BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF041G02

Length=643
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP07384.1|  unnamed protein product                                310   1e-96   Coffea canephora [robusta coffee]
ref|XP_011083591.1|  PREDICTED: endoplasmin homolog                     302   1e-93   
gb|EYU38796.1|  hypothetical protein MIMGU_mgv1a001101mg                302   7e-93   Erythranthe guttata [common monkey flower]
ref|XP_009596271.1|  PREDICTED: endoplasmin homolog                     295   2e-92   Nicotiana tomentosiformis
gb|EYU36792.1|  hypothetical protein MIMGU_mgv1a001447mg                299   3e-92   Erythranthe guttata [common monkey flower]
ref|XP_009606988.1|  PREDICTED: endoplasmin homolog                     296   2e-91   Nicotiana tomentosiformis
ref|XP_009791520.1|  PREDICTED: endoplasmin homolog                     296   2e-91   Nicotiana sylvestris
sp|P35016.1|ENPL_CATRO  RecName: Full=Endoplasmin homolog; AltNam...    296   3e-91   Catharanthus roseus [chatas]
dbj|BAL42333.1|  Heat shock protein 90                                  296   4e-91   Nicotiana tabacum [American tobacco]
ref|XP_002273785.1|  PREDICTED: endoplasmin homolog                     294   2e-90   Vitis vinifera
ref|XP_004238368.1|  PREDICTED: endoplasmin homolog                     293   3e-90   Solanum lycopersicum
ref|XP_006342064.1|  PREDICTED: endoplasmin homolog                     293   3e-90   Solanum tuberosum [potatoes]
ref|XP_009791518.1|  PREDICTED: endoplasmin homolog                     293   6e-90   Nicotiana sylvestris
dbj|BAL42332.1|  Heat shock protein 90                                  293   6e-90   Nicotiana tabacum [American tobacco]
gb|KDO84888.1|  hypothetical protein CISIN_1g003458mg                   281   1e-88   Citrus sinensis [apfelsine]
emb|CAN79404.1|  hypothetical protein VITISV_028074                     293   2e-88   Vitis vinifera
ref|XP_011074690.1|  PREDICTED: endoplasmin homolog                     288   3e-88   Sesamum indicum [beniseed]
ref|XP_004499281.1|  PREDICTED: endoplasmin homolog isoform X1          287   6e-88   Cicer arietinum [garbanzo]
ref|XP_004499283.1|  PREDICTED: endoplasmin homolog isoform X3          287   6e-88   Cicer arietinum [garbanzo]
gb|KDO84887.1|  hypothetical protein CISIN_1g003458mg                   282   6e-88   Citrus sinensis [apfelsine]
gb|KDP36908.1|  hypothetical protein JCGZ_08199                         287   1e-87   Jatropha curcas
ref|XP_010539097.1|  PREDICTED: endoplasmin homolog                     286   3e-87   Tarenaya hassleriana [spider flower]
ref|XP_003589505.1|  Endoplasmin-like protein                           285   3e-87   Medicago truncatula
ref|XP_010109992.1|  Endoplasmin-like protein                           288   4e-87   
ref|XP_002307732.1|  hypothetical protein POPTR_0005s26260g             285   9e-87   Populus trichocarpa [western balsam poplar]
ref|XP_011045067.1|  PREDICTED: endoplasmin homolog                     284   1e-86   Populus euphratica
gb|KDO84886.1|  hypothetical protein CISIN_1g003458mg                   282   2e-86   Citrus sinensis [apfelsine]
gb|KDO84884.1|  hypothetical protein CISIN_1g003458mg                   283   3e-86   Citrus sinensis [apfelsine]
ref|XP_009409971.1|  PREDICTED: endoplasmin homolog                     283   3e-86   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006435195.1|  hypothetical protein CICLE_v10000296mg             283   3e-86   Citrus clementina [clementine]
ref|XP_006473673.1|  PREDICTED: endoplasmin homolog                     283   4e-86   Citrus sinensis [apfelsine]
ref|XP_008377135.1|  PREDICTED: endoplasmin homolog                     283   4e-86   
dbj|BAD94659.1|  HSP90-like protein                                     269   5e-86   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008387928.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmin ...    282   6e-86   
ref|XP_009334927.1|  PREDICTED: endoplasmin homolog                     282   9e-86   Pyrus x bretschneideri [bai li]
ref|XP_003550428.1|  PREDICTED: endoplasmin homolog isoform X1          281   2e-85   
ref|XP_006601356.1|  PREDICTED: endoplasmin homolog isoform X2          281   2e-85   Glycine max [soybeans]
ref|XP_003545030.1|  PREDICTED: endoplasmin homolog isoform X1          280   2e-85   Glycine max [soybeans]
ref|XP_006596543.1|  PREDICTED: endoplasmin homolog isoform X2          280   2e-85   Glycine max [soybeans]
ref|XP_004291352.1|  PREDICTED: endoplasmin homolog                     280   4e-85   Fragaria vesca subsp. vesca
ref|XP_002510550.1|  endoplasmin, putative                              278   1e-84   Ricinus communis
ref|XP_009393849.1|  PREDICTED: endoplasmin homolog                     278   2e-84   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010246858.1|  PREDICTED: endoplasmin homolog                     278   3e-84   Nelumbo nucifera [Indian lotus]
ref|XP_010691883.1|  PREDICTED: endoplasmin homolog                     277   4e-84   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007225662.1|  hypothetical protein PRUPE_ppa001487mg             277   6e-84   Prunus persica
ref|XP_010069812.1|  PREDICTED: endoplasmin homolog                     276   8e-84   Eucalyptus grandis [rose gum]
ref|XP_008221245.1|  PREDICTED: endoplasmin homolog                     276   1e-83   Prunus mume [ume]
ref|XP_007160650.1|  hypothetical protein PHAVU_001G005200g             275   2e-83   Phaseolus vulgaris [French bean]
gb|AAX19870.1|  unknown                                                 261   3e-83   Doryanthes excelsa
ref|XP_008444821.1|  PREDICTED: endoplasmin homolog                     275   3e-83   Cucumis melo [Oriental melon]
ref|XP_010266798.1|  PREDICTED: endoplasmin homolog                     275   3e-83   Nelumbo nucifera [Indian lotus]
gb|AIZ68158.1|  heat shock protein 90                                   273   1e-82   Ornithogalum longebracteatum [sea-onion]
gb|KJB63271.1|  hypothetical protein B456_010G0030002                   258   1e-82   Gossypium raimondii
gb|KJB63270.1|  hypothetical protein B456_010G0030002                   258   2e-82   Gossypium raimondii
gb|KJB63272.1|  hypothetical protein B456_010G0030002                   258   6e-82   Gossypium raimondii
ref|XP_010941296.1|  PREDICTED: endoplasmin homolog                     271   8e-82   Elaeis guineensis
ref|XP_010935079.1|  PREDICTED: endoplasmin homolog                     270   2e-81   Elaeis guineensis
gb|EPS69355.1|  hypothetical protein M569_05408                         270   2e-81   Genlisea aurea
ref|XP_006657350.1|  PREDICTED: endoplasmin homolog                     269   3e-81   Oryza brachyantha
ref|NP_194150.1|  HSP90-like protein GRP94                              270   4e-81   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB86368.1|  SHEPHERD                                               270   4e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010439073.1|  PREDICTED: endoplasmin homolog                     269   4e-81   Camelina sativa [gold-of-pleasure]
ref|XP_002439030.1|  hypothetical protein SORBIDRAFT_10g030240          269   5e-81   
ref|XP_002867677.1|  hypothetical protein ARALYDRAFT_492441             269   5e-81   Arabidopsis lyrata subsp. lyrata
ref|XP_008808636.1|  PREDICTED: endoplasmin homolog                     269   5e-81   Phoenix dactylifera
gb|AFW75766.1|  hypothetical protein ZEAMMB73_790349                    267   6e-81   
ref|XP_010433803.1|  PREDICTED: endoplasmin homolog                     269   6e-81   Camelina sativa [gold-of-pleasure]
ref|XP_004966467.1|  PREDICTED: endoplasmin homolog                     268   6e-81   Setaria italica
ref|XP_006283118.1|  hypothetical protein CARUB_v10004140mg             269   7e-81   Capsella rubella
ref|NP_001151475.1|  endoplasmin precursor                              268   7e-81   
gb|AFW75767.1|  endoplasmin                                             268   1e-80   
gb|AAN34791.1|  Grp94                                                   267   2e-80   Xerophyta viscosa
ref|NP_974606.1|  HSP90-like protein GRP94                              266   4e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008643502.1|  PREDICTED: shepherd-like1 isoform X1               266   6e-80   
ref|NP_001058590.1|  Os06g0716700                                       266   8e-80   
ref|XP_006413464.1|  hypothetical protein EUTSA_v10024414mg             266   9e-80   Eutrema salsugineum [saltwater cress]
emb|CDY10992.1|  BnaA03g46510D                                          266   1e-79   Brassica napus [oilseed rape]
gb|AAL79732.1|AC091774_23  heat shock protein 90                        265   1e-79   Oryza sativa Japonica Group [Japonica rice]
gb|KJB14398.1|  hypothetical protein B456_002G122800                    264   1e-79   Gossypium raimondii
gb|KFK29085.1|  hypothetical protein AALP_AA7G086900                    265   2e-79   Arabis alpina [alpine rockcress]
ref|XP_010448597.1|  PREDICTED: endoplasmin homolog                     265   3e-79   Camelina sativa [gold-of-pleasure]
ref|XP_009137776.1|  PREDICTED: endoplasmin homolog                     264   3e-79   Brassica rapa
emb|CDY24830.1|  BnaA08g14800D                                          264   3e-79   Brassica napus [oilseed rape]
emb|CDY34264.1|  BnaA01g13670D                                          264   4e-79   Brassica napus [oilseed rape]
gb|KJB14397.1|  hypothetical protein B456_002G122800                    264   5e-79   Gossypium raimondii
dbj|BAA90487.1|  heat shock protein 90                                  263   5e-79   Oryza sativa [red rice]
ref|XP_008788614.1|  PREDICTED: endoplasmin homolog                     263   1e-78   Phoenix dactylifera
sp|P36183.1|ENPL_HORVU  RecName: Full=Endoplasmin homolog; AltNam...    262   1e-78   Hordeum vulgare [barley]
emb|CDY03477.1|  BnaC01g16050D                                          262   2e-78   
gb|KJB63501.1|  hypothetical protein B456_010G0030001                   262   3e-78   Gossypium raimondii
emb|CDX92620.1|  BnaC07g38780D                                          261   4e-78   
gb|KHG17445.1|  Endoplasmin                                             261   6e-78   Gossypium arboreum [tree cotton]
gb|EAZ38293.1|  hypothetical protein OsJ_22671                          260   1e-77   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ02369.1|  hypothetical protein OsI_24473                          260   1e-77   Oryza sativa Indica Group [Indian rice]
ref|XP_006851911.1|  hypothetical protein AMTR_s00041p00161550          259   2e-77   Amborella trichopoda
ref|XP_004152644.1|  PREDICTED: endoplasmin homolog                     259   2e-77   Cucumis sativus [cucumbers]
ref|XP_003563275.1|  PREDICTED: endoplasmin homolog                     258   8e-77   Brachypodium distachyon [annual false brome]
gb|ABV82432.1|  Hsp90-like protein                                      257   2e-76   Dactylis glomerata [cocksfoot]
gb|AFW69515.1|  hypothetical protein ZEAMMB73_665489                    257   7e-76   
ref|XP_007017829.1|  Chaperone protein htpG family protein isoform 2    253   3e-75   
ref|XP_007017828.1|  Chaperone protein htpG family protein isoform 1    253   5e-75   
gb|EMT19498.1|  Endoplasmin-like protein                                254   2e-74   
gb|EMS56078.1|  Endoplasmin-like protein                                248   4e-73   Triticum urartu
ref|XP_007017830.1|  Chaperone protein htpG family protein isoform 3    244   3e-72   
gb|ABV21762.1|  GRP94                                                   245   5e-72   Pinus taeda
gb|KJB63502.1|  hypothetical protein B456_010G0030001                   244   6e-72   Gossypium raimondii
tpg|DAA46734.1|  TPA: hypothetical protein ZEAMMB73_851694              221   1e-66   
tpg|DAA46735.1|  TPA: hypothetical protein ZEAMMB73_851694              219   1e-65   
gb|AFW81541.1|  hypothetical protein ZEAMMB73_624427                    217   1e-64   
emb|CDY08910.1|  BnaC08g11400D                                          222   7e-64   Brassica napus [oilseed rape]
ref|XP_002969701.1|  hypothetical protein SELMODRAFT_451343             221   2e-63   Selaginella moellendorffii
ref|XP_002981308.1|  hypothetical protein SELMODRAFT_444847             221   2e-63   Selaginella moellendorffii
gb|KHN44921.1|  Endoplasmin like                                        207   3e-62   Glycine soja [wild soybean]
ref|XP_001770511.1|  predicted protein                                  218   4e-62   
ref|XP_008660989.1|  PREDICTED: endoplasmin homolog                     198   1e-59   
ref|XP_008646956.1|  PREDICTED: endoplasmin homolog                     186   3e-55   
ref|XP_002949693.1|  hypothetical protein VOLCADRAFT_80696              192   3e-53   Volvox carteri f. nagariensis
ref|XP_001701885.1|  heat shock protein 90B                             192   4e-53   Chlamydomonas reinhardtii
gb|AFK46854.1|  unknown                                                 165   6e-48   Medicago truncatula
gb|KJB63273.1|  hypothetical protein B456_010G0030002                   164   7e-47   Gossypium raimondii
ref|XP_006657349.1|  PREDICTED: endoplasmin homolog                     171   6e-45   
gb|KHG15193.1|  Endoplasmin                                             165   1e-43   Gossypium arboreum [tree cotton]
ref|XP_001753222.1|  predicted protein                                  165   2e-43   
ref|XP_002508627.1|  predicted protein                                  165   2e-43   Micromonas commoda
ref|XP_001421809.1|  Heat Shock Protein 90, endoplasmic reticulum       165   3e-43   Ostreococcus lucimarinus CCE9901
ref|NP_001146348.1|  shepherd-like1                                     162   9e-43   
gb|ACR38010.1|  unknown                                                 150   1e-42   Zea mays [maize]
ref|XP_003083767.1|  heat shock protein 90 (ISS)                        162   2e-42   
ref|XP_003063917.1|  predicted protein                                  162   3e-42   Micromonas pusilla CCMP1545
gb|AFW81490.1|  hypothetical protein ZEAMMB73_031063                    149   4e-42   
ref|XP_005823214.1|  hypothetical protein GUITHDRAFT_160160             161   9e-42   Guillardia theta CCMP2712
ref|XP_007512535.1|  predicted protein                                  160   4e-41   Bathycoccus prasinos
ref|XP_002157524.1|  PREDICTED: endoplasmin-like                        157   1e-40   Hydra vulgaris
ref|XP_005651682.1|  heat shock protein Hsp90                           157   2e-40   Coccomyxa subellipsoidea C-169
emb|CEG00480.1|  Histidine kinase-like ATPase, ATP-binding domain       153   4e-39   Ostreococcus tauri
dbj|GAM27457.1|  hypothetical protein SAMD00019534_106330               153   6e-39   Acytostelium subglobosum LB1
ref|XP_006588134.1|  PREDICTED: endoplasmin homolog                     141   1e-38   Glycine max [soybeans]
gb|EFA78289.1|  heat shock protein Hsp90 family protein                 151   2e-38   Heterostelium album PN500
gb|AGX25162.1|  heat shock protein                                      143   2e-37   Leptinotarsa decemlineata
tpg|DAA34121.1|  TPA: endoplasmic reticulum glucose-regulated pro...    139   6e-37   Amblyomma variegatum
ref|XP_002117847.1|  hypothetical protein TRIADDRAFT_64388              146   7e-37   Trichoplax adhaerens
gb|AIC62039.1|  HSP90B1                                                 141   1e-36   synthetic construct
gb|AAH09195.1|  HSP90B1 protein                                         141   1e-36   Homo sapiens [man]
gb|EAW97723.1|  heat shock protein 90kDa beta (Grp94), member 1, ...    141   3e-36   Homo sapiens [man]
ref|XP_011402246.1|  Endoplasmin-like protein                           145   6e-36   Auxenochlorella protothecoides
emb|CBN74418.1|  Heat shock protein 90                                  144   6e-36   Ectocarpus siliculosus
ref|XP_011311739.1|  PREDICTED: endoplasmin                             143   1e-35   Fopius arisanus
ref|XP_007893493.1|  PREDICTED: endoplasmin                             143   2e-35   Callorhinchus milii [Australian ghost shark]
ref|XP_004373828.1|  PREDICTED: endoplasmin                             142   3e-35   Trichechus manatus latirostris
ref|XP_003907109.1|  PREDICTED: endoplasmin                             142   3e-35   
dbj|BAD92771.1|  tumor rejection antigen (gp96) 1 variant               140   3e-35   Homo sapiens [man]
ref|XP_009065664.1|  hypothetical protein LOTGIDRAFT_197084             142   3e-35   Lottia gigantea
