNSTLDIEKAATLSIG-SASEGRDKSY---VPRTWSL  155



>ref|XP_009126594.1| PREDICTED: uncharacterized protein LOC103851495 isoform X3 [Brassica 
rapa]
Length=480

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 70/121 (58%), Gaps = 11/121 (9%)
 Frame = +2

Query  266  TQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVT---PSPSDPRVN  436
            T V+  RR NLSL+IP  +   S E+ V IK   TP+PT ++VNF +T   P P  P  +
Sbjct  35   TNVQQWRRKNLSLQIPSRTTGLSPEDSVVIKMPPTPSPTPRRVNFSLTSTSPGPG-PTSS  93

Query  437  GSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISISRSWS  616
              P   PR KSS++NL+PK  F    S+ D+EK    D+  S +A Q+K    SISRS S
Sbjct  94   NVP---PRGKSSLKNLIPKAGFKPKTSHTDIEKGQG-DVVYSPSALQEKA---SISRSLS  146

Query  617  L  619
            L
Sbjct  147  L  147



>ref|XP_009126595.1| PREDICTED: uncharacterized protein LOC103851495 isoform X4 [Brassica 
rapa]
Length=479

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 70/121 (58%), Gaps = 11/121 (9%)
 Frame = +2

Query  266  TQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVT---PSPSDPRVN  436
            T V+  RR NLSL+IP  +   S E+ V IK   TP+PT ++VNF +T   P P  P  +
Sbjct  34   TNVQQWRRKNLSLQIPSRTTGLSPEDSVVIKMPPTPSPTPRRVNFSLTSTSPGPG-PTSS  92

Query  437  GSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISISRSWS  616
              P   PR KSS++NL+PK  F    S+ D+EK    D+  S +A Q+K    SISRS S
Sbjct  93   NVP---PRGKSSLKNLIPKAGFKPKTSHTDIEKGQG-DVVYSPSALQEKA---SISRSLS  145

Query  617  L  619
            L
Sbjct  146  L  146



>emb|CDY09194.1| BnaA02g06200D [Brassica napus]
Length=479

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 70/121 (58%), Gaps = 11/121 (9%)
 Frame = +2

Query  266  TQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVT---PSPSDPRVN  436
            T V+  RR NLSL+IP  +   S E+ V IK   TP+PT ++VNF +T   P P  P  +
Sbjct  34   TNVQQWRRKNLSLQIPSRTTGLSPEDSVVIKMPPTPSPTPRRVNFSLTSTSPGPG-PTSS  92

Query  437  GSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISISRSWS  616
              P   PR KSS++NL+PK  F    S+ D+EK    D+  S +A Q+K    SISRS S
Sbjct  93   NVP---PRGKSSLKNLIPKAGFKPKTSHTDIEKGQG-DVVYSPSALQEKA---SISRSLS  145

Query  617  L  619
            L
Sbjct  146  L  146



>ref|XP_010689560.1| PREDICTED: uncharacterized protein LOC104903248 [Beta vulgaris 
subsp. vulgaris]
Length=503

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 67/122 (55%), Gaps = 10/122 (8%)
 Frame = +2

Query  257  EEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPSDPRVN  436
            E+ T V + R+ NL LEIP   +   +E +      +   PT K+VNFL+ P+ SD +  
Sbjct  31   EDSTNVPNWRKQNLFLEIPTRKVDVPQESV-----KIKMPPTPKRVNFLLNPTSSDIKPY  85

Query  437  GSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISISRSW  613
             SPG    R +SSI+N LPK  F+ H S+ D+EKA         + P++K    SISRS 
Sbjct  86   ESPGPSSARGRSSIKNFLPKFGFI-HRSSSDVEKAACAASDVPFSTPREKA---SISRST  141

Query  614  SL  619
            SL
Sbjct  142  SL  143



>ref|XP_009126593.1| PREDICTED: uncharacterized protein LOC103851495 isoform X2 [Brassica 
rapa]
Length=524

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 70/121 (58%), Gaps = 11/121 (9%)
 Frame = +2

Query  266  TQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVT---PSPSDPRVN  436
            T V+  RR NLSL+IP  +   S E+ V IK   TP+PT ++VNF +T   P P  P  +
Sbjct  79   TNVQQWRRKNLSLQIPSRTTGLSPEDSVVIKMPPTPSPTPRRVNFSLTSTSPGPG-PTSS  137

Query  437  GSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISISRSWS  616
              P   PR KSS++NL+PK  F    S+ D+EK    D+  S +A Q+K    SISRS S
Sbjct  138  NVP---PRGKSSLKNLIPKAGFKPKTSHTDIEKGQG-DVVYSPSALQEKA---SISRSLS  190

Query  617  L  619
            L
Sbjct  191  L  191



>ref|XP_009126592.1| PREDICTED: uncharacterized protein LOC103851495 isoform X1 [Brassica 
rapa]
Length=525

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 70/121 (58%), Gaps = 11/121 (9%)
 Frame = +2

Query  266  TQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVT---PSPSDPRVN  436
            T V+  RR NLSL+IP  +   S E+ V IK   TP+PT ++VNF +T   P P  P  +
Sbjct  80   TNVQQWRRKNLSLQIPSRTTGLSPEDSVVIKMPPTPSPTPRRVNFSLTSTSPGPG-PTSS  138

Query  437  GSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISISRSWS  616
              P   PR KSS++NL+PK  F    S+ D+EK    D+  S +A Q+K    SISRS S
Sbjct  139  NVP---PRGKSSLKNLIPKAGFKPKTSHTDIEKGQG-DVVYSPSALQEKA---SISRSLS  191

Query  617  L  619
            L
Sbjct  192  L  192



>ref|XP_008369756.1| PREDICTED: uncharacterized protein LOC103433283 [Malus domestica]
Length=501

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/162 (31%), Positives = 76/162 (47%), Gaps = 34/162 (21%)
 Frame = +2

Query  188  VQNGGRRETGISIPKSL---SSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIk  358
            V+NGG   T  + P +     S+ IIEE       RR NL L+IP  +L++++E+ V I 
Sbjct  9    VKNGGNIFTNEAEPSAHMGGDSTEIIEEAPPDHPWRRQNLVLQIPPRTLEDAKEDFVSI-  67

Query  359  klltptptakkVNFLVTPSPSDPRVNGSPGHLP---------------RAKSSIRNLLPK  493
                        N   TPSP+  RVN SP   P                  ++ R+LLPK
Sbjct  68   ------------NMPPTPSPTPKRVNFSPLPSPIVAKISGSPGPSSSKTKSTTKRSLLPK  115

Query  494  LNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISISRSWSL  619
            L+F + N+  +++KA  + LG      ++K    +I R+WS 
Sbjct  116  LSFKNRNTTSEIQKAAALALGGLPAGTREKP---TIPRTWSF  154



>ref|XP_009377416.1| PREDICTED: uncharacterized protein LOC103966027 [Pyrus x bretschneideri]
Length=501

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 50/162 (31%), Positives = 75/162 (46%), Gaps = 34/162 (21%)
 Frame = +2

Query  188  VQNGGRRETGISIPKSL---SSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIk  358
            V+NGG   T  + P +     S+ IIEE       RR NL L+IP  +L++++E+ V I 
Sbjct  9    VKNGGNIFTNEAEPSAHMGGDSTEIIEEAPPDHPWRRQNLVLQIPPRTLEDAKEDFVSI-  67

Query  359  klltptptakkVNFLVTPSPSDPRVNGSPGHLP---------------RAKSSIRNLLPK  493
                        N   TPSP+  RVN SP   P                  ++ R+LLPK
Sbjct  68   ------------NMPPTPSPTPKRVNFSPLPSPIVAKISGSPGPSSSKTKSTTKRSLLPK  115

Query  494  LNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISISRSWSL  619
            L+F   N+  +++KA  + LG      ++K    +I R+WS 
Sbjct  116  LSFKHRNTTSEIQKAAALALGGLPAGTREKP---TIPRAWSF  154