gb|AAH81917.1|  Tra1 protein                                            141   3e-35   Rattus norvegicus [brown rat]
dbj|BAP28370.1|  heat shock protein 90 kDa beta member 1                141   4e-35   Canis lupus familiaris [dogs]
ref|XP_005358282.1|  PREDICTED: endoplasmin                             142   4e-35   Microtus ochrogaster [prairie voles]
ref|XP_007109922.1|  PREDICTED: endoplasmin                             142   5e-35   Physeter catodon
ref|XP_006740281.1|  PREDICTED: endoplasmin isoform X2                  141   5e-35   
ref|XP_002428463.1|  Hsp90 protein, putative                            142   5e-35   Pediculus humanus corporis [human body lice]
gb|KFM57735.1|  Endoplasmin                                             142   5e-35   Stegodyphus mimosarum
ref|XP_004269495.1|  PREDICTED: endoplasmin                             142   5e-35   
ref|XP_004326676.1|  PREDICTED: endoplasmin                             142   6e-35   Tursiops truncatus [Atlantic bottle-nosed dolphin]
ref|XP_007096540.1|  PREDICTED: endoplasmin                             141   6e-35   Panthera tigris altaica
ref|XP_007165840.1|  PREDICTED: endoplasmin                             141   6e-35   Balaenoptera acutorostrata scammoni
ref|XP_004414318.1|  PREDICTED: endoplasmin                             141   7e-35   Odobenus rosmarus divergens
dbj|BAE29874.1|  unnamed protein product                                141   7e-35   Mus musculus [mouse]
ref|XP_011218345.1|  PREDICTED: endoplasmin isoform X2                  141   7e-35   
ref|XP_008703910.1|  PREDICTED: endoplasmin                             141   7e-35   Ursus maritimus [white bear]
ref|XP_004006728.1|  PREDICTED: endoplasmin                             141   7e-35   
ref|NP_035761.1|  endoplasmin precursor                                 141   7e-35   Mus musculus [mouse]
gb|ELR54024.1|  Endoplasmin                                             141   8e-35   Bos mutus
ref|XP_003745792.1|  PREDICTED: endoplasmin-like                        141   8e-35   Galendromus occidentalis
ref|XP_003929672.1|  PREDICTED: endoplasmin                             141   8e-35   Saimiri boliviensis boliviensis
ref|XP_009019107.1|  hypothetical protein HELRODRAFT_157169             141   8e-35   Helobdella robusta
ref|NP_001012197.2|  endoplasmin precursor                              141   8e-35   Rattus norvegicus [brown rat]
ref|NP_777125.1|  endoplasmin precursor                                 141   8e-35   Bos taurus [bovine]
ref|XP_006934044.1|  PREDICTED: endoplasmin                             141   8e-35   
gb|EPY74066.1|  endoplasmin precursor                                   140   8e-35   Camelus ferus
ref|XP_006979926.1|  PREDICTED: endoplasmin                             141   8e-35   Peromyscus maniculatus bairdii
ref|XP_008002644.1|  PREDICTED: endoplasmin                             141   8e-35   Chlorocebus sabaeus
ref|XP_006740280.1|  PREDICTED: endoplasmin isoform X1                  141   8e-35   Leptonychotes weddellii
ref|XP_002915502.1|  PREDICTED: endoplasmin isoform X1                  141   8e-35   Ailuropoda melanoleuca
ref|XP_010219153.1|  PREDICTED: endoplasmin-like                        136   8e-35   Tinamus guttatus
ref|XP_003783342.1|  PREDICTED: endoplasmin-like                        141   9e-35   Otolemur garnettii
ref|XP_007619353.1|  PREDICTED: endoplasmin                             141   9e-35   
ref|XP_005068020.1|  PREDICTED: endoplasmin                             141   9e-35   Mesocricetus auratus [Syrian golden hamster]
ref|XP_003505898.1|  PREDICTED: endoplasmin                             141   9e-35   Cricetulus griseus [Chinese hamsters]
ref|XP_005322404.1|  PREDICTED: endoplasmin                             141   9e-35   Ictidomys tridecemlineatus
gb|AAH10445.1|  Heat shock protein 90, beta (Grp94), member 1           141   9e-35   Mus musculus [mouse]
ref|XP_004879102.1|  PREDICTED: endoplasmin                             141   9e-35   
ref|NP_001127573.1|  endoplasmin precursor                              141   9e-35   Pongo abelii [orang utan]
ref|XP_008568503.1|  PREDICTED: endoplasmin                             141   9e-35   Galeopterus variegatus [Malayan flying lemur]
ref|XP_003269991.2|  PREDICTED: endoplasmin                             141   9e-35   Nomascus leucogenys [White-cheeked Gibbon]
ref|NP_001182453.1|  heat shock protein 90kDa beta (Grp94), membe...    141   9e-35   Macaca mulatta [rhesus macaque]
ref|NP_001003327.1|  endoplasmin precursor                              141   9e-35   Canis lupus familiaris [dogs]
ref|NP_001233416.1|  endoplasmin precursor                              141   9e-35   Pan troglodytes
gb|EFB13451.1|  hypothetical protein PANDA_003512                       141   9e-35   Ailuropoda melanoleuca
ref|XP_006888611.1|  PREDICTED: endoplasmin                             141   9e-35   Elephantulus edwardii [Cape long-eared elephant shrew]
gb|EHH66650.1|  hypothetical protein EGM_03684                          141   9e-35   Macaca fascicularis [crab eating macaque]
gb|EHH21126.1|  hypothetical protein EGK_04124                          141   9e-35   Macaca mulatta [rhesus macaque]
gb|EHA99498.1|  Endoplasmin                                             141   9e-35   Heterocephalus glaber [naked mole rat]
ref|XP_004743081.1|  PREDICTED: endoplasmin                             141   9e-35   
ref|XP_006084129.1|  PREDICTED: endoplasmin                             141   9e-35   Myotis lucifugus
ref|XP_005865309.1|  PREDICTED: endoplasmin                             141   9e-35   Myotis brandtii
ref|XP_006141474.1|  PREDICTED: endoplasmin                             141   9e-35   Tupaia chinensis
gb|AAQ02595.1|  tumor rejection antigen 1gp96                           141   9e-35   synthetic construct
emb|CAI64497.1|  tumor rejection antigen (gp96) 1                       141   1e-34   Homo sapiens [man]
ref|XP_003202424.1|  PREDICTED: endoplasmin                             141   1e-34   Meleagris gallopavo [common turkey]
ref|XP_008142964.1|  PREDICTED: endoplasmin                             141   1e-34   Eptesicus fuscus
ref|XP_006769416.1|  PREDICTED: endoplasmin                             141   1e-34   Myotis davidii
ref|NP_003290.1|  endoplasmin precursor                                 141   1e-34   Homo sapiens [man]
gb|KDD75133.1|  heat shock protein 90 Hsp90                             140   1e-34   Helicosporidium sp. ATCC 50920
ref|XP_011385167.1|  PREDICTED: endoplasmin                             141   1e-34   
ref|XP_004418096.1|  PREDICTED: endoplasmin                             141   1e-34   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_004053833.1|  PREDICTED: endoplasmin                             141   1e-34   
ref|NP_001157345.1|  glucose-regulated protein precursor                141   1e-34   Equus caballus [domestic horse]
gb|EPQ07146.1|  Endoplasmin                                             141   1e-34   Myotis brandtii
ref|XP_971540.1|  PREDICTED: endoplasmin                                140   1e-34   Tribolium castaneum [rust-red flour beetle]
ref|XP_006205953.1|  PREDICTED: endoplasmin                             140   1e-34   Vicugna pacos
ref|XP_001365625.1|  PREDICTED: endoplasmin                             140   1e-34   Monodelphis domestica
ref|XP_004349108.2|  glucose-regulated protein 94                       141   1e-34   Capsaspora owczarzaki ATCC 30864
ref|XP_006193753.1|  PREDICTED: endoplasmin                             140   1e-34   Camelus ferus
ref|XP_004844893.1|  PREDICTED: endoplasmin isoform X1                  140   1e-34   
ref|XP_010629639.1|  PREDICTED: endoplasmin                             140   1e-34   Fukomys damarensis [Damara mole rat]
ref|XP_004589651.1|  PREDICTED: endoplasmin                             140   1e-34   Ochotona princeps [southern American pika]
ref|XP_011494775.1|  PREDICTED: endoplasmin                             140   1e-34   Ceratosolen solmsi marchali
ref|XP_003405348.1|  PREDICTED: endoplasmin                             140   2e-34   Loxodonta africana [African bush elephant]
sp|Q29092.3|ENPL_PIG  RecName: Full=Endoplasmin; AltName: Full=94...    140   2e-34   Sus scrofa [pigs]
gb|ADR79285.1|  Hsp90 beta                                              140   2e-34   Brachionus ibericus
ref|XP_005680600.1|  PREDICTED: endoplasmin                             140   2e-34   
emb|CAA62352.1|  protein kinase                                         140   2e-34   Sus scrofa [pigs]
ref|XP_005374635.1|  PREDICTED: endoplasmin                             140   2e-34   Chinchilla lanigera
ref|XP_004623907.1|  PREDICTED: endoplasmin                             140   2e-34   Octodon degus
ref|NP_001039228.1|  heat shock protein 90kDa beta (Grp94), membe...    140   2e-34   Xenopus tropicalis [western clawed frog]
ref|XP_001637407.1|  predicted protein                                  140   2e-34   Nematostella vectensis
emb|CAA28629.1|  hsp 108                                                140   2e-34   Gallus gallus [bantam]
ref|XP_007454336.1|  PREDICTED: endoplasmin                             140   2e-34   Lipotes vexillifer [baiji]
gb|AAA48827.1|  108K heat shock protein                                 140   2e-34   Gallus gallus [bantam]
gb|AEE63339.1|  unknown                                                 140   2e-34   Dendroctonus ponderosae
gb|ACF35012.1|  heat shock protein 108                                  140   2e-34   Gallus gallus [bantam]
ref|XP_003694125.1|  PREDICTED: endoplasmin-like                        140   2e-34   Apis florea [dwarf honeybee]
dbj|BAI23208.1|  heat shock protein 90kDa beta (Grp94), member 1        140   2e-34   Coturnix japonica
ref|XP_006619420.1|  PREDICTED: endoplasmin-like                        140   2e-34   Apis dorsata [rock honeybee]
ref|NP_999268.1|  endoplasmin precursor                                 140   2e-34   Sus scrofa [pigs]
ref|NP_989620.1|  endoplasmin precursor                                 140   2e-34   Gallus gallus [bantam]
gb|ERL91651.1|  hypothetical protein D910_08979                         140   2e-34   Dendroctonus ponderosae
ref|NP_001083114.1|  uncharacterized protein LOC398753 precursor        140   2e-34   Xenopus laevis [clawed frog]
ref|XP_008062311.1|  PREDICTED: endoplasmin isoform X1                  140   2e-34   
ref|XP_003401925.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmin-...    140   2e-34   Bombus terrestris [large earth bumblebee]
ref|XP_004602837.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmin        139   2e-34   Sorex araneus [Eurasian shrew]
ref|XP_003461118.1|  PREDICTED: endoplasmin isoform X1                  140   2e-34   Cavia porcellus [guinea pig]
ref|XP_009861771.1|  PREDICTED: endoplasmin-like                        140   2e-34   Ciona intestinalis [sea vase]
ref|XP_007950582.1|  PREDICTED: endoplasmin                             140   2e-34   Orycteropus afer afer
gb|KFP71026.1|  Endoplasmin                                             139   2e-34   Acanthisitta chloris
ref|XP_011474862.1|  PREDICTED: endoplasmin                             140   3e-34   
gb|AAK74072.1|  heat shock protein gp96 precursor                       139   3e-34   Homo sapiens [man]
ref|XP_004675798.1|  PREDICTED: endoplasmin                             139   3e-34   
ref|XP_006782653.1|  PREDICTED: endoplasmin-like                        139   3e-34   Neolamprologus brichardi [lyretail cichlid]
emb|CAG08708.1|  unnamed protein product                                139   3e-34   Tetraodon nigroviridis
gb|ENN73291.1|  hypothetical protein YQE_10055                          139   3e-34   Dendroctonus ponderosae
ref|XP_008841379.1|  PREDICTED: endoplasmin                             139   4e-34   Nannospalax galili
ref|XP_003493872.1|  PREDICTED: endoplasmin-like                        139   4e-34   Bombus impatiens
gb|KFB42185.1|  AGAP001424-PA-like protein                              139   4e-34   Anopheles sinensis
ref|XP_005984835.1|  PREDICTED: endoplasmin                             139   4e-34   
ref|XP_008255217.1|  PREDICTED: endoplasmin                             139   4e-34   Oryctolagus cuniculus [domestic rabbit]
ref|XP_006871146.1|  PREDICTED: endoplasmin                             139   5e-34   Chrysochloris asiatica
gb|ELK25961.1|  Endoplasmin                                             140   5e-34   Myotis davidii
sp|Q9NKX1.2|ENPL_DICDI  RecName: Full=Endoplasmin homolog; AltNam...    139   5e-34   Dictyostelium discoideum
gb|KDR24512.1|  Endoplasmin                                             139   5e-34   Zootermopsis nevadensis
emb|CBK24402.2|  unnamed protein product                                139   5e-34   Blastocystis hominis
emb|CBK20696.2|  unnamed protein product                                139   5e-34   Blastocystis hominis
ref|XP_641313.1|  heat shock protein Hsp90 family protein               139   5e-34   Dictyostelium discoideum AX4
dbj|BAA94290.2|  glucose-regulated protein 94                           139   5e-34   Dictyostelium discoideum
ref|XP_006039346.1|  PREDICTED: endoplasmin-like                        135   6e-34   
ref|XP_004994487.1|  heat shock protein gp96                            139   6e-34   Salpingoeca rosetta
ref|XP_009700867.1|  PREDICTED: endoplasmin                             139   6e-34   Cariama cristata
ref|XP_004999393.1|  PREDICTED: endoplasmin isoform X2                  139   6e-34   
gb|ACS75351.1|  endoplasmin                                             139   7e-34   Locusta migratoria
ref|XP_004446859.1|  PREDICTED: endoplasmin isoform 1                   139   7e-34   
ref|XP_002752963.1|  PREDICTED: endoplasmin                             139   7e-34   Callithrix jacchus [common marmoset]
gb|KFP55508.1|  Endoplasmin                                             138   7e-34   
ref|XP_007527982.1|  PREDICTED: endoplasmin                             138   7e-34   
gb|EFX71215.1|  hypothetical protein DAPPUDRAFT_309186                  138   8e-34   
ref|NP_937853.1|  endoplasmin precursor                                 138   8e-34   
gb|KFP21894.1|  Endoplasmin                                             138   8e-34   
ref|XP_004446860.1|  PREDICTED: endoplasmin isoform 2                   138   9e-34   
ref|XP_004650619.1|  PREDICTED: endoplasmin                             138   9e-34   
ref|XP_395614.3|  PREDICTED: endoplasmin-like isoform 1                 138   9e-34   
gb|KFQ43502.1|  Endoplasmin                                             138   9e-34   
ref|XP_006633152.1|  PREDICTED: endoplasmin-like                        138   1e-33   
ref|XP_002155110.2|  PREDICTED: heat shock protein HSP 90-alpha         129   1e-33   
ref|XP_009844916.1|  hypothetical protein H257_17728                    135   1e-33   
gb|KFP37272.1|  Endoplasmin                                             138   1e-33   
gb|KFU95780.1|  Endoplasmin                                             138   1e-33   
ref|NP_001084280.1|  heat shock protein 90kDa beta (Grp94), membe...    138   1e-33   
ref|XP_001746031.1|  hypothetical protein                               137   1e-33   
ref|XP_001599282.1|  PREDICTED: endoplasmin                             138   1e-33   
ref|XP_008281449.1|  PREDICTED: endoplasmin                             137   1e-33   
gb|KDO21013.1|  hypothetical protein SPRG_13941                         137   2e-33   
gb|ABA06415.1|  83 kDa heat shock protein                               130   2e-33   
ref|XP_004700402.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmin        137   2e-33   
ref|XP_008620345.1|  heat shock protein 90kDa beta                      137   2e-33   
gb|ELU00023.1|  hypothetical protein CAPTEDRAFT_159587                  137   2e-33   
ref|XP_003443932.1|  PREDICTED: endoplasmin-like                        137   2e-33   
ref|XP_011330408.1|  PREDICTED: endoplasmin                             137   2e-33   
ref|XP_003772640.1|  PREDICTED: endoplasmin-like                        137   2e-33   
ref|XP_008666260.1|  PREDICTED: endoplasmin homolog                     126   2e-33   
ref|XP_004358722.1|  heat shock protein Hsp90 family protein            137   2e-33   
gb|KFQ54644.1|  Endoplasmin                                             137   2e-33   
gb|KFP29919.1|  Endoplasmin                                             137   2e-33   
gb|EMC80264.1|  Endoplasmin                                             137   2e-33   