>ref|XP_004497493.1| PREDICTED: uncharacterized protein LOC101500530 [Cicer arietinum]
Length=503

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 75/132 (57%), Gaps = 2/132 (2%)
 Frame = +2

Query  218  ISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVN  397
            ISI K  +SS I EE+   +   + NLS+E P    + ++E+ ++I   LT TP+ ++V 
Sbjct  23   ISIHKGAASSEITEELPSGQQRTKQNLSIETPKKIQEEAKEDFLRINIPLTLTPSPRRVI  82

Query  398  FLVTPSPSDPRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAP  574
            F    SP     N SPG    + +S+++ L+PKL+F   N+  ++EKA  + L  S+  P
Sbjct  83   FSPCTSPVFIETNESPGPSSSKNRSTLKALIPKLSFKFKNTTSEIEKAAFLALEGSSNVP  142

Query  575  QDK-VVSISISR  607
            Q K  +S ++SR
Sbjct  143  QKKPFLSRTLSR  154



>gb|KEH30052.1| RING/U-box protein [Medicago truncatula]
Length=372

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 73/131 (56%), Gaps = 9/131 (7%)
 Frame = +2

Query  242  SSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptpta----kkVNFLVT  409
            S GI EE + V   ++ NL LEIP  + +   E+ V IK  +TP+PT     K+VNFL+T
Sbjct  38   SMGITEETSHVPPRKKQNLLLEIPSRTPEECSEDFVAIKMPMTPSPTPTPTPKRVNFLMT  97

Query  410  PSPSDPRVNGSPGH-LPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKV  586
                D   N SPG    + KSSIR +LPKL+F  + +  D+EK        S++  ++K 
Sbjct  98   SRSVDAPTNSSPGSATSKGKSSIRKMLPKLSFR-YRTPADIEKTNTPTREVSSSGTREKP  156

Query  587  VSISISRSWSL  619
            +   ISRS SL
Sbjct  157  L---ISRSLSL  164



>ref|XP_008369770.1| PREDICTED: uncharacterized protein LOC103433299 [Malus domestica]
Length=492

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 67/141 (48%), Gaps = 31/141 (22%)
 Frame = +2

Query  242  SSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPS  421
            S+ IIEE       RR NL L+IP  +L++++E+ V I             N   TPSP+
Sbjct  21   STEIIEEAPPDHPWRRQNLVLQIPPRTLEDAKEDFVSI-------------NMPPTPSPT  67

Query  422  DPRVNGSPGHLP---------------RAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLG  556
              RVN SP   P                  ++ R+LLPKL+F + N+  +++KA  + LG
Sbjct  68   PKRVNFSPLPSPIVAKISGSPGPSSSKTKSTTKRSLLPKLSFKNRNTTSEIQKAAALALG  127

Query  557  CSATAPQDKVVSISISRSWSL  619
                  ++K    +I R+WS 
Sbjct  128  GLPAGTREKP---TIPRTWSF  145



>gb|AES88591.2| RING/U-box protein [Medicago truncatula]
Length=521

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 73/131 (56%), Gaps = 9/131 (7%)
 Frame = +2

Query  242  SSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptpta----kkVNFLVT  409
            S GI EE + V   ++ NL LEIP  + +   E+ V IK  +TP+PT     K+VNFL+T
Sbjct  38   SMGITEETSHVPPRKKQNLLLEIPSRTPEECSEDFVAIKMPMTPSPTPTPTPKRVNFLMT  97

Query  410  PSPSDPRVNGSPGHLP-RAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKV  586
                D   N SPG    + KSSIR +LPKL+F  + +  D+EK        S++  ++K 
Sbjct  98   SRSVDAPTNSSPGSATSKGKSSIRKMLPKLSF-RYRTPADIEKTNTPTREVSSSGTREKP  156

Query  587  VSISISRSWSL  619
            +   ISRS SL
Sbjct  157  L---ISRSLSL  164