gb|KFQ37930.1|  Endoplasmin                                             137   2e-33   
gb|KFV74906.1|  Endoplasmin                                             137   2e-33   
ref|XP_005527932.1|  PREDICTED: endoplasmin                             137   2e-33   
ref|XP_005929149.1|  PREDICTED: endoplasmin-like                        137   2e-33   
ref|XP_005100278.1|  PREDICTED: mesocentin-like                         139   2e-33   
gb|KFW84338.1|  Endoplasmin                                             137   2e-33   
gb|KFQ97565.1|  Endoplasmin                                             137   2e-33   
gb|KFV06212.1|  Endoplasmin                                             137   2e-33   
ref|XP_002199813.1|  PREDICTED: endoplasmin                             137   2e-33   
ref|XP_003288550.1|  hypothetical protein DICPUDRAFT_98061              137   2e-33   
gb|KFV41897.1|  Endoplasmin                                             137   2e-33   
gb|KFQ78325.1|  Endoplasmin                                             137   2e-33   
ref|XP_009560285.1|  PREDICTED: endoplasmin                             137   2e-33   
ref|XP_004567801.1|  PREDICTED: endoplasmin-like                        137   2e-33   
ref|XP_009906642.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmin        137   3e-33   
gb|KFV91223.1|  Endoplasmin                                             137   3e-33   
gb|KFQ04275.1|  Endoplasmin                                             137   3e-33   
gb|KFW73460.1|  Endoplasmin                                             137   3e-33   
gb|KFO61201.1|  Endoplasmin                                             137   3e-33   
ref|XP_005728136.1|  PREDICTED: endoplasmin-like                        137   3e-33   
gb|KFQ80494.1|  Endoplasmin                                             137   3e-33   
gb|KFP75492.1|  Endoplasmin                                             137   3e-33   
gb|KFM13671.1|  Endoplasmin                                             137   3e-33   
ref|XP_009917591.1|  PREDICTED: endoplasmin                             137   3e-33   
ref|XP_009464118.1|  PREDICTED: endoplasmin                             137   3e-33   
gb|KFO95435.1|  Endoplasmin                                             137   3e-33   
ref|XP_010564611.1|  PREDICTED: endoplasmin                             137   3e-33   
gb|KFO76957.1|  Endoplasmin                                             137   3e-33   
pdb|3H80|A  Chain A, Crystal Structure Of The Amino-Terminal Doma...    130   3e-33   
gb|KFU98338.1|  Endoplasmin                                             137   3e-33   
gb|KFZ45999.1|  Endoplasmin                                             137   3e-33   
ref|XP_001662951.1|  AAEL012827-PA                                      137   3e-33   
ref|XP_005150492.1|  PREDICTED: endoplasmin                             137   3e-33   
ref|XP_010195758.1|  PREDICTED: endoplasmin                             137   3e-33   
ref|XP_005494809.1|  PREDICTED: endoplasmin                             137   3e-33   
gb|AAI29529.1|  Unknown (protein for MGC:160189)                        137   3e-33   
gb|KFO89906.1|  Endoplasmin                                             136   3e-33   
gb|KFP99533.1|  Endoplasmin                                             136   4e-33   
ref|XP_008310403.1|  PREDICTED: endoplasmin                             136   4e-33   
ref|XP_005040044.1|  PREDICTED: endoplasmin isoform X2                  136   4e-33   
ref|XP_002141043.1|  Hsp90 protein                                      136   4e-33   
gb|AAK69350.1|AF387865_1  heat shock protein 108                        136   4e-33   
ref|XP_010073947.1|  PREDICTED: endoplasmin                             136   4e-33   
ref|XP_010409181.1|  PREDICTED: endoplasmin                             136   4e-33   
ref|XP_009286695.1|  PREDICTED: endoplasmin                             136   4e-33   
ref|XP_005782556.1|  hypothetical protein EMIHUDRAFT_449776             136   5e-33   
emb|CBK22622.2|  unnamed protein product                                136   5e-33   
ref|XP_005040043.1|  PREDICTED: endoplasmin isoform X1                  136   5e-33   
ref|XP_008880478.1|  hypothetical protein H310_14401                    136   5e-33   
gb|KFV83935.1|  Endoplasmin                                             136   5e-33   
gb|KGL95273.1|  Endoplasmin                                             136   5e-33   
dbj|BAJ98551.1|  predicted protein                                      136   5e-33   
ref|XP_321706.5|  AGAP001424-PA                                         136   5e-33   
ref|XP_007438500.1|  PREDICTED: endoplasmin                             136   5e-33   
ref|XP_003220951.1|  PREDICTED: endoplasmin                             136   5e-33   
ref|XP_001844128.1|  endoplasmin                                        136   5e-33   
ref|XP_005500402.1|  PREDICTED: endoplasmin                             136   5e-33   
ref|XP_005022616.1|  PREDICTED: endoplasmin                             135   6e-33   
ref|XP_003701264.1|  PREDICTED: endoplasmin-like                        136   6e-33   
gb|EPY43731.1|  hypothetical protein AGDE_00190                         131   6e-33   
ref|XP_003967565.1|  PREDICTED: endoplasmin-like                        136   6e-33   
gb|ABG56395.1|  glucose-regulated protein 94                            136   6e-33   
ref|XP_010901527.1|  PREDICTED: endoplasmin-like                        135   6e-33   
gb|KFO04912.1|  Endoplasmin                                             135   6e-33   
ref|XP_011061023.1|  PREDICTED: endoplasmin                             135   7e-33   
ref|XP_009942600.1|  PREDICTED: endoplasmin                             135   7e-33   
gb|KFR02424.1|  Endoplasmin                                             135   8e-33   
gb|KFQ16767.1|  Endoplasmin                                             135   1e-32   
ref|XP_009843856.1|  hypothetical protein H257_16935                    135   1e-32   
gb|ETN62729.1|  endoplasmin                                             135   1e-32   
ref|XP_001507634.2|  PREDICTED: endoplasmin                             135   1e-32   
ref|XP_002413149.1|  tumor rejection antigen (gp96), putative           135   1e-32   
emb|CDG41617.1|  GRP94a protein                                         135   1e-32   
ref|XP_007541888.1|  PREDICTED: endoplasmin                             135   1e-32   
ref|NP_001181938.1|  94 kD glucose-regulated protein precursor          135   1e-32   
ref|XP_008934413.1|  PREDICTED: endoplasmin                             135   1e-32   
gb|ETE69540.1|  Endoplasmin                                             135   1e-32   
ref|XP_008559868.1|  PREDICTED: endoplasmin                             135   1e-32   
gb|EPY39497.1|  molecular chaperone HtpG                                131   1e-32   
emb|CDQ84254.1|  unnamed protein product                                135   2e-32   
ref|XP_001899398.1|  Endoplasmin precursor                              135   2e-32   
ref|XP_005310776.1|  PREDICTED: endoplasmin                             135   2e-32   
gb|KFZ55452.1|  Endoplasmin                                             134   2e-32   
ref|XP_005796337.1|  PREDICTED: endoplasmin-like                        134   2e-32   
gb|ADA70351.1|  heat shock protein                                      134   2e-32   
ref|XP_011260972.1|  PREDICTED: endoplasmin                             134   2e-32   
ref|NP_001274194.1|  heat shock protein 90kDa beta (Grp94), membe...    134   2e-32   
gb|AEE01388.1|  heat shock protein 90                                   127   2e-32   
gb|KHN71590.1|  Endoplasmin                                             134   3e-32   
emb|CAJ28988.1|  heat shock protein 83                                  126   3e-32   
gb|AAC07922.1|  82 kDa heat shock protein                               129   3e-32   
ref|NP_999808.1|  heat shock protein gp96 precursor                     134   3e-32   
ref|XP_010885352.1|  PREDICTED: endoplasmin                             134   3e-32   
ref|XP_011155603.1|  PREDICTED: endoplasmin                             134   3e-32   
gb|AAC07939.1|  82 kDa heat shock protein                               128   3e-32   
ref|XP_007252444.1|  PREDICTED: endoplasmin-like isoform X2             134   3e-32   
ref|XP_006138079.1|  PREDICTED: endoplasmin                             134   3e-32   
ref|XP_007252443.1|  PREDICTED: endoplasmin-like isoform X1             134   3e-32   
gb|EKF98902.1|  Heat shock protein 83, putative                         126   4e-32   
gb|EPY42272.1|  molecular chaperone HtpG                                131   4e-32   
gb|AAC07920.1|  82 kDa heat shock protein                               128   4e-32   
ref|XP_010790631.1|  PREDICTED: endoplasmin                             133   5e-32   
ref|XP_011212529.1|  PREDICTED: endoplasmin                             133   5e-32   
gb|AAC07936.1|  82 kDa heat shock protein                               128   5e-32   
gb|AAC07942.1|  82 kDa heat shock protein                               127   6e-32   
gb|AAC07946.1|  82 kDa heat shock protein                               127   6e-32   
gb|AAC07928.1|  82 kDa heat shock protein                               127   6e-32   
gb|AAC07917.1|  82 kDa heat shock protein                               127   6e-32   
gb|AAC07921.1|  82 kDa heat shock protein                               127   6e-32   
ref|XP_002262292.1|  endoplasmin homolog                                133   6e-32   
gb|AAC07927.1|  82 kDa heat shock protein                               127   6e-32   
gb|AAC07930.1|  82 kDa heat shock protein                               127   6e-32   
sp|O16087.1|HSP83_DROMI  RecName: Full=Heat shock protein 83; Alt...    127   6e-32   
gb|AAC07937.1|  82 kDa heat shock protein                               127   6e-32   
gb|KFP60419.1|  Heat shock protein HSP 90-alpha                         125   6e-32   
gb|EKF26442.1|  Heat shock protein 83, putative                         126   6e-32   
ref|XP_006079133.1|  PREDICTED: heat shock protein HSP 90-alpha i...    133   7e-32   
gb|AAC07919.1|  82 kDa heat shock protein                               127   7e-32   
sp|O16076.1|HSP83_DROPE  RecName: Full=Heat shock protein 83; Alt...    127   7e-32   
ref|XP_009706990.1|  PREDICTED: putative heat shock protein HSP 9...    124   7e-32   
gb|AAC07947.1|  82 kDa heat shock protein                               127   7e-32   
gb|AAC07924.1|  82 kDa heat shock protein                               127   7e-32   
gb|KGL81577.1|  Endoplasmin                                             126   7e-32   
ref|XP_009519039.1|  hypothetical protein PHYSODRAFT_255139             132   7e-32   
ref|XP_011152996.1|  PREDICTED: endoplasmin                             133   7e-32   
gb|KIY96790.1|  molecular chaperone HtpG                                124   7e-32   
ref|XP_668238.1|  heat shock protein 90                                 133   7e-32   
ref|XP_628530.1|  heat shock protein 90 (Hsp90), signal peptide p...    133   7e-32   
emb|CDQ78594.1|  unnamed protein product                                132   9e-32   
pdb|3O6O|A  Chain A, Crystal Structure Of The N-Terminal Domain O...    125   1e-31   
gb|ADQ64484.1|  hypothetical protein                                    126   1e-31   
ref|XP_011216700.1|  PREDICTED: putative heat shock protein HSP 9...    124   1e-31   
ref|XP_008814600.1|  heat shock protein 90kDa beta                      132   1e-31   
ref|XP_001617311.1|  endoplasmin precursor                              132   1e-31   
pdb|3PEH|A  Chain A, Crystal Structure Of The N-Terminal Domain O...    127   1e-31   
dbj|BAG61917.1|  unnamed protein product                                124   1e-31   
pdb|1U2O|A  Chain A, Crystal Structure Of The N-Domain Of Grp94 L...    125   2e-31   
gb|ABB55890.1|  heat shock protein 90                                   130   2e-31   
ref|XP_004224999.1|  endoplasmin precursor                              132   2e-31   
gb|EKF99923.1|  Heat shock protein 83, putative                         126   2e-31   
pdb|3OPD|A  Chain A, Crystal Structure Of The N-Terminal Domain O...    125   2e-31   
ref|XP_001358252.1|  GA18946                                            132   2e-31   
ref|XP_002012968.1|  GL23644                                            131   2e-31   
ref|XP_001441660.1|  hypothetical protein                               129   2e-31   
ref|XP_002021280.1|  Hsp83                                              128   2e-31   
gb|AAC07935.1|  82 kDa heat shock protein                               126   2e-31   
ref|XP_003878279.1|  heat shock protein 83-1                            131   2e-31   
gb|EPY30260.1|  molecular chaperone HtpG                                131   2e-31   
pdb|1QY5|A  Chain A, Crystal Structure Of The N-Domain Of The Er ...    126   2e-31   
pdb|1U0Y|A  Chain A, N-Domain Of Grp94, With The Charged Domain, ...    126   2e-31   
pir||S57415  Hsp83 protein - Leishmania donovani infantum               130   3e-31   
sp|Q25293.2|HSP83_LEIIN  RecName: Full=Heat shock protein 83-1; S...    130   3e-31   
gb|AAC07948.1|  82 kDa heat shock protein                               126   3e-31   
pdb|4NH9|A  Chain A, Correlation Between Chemotype-dependent Bind...    126   3e-31   
ref|XP_811792.1|  heat shock protein 83                                 126   3e-31   
gb|ADY39524.1|  putative heat shock protein gp-96                       123   3e-31   
pdb|2FWY|A  Chain A, Structure Of Human Hsp90-Alpha Bound To The ...    125   3e-31   
ref|XP_006004184.1|  PREDICTED: endoplasmin isoform X2                  131   3e-31   
ref|XP_006004183.1|  PREDICTED: endoplasmin isoform X1                  131   3e-31   
gb|AER60491.1|  heat shock protein gp96                                 131   3e-31   
ref|XP_003863861.1|  heat shock protein 83-1                            130   3e-31   
ref|XP_003392730.1|  heat shock protein 83-1                            130   3e-31   
gb|EKF99676.1|  Heat shock protein 83, putative                         127   3e-31   
gb|AAC07938.1|  82 kDa heat shock protein                               125   3e-31   
ref|XP_001685762.1|  heat shock protein 83-1                            130   3e-31   
ref|XP_001685759.1|  heat shock protein 83-1                            130   3e-31   
emb|CAG32523.1|  hypothetical protein RCJMB04_28d6                      124   3e-31   
ref|XP_004523400.1|  PREDICTED: endoplasmin-like                        131   4e-31   
ref|XP_003140246.1|  endoplasmin                                        130   4e-31   
ref|XP_010702130.1|  heat shock protein 83                              130   4e-31   
emb|CCA22450.1|  heat shock protein 90 putative                         130   4e-31   
gb|AAC07940.1|  82 kDa heat shock protein                               125   4e-31   
gb|AJG42174.1|  heat shock protein 90                                   123   4e-31   
ref|XP_001567804.1|  heat shock protein 83-1                            130   4e-31   
gb|AAB46677.1|  heat shock protein 83                                   127   5e-31   
emb|CAD66568.1|  unnamed protein product                                125   5e-31   
ref|XP_006299404.1|  hypothetical protein CARUB_v10015564mg             130   5e-31   
dbj|BAF63637.1|  glucose-regulated protein 94                           130   5e-31   
ref|XP_006985046.1|  PREDICTED: heat shock protein HSP 90-beta-like     123   5e-31   
ref|XP_002072044.1|  GK22636                                            130   5e-31   
gb|KDO70251.1|  hypothetical protein CISIN_1g0038271mg                  127   5e-31   
ref|XP_006748995.1|  PREDICTED: heat shock protein HSP 90-alpha-like    125   5e-31   
gb|KDO70248.1|  hypothetical protein CISIN_1g0038271mg                  127   5e-31   
gb|AHN92447.1|  heat shock protein 90                                   122   5e-31   
pdb|3FT5|A  Chain A, Structure Of Hsp90 Bound With A Novel Fragment     125   5e-31   
ref|XP_010755578.1|  PREDICTED: endoplasmin isoform X1                  130   5e-31   
sp|P04810.1|HSP83_DROSI  RecName: Full=Heat shock protein 83; Alt...    127   5e-31   
gb|AAL83217.1|AF473560_1  heat shock protein 90 alpha                   124   5e-31   
pdb|2XJJ|A  Chain A, Structure Of Hsp90 With Small Molecule Inhib...    124   5e-31   
gb|AAB46685.1|  heat shock protein 83                                   127   6e-31   