>ref|XP_003606394.1| hypothetical protein MTR_4g059540 [Medicago truncatula]
Length=511

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 73/131 (56%), Gaps = 9/131 (7%)
 Frame = +2

Query  242  SSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptpta----kkVNFLVT  409
            S GI EE + V   ++ NL LEIP  + +   E+ V IK  +TP+PT     K+VNFL+T
Sbjct  38   SMGITEETSHVPPRKKQNLLLEIPSRTPEECSEDFVAIKMPMTPSPTPTPTPKRVNFLMT  97

Query  410  PSPSDPRVNGSPGHLP-RAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKV  586
                D   N SPG    + KSSIR +LPKL+F  + +  D+EK        S++  ++K 
Sbjct  98   SRSVDAPTNSSPGSATSKGKSSIRKMLPKLSF-RYRTPADIEKTNTPTREVSSSGTREKP  156

Query  587  VSISISRSWSL  619
            +   ISRS SL
Sbjct  157  L---ISRSLSL  164



>gb|KEH30051.1| RING/U-box protein [Medicago truncatula]
Length=468

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 73/131 (56%), Gaps = 9/131 (7%)
 Frame = +2

Query  242  SSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptpta----kkVNFLVT  409
            S GI EE + V   ++ NL LEIP  + +   E+ V IK  +TP+PT     K+VNFL+T
Sbjct  38   SMGITEETSHVPPRKKQNLLLEIPSRTPEECSEDFVAIKMPMTPSPTPTPTPKRVNFLMT  97

Query  410  PSPSDPRVNGSPGHLP-RAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKV  586
                D   N SPG    + KSSIR +LPKL+F  + +  D+EK        S++  ++K 
Sbjct  98   SRSVDAPTNSSPGSATSKGKSSIRKMLPKLSF-RYRTPADIEKTNTPTREVSSSGTREKP  156

Query  587  VSISISRSWSL  619
            +   ISRS SL
Sbjct  157  L---ISRSLSL  164



>ref|XP_006836375.1| hypothetical protein AMTR_s00092p00120720 [Amborella trichopoda]
 gb|ERM99228.1| hypothetical protein AMTR_s00092p00120720 [Amborella trichopoda]
Length=530

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 71/154 (46%), Gaps = 17/154 (11%)
 Frame = +2

Query  161  ETFLSEGEDVQNGGRRETGISIPKSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSRE  340
            E  ++E    + G     G  + + L  S   +    V H ++PNLSL+IP  +L NS  
Sbjct  2    EDSIAELRSDEGGVSNVPGPQVQQVLEKSEGSDAAAPVPHPKKPNLSLQIPARTLDNSCA  61

Query  341  EIVQIkklltptptakkVNFLVTPSPSDPRVNGSP-GHLPRAKSSIRNLLPKLNFMSHNS  517
              V+I             N   TPSPS  R+N  P  +  ++K  IRN LP+ +F +   
Sbjct  62   NSVRI-------------NIPPTPSPSSTRMNLPPRPNSAKSKPGIRNFLPQRSFKTKGL  108

Query  518  NLDMEKAPDIDLGCSATAPQDKVVSISISRSWSL  619
             L+ EK   +  G +    Q+K    S SRS+SL
Sbjct  109  TLENEKTVLLTAGETLEKQQEKA---STSRSFSL  139



>ref|XP_008791532.1| PREDICTED: uncharacterized protein LOC103708403 isoform X4 [Phoenix 
dactylifera]
Length=432

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 56/98 (57%), Gaps = 6/98 (6%)
 Frame = +2

Query  245  SGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPSD  424
            SG+ E++T V  G+RPNLS+EIP  S+      +V+  K  T    + +VN L   SP+ 
Sbjct  12   SGVTEDLTSVHQGKRPNLSIEIPPHSMN-----LVRKNKSPTRGSVSTRVNNLPICSPAS  66

Query  425  PRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEK  535
              +  SP     +A+ SI+NLLP L+F   +S  ++EK
Sbjct  67   AGIQASPCPSSSKARPSIKNLLPGLSFKFRSSASEIEK  104



>ref|XP_008791531.1| PREDICTED: uncharacterized protein LOC103708403 isoform X3 [Phoenix 
dactylifera]
Length=435

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 56/98 (57%), Gaps = 6/98 (6%)
 Frame = +2

Query  245  SGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPSD  424
            SG+ E++T V  G+RPNLS+EIP  S+      +V+  K  T    + +VN L   SP+ 
Sbjct  12   SGVTEDLTSVHQGKRPNLSIEIPPHSMN-----LVRKNKSPTRGSVSTRVNNLPICSPAS  66

Query  425  PRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEK  535
              +  SP     +A+ SI+NLLP L+F   +S  ++EK
Sbjct  67   AGIQASPCPSSSKARPSIKNLLPGLSFKFRSSASEIEK  104



>ref|XP_008791528.1| PREDICTED: uncharacterized protein LOC103708403 isoform X1 [Phoenix 
dactylifera]
Length=492

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 56/98 (57%), Gaps = 6/98 (6%)
 Frame = +2

Query  245  SGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPSD  424
            SG+ E++T V  G+RPNLS+EIP  S+      +V+  K  T    + +VN L   SP+ 
Sbjct  12   SGVTEDLTSVHQGKRPNLSIEIPPHSMN-----LVRKNKSPTRGSVSTRVNNLPICSPAS  66

Query  425  PRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEK  535
              +  SP     +A+ SI+NLLP L+F   +S  ++EK
Sbjct  67   AGIQASPCPSSSKARPSIKNLLPGLSFKFRSSASEIEK  104



>ref|XP_008791529.1| PREDICTED: uncharacterized protein LOC103708403 isoform X2 [Phoenix 
dactylifera]
Length=482

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 56/98 (57%), Gaps = 6/98 (6%)
 Frame = +2

Query  245  SGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPSD  424
            SG+ E++T V  G+RPNLS+EIP  S+      +V+  K  T    + +VN L   SP+ 
Sbjct  2    SGVTEDLTSVHQGKRPNLSIEIPPHSMN-----LVRKNKSPTRGSVSTRVNNLPICSPAS  56

Query  425  PRVNGSPG-HLPRAKSSIRNLLPKLNFMSHNSNLDMEK  535
              +  SP     +A+ SI+NLLP L+F   +S  ++EK
Sbjct  57   AGIQASPCPSSSKARPSIKNLLPGLSFKFRSSASEIEK  94



>gb|KFK27585.1| hypothetical protein AALP_AA8G403000 [Arabis alpina]
Length=483

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 80/135 (59%), Gaps = 12/135 (9%)
 Frame = +2

Query  221  SIPKSLSSSGIIEEITQ-VKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVN  397
            SI K+  SS I EE ++ V+  RR NLSL+IP  +   S E+ V IK   TP+PT ++VN
Sbjct  22   SIQKAEESSAITEETSENVQQWRRKNLSLQIPSRATGLSPEDSVVIKMPPTPSPTPRRVN  81

Query  398  FLVTPSPSDPRVNGSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKA-PDIDLGCSATAP  574
            F +T S   P  +  P    R+KSS++NLLPK      +SN D+EK   D+   CS++  
Sbjct  82   FALTSSSPVPTPSSVPA---RSKSSLKNLLPK-GLKPKSSNTDIEKGHGDV---CSSSVL  134

Query  575  QDKVVSISISRSWSL  619
            Q+K    SISRS SL
Sbjct  135  QEKA---SISRSLSL  146



>ref|XP_006594143.1| PREDICTED: E3 ubiquitin-protein ligase MARCH7-like [Glycine max]
 gb|KHN48304.1| hypothetical protein glysoja_007973 [Glycine soja]
Length=503

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 68/139 (49%), Gaps = 29/139 (21%)
 Frame = +2

Query  230  KSLSSSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVT  409
            K  + S I EE+ + +HG R NL L+IP +S + +RE+ V+I             N  +T
Sbjct  30   KGPAPSEITEELPREQHGARQNLILDIPAISQEEAREDYVRI-------------NMPLT  76