>emb|CDP07384.1| unnamed protein product [Coffea canephora]
Length=815

 Score =   310 bits (795),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 185/196 (94%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW VPAVLFLLCLLFLLPDQGRKIHANAEVD+DAPVDPPKVEEKIG VP+GLSTD DV
Sbjct  1    MRKWTVPAVLFLLCLLFLLPDQGRKIHANAEVDADAPVDPPKVEEKIGAVPNGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
             KREAESMS+RTLRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKREAESMSRRTLRATAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK+ILGEGDTAKLEIQIKLDK+KKILSIRDRGIGMTKEDLVKNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEILGEGDTAKLEIQIKLDKEKKILSIRDRGIGMTKEDLVKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>ref|XP_011083591.1| PREDICTED: endoplasmin homolog [Sesamum indicum]
Length=808

 Score =   302 bits (774),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 178/196 (91%), Positives = 189/196 (96%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW +P+VLFLLCLLFLLPDQGRKI ANAEVDSDAP+DPPKVEEKIGGVP+GLSTD DV
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRKIQANAEVDSDAPLDPPKVEEKIGGVPNGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
             KREAESMS+RTLRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKREAESMSRRTLRANAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FL+LTDK++LGEGD  KLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLALTDKEVLGEGDNTKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>gb|EYU38796.1| hypothetical protein MIMGU_mgv1a001101mg [Erythranthe guttata]
Length=889

 Score =   302 bits (773),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 179/197 (91%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = +1

Query  52   TMRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPD  231
            TMRKW +P+VLFLLCLLFLLPDQGRKI ANAEVDSDA VDPPKVEEK+G VPHGLSTD D
Sbjct  70   TMRKWTIPSVLFLLCLLFLLPDQGRKIQANAEVDSDAAVDPPKVEEKLGAVPHGLSTDSD  129

Query  232  VAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  411
            V KREAESMS+R LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI
Sbjct  130  VVKREAESMSRRNLRTNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  189

Query  412  RFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSA  591
            RFLSLTDK+ILGEGD AKLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSA
Sbjct  190  RFLSLTDKEILGEGDDAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSA  249

Query  592  FVEKMQSSGDLNLIGQF  642
            FVEKMQ+SGDLNLIGQF
Sbjct  250  FVEKMQTSGDLNLIGQF  266



>ref|XP_009596271.1| PREDICTED: endoplasmin homolog, partial [Nicotiana tomentosiformis]
Length=644

 Score =   295 bits (756),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 173/196 (88%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW +P+VLFLLCLLFLLPDQGR+I ANAE +SD PVDPPKVEEK G +PHGLSTD DV
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRRIQANAEAESDVPVDPPKVEEKFGAIPHGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
             KRE+ESMS++TLRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESMSRKTLRADAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK++LGEGD AKLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDNAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>gb|EYU36792.1| hypothetical protein MIMGU_mgv1a001447mg [Erythranthe guttata]
Length=818

 Score =   299 bits (765),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 172/196 (88%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW +P+VLFLLCLLFLLPDQGRKIHANAE DSD P+DPPKVEEKIG VPHGLSTD +V
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRKIHANAEADSDVPLDPPKVEEKIGAVPHGLSTDSEV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
             KREAESMS++TLRA A+KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKREAESMSRKTLRASAQKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK++LGEGD  KLEIQIKLDK+ KILSIRDRG+GMTKEDL+KNLGTIA+SGTSAF
Sbjct  121  FLSLTDKEVLGEGDNTKLEIQIKLDKENKILSIRDRGVGMTKEDLIKNLGTIARSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>ref|XP_009606988.1| PREDICTED: endoplasmin homolog [Nicotiana tomentosiformis]
Length=812

 Score =   296 bits (759),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 173/196 (88%), Positives = 187/196 (95%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW +P+VLFLLCLLFLLPDQGR+I ANAE +SDAPVDPPKVEEK+G VPHGLSTD DV
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRRIQANAEAESDAPVDPPKVEEKLGAVPHGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
             KRE+ESMS++TLRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESMSRKTLRADAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK++LGEGD  +LEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDNTELEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>ref|XP_009791520.1| PREDICTED: endoplasmin homolog [Nicotiana sylvestris]
Length=811

 Score =   296 bits (758),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 174/196 (89%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW +P+VLFLLCLLFLLPDQGR+I ANAE +SDAPVDPPKVEEK G VPHGLSTD DV
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRRIQANAEAESDAPVDPPKVEEKFGAVPHGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
             KRE+ESMS++TLRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESMSRKTLRADAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK++LGEGD  KLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDNTKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>sp|P35016.1|ENPL_CATRO RecName: Full=Endoplasmin homolog; AltName: Full=Glucose-regulated 
protein 94 homolog; Short=GRP-94 homolog; Flags: Precursor 
[Catharanthus roseus]
 gb|AAA16785.1| heat shock protein 90 [Catharanthus roseus]
Length=817

 Score =   296 bits (758),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 173/196 (88%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW VP+VLFLLC       QGRKIHANAE DSDAPVDPPKVE+KIG VP+GLSTD DV
Sbjct  1    MRKWTVPSVLFLLCPSLSSSCQGRKIHANAEADSDAPVDPPKVEDKIGAVPNGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
            AKREAESMS R LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESMSMRNLRSDAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FL+LTDK+ILGEGDTAKLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLALTDKEILGEGDTAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>dbj|BAL42333.1| Heat shock protein 90 [Nicotiana tabacum]
Length=812

 Score =   296 bits (757),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 173/196 (88%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW +P+VLFLLCLLFLLPDQGR+I ANAE +SD PVDPPKVEEK G +PHGLSTD DV
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRRIQANAEAESDVPVDPPKVEEKFGAIPHGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
             KRE+ESMS++TLRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESMSRKTLRADAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK++LGEGD AKLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDNAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>ref|XP_002273785.1| PREDICTED: endoplasmin homolog [Vitis vinifera]
 emb|CBI19885.3| unnamed protein product [Vitis vinifera]
Length=818

 Score =   294 bits (753),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 173/196 (88%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW +P+ L LLCLL LLPDQGRKIHANAE DS+  V+PPKVEEKIG VP+GLSTD DV
Sbjct  1    MRKWTIPSALLLLCLLCLLPDQGRKIHANAEADSEELVNPPKVEEKIGAVPNGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
            AKREAES+SKR LRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRNLRANAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK+ILGEGDTAKL+IQIKLDK+KKILSIRDRGIGMTK+DL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEILGEGDTAKLDIQIKLDKEKKILSIRDRGIGMTKDDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>ref|XP_004238368.1| PREDICTED: endoplasmin homolog [Solanum lycopersicum]
Length=812

 Score =   293 bits (751),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 171/196 (87%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW +P VLFLLCL++L+PDQGRKI ANAE DSDAPVDPPKVEEK G VP+GLSTD DV
Sbjct  1    MRKWKIPFVLFLLCLIYLVPDQGRKIQANAEADSDAPVDPPKVEEKFGAVPNGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
            AKREAESMS++TLRA AEKFEFQAEVSRLMDI+INSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESMSRKTLRASAEKFEFQAEVSRLMDILINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FL+LTDK++LGEGD  KLEIQIKLDK+KKILSIRDRG+GMTKEDL KNLGTIAKSGTSAF
Sbjct  121  FLALTDKEVLGEGDNTKLEIQIKLDKEKKILSIRDRGVGMTKEDLRKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>ref|XP_006342064.1| PREDICTED: endoplasmin homolog [Solanum tuberosum]
Length=806

 Score =   293 bits (750),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 171/196 (87%), Positives = 184/196 (94%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW +P VLFLLCL+FL+PDQGRKI ANAE DSDAPVDPPKVEEK G VP+GLSTD DV
Sbjct  1    MRKWTIPFVLFLLCLIFLVPDQGRKIQANAEADSDAPVDPPKVEEKFGAVPNGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
            AKREAESMS++TLRA AEKFEFQAEVSRLMDI+INSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESMSRKTLRASAEKFEFQAEVSRLMDILINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FL+LTDK++LGEGD  KLEIQIKLDK+KKIL IRDRG+GMTKEDL KNLGTIAKSGTSAF
Sbjct  121  FLALTDKEVLGEGDNTKLEIQIKLDKEKKILFIRDRGVGMTKEDLRKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>ref|XP_009791518.1| PREDICTED: endoplasmin homolog [Nicotiana sylvestris]
Length=811

 Score =   293 bits (749),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 171/196 (87%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW +P+VLFLLCLLFLLPDQGR+I ANAE +SD PVDPPKVEEK G +PHGLSTD DV
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRRIQANAEAESDVPVDPPKVEEKFGAIPHGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
             KRE+ESMS++TLRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESMSRKTLRADAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK++LGEG+  KLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGENTKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>dbj|BAL42332.1| Heat shock protein 90 [Nicotiana tabacum]
Length=811

 Score =   293 bits (749),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 171/196 (87%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW +P+VLFLLCLLFLLPDQGR+I ANAE +SD PVDPPKVEEK G +PHGLSTD DV
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRRIQANAEAESDVPVDPPKVEEKFGAIPHGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
             KRE+ESMS++TLRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESMSRKTLRADAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK++LGEG+  KLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGENTKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>gb|KDO84888.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=507

 Score =   281 bits (720),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 165/196 (84%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW +P++L LL L+ L+PDQGR I A AE +SD  VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSILLLLFLVALIPDQGRNIQAKAEDESDKLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
            AKREAES+SKR+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK++LGEGD  KLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDNTKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>emb|CAN79404.1| hypothetical protein VITISV_028074 [Vitis vinifera]
Length=1084

 Score =   293 bits (749),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 173/196 (88%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW +P+ L LLCLL LLPDQGRKIHANAE DS+  V+PPKVEEKIG VP+GLSTD DV
Sbjct  266  MRKWTIPSALLLLCLLCLLPDQGRKIHANAEADSEELVNPPKVEEKIGAVPNGLSTDSDV  325

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
            AKREAES+SKR LRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  326  AKREAESISKRNLRANAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  385

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK+ILGEGDTAKL+IQIKLDK+KKILSIRDRGIGMTK+DL+KNLGTIAKSGTSAF
Sbjct  386  FLSLTDKEILGEGDTAKLDIQIKLDKEKKILSIRDRGIGMTKDDLIKNLGTIAKSGTSAF  445

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  446  VEKMQTSGDLNLIGQF  461



>ref|XP_011074690.1| PREDICTED: endoplasmin homolog [Sesamum indicum]
Length=811

 Score =   288 bits (738),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 173/196 (88%), Positives = 186/196 (95%), Gaps = 1/196 (1%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW + +VLFLLCLLFL PDQGRKIH NA+ DSDA VDPPKVEEKIG VP+GLSTD +V
Sbjct  1    MRKWTI-SVLFLLCLLFLFPDQGRKIHVNAKGDSDASVDPPKVEEKIGAVPNGLSTDSNV  59

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
            AKREAESMS+RTLRA AE+FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  60   AKREAESMSRRTLRANAERFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  119

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK++LGEGD AKLE+QIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  120  FLSLTDKEVLGEGDDAKLEMQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  179

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  180  VEKMQTSGDLNLIGQF  195



>ref|XP_004499281.1| PREDICTED: endoplasmin homolog isoform X1 [Cicer arietinum]
 ref|XP_004499282.1| PREDICTED: endoplasmin homolog isoform X2 [Cicer arietinum]
Length=817

 Score =   287 bits (735),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 169/196 (86%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW +P+ L LL LL L  DQG+K+ ANAE +SD  VDPPKVE+KIG VPHGLSTD DV
Sbjct  1    MRKWTIPSALLLLSLLLLFADQGQKLKANAEDNSDELVDPPKVEDKIGAVPHGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
            AKREAES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDKDILGEGD AKL+IQIKLDK+KKILSIRDRGIGMTKEDLVKNLGTIAKSGTSAF
Sbjct  121  FLSLTDKDILGEGDNAKLDIQIKLDKEKKILSIRDRGIGMTKEDLVKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>ref|XP_004499283.1| PREDICTED: endoplasmin homolog isoform X3 [Cicer arietinum]
Length=816

 Score =   287 bits (735),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 169/196 (86%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW +P+ L LL LL L  DQG+K+ ANAE +SD  VDPPKVE+KIG VPHGLSTD DV
Sbjct  1    MRKWTIPSALLLLSLLLLFADQGQKLKANAEDNSDELVDPPKVEDKIGAVPHGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
            AKREAES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDKDILGEGD AKL+IQIKLDK+KKILSIRDRGIGMTKEDLVKNLGTIAKSGTSAF
Sbjct  121  FLSLTDKDILGEGDNAKLDIQIKLDKEKKILSIRDRGIGMTKEDLVKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>gb|KDO84887.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=584

 Score =   282 bits (721),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 165/196 (84%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW +P++L LL L+ L+PDQGR I A AE +SD  VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSILLLLFLVALIPDQGRNIQAKAEDESDKLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
            AKREAES+SKR+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK++LGEGD  KLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDNTKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>gb|KDP36908.1| hypothetical protein JCGZ_08199 [Jatropha curcas]
Length=821

 Score =   287 bits (734),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 165/196 (84%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW +P+ L LLCLL ++ DQGR +HANAE DS  PVDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSALLLLCLLSVISDQGRNLHANAEADSQNPVDPPKVEEKLGAVPNGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
            AKREAES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FL+LTDK++LGEGD  KL+IQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLALTDKEVLGEGDNTKLDIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>ref|XP_010539097.1| PREDICTED: endoplasmin homolog [Tarenaya hassleriana]
Length=830

 Score =   286 bits (732),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 169/196 (86%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW +P+VLF +CL+FLLPDQGRK+HANA+  SD  VDPPKVEEK+GG+  GLSTD DV
Sbjct  1    MRKWTIPSVLFFVCLIFLLPDQGRKLHANADGSSDEVVDPPKVEEKVGGIHGGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
              RE+ESMSKRTLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VHRESESMSKRTLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDKD+LGEGD AKLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKDVLGEGDNAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ SGDLNLIGQF
Sbjct  181  VEKMQKSGDLNLIGQF  196



>ref|XP_003589505.1| Endoplasmin-like protein [Medicago truncatula]
 gb|AES59756.1| heat shock protein 81-2 [Medicago truncatula]
Length=818

 Score =   285 bits (730),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 169/196 (86%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW +P+ L LL LL LL DQG+K  ANAE +SD  VDPPKVEEK+G VPHGLSTD DV
Sbjct  1    MRKWTIPSTLLLLSLLLLLADQGQKFQANAEGNSDEIVDPPKVEEKLGAVPHGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
             KRE+ES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDKDILGEGD AKLEIQIKLDK+KKILSIRDRGIGMTKEDLVKNLGTIAKSGTSAF
Sbjct  121  FLSLTDKDILGEGDNAKLEIQIKLDKEKKILSIRDRGIGMTKEDLVKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>ref|XP_010109992.1| Endoplasmin-like protein [Morus notabilis]
 gb|EXC25010.1| Endoplasmin-like protein [Morus notabilis]
Length=1004

 Score =   288 bits (737),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 173/196 (88%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW +P+ LFLLCLLFLLPDQGRK+ ANAE  SD  VDPPKVEEKIG VP+GLSTD DV
Sbjct  1    MRKWTIPSALFLLCLLFLLPDQGRKLQANAEGSSDDLVDPPKVEEKIGAVPNGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
             KREAES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDA+DKIR
Sbjct  61   VKREAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDAIDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK+ILGEGDTAKLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEILGEGDTAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>ref|XP_002307732.1| hypothetical protein POPTR_0005s26260g [Populus trichocarpa]
 gb|EEE94728.1| hypothetical protein POPTR_0005s26260g [Populus trichocarpa]
Length=823

 Score =   285 bits (728),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 168/196 (86%), Positives = 183/196 (93%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW VP+VL LLCLL L+ DQG+K+HA AE DSD+ VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTVPSVLLLLCLLSLISDQGQKLHAKAEDDSDSLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
             KRE+ES+SKRTLR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESISKRTLRNTAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK++LGEGD AKL+IQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDNAKLDIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>ref|XP_011045067.1| PREDICTED: endoplasmin homolog [Populus euphratica]
Length=823

 Score =   284 bits (727),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 168/196 (86%), Positives = 183/196 (93%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW VP+VL LLCLL L+ DQG+K+HA AE DSD+ VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTVPSVLLLLCLLSLISDQGQKLHAKAEDDSDSLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
             KRE+ES+SKRTLR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESISKRTLRNTAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK++LGEGD AKL+IQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDNAKLDIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>gb|KDO84886.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=762

 Score =   282 bits (722),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 165/196 (84%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW +P++L LL L+ L+PDQGR I A AE +SD  VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSILLLLFLVALIPDQGRNIQAKAEDESDKLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
            AKREAES+SKR+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK++LGEGD  KLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDNTKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>gb|KDO84884.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=818

 Score =   283 bits (724),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 165/196 (84%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW +P++L LL L+ L+PDQGR I A AE +SD  VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSILLLLFLVALIPDQGRNIQAKAEDESDKLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
            AKREAES+SKR+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK++LGEGD  KLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDNTKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>ref|XP_009409971.1| PREDICTED: endoplasmin homolog [Musa acuminata subsp. malaccensis]
Length=814

 Score =   283 bits (724),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 181/198 (91%), Gaps = 2/198 (1%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEV--DSDAPVDPPKVEEKIGGVPHGLSTDP  228
            MRKWA+P+ L LL LL  +PD+GRK+HANAE   DSD  VDPPKVE+K+G VPHGLSTD 
Sbjct  1    MRKWALPSALLLLLLLSTIPDRGRKLHANAEDSGDSDELVDPPKVEDKLGAVPHGLSTDS  60

Query  229  DVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK  408
            +VAKREAES+S+RTLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK
Sbjct  61   EVAKREAESISRRTLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK  120

Query  409  IRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTS  588
            IRFLSLTDK++LGEGD  KL+I IKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTS
Sbjct  121  IRFLSLTDKEVLGEGDNTKLDILIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTS  180

Query  589  AFVEKMQSSGDLNLIGQF  642
            AFVEKMQ+ GDLNLIGQF
Sbjct  181  AFVEKMQTGGDLNLIGQF  198



>ref|XP_006435195.1| hypothetical protein CICLE_v10000296mg [Citrus clementina]
 gb|ESR48435.1| hypothetical protein CICLE_v10000296mg [Citrus clementina]
Length=820

 Score =   283 bits (724),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 165/196 (84%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW +P++L LL L+ L+PDQGR I A AE +SD  VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSILLLLFLVALIPDQGRNIQAKAEDESDKLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
            AKREAES+SKR+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK++LGEGD  KLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDNTKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>ref|XP_006473673.1| PREDICTED: endoplasmin homolog [Citrus sinensis]
Length=822

 Score =   283 bits (723),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 166/196 (85%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW +P++L LL LL L+PDQGR I A AE +SD  VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSILLLLFLLALIPDQGRNIQAKAEDESDKLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
            AKREAES+SKR+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK++LGEGD  KLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDNTKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>ref|XP_008377135.1| PREDICTED: endoplasmin homolog [Malus domestica]
Length=818

 Score =   283 bits (723),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 165/196 (84%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW +P+VL LLCLL LLPDQGRK+ ANAE DSD  VDPPKVEEKIG VP GLSTD DV
Sbjct  1    MRKWTIPSVLLLLCLLSLLPDQGRKLQANAEADSDELVDPPKVEEKIGAVPSGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
            AKREAES+SKR+ R+ A+ FEFQAEVSRLMDIII+SLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSQRSNAQHFEFQAEVSRLMDIIIHSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FL+LTDKD+LGEGD   LEIQIKLDK+K+I+SIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLALTDKDVLGEGDDTNLEIQIKLDKEKRIISIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>dbj|BAD94659.1| HSP90-like protein [Arabidopsis thaliana]
Length=328

 Score =   269 bits (688),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = +1

Query  112  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEK  291
            PDQGRK+HANAE  SD   DPPKVEEKIGG   GLSTD DV  RE+ESMSK+TLR+ AEK
Sbjct  20   PDQGRKLHANAEESSDDVTDPPKVEEKIGG-HGGLSTDSDVVHRESESMSKKTLRSNAEK  78

Query  292  FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkle  471
            FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKLE
Sbjct  79   FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKLE  138

Query  472  iqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  642
            IQIKLDK KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQSSGDLNLIGQF
Sbjct  139  IQIKLDKAKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  195



>ref|XP_008387928.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmin homolog [Malus domestica]
Length=818

 Score =   282 bits (722),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 165/196 (84%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW +P+VL LLCLL LLPDQGRK+ ANAE +SD  VDPPKVEEKIG VP+GL+TD DV
Sbjct  1    MRKWTIPSVLLLLCLLSLLPDQGRKLQANAEANSDELVDPPKVEEKIGAVPNGLTTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
            AKREAES+SKR+ R+ A+ FEFQAEVSRLMDIII+SLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSQRSNAQHFEFQAEVSRLMDIIIHSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FL+LTDKD+LGEGD  KLEIQIKLDK+K+ILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLALTDKDVLGEGDNTKLEIQIKLDKEKRILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>ref|XP_009334927.1| PREDICTED: endoplasmin homolog [Pyrus x bretschneideri]
Length=818

 Score =   282 bits (721),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 165/196 (84%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW +P+VL LLCLL LLPDQGRK+ ANAE +SD  VDPPKVEEKIG VP+GL+TD DV
Sbjct  1    MRKWTIPSVLLLLCLLSLLPDQGRKLQANAEANSDELVDPPKVEEKIGAVPNGLTTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
            AKREAES+SKR+ R+ A+ FEFQAEVSRLMDIII+SLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSQRSNAQHFEFQAEVSRLMDIIIHSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FL+LTDKD+LGEGD  KLEIQIKLDK+K+ILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLALTDKDVLGEGDNTKLEIQIKLDKEKRILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>ref|XP_003550428.1| PREDICTED: endoplasmin homolog isoform X1 [Glycine max]
 gb|KHN12637.1| Endoplasmin like [Glycine soja]
Length=814

 Score =   281 bits (718),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 167/196 (85%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW V + L LL LLFL  DQGRK  ANAE DSD  VDPPKVE+KIG VPHGLSTD DV
Sbjct  1    MRKWTVASALLLLSLLFLFADQGRKFQANAEGDSDELVDPPKVEDKIGAVPHGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
             KRE+ES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDKD+LGEGD  KL+IQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKDVLGEGDNTKLDIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>ref|XP_006601356.1| PREDICTED: endoplasmin homolog isoform X2 [Glycine max]
Length=813

 Score =   281 bits (718),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 167/196 (85%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW V + L LL LLFL  DQGRK  ANAE DSD  VDPPKVE+KIG VPHGLSTD DV
Sbjct  1    MRKWTVASALLLLSLLFLFADQGRKFQANAEGDSDELVDPPKVEDKIGAVPHGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
             KRE+ES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDKD+LGEGD  KL+IQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKDVLGEGDNTKLDIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>ref|XP_003545030.1| PREDICTED: endoplasmin homolog isoform X1 [Glycine max]
 gb|KHN39421.1| Endoplasmin like [Glycine soja]
Length=816

 Score =   280 bits (717),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 167/196 (85%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW V + L LL LLFL  DQGRK  ANAE DSD  VDPPKVE+KIG VPHGLSTD DV
Sbjct  1    MRKWTVASALLLLSLLFLFADQGRKFQANAEGDSDELVDPPKVEDKIGAVPHGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
             KREAES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKREAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK++LGEGD  KL+IQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDNTKLDIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>ref|XP_006596543.1| PREDICTED: endoplasmin homolog isoform X2 [Glycine max]
Length=815

 Score =   280 bits (717),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 167/196 (85%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW V + L LL LLFL  DQGRK  ANAE DSD  VDPPKVE+KIG VPHGLSTD DV
Sbjct  1    MRKWTVASALLLLSLLFLFADQGRKFQANAEGDSDELVDPPKVEDKIGAVPHGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
             KREAES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKREAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK++LGEGD  KL+IQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDNTKLDIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>ref|XP_004291352.1| PREDICTED: endoplasmin homolog [Fragaria vesca subsp. vesca]
Length=815

 Score =   280 bits (716),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 168/196 (86%), Positives = 181/196 (92%), Gaps = 2/196 (1%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW +P+VL LLCLL LLPDQGRK+ ANAE +SD  VDPPKVEEKIG VP+GLSTD DV
Sbjct  1    MRKWTIPSVLLLLCLLSLLPDQGRKLQANAEANSDELVDPPKVEEKIGAVPNGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
            AKREAESMSKR  R  A++FEFQAEVSRLMDIII+SLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESMSKR--RGNAQQFEFQAEVSRLMDIIIHSLYSNKDIFLRELISNASDALDKIR  118

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK+ILGEGD  KLEIQIKLDK+K+ILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  119  FLSLTDKEILGEGDNTKLEIQIKLDKEKRILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  178

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  179  VEKMQTSGDLNLIGQF  194



>ref|XP_002510550.1| endoplasmin, putative [Ricinus communis]
 gb|EEF52737.1| endoplasmin, putative [Ricinus communis]
Length=816

 Score =   278 bits (712),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW +P+ L LLCLL L+ DQGR +HANAE DS  PVDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSALLLLCLLSLISDQGRNLHANAEADSQNPVDPPKVEEKLGAVPNGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
             KRE+ES+SKR+LR+ AEKF+FQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESISKRSLRSDAEKFQFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FL+LTDK++LGEG+  KL+IQIKLDK+KKILSIRD+GIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLALTDKEVLGEGENTKLDIQIKLDKEKKILSIRDKGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>ref|XP_009393849.1| PREDICTED: endoplasmin homolog [Musa acuminata subsp. malaccensis]
Length=815

 Score =   278 bits (711),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 180/198 (91%), Gaps = 2/198 (1%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEV--DSDAPVDPPKVEEKIGGVPHGLSTDP  228
            MRKWA+P+ L LL LL  +PD+GR +HANAE   DSD  VDPPKVEEK+G VP+GLSTD 
Sbjct  1    MRKWALPSALLLLLLLSTVPDRGRNLHANAEDSGDSDELVDPPKVEEKLGAVPNGLSTDA  60

Query  229  DVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK  408
            +VAKREAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK
Sbjct  61   EVAKREAESISRKTLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK  120

Query  409  IRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTS  588
            IRFL+LTDKD+LGEGD  KL+I IKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTS
Sbjct  121  IRFLALTDKDVLGEGDDTKLDILIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTS  180

Query  589  AFVEKMQSSGDLNLIGQF  642
            AFVEKMQ+ GDLNLIGQF
Sbjct  181  AFVEKMQTGGDLNLIGQF  198



>ref|XP_010246858.1| PREDICTED: endoplasmin homolog [Nelumbo nucifera]
Length=821

 Score =   278 bits (710),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 166/196 (85%), Positives = 181/196 (92%), Gaps = 1/196 (1%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW +P+ L LL LL LLPDQG K+HA+AE +S+  VDPPKVEEKIG VP+GLSTD DV
Sbjct  1    MRKWTIPSALLLLLLLSLLPDQGHKLHASAE-ESEELVDPPKVEEKIGAVPNGLSTDSDV  59

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
            AKREAES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  60   AKREAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  119

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK+ILGEGD  KLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  120  FLSLTDKEILGEGDNTKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  179

Query  595  VEKMQSSGDLNLIGQF  642
            +EKMQ+ GDLNLIGQF
Sbjct  180  MEKMQTGGDLNLIGQF  195



>ref|XP_010691883.1| PREDICTED: endoplasmin homolog [Beta vulgaris subsp. vulgaris]
Length=810

 Score =   277 bits (708),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            M+KW + + +FLLC+LFL PDQGR+IHANAE DSD   +PPKVEEK+G VP+GLSTD DV
Sbjct  1    MKKWTLTSAIFLLCILFLFPDQGRRIHANAEGDSDEIANPPKVEEKLGAVPNGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
             KRE+ESMSK+TLR  A+KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESMSKKTLRNSAQKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FL+LTDK++LGEGD AKLEI IKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLALTDKEVLGEGDNAKLEILIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>ref|XP_007225662.1| hypothetical protein PRUPE_ppa001487mg [Prunus persica]
 gb|EMJ26861.1| hypothetical protein PRUPE_ppa001487mg [Prunus persica]
Length=815

 Score =   277 bits (708),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW +P+ L LLCLL LLPDQGRK+ ANAE  S+  VDPPKVE+KIG VP+GLSTD DV
Sbjct  1    MRKWTIPSALLLLCLLSLLPDQGRKLQANAEDSSEELVDPPKVEDKIGAVPNGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
            AKREAES+SKR+LR+ AE+F+FQAEVSRLMDIII+SLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSLRSNAEQFQFQAEVSRLMDIIIHSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FL+LTDK++LGEGD   LEIQIKLDK+K+ILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLALTDKEVLGEGDDTNLEIQIKLDKEKRILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>ref|XP_010069812.1| PREDICTED: endoplasmin homolog [Eucalyptus grandis]
 gb|KCW58281.1| hypothetical protein EUGRSUZ_H00972 [Eucalyptus grandis]
Length=822

 Score =   276 bits (707),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            M KW +P+VL +LCLL  LPDQGRK+ ANAE DS+  VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MGKWTIPSVLLVLCLLCALPDQGRKLRANAEGDSEELVDPPKVEEKLGAVPNGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
             KRE+ES+SKR+LR  AEKFEFQAEVSRLMDI++NSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESISKRSLRNSAEKFEFQAEVSRLMDILVNSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FL+LTDKDILGEGD  KLEIQ+K+DK+K+I+++RDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLALTDKDILGEGDDTKLEIQMKVDKEKRIVTLRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>ref|XP_008221245.1| PREDICTED: endoplasmin homolog [Prunus mume]
Length=815

 Score =   276 bits (705),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW +P+ L LLCLL LLPDQGRK+ ANAE  S+  VDPPKVE+KIG VP+GLSTD DV
Sbjct  1    MRKWTIPSALLLLCLLSLLPDQGRKLQANAEGGSEELVDPPKVEDKIGAVPNGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
            AKREAES+SKR+LR+ AE+F+FQAEVSRLMDIII+SLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSLRSNAEQFQFQAEVSRLMDIIIHSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FL+LTDK++LGEGD   L+IQIKLDK+K+ILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLALTDKEVLGEGDDTNLQIQIKLDKEKRILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>ref|XP_007160650.1| hypothetical protein PHAVU_001G005200g [Phaseolus vulgaris]
 gb|ESW32644.1| hypothetical protein PHAVU_001G005200g [Phaseolus vulgaris]
Length=817