Query  410  PSPSDPRVNGSPGH---LPRAKS-----------SIRNLLPKLNFMSHNSNLDMEKAPDI  547
            P P   RV  SP      PR+K            +I+  LPKL+    N++ ++EKA  +
Sbjct  77   PPPR--RVIFSPCPSPVFPRSKESPGPSSSKSKSNIKTFLPKLSLKFRNTSSEIEKAAFL  134

Query  548  DLGCSATAPQDKVVSISIS  604
             L  S  AP+   +S ++S
Sbjct  135  ALEGSTVAPKKPFLSRTLS  153



>ref|XP_009596996.1| PREDICTED: uncharacterized protein LOC104093001 isoform X3 [Nicotiana 
tomentosiformis]
Length=423

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 41/77 (53%), Gaps = 13/77 (17%)
 Frame = +2

Query  392  VNFLVTPSPSDPRVNGSPGHLPRAKSS-IRNLLPKLNFMSHNSNLDMEKAPDIDLGCSAT  568
            VNFL+ PS S+ R N  P        S IRNLLPKL+F   N+N D EKA   D      
Sbjct  12   VNFLLMPSSSNSRANAFPSPSSCRSKSSIRNLLPKLSFKLRNTNSDTEKAALSD------  65

Query  569  APQDKVVSISISRSWSL  619
               +KV   SISRSWS 
Sbjct  66   ---EKV---SISRSWSF  76



>ref|XP_011044364.1| PREDICTED: uncharacterized protein LOC105139582 isoform X1 [Populus 
euphratica]
Length=521

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 73/124 (59%), Gaps = 5/124 (4%)
 Frame = +2

Query  251  IIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPSD-P  427
            I+EE    +H +R NL LEIP  +L+ S  + V I+   TP+P+ +KVNFL+TPS  D  
Sbjct  36   IVEETDTFQHWKRRNLFLEIPSRALEESSRDSVVIRMPPTPSPSPRKVNFLLTPSSVDAR  95

Query  428  RVNGSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISISR  607
                      + KSS+++LLPKL+F S  S LD+EKA  +    S+  P+ K    SISR
Sbjct  96   ASGSPAASSSKGKSSLKSLLPKLSFKSRTSTLDIEKAATVAPDASSI-PRKKP---SISR  151

Query  608  SWSL  619
            S SL
Sbjct  152  SLSL  155



>ref|XP_011044368.1| PREDICTED: uncharacterized protein LOC105139582 isoform X5 [Populus 
euphratica]
Length=512

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 73/124 (59%), Gaps = 5/124 (4%)
 Frame = +2

Query  251  IIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPSD-P  427
            I+EE    +H +R NL LEIP  +L+ S  + V I+   TP+P+ +KVNFL+TPS  D  
Sbjct  36   IVEETDTFQHWKRRNLFLEIPSRALEESSRDSVVIRMPPTPSPSPRKVNFLLTPSSVDAR  95

Query  428  RVNGSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISISR  607
                      + KSS+++LLPKL+F S  S LD+EKA  +    S+  P+ K    SISR
Sbjct  96   ASGSPAASSSKGKSSLKSLLPKLSFKSRTSTLDIEKAATVAPDASSI-PRKKP---SISR  151

Query  608  SWSL  619
            S SL
Sbjct  152  SLSL  155



>ref|XP_011044366.1| PREDICTED: uncharacterized protein LOC105139582 isoform X3 [Populus 
euphratica]
Length=517

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 73/124 (59%), Gaps = 5/124 (4%)
 Frame = +2

Query  251  IIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPSD-P  427
            I+EE    +H +R NL LEIP  +L+ S  + V I+   TP+P+ +KVNFL+TPS  D  
Sbjct  36   IVEETDTFQHWKRRNLFLEIPSRALEESSRDSVVIRMPPTPSPSPRKVNFLLTPSSVDAR  95