 Score =   275 bits (704),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 166/196 (85%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW V +VL LL LLFL  DQGRK  ANA  DSD  VDPPKVE+KIG VPHGLSTD DV
Sbjct  1    MRKWTVASVLLLLSLLFLFADQGRKFQANAAGDSDELVDPPKVEDKIGAVPHGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
             KREAES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKREAESISKRSLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK++LGEGD  KL+I+IKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDNTKLDIRIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>gb|AAX19870.1| unknown, partial [Doryanthes excelsa]
Length=289

 Score =   261 bits (666),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 164/176 (93%), Gaps = 1/176 (1%)
 Frame = +1

Query  115  DQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKF  294
            DQGRK+ ANAE +S+  VDPPKVEEK+G VP GLSTD DVAKREAES+S++TLR+ AEKF
Sbjct  23   DQGRKLQANAE-ESEELVDPPKVEEKLGAVPGGLSTDSDVAKREAESISRKTLRSSAEKF  81

Query  295  EFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAklei  474
            EFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDK+ILGEGD  KLEI
Sbjct  82   EFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKEILGEGDNTKLEI  141

Query  475  qikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  642
             IKLDK+KKIL+IRDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQ+ GDLNLIGQF
Sbjct  142  LIKLDKEKKILTIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQTGGDLNLIGQF  197



>ref|XP_008444821.1| PREDICTED: endoplasmin homolog [Cucumis melo]
Length=817

 Score =   275 bits (703),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 177/196 (90%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW + + L LLC+L L+PD+G + HA A+ D+D  VDPPKVEEKIG VPHGLSTD DV
Sbjct  1    MRKWTIASALLLLCILSLVPDEGPRFHAKADGDADEVVDPPKVEEKIGAVPHGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
             KRE+ES+SKR+LR+  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESISKRSLRSSGEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK+ILGEGD +KLEIQIKLDK  KILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEILGEGDNSKLEIQIKLDKANKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>ref|XP_010266798.1| PREDICTED: endoplasmin homolog [Nelumbo nucifera]
Length=822

 Score =   275 bits (703),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 178/196 (91%), Gaps = 1/196 (1%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW +P+ L LL LL LLPDQG KIHANAE +S+  VDPPKVEEKIG VP GLSTD DV
Sbjct  1    MRKWMIPSALLLLLLLSLLPDQGHKIHANAE-ESEDLVDPPKVEEKIGAVPKGLSTDSDV  59

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
            A+REAES+SKR+LR+ AEKFEFQAEVSRLMDI++NSLYSNKDIFLRELISNASDALDKIR
Sbjct  60   ARREAESISKRSLRSNAEKFEFQAEVSRLMDILVNSLYSNKDIFLRELISNASDALDKIR  119

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLT+K+ILGEGD  KLEIQI LDK+KK+LSIRDRGIGMT+EDL+KNLGTIAKSGTSAF
Sbjct  120  FLSLTNKEILGEGDNTKLEIQINLDKEKKVLSIRDRGIGMTREDLIKNLGTIAKSGTSAF  179

Query  595  VEKMQSSGDLNLIGQF  642
            VEKM S GDLNLIGQF
Sbjct  180  VEKMHSGGDLNLIGQF  195



>gb|AIZ68158.1| heat shock protein 90 [Ornithogalum saundersiae]
Length=814

 Score =   273 bits (699),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 178/197 (90%), Gaps = 1/197 (1%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAE-VDSDAPVDPPKVEEKIGGVPHGLSTDPD  231
            MRKWA+P+VL LL LL  LPDQGRKIHANAE  D D  VDPPKVEEKIG VP GLSTD D
Sbjct  1    MRKWALPSVLLLLVLLSTLPDQGRKIHANAEESDGDELVDPPKVEEKIGAVPSGLSTDSD  60

Query  232  VAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  411
            VAKREAES+S+++LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI
Sbjct  61   VAKREAESISRKSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  120

Query  412  RFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSA  591
            RFLSLTDK+ILGEGD  KLEI IKLDK+ K+LSIRDRGIGMTKEDL+KNLGTIAKSGTSA
Sbjct  121  RFLSLTDKEILGEGDNTKLEIMIKLDKENKVLSIRDRGIGMTKEDLIKNLGTIAKSGTSA  180

Query  592  FVEKMQSSGDLNLIGQF  642
            FVEKMQ+ GDLNLIGQF
Sbjct  181  FVEKMQTGGDLNLIGQF  197



>gb|KJB63271.1| hypothetical protein B456_010G0030002, partial [Gossypium raimondii]
Length=264

 Score =   258 bits (660),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 178/196 (91%), Gaps = 3/196 (2%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKWA+P+ L LLCLL LL D GRK+  NAE   +  VDPPKVEEKIG VPHGL TD DV
Sbjct  1    MRKWAIPSALVLLCLLSLLSDHGRKVQVNAE---EGAVDPPKVEEKIGAVPHGLQTDSDV  57

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
            AKRE+ES+S R+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  58   AKRESESISSRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  117

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK++LGEGDT+KL+IQIKLDK+KKILS+RDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  118  FLSLTDKEVLGEGDTSKLDIQIKLDKEKKILSLRDRGIGMTKEDLIKNLGTIAKSGTSAF  177

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQSSGDLNLIGQF
Sbjct  178  VEKMQSSGDLNLIGQF  193



>gb|KJB63270.1| hypothetical protein B456_010G0030002, partial [Gossypium raimondii]
Length=260

 Score =   258 bits (659),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 178/196 (91%), Gaps = 3/196 (2%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKWA+P+ L LLCLL LL D GRK+  NAE   +  VDPPKVEEKIG VPHGL TD DV
Sbjct  1    MRKWAIPSALVLLCLLSLLSDHGRKVQVNAE---EGAVDPPKVEEKIGAVPHGLQTDSDV  57

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
            AKRE+ES+S R+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  58   AKRESESISSRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  117

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK++LGEGDT+KL+IQIKLDK+KKILS+RDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  118  FLSLTDKEVLGEGDTSKLDIQIKLDKEKKILSLRDRGIGMTKEDLIKNLGTIAKSGTSAF  177

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQSSGDLNLIGQF
Sbjct  178  VEKMQSSGDLNLIGQF  193



>gb|KJB63272.1| hypothetical protein B456_010G0030002, partial [Gossypium raimondii]
Length=303

 Score =   258 bits (659),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 178/196 (91%), Gaps = 3/196 (2%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKWA+P+ L LLCLL LL D GRK+  NAE   +  VDPPKVEEKIG VPHGL TD DV
Sbjct  1    MRKWAIPSALVLLCLLSLLSDHGRKVQVNAE---EGAVDPPKVEEKIGAVPHGLQTDSDV  57

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
            AKRE+ES+S R+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  58   AKRESESISSRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  117

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK++LGEGDT+KL+IQIKLDK+KKILS+RDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  118  FLSLTDKEVLGEGDTSKLDIQIKLDKEKKILSLRDRGIGMTKEDLIKNLGTIAKSGTSAF  177

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQSSGDLNLIGQF
Sbjct  178  VEKMQSSGDLNLIGQF  193



>ref|XP_010941296.1| PREDICTED: endoplasmin homolog [Elaeis guineensis]
Length=838

 Score =   271 bits (694),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 179/200 (90%), Gaps = 2/200 (1%)
 Frame = +1

Query  49   VTMRKWAVPAVlfllcllfllPDQGRKIHANAEV--DSDAPVDPPKVEEKIGGVPHGLST  222
            + MRKWA+P+ L LL LL   PDQGRK+HANAE   DSD  VDPPKVEEK+G VP GLST
Sbjct  20   IAMRKWALPSALLLLLLLSSFPDQGRKLHANAEDSGDSDELVDPPKVEEKLGAVPGGLST  79

Query  223  DPDVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDAL  402
            D DVAKREAES+S++TL + AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDAL
Sbjct  80   DSDVAKREAESISRKTLGSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDAL  139

Query  403  DKIRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSG  582
            DKIRFLSLT+K+ILGEGD  KLEI IKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSG
Sbjct  140  DKIRFLSLTNKEILGEGDNTKLEILIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSG  199

Query  583  TSAFVEKMQSSGDLNLIGQF  642
            TSAFVEKMQ+ GDLNLIGQF
Sbjct  200  TSAFVEKMQTGGDLNLIGQF  219



>ref|XP_010935079.1| PREDICTED: endoplasmin homolog [Elaeis guineensis]
Length=822

 Score =   270 bits (691),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 165/198 (83%), Positives = 181/198 (91%), Gaps = 2/198 (1%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEV--DSDAPVDPPKVEEKIGGVPHGLSTDP  228
            MRKWA+P+ L LL LL  LPDQGRK+HANAE   DSD  VDPPKVEEK+G VP GLSTDP
Sbjct  1    MRKWALPSALLLLLLLSFLPDQGRKLHANAEDSGDSDELVDPPKVEEKLGAVPGGLSTDP  60

Query  229  DVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK  408
            DVAKREAES+S++TLR+ AEKFEFQAEVSRL+DIIINSLYSNKDIFLRELISNASDALDK
Sbjct  61   DVAKREAESISRKTLRSNAEKFEFQAEVSRLLDIIINSLYSNKDIFLRELISNASDALDK  120

Query  409  IRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTS  588
            IRFLSLT+KDILGEGD  KLEI +KLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTS
Sbjct  121  IRFLSLTNKDILGEGDNTKLEILMKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTS  180

Query  589  AFVEKMQSSGDLNLIGQF  642
            AF+EKMQ+ GDL+LIGQF
Sbjct  181  AFMEKMQTGGDLSLIGQF  198



>gb|EPS69355.1| hypothetical protein M569_05408 [Genlisea aurea]
Length=815

 Score =   270 bits (691),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 177/196 (90%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW V ++L LLC+L +LPDQGRK   NAE + DA   PPKVEEKIGG+P GLSTD +V
Sbjct  1    MRKWTVTSILLLLCILLVLPDQGRKARVNAESEKDAATGPPKVEEKIGGIPSGLSTDSEV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
             KREAES+S R LRA AEKF+FQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKREAESISGRNLRAEAEKFQFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK++LGEG+ AKL+IQIKLDKDKKILS+RDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGENAKLDIQIKLDKDKKILSLRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>ref|XP_006657350.1| PREDICTED: endoplasmin homolog [Oryza brachyantha]
Length=810

 Score =   269 bits (688),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKWA+ + L LL LL  LPD  +K+  NA+  +D  VDPPKVEE+IG VPHGLSTD +V
Sbjct  1    MRKWALASALLLLFLLTTLPDPAKKLQVNADDSADELVDPPKVEERIGAVPHGLSTDSEV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
            A+REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FL+LTDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLALTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>ref|NP_194150.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
 sp|Q9STX5.1|ENPL_ARATH RecName: Full=Endoplasmin homolog; AltName: Full=Glucose-regulated 
protein 94 homolog; Short=GRP-94 homolog; AltName: Full=HSP90-like 
protein 7; AltName: Full=Protein SHEPHERD; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB45054.1| HSP90-like protein [Arabidopsis thaliana]
 emb|CAB79329.1| HSP90-like protein [Arabidopsis thaliana]
 gb|AAK63999.1| AT4g24190/T22A6_20 [Arabidopsis thaliana]
 dbj|BAB86369.1| SHEPHERD [Arabidopsis thaliana]
 gb|AAO42773.1| At4g24190/T22A6_20 [Arabidopsis thaliana]
 gb|AEE84861.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
Length=823

 Score =   270 bits (689),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 165/178 (93%), Gaps = 3/178 (2%)
 Frame = +1

Query  112  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHG-LSTDPDVAKREAESMSKRTLRAGAE  288
            PDQGRK+HANAE  SD   DPPKVEEKIGG  HG LSTD DV  RE+ESMSK+TLR+ AE
Sbjct  20   PDQGRKLHANAEESSDDVTDPPKVEEKIGG--HGGLSTDSDVVHRESESMSKKTLRSNAE  77

Query  289  KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkl  468
            KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKL
Sbjct  78   KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKL  137

Query  469  eiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  642
            EIQIKLDK KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQSSGDLNLIGQF
Sbjct  138  EIQIKLDKAKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  195



>dbj|BAB86368.1| SHEPHERD [Arabidopsis thaliana]
Length=823

 Score =   270 bits (689),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 165/178 (93%), Gaps = 3/178 (2%)
 Frame = +1

Query  112  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHG-LSTDPDVAKREAESMSKRTLRAGAE  288
            PDQGRK+HANAE  SD   DPPKVEEKIGG  HG LSTD DV  RE+ESMSK+TLR+ AE
Sbjct  20   PDQGRKLHANAEESSDDVTDPPKVEEKIGG--HGGLSTDSDVVHRESESMSKKTLRSNAE  77

Query  289  KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkl  468
            KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKL
Sbjct  78   KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKL  137

Query  469  eiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  642
            EIQIKLDK KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQSSGDLNLIGQF
Sbjct  138  EIQIKLDKAKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  195



>ref|XP_010439073.1| PREDICTED: endoplasmin homolog [Camelina sativa]
Length=823

 Score =   269 bits (688),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 165/178 (93%), Gaps = 3/178 (2%)
 Frame = +1

Query  112  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHG-LSTDPDVAKREAESMSKRTLRAGAE  288
            PDQGRK+HANAE  SD   DPPKVEEKIGG  HG LSTD DV  RE+ESMSK+TLR+ AE
Sbjct  20   PDQGRKLHANAEDSSDEVTDPPKVEEKIGG--HGGLSTDSDVVHRESESMSKKTLRSSAE  77

Query  289  KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkl  468
            KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKL
Sbjct  78   KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKL  137

Query  469  eiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  642
            EIQIKLDK KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQSSGDLNLIGQF
Sbjct  138  EIQIKLDKAKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  195



>ref|XP_002439030.1| hypothetical protein SORBIDRAFT_10g030240 [Sorghum bicolor]
 gb|EER90397.1| hypothetical protein SORBIDRAFT_10g030240 [Sorghum bicolor]
Length=807

 Score =   269 bits (687),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 177/196 (90%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKWA+ + L LL LL  LPD  +K+  NAE  SD   +PPKVEEK+G VPHGLSTD DV
Sbjct  1    MRKWALSSALLLLFLLTTLPDPAKKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
            A+REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDI+LRELISNASDALDKIR
Sbjct  61   AQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIYLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQS GDLNLIGQF
Sbjct  181  VEKMQSGGDLNLIGQF  196



>ref|XP_002867677.1| hypothetical protein ARALYDRAFT_492441 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43936.1| hypothetical protein ARALYDRAFT_492441 [Arabidopsis lyrata subsp. 
lyrata]
Length=823

 Score =   269 bits (688),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 165/178 (93%), Gaps = 3/178 (2%)
 Frame = +1

Query  112  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHG-LSTDPDVAKREAESMSKRTLRAGAE  288
            PDQGRK+HANAE  SD   DPPKVEEKIGG  HG LSTD DV  RE+ESMSK+TLR+ AE
Sbjct  20   PDQGRKLHANAEDSSDEVTDPPKVEEKIGG--HGGLSTDSDVVHRESESMSKKTLRSNAE  77

Query  289  KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkl  468
            KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKL
Sbjct  78   KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKL  137

Query  469  eiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  642
            EIQIKLDK KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQSSGDLNLIGQF
Sbjct  138  EIQIKLDKAKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  195



>ref|XP_008808636.1| PREDICTED: endoplasmin homolog [Phoenix dactylifera]
Length=817

 Score =   269 bits (688),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 178/198 (90%), Gaps = 2/198 (1%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEV--DSDAPVDPPKVEEKIGGVPHGLSTDP  228
            MRKWA+P+ L LL LL   PDQGRK+HANAE   D+D   DPPKVEEK+G VP GLSTD 
Sbjct  1    MRKWALPSALLLLLLLSSFPDQGRKLHANAEDSGDADELADPPKVEEKLGAVPGGLSTDS  60

Query  229  DVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK  408
            DVAKREAES+S++TLR+ AEKF+FQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK
Sbjct  61   DVAKREAESISRKTLRSNAEKFDFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK  120

Query  409  IRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTS  588
            IRFLSLT+K+ILGEGD  KLEI IKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTS
Sbjct  121  IRFLSLTNKEILGEGDNTKLEILIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTS  180

Query  589  AFVEKMQSSGDLNLIGQF  642
            AFVEKMQ+ GDLNLIGQF
Sbjct  181  AFVEKMQTGGDLNLIGQF  198



>gb|AFW75766.1| hypothetical protein ZEAMMB73_790349 [Zea mays]
Length=710

 Score =   267 bits (682),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 175/196 (89%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKWA+ + L LL LL  LPD  +K+  NAE  S    +PPKVEEK G VPHGLSTD +V
Sbjct  1    MRKWALSSTLLLLFLLTTLPDPAKKLQVNAEESSHDLANPPKVEEKFGAVPHGLSTDSEV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
            A+REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQS GDLNLIGQF
Sbjct  181  VEKMQSGGDLNLIGQF  196



>ref|XP_010433803.1| PREDICTED: endoplasmin homolog [Camelina sativa]
Length=823

 Score =   269 bits (687),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 165/178 (93%), Gaps = 3/178 (2%)
 Frame = +1

Query  112  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHG-LSTDPDVAKREAESMSKRTLRAGAE  288
            PDQGRK+HANAE  SD   DPPKVEEKIGG  HG LSTD DV  RE+ESMSK+TLR+ AE
Sbjct  20   PDQGRKLHANAEDSSDEVTDPPKVEEKIGG--HGGLSTDSDVVHRESESMSKKTLRSSAE  77

Query  289  KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkl  468
            KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKL
Sbjct  78   KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKL  137

Query  469  eiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  642
            EIQIKLDK KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQSSGDLNLIGQF
Sbjct  138  EIQIKLDKAKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  195



>ref|XP_004966467.1| PREDICTED: endoplasmin homolog [Setaria italica]
Length=807

 Score =   268 bits (686),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 177/196 (90%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKWA+ + L LL LL  LPD  +K+  NAE  SD   +PPKVEEK+G VPHGLSTD +V
Sbjct  1    MRKWALSSALLLLFLLTTLPDPAKKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDAEV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
            A+REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQS GDLNLIGQF
Sbjct  181  VEKMQSGGDLNLIGQF  196



>ref|XP_006283118.1| hypothetical protein CARUB_v10004140mg [Capsella rubella]
 gb|EOA16016.1| hypothetical protein CARUB_v10004140mg [Capsella rubella]
Length=823

 Score =   269 bits (687),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = +1

Query  112  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEK  291
            PDQGRK+HANAE  SD   DPPKVEEKIGG   GLSTD DV  RE+ESMSK+TLR+ AEK
Sbjct  20   PDQGRKLHANAEDSSDEVTDPPKVEEKIGG-HGGLSTDSDVVHRESESMSKKTLRSSAEK  78

Query  292  FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkle  471
            FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKLE
Sbjct  79   FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKLE  138

Query  472  iqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  642
            IQIKLDK KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQSSGDLNLIGQF
Sbjct  139  IQIKLDKAKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  195



>ref|NP_001151475.1| endoplasmin precursor [Zea mays]
 gb|ACG42989.1| endoplasmin precursor [Zea mays]
Length=807

 Score =   268 bits (686),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 177/196 (90%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKWA+ + L LL LL  LPD  +K+  NAE  SD   +PPKVEEK+G VPHGLSTD +V
Sbjct  1    MRKWALSSALLLLFLLTTLPDPAKKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSEV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
            A+REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQS GDLNLIGQF
Sbjct  181  VEKMQSGGDLNLIGQF  196



>gb|AFW75767.1| endoplasmin [Zea mays]
Length=804

 Score =   268 bits (684),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 175/196 (89%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKWA+ + L LL LL  LPD  +K+  NAE  S    +PPKVEEK G VPHGLSTD +V
Sbjct  1    MRKWALSSTLLLLFLLTTLPDPAKKLQVNAEESSHDLANPPKVEEKFGAVPHGLSTDSEV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
            A+REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQS GDLNLIGQF
Sbjct  181  VEKMQSGGDLNLIGQF  196



>gb|AAN34791.1| Grp94 [Xerophyta viscosa]
Length=812

 Score =   267 bits (683),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 175/200 (88%), Gaps = 4/200 (2%)
 Frame = +1

Query  55   MRKWAVP--AVlfllcllfllPDQGRKIHANAEV--DSDAPVDPPKVEEKIGGVPHGLST  222
            MR W++P   VL LL  L  +PD GRK+HANAE   D+D  VDPPKVEEKI GV  GLST
Sbjct  1    MRNWSIPPALVLLLLISLSAIPDGGRKLHANAEESRDADELVDPPKVEEKIAGVHGGLST  60

Query  223  DPDVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDAL  402
            D DVAKREAESMS++ LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDAL
Sbjct  61   DADVAKREAESMSRKNLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDAL  120

Query  403  DKIRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSG  582
            DKIRFLSLTDK++LGEGD  KLEI IKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSG
Sbjct  121  DKIRFLSLTDKEVLGEGDNTKLEIMIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSG  180

Query  583  TSAFVEKMQSSGDLNLIGQF  642
            TSAFVEKMQ+ GDLNLIGQF
Sbjct  181  TSAFVEKMQTGGDLNLIGQF  200



>ref|NP_974606.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
 gb|AEE84862.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
Length=823

 Score =   266 bits (681),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 164/178 (92%), Gaps = 3/178 (2%)
 Frame = +1

Query  112  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHG-LSTDPDVAKREAESMSKRTLRAGAE  288
            PDQG K+HANAE  SD   DPPKVEEKIGG  HG LSTD DV  RE+ESMSK+TLR+ AE
Sbjct  20   PDQGTKLHANAEESSDDVTDPPKVEEKIGG--HGGLSTDSDVVHRESESMSKKTLRSNAE  77

Query  289  KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkl  468
            KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKL
Sbjct  78   KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKL  137

Query  469  eiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  642
            EIQIKLDK KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQSSGDLNLIGQF
Sbjct  138  EIQIKLDKAKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  195



>ref|XP_008643502.1| PREDICTED: shepherd-like1 isoform X1 [Zea mays]
 gb|AFW69514.1| hypothetical protein ZEAMMB73_665489 [Zea mays]
Length=808

 Score =   266 bits (680),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKWA+ + L LL LL  LPD  +K+  NAE  SD   +PPKVEEK+G VPHGLSTD +V
Sbjct  1    MRKWALSSALLLLFLLTTLPDPAKKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSEV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
            A+REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGMTKEDL+ NLGTIAKSGTSAF
Sbjct  121  FLSLTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMTKEDLINNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQS GDLNLIGQF
Sbjct  181  VEKMQSGGDLNLIGQF  196



>ref|NP_001058590.1| Os06g0716700 [Oryza sativa Japonica Group]
 dbj|BAF20504.1| Os06g0716700 [Oryza sativa Japonica Group]
Length=810

 Score =   266 bits (679),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 177/196 (90%), Gaps = 1/196 (1%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKWA+ +   LL LL  LPD  +K+  NA+  +D  VDPPKVEEKIGGVPHGLSTD +V
Sbjct  1    MRKWAL-SSALLLLLLTTLPDPAKKLQVNADDSTDELVDPPKVEEKIGGVPHGLSTDSEV  59

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
             +REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  60   VQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  119

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FL+LTDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  120  FLALTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  179

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+ GDLNLIGQF
Sbjct  180  VEKMQTGGDLNLIGQF  195



>ref|XP_006413464.1| hypothetical protein EUTSA_v10024414mg [Eutrema salsugineum]
 gb|ESQ54917.1| hypothetical protein EUTSA_v10024414mg [Eutrema salsugineum]
Length=822

 Score =   266 bits (679),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 179/197 (91%), Gaps = 3/197 (2%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHG-LSTDPD  231
            MRK  + +VLFL  LLFLLPDQGRK+HANAE  SD   DPPKVEEK+GG  HG LSTD D
Sbjct  1    MRKRTIVSVLFLFSLLFLLPDQGRKLHANAEDSSDEVTDPPKVEEKLGG--HGGLSTDSD  58

Query  232  VAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  411
            V  RE+ES+SK++LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI
Sbjct  59   VVHRESESISKKSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  118

Query  412  RFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSA  591
            RFL+LTDKD+LGEGDTAKLEIQIKLDK KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSA
Sbjct  119  RFLALTDKDVLGEGDTAKLEIQIKLDKAKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSA  178

Query  592  FVEKMQSSGDLNLIGQF  642
            FVEKMQSSGDLNLIGQF
Sbjct  179  FVEKMQSSGDLNLIGQF  195



>emb|CDY10992.1| BnaA03g46510D [Brassica napus]
Length=871

 Score =   266 bits (680),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = +1

Query  112  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEK  291
            PDQGRK+HANAE  SD   DPPKVEEK+GG   GLSTD DV  RE+ES+SK++LR+ AEK
Sbjct  20   PDQGRKLHANAEDSSDEVTDPPKVEEKLGG-HSGLSTDSDVVHRESESISKKSLRSNAEK  78

Query  292  FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkle  471
            FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKLE
Sbjct  79   FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKLE  138

Query  472  iqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  642
            IQIKLDK KKI+SIRDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQSSGDLNLIGQF
Sbjct  139  IQIKLDKAKKIISIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  195



>gb|AAL79732.1|AC091774_23 heat shock protein 90 [Oryza sativa Japonica Group]
 dbj|BAD53585.1| heat shock protein 90 [Oryza sativa Japonica Group]
 dbj|BAD61715.1| heat shock protein 90 [Oryza sativa Japonica Group]
 gb|ADR66979.1| 90 kDa heat shock protein [Oryza sativa Japonica Group]
Length=812

 Score =   265 bits (677),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 159/197 (81%), Positives = 177/197 (90%), Gaps = 1/197 (1%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfll-PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPD  231
            MRKWA+ + L LL LL    PD  +K+  NA+  +D  VDPPKVEEKIGGVPHGLSTD +
Sbjct  1    MRKWALSSALLLLLLLLTTLPDPAKKLQVNADDSTDELVDPPKVEEKIGGVPHGLSTDSE  60

Query  232  VAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  411
            V +REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI
Sbjct  61   VVQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  120

Query  412  RFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSA  591
            RFL+LTDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSA
Sbjct  121  RFLALTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSA  180

Query  592  FVEKMQSSGDLNLIGQF  642
            FVEKMQ+ GDLNLIGQF
Sbjct  181  FVEKMQTGGDLNLIGQF  197



>gb|KJB14398.1| hypothetical protein B456_002G122800 [Gossypium raimondii]
Length=739

 Score =   264 bits (674),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 176/196 (90%), Gaps = 3/196 (2%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            M KW +P+ L LLCLL LL DQGRK+ ANA+   +  VDPPKVE+ IG VPHGL TD DV
Sbjct  1    MGKWTIPSALILLCLLSLLSDQGRKLQANAK---EGAVDPPKVEDNIGAVPHGLQTDSDV  57

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
             KRE++S+S R+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  58   VKRESDSISSRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  117

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK++LGEGDT+KLEIQIKLDK+KK+LS+RDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  118  FLSLTDKEVLGEGDTSKLEIQIKLDKEKKMLSLRDRGIGMTKEDLIKNLGTIAKSGTSAF  177

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQS+GDLNLIGQF
Sbjct  178  VEKMQSTGDLNLIGQF  193



>gb|KFK29085.1| hypothetical protein AALP_AA7G086900 [Arabis alpina]
Length=823

 Score =   265 bits (678),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 166/196 (85%), Positives = 179/196 (91%), Gaps = 1/196 (1%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRK  + +VLFL+CL+FLLPDQGRK+HANAE  ++   DPPKVEEK+GG   GLSTD DV
Sbjct  1    MRKKTIVSVLFLVCLVFLLPDQGRKLHANAEGSTEEYSDPPKVEEKLGG-HGGLSTDSDV  59

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
              RE+ESMSKR+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  60   VHRESESMSKRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  119

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FL+LTDKD+LGEGDTAKLEIQIKLDK KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  120  FLALTDKDVLGEGDTAKLEIQIKLDKAKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  179

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQSSGDLNLIGQF
Sbjct  180  VEKMQSSGDLNLIGQF  195



>ref|XP_010448597.1| PREDICTED: endoplasmin homolog [Camelina sativa]
Length=823

 Score =   265 bits (676),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 164/178 (92%), Gaps = 3/178 (2%)
 Frame = +1

Query  112  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHG-LSTDPDVAKREAESMSKRTLRAGAE  288
            PDQGRK+HANAE  SD   DPPKVEE IGG  HG LSTD DV  RE+ES+SK+TLR+ AE
Sbjct  20   PDQGRKLHANAEDSSDEVTDPPKVEEPIGG--HGGLSTDSDVVHRESESISKKTLRSSAE  77

Query  289  KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkl  468
            KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKL
Sbjct  78   KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKL  137

Query  469  eiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  642
            EIQIKLDK KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQSSGDLNLIGQF
Sbjct  138  EIQIKLDKAKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  195



>ref|XP_009137776.1| PREDICTED: endoplasmin homolog [Brassica rapa]
Length=822

 Score =   264 bits (675),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 165/178 (93%), Gaps = 3/178 (2%)
 Frame = +1

Query  112  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHG-LSTDPDVAKREAESMSKRTLRAGAE  288
            PDQGRK+HANAE  SD   DPPKVEEK+GG  HG LSTD DV  RE+ES+SK++LR+ AE
Sbjct  20   PDQGRKLHANAEDSSDEVSDPPKVEEKLGG--HGGLSTDSDVVHRESESISKKSLRSNAE  77

Query  289  KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkl  468
            KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKL
Sbjct  78   KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKL  137

Query  469  eiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  642
            EIQIKLDK KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQSSGDLNLIGQF
Sbjct  138  EIQIKLDKAKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  195



>emb|CDY24830.1| BnaA08g14800D [Brassica napus]
Length=819

 Score =   264 bits (675),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 177/196 (90%), Gaps = 1/196 (1%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRK  + +V+FL  LLFLLP+QGRK+HANAE  SD   DPPKVEEK+GG   GLSTD DV
Sbjct  1    MRKKTIVSVMFLFSLLFLLPEQGRKLHANAEESSDDVTDPPKVEEKLGG-HGGLSTDSDV  59

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
              R +ES+SK++LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  60   VHRSSESISKKSLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  119

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FL+LTDKD+LGEGDTAKLEIQIKLDK KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  120  FLALTDKDVLGEGDTAKLEIQIKLDKAKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  179

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQSSGDLNLIGQF
Sbjct  180  VEKMQSSGDLNLIGQF  195



>emb|CDY34264.1| BnaA01g13670D [Brassica napus]
Length=822

 Score =   264 bits (674),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 165/178 (93%), Gaps = 3/178 (2%)
 Frame = +1

Query  112  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHG-LSTDPDVAKREAESMSKRTLRAGAE  288
            PDQGRK+HANAE  SD   DPPKVEEK+GG  HG LSTD DV  RE+ES+SK++LR+ AE
Sbjct  20   PDQGRKLHANAEDSSDEVSDPPKVEEKLGG--HGGLSTDSDVVHRESESISKKSLRSNAE  77

Query  289  KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkl  468
            KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKL
Sbjct  78   KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKL  137

Query  469  eiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  642
            EIQIKLDK KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQSSGDLNLIGQF
Sbjct  138  EIQIKLDKAKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  195



>gb|KJB14397.1| hypothetical protein B456_002G122800 [Gossypium raimondii]
Length=809

 Score =   264 bits (674),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 176/196 (90%), Gaps = 3/196 (2%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            M KW +P+ L LLCLL LL DQGRK+ ANA+   +  VDPPKVE+ IG VPHGL TD DV
Sbjct  1    MGKWTIPSALILLCLLSLLSDQGRKLQANAK---EGAVDPPKVEDNIGAVPHGLQTDSDV  57

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
             KRE++S+S R+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  58   VKRESDSISSRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  117

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK++LGEGDT+KLEIQIKLDK+KK+LS+RDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  118  FLSLTDKEVLGEGDTSKLEIQIKLDKEKKMLSLRDRGIGMTKEDLIKNLGTIAKSGTSAF  177

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQS+GDLNLIGQF
Sbjct  178  VEKMQSTGDLNLIGQF  193