Query  428  RVNGSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISISR  607
                      + KSS+++LLPKL+F S  S LD+EKA  +    S+  P+ K    SISR
Sbjct  96   ASGSPAASSSKGKSSLKSLLPKLSFKSRTSTLDIEKAATVAPDASSI-PRKKP---SISR  151

Query  608  SWSL  619
            S SL
Sbjct  152  SLSL  155



>ref|XP_011044365.1| PREDICTED: uncharacterized protein LOC105139582 isoform X2 [Populus 
euphratica]
Length=519

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 73/124 (59%), Gaps = 5/124 (4%)
 Frame = +2

Query  251  IIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPSD-P  427
            I+EE    +H +R NL LEIP  +L+ S  + V I+   TP+P+ +KVNFL+TPS  D  
Sbjct  34   IVEETDTFQHWKRRNLFLEIPSRALEESSRDSVVIRMPPTPSPSPRKVNFLLTPSSVDAR  93

Query  428  RVNGSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISISR  607
                      + KSS+++LLPKL+F S  S LD+EKA  +    S+  P+ K    SISR
Sbjct  94   ASGSPAASSSKGKSSLKSLLPKLSFKSRTSTLDIEKAATVAPDASSI-PRKKP---SISR  149

Query  608  SWSL  619
            S SL
Sbjct  150  SLSL  153



>ref|XP_011044367.1| PREDICTED: uncharacterized protein LOC105139582 isoform X4 [Populus 
euphratica]
Length=516

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 73/124 (59%), Gaps = 5/124 (4%)
 Frame = +2

Query  251  IIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPSD-P  427
            I+EE    +H +R NL LEIP  +L+ S  + V I+   TP+P+ +KVNFL+TPS  D  
Sbjct  36   IVEETDTFQHWKRRNLFLEIPSRALEESSRDSVVIRMPPTPSPSPRKVNFLLTPSSVDAR  95

Query  428  RVNGSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISISR  607
                      + KSS+++LLPKL+F S  S LD+EKA  +    S+  P+ K    SISR
Sbjct  96   ASGSPAASSSKGKSSLKSLLPKLSFKSRTSTLDIEKAATVAPDASSI-PRKKP---SISR  151

Query  608  SWSL  619
            S SL
Sbjct  152  SLSL  155



>ref|XP_009120591.1| PREDICTED: uncharacterized protein LOC103845473 isoform X2 [Brassica 
rapa]
Length=480

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 73/128 (57%), Gaps = 12/128 (9%)
 Frame = +2

Query  239  SSSGIIEEIT-QVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPS  415
            SSS I EE +  V+  RR NLSL+IP  +   S EE V IK   TP+PT ++VNF +T S
Sbjct  28   SSSAITEETSANVQQWRRNNLSLQIPSRAANLSPEESVVIKMPPTPSPTPRRVNFSLTSS  87

Query  416  PSDPRVNGSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSI  595
               P  + +     R KSS++NL+PK+ F    SN D+EK    D+ C     Q+K +  
Sbjct  88   SPAPTSSSAAPP--RTKSSLKNLIPKVGFKPKLSNTDVEKGQG-DVSC-----QEKAL--  137

Query  596  SISRSWSL  619
             ISRS SL
Sbjct  138  -ISRSLSL  144



>ref|XP_009120590.1| PREDICTED: uncharacterized protein LOC103845473 isoform X1 [Brassica 
rapa]
Length=481

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 73/128 (57%), Gaps = 12/128 (9%)
 Frame = +2

Query  239  SSSGIIEEIT-QVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPS  415
            SSS I EE +  V+  RR NLSL+IP  +   S EE V IK   TP+PT ++VNF +T S
Sbjct  29   SSSAITEETSANVQQWRRNNLSLQIPSRAANLSPEESVVIKMPPTPSPTPRRVNFSLTSS  88

Query  416  PSDPRVNGSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSI  595
               P  + +     R KSS++NL+PK+ F    SN D+EK    D+ C     Q+K +  
Sbjct  89   SPAPTSSSAAPP--RTKSSLKNLIPKVGFKPKLSNTDVEKGQG-DVSC-----QEKAL--  138

Query  596  SISRSWSL  619
             ISRS SL
Sbjct  139  -ISRSLSL  145



>gb|KDO44228.1| hypothetical protein CISIN_1g0103781mg, partial [Citrus sinensis]
Length=483

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 67/117 (57%), Gaps = 6/117 (5%)
 Frame = +2

Query  242  SSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPS  421
            ++ I+E  +  +  R+ +L L IP  +++   E  V+I    TPT + + VNF   PSP 
Sbjct  4    ATEIVEVTSPSQPQRQHDLVLNIPSRTIEEVEEGFVRIDMPSTPTTSRR-VNFSPMPSPC  62

Query  422  DPRVNGSPGHLP---RAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDK  583
              ++N  P  +P   ++K++ ++LLPKL+F   N+  D+EKA  + LG S T  ++K
Sbjct  63   FGKINDFP--VPSSSKSKTTFKSLLPKLSFKYRNTTSDIEKAAILALGSSFTETREK  117



>ref|XP_008806817.1| PREDICTED: uncharacterized protein LOC103719384, partial [Phoenix 
dactylifera]
Length=387

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 60/122 (49%), Gaps = 20/122 (16%)
 Frame = +2

Query  260  EITQVKHGRRPNLS-LEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPSDPRVN  436
            EIT  +H RRPNLS LEIP  +L+N      +I                ++PSPS  RV 
Sbjct  30   EITPAQHSRRPNLSSLEIPARTLENQFPSSTRIN---------------ISPSPSSTRVG  74

Query  437  GSPGHL-PRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSISISRSW  613
              P     R KS+IRNLLP+ +F    S  D ++   +  G  ++  QDK    S S+ +
Sbjct  75   LPPRPASARTKSTIRNLLPQRSFKIKGSTPDSDRTILLVPGTPSSEGQDKP---STSKPF  131

Query  614  SL  619
            SL
Sbjct  132  SL  133



>emb|CDY31533.1| BnaA10g13380D [Brassica napus]
Length=498

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 73/128 (57%), Gaps = 12/128 (9%)
 Frame = +2

Query  239  SSSGIIEEIT-QVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPS  415
            SSS I EE +  V+  RR NLSL+IP  +   S EE V IK   TP+PT ++VNF +T S
Sbjct  45   SSSAITEETSANVQQWRRNNLSLQIPSRAANLSPEESVVIKMPPTPSPTPRRVNFSLTSS  104

Query  416  PSDPRVNGSPGHLPRAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDKVVSI  595
               P  + +     R KSS++NL+PK+ F    SN D+EK    D+ C     Q+K +  
Sbjct  105  SPAPTSSSAAPP--RTKSSLKNLIPKVGFKPKLSNTDVEKGQG-DVSC-----QEKAL--  154

Query  596  SISRSWSL  619
             ISRS SL
Sbjct  155  -ISRSLSL  161



>gb|KDO44229.1| hypothetical protein CISIN_1g0103781mg, partial [Citrus sinensis]
Length=402

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 67/117 (57%), Gaps = 6/117 (5%)
 Frame = +2

Query  242  SSGIIEEITQVKHGRRPNLSLEIPMMSLQNSREEIVQIkklltptptakkVNFLVTPSPS  421
            ++ I+E  +  +  R+ +L L IP  +++   E  V+I    TPT + + VNF   PSP 
Sbjct  4    ATEIVEVTSPSQPQRQHDLVLNIPSRTIEEVEEGFVRIDMPSTPTTSRR-VNFSPMPSPC  62

Query  422  DPRVNGSPGHLP---RAKSSIRNLLPKLNFMSHNSNLDMEKAPDIDLGCSATAPQDK  583
              ++N  P  +P   ++K++ ++LLPKL+F   N+  D+EKA  + LG S T  ++K
Sbjct  63   FGKINDFP--VPSSSKSKTTFKSLLPKLSFKYRNTTSDIEKAAILALGSSFTETREK  117



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520