>dbj|BAA90487.1| heat shock protein 90 [Oryza sativa]
Length=810

 Score =   263 bits (673),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 177/196 (90%), Gaps = 1/196 (1%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKWA+ +   LL LL  LPD  +K+  NA+  +D  VDPPKVEEKIGGVPHGLSTD +V
Sbjct  1    MRKWAL-SSALLLLLLTTLPDPAKKLQVNADDSTDELVDPPKVEEKIGGVPHGLSTDSEV  59

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
             +REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  60   VQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  119

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FL+LTDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  120  FLALTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  179

Query  595  VEKMQSSGDLNLIGQF  642
            VEK+Q+ GDLNLIGQF
Sbjct  180  VEKVQTGGDLNLIGQF  195



>ref|XP_008788614.1| PREDICTED: endoplasmin homolog [Phoenix dactylifera]
Length=822

 Score =   263 bits (672),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 179/198 (90%), Gaps = 2/198 (1%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEV--DSDAPVDPPKVEEKIGGVPHGLSTDP  228
            MRKWA+P+ L LL LL  LPDQGRK+HANAE   DSD  VDPPKVEEK+G VP GLSTD 
Sbjct  1    MRKWALPSALLLLLLLSSLPDQGRKLHANAEDSGDSDELVDPPKVEEKLGAVPGGLSTDS  60

Query  229  DVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK  408
            DVAKREAES+S++++R+  EKFEFQAEVSRL+DIIINSLYSNKDIFLRELISNASDALDK
Sbjct  61   DVAKREAESISRKSMRSDGEKFEFQAEVSRLLDIIINSLYSNKDIFLRELISNASDALDK  120

Query  409  IRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTS  588
            IRFLSLT+K+ILGEGD  KLEI IKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTS
Sbjct  121  IRFLSLTNKEILGEGDNTKLEILIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTS  180

Query  589  AFVEKMQSSGDLNLIGQF  642
            AF+EKMQ+ GDLNLIGQF
Sbjct  181  AFMEKMQTGGDLNLIGQF  198



>sp|P36183.1|ENPL_HORVU RecName: Full=Endoplasmin homolog; AltName: Full=Glucose-regulated 
protein 94 homolog; Short=GRP-94 homolog; Flags: Precursor 
[Hordeum vulgare]
 emb|CAA48143.1| GRP94 homologue [Hordeum vulgare]
 dbj|BAJ91793.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=809

 Score =   262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 172/196 (88%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKWA+   L L+ LL  LPD  +K+  NAE  SD   D PKVEEK+G VPHGLSTD +V
Sbjct  1    MRKWALSCALLLVLLLTTLPDPAKKLQVNAEESSDEVGDFPKVEEKLGAVPHGLSTDSEV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
             +RE+ES+S++TLR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VQRESESISRKTLRNSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FL+LTDK+++GEGDTAKLEIQIKLDK+ KILSIRDRG+GMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLALTDKEVMGEGDTAKLEIQIKLDKENKILSIRDRGVGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+ GDLNLIGQF
Sbjct  181  VEKMQTGGDLNLIGQF  196



>emb|CDY03477.1| BnaC01g16050D [Brassica napus]
Length=822

 Score =   262 bits (669),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 164/178 (92%), Gaps = 3/178 (2%)
 Frame = +1

Query  112  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHG-LSTDPDVAKREAESMSKRTLRAGAE  288
            PDQGRK+HANAE  SD   DPPKVEEK+GG  HG LSTD DV  RE+ES+SK++LR+ AE
Sbjct  20   PDQGRKLHANAEDSSDEVSDPPKVEEKLGG--HGGLSTDSDVVHRESESISKKSLRSNAE  77

Query  289  KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkl  468
            KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGD AKL
Sbjct  78   KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDNAKL  137

Query  469  eiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  642
            EIQIKLDK KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQSSGDLNLIGQF
Sbjct  138  EIQIKLDKAKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  195



>gb|KJB63501.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
Length=823

 Score =   262 bits (669),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 165/197 (84%), Positives = 179/197 (91%), Gaps = 3/197 (2%)
 Frame = +1

Query  52   TMRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPD  231
            TMRKWA+P+ L LLCLL LL D GRK+ ANAE   +  VDPPKVEEKIG VPHGL TD D
Sbjct  19   TMRKWAIPSALVLLCLLSLLSDHGRKVQANAE---EGAVDPPKVEEKIGAVPHGLQTDSD  75

Query  232  VAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  411
            V KRE+ES+S R+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI
Sbjct  76   VVKRESESISSRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  135

Query  412  RFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSA  591
            RFLSLTDK++LGEGDT+KL+IQIKLDK+KKILS+RDRGIGMTKEDL+KNLGTIAKSGTSA
Sbjct  136  RFLSLTDKEVLGEGDTSKLDIQIKLDKEKKILSLRDRGIGMTKEDLIKNLGTIAKSGTSA  195

Query  592  FVEKMQSSGDLNLIGQF  642
            FVEKMQSSGDLNLIGQF
Sbjct  196  FVEKMQSSGDLNLIGQF  212



>emb|CDX92620.1| BnaC07g38780D [Brassica napus]
Length=792

 Score =   261 bits (666),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 164/178 (92%), Gaps = 3/178 (2%)
 Frame = +1

Query  112  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHG-LSTDPDVAKREAESMSKRTLRAGAE  288
            PDQGRK+HA+AE  +D   DPPKVEEK+GG  HG LSTD DV  RE+ES+SK++LR+ AE
Sbjct  20   PDQGRKLHASAEDSTDEVTDPPKVEEKLGG--HGGLSTDSDVVHRESESISKKSLRSNAE  77

Query  289  KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkl  468
            KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKL
Sbjct  78   KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKL  137

Query  469  eiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  642
            EIQIKLDK KKIL IRDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQSSGDLNLIGQF
Sbjct  138  EIQIKLDKAKKILCIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  195



>gb|KHG17445.1| Endoplasmin [Gossypium arboreum]
Length=812

 Score =   261 bits (666),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 175/196 (89%), Gaps = 3/196 (2%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            M  W +P+ L LLCLL LL DQGRK+ ANA+   +  VDPPKVE+ IG VPHGL TD DV
Sbjct  1    MGNWTIPSALILLCLLSLLSDQGRKLQANAK---EGAVDPPKVEDNIGAVPHGLQTDSDV  57

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
             KRE++S+S R+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  58   VKRESDSISSRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  117

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK++LGEGDT+KLEIQIKLDK+KK+LS+RDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  118  FLSLTDKEVLGEGDTSKLEIQIKLDKEKKMLSLRDRGIGMTKEDLIKNLGTIAKSGTSAF  177

Query  595  VEKMQSSGDLNLIGQF  642
            VE+MQS+GDLNLIGQF
Sbjct  178  VERMQSTGDLNLIGQF  193



>gb|EAZ38293.1| hypothetical protein OsJ_22671 [Oryza sativa Japonica Group]
Length=838

 Score =   260 bits (665),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = +1

Query  121  GRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEF  300
             +K+  NA+  +D  VDPPKVEEKIGGVPHGLSTD +V +REAES+S++TLR+ AEKFEF
Sbjct  50   AKKLQVNADDSTDELVDPPKVEEKIGGVPHGLSTDSEVVQREAESISRKTLRSSAEKFEF  109

Query  301  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqi  480
            QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDK++LGEGDTAKLEIQI
Sbjct  110  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKEVLGEGDTAKLEIQI  169

Query  481  kldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  642
            KLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQ+ GDLNLIGQF
Sbjct  170  KLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQTGGDLNLIGQF  223



>gb|EAZ02369.1| hypothetical protein OsI_24473 [Oryza sativa Indica Group]
Length=837

 Score =   260 bits (664),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = +1

Query  121  GRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEF  300
             +K+  NA+  +D  VDPPKVEEKIGGVPHGLSTD +V +REAES+S++TLR+ AEKFEF
Sbjct  49   AKKLQVNADDSTDELVDPPKVEEKIGGVPHGLSTDSEVVQREAESISRKTLRSSAEKFEF  108

Query  301  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqi  480
            QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDK++LGEGDTAKLEIQI
Sbjct  109  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKEVLGEGDTAKLEIQI  168

Query  481  kldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  642
            KLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQ+ GDLNLIGQF
Sbjct  169  KLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQTGGDLNLIGQF  222



>ref|XP_006851911.1| hypothetical protein AMTR_s00041p00161550 [Amborella trichopoda]
 gb|ERN13378.1| hypothetical protein AMTR_s00041p00161550 [Amborella trichopoda]
Length=818

 Score =   259 bits (663),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 175/198 (88%), Gaps = 2/198 (1%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAP--VDPPKVEEKIGGVPHGLSTDP  228
            MRK A+ + +FL+ LL LLP QGR + ANAE ++ A   VDPPKVEEKIG +P  LSTD 
Sbjct  1    MRKGAMTSAIFLVFLLALLPYQGRHLQANAEENNGAEGLVDPPKVEEKIGAIPDALSTDS  60

Query  229  DVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK  408
            DVAKREAESMS+++LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK
Sbjct  61   DVAKREAESMSRKSLRGNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK  120

Query  409  IRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTS  588
            IRFLSLTDK+ILGEGD  KLEI IKLDK+KK+LSIRDRGIGMTKEDL+KNLGTIAKSGTS
Sbjct  121  IRFLSLTDKEILGEGDNTKLEILIKLDKEKKVLSIRDRGIGMTKEDLIKNLGTIAKSGTS  180

Query  589  AFVEKMQSSGDLNLIGQF  642
            AFVEKMQ+ GDLNLIGQF
Sbjct  181  AFVEKMQTGGDLNLIGQF  198



>ref|XP_004152644.1| PREDICTED: endoplasmin homolog [Cucumis sativus]
 ref|XP_004162237.1| PREDICTED: endoplasmin homolog [Cucumis sativus]
 gb|KGN62687.1| hypothetical protein Csa_2G368880 [Cucumis sativus]
Length=817

 Score =   259 bits (662),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKW + + L LLC+L L+PD+G + HA A+VD+D  VDPPKVEEKIG VPHGLSTD DV
Sbjct  1    MRKWTIASALLLLCILSLVPDEGPRFHAKADVDADEVVDPPKVEEKIGAVPHGLSTDSDV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
             KRE+ES+S+R+LR+  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESISRRSLRSSGEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK+ILGEGD +KLEIQIKLDK  KILSIRDRGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLSLTDKEILGEGDNSKLEIQIKLDKANKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+SGDLNLIGQF
Sbjct  181  VEKMQTSGDLNLIGQF  196



>ref|XP_003563275.1| PREDICTED: endoplasmin homolog [Brachypodium distachyon]
Length=807

 Score =   258 bits (658),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 153/197 (78%), Positives = 171/197 (87%), Gaps = 1/197 (1%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfl-lPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPD  231
            MRKWA+ + L L+ LL    PD  +++  NAE  SD   D PKVEEK+G VPHGLSTD +
Sbjct  1    MRKWALSSALLLVFLLATLSPDPAKRLQVNAEESSDELADLPKVEEKLGAVPHGLSTDSE  60

Query  232  VAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  411
            V KRE+ES+S++TLR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI
Sbjct  61   VVKRESESISRKTLRNSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  120

Query  412  RFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSA  591
            RFL LTDK++LGEGDTAKLEIQIKLDK+ KILSIRDRG+GMTKEDL+KNLGTIAKSGTSA
Sbjct  121  RFLGLTDKEVLGEGDTAKLEIQIKLDKENKILSIRDRGVGMTKEDLIKNLGTIAKSGTSA  180

Query  592  FVEKMQSSGDLNLIGQF  642
            FVEKMQ+ GDLNLIGQF
Sbjct  181  FVEKMQTGGDLNLIGQF  197



>gb|ABV82432.1| Hsp90-like protein [Dactylis glomerata]
Length=808

 Score =   257 bits (656),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 173/196 (88%), Gaps = 0/196 (0%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MR+WA+ + L L+ LL  LPD  +++  NAE  SD   D PKVEEK+G VPHGLSTD +V
Sbjct  1    MRRWALSSALLLVLLLTTLPDPAKRLQVNAEESSDELTDLPKVEEKLGAVPHGLSTDSEV  60

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
             +RE+ES+S++TLR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VQRESESISRKTLRNSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FL+LT+K++LGEGDTAKLEIQIKLDK+ KILSIRDRG+GMTKEDL+KNLGTIAKSGTSAF
Sbjct  121  FLALTEKEVLGEGDTAKLEIQIKLDKENKILSIRDRGVGMTKEDLIKNLGTIAKSGTSAF  180

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQ+ GDLNLIGQF
Sbjct  181  VEKMQTGGDLNLIGQF  196



>gb|AFW69515.1| hypothetical protein ZEAMMB73_665489 [Zea mays]
Length=1001

 Score =   257 bits (657),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = +1

Query  121  GRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEF  300
             +K+  NAE  SD   +PPKVEEK+G VPHGLSTD +VA+REAES+S++TLR+ AEKFEF
Sbjct  216  AKKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSEVAQREAESISRKTLRSSAEKFEF  275

Query  301  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqi  480
            QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGDTAKLEIQI
Sbjct  276  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTAKLEIQI  335

Query  481  kldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  642
            KLDK+KKILSIRDRGIGMTKEDL+ NLGTIAKSGTSAFVEKMQS GDLNLIGQF
Sbjct  336  KLDKEKKILSIRDRGIGMTKEDLINNLGTIAKSGTSAFVEKMQSGGDLNLIGQF  389



>ref|XP_007017829.1| Chaperone protein htpG family protein isoform 2 [Theobroma cacao]
 gb|EOY15054.1| Chaperone protein htpG family protein isoform 2 [Theobroma cacao]
Length=824

 Score =   253 bits (647),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 181/196 (92%), Gaps = 3/196 (2%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKWA+P+ L LLCLL LL DQGRK+HANA+   +  VDPPKVEEKIG VP+GL TD DV
Sbjct  1    MRKWAIPSALILLCLLSLLSDQGRKVHANAD---EGAVDPPKVEEKIGAVPNGLQTDSDV  57

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
             KRE+ES+S R+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  58   VKRESESISSRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  117

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK++LGEGDTAKLEIQIKLDK+KKIL++RDRGIGMTKEDL+K+LGTIAKSGTSAF
Sbjct  118  FLSLTDKEVLGEGDTAKLEIQIKLDKEKKILTLRDRGIGMTKEDLIKHLGTIAKSGTSAF  177

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQSSGDLNLIGQF
Sbjct  178  VEKMQSSGDLNLIGQF  193



>ref|XP_007017828.1| Chaperone protein htpG family protein isoform 1 [Theobroma cacao]
 gb|EOY15053.1| Chaperone protein htpG family protein isoform 1 [Theobroma cacao]
Length=840

 Score =   253 bits (647),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 181/196 (92%), Gaps = 3/196 (2%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRKWA+P+ L LLCLL LL DQGRK+HANA+   +  VDPPKVEEKIG VP+GL TD DV
Sbjct  1    MRKWAIPSALILLCLLSLLSDQGRKVHANAD---EGAVDPPKVEEKIGAVPNGLQTDSDV  57

Query  235  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  414
             KRE+ES+S R+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  58   VKRESESISSRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  117

Query  415  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF  594
            FLSLTDK++LGEGDTAKLEIQIKLDK+KKIL++RDRGIGMTKEDL+K+LGTIAKSGTSAF
Sbjct  118  FLSLTDKEVLGEGDTAKLEIQIKLDKEKKILTLRDRGIGMTKEDLIKHLGTIAKSGTSAF  177

Query  595  VEKMQSSGDLNLIGQF  642
            VEKMQSSGDLNLIGQF
Sbjct  178  VEKMQSSGDLNLIGQF  193



>gb|EMT19498.1| Endoplasmin-like protein [Aegilops tauschii]
Length=1222

 Score =   254 bits (649),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 172/206 (83%), Gaps = 10/206 (5%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGR----------KIHANAEVDSDAPVDPPKVEEKIGGV  204
            MRKWA+   L L+ LL  LPD G+          K+  NAE  SD   D PKVEEK+G V
Sbjct  1    MRKWALSCALLLVLLLTTLPDPGKPPQSLPLNTKKLQVNAEESSDEVGDFPKVEEKLGAV  60

Query  205  PHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELIS  384
            PHGLSTD +V +RE+ES+S++TLR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELIS
Sbjct  61   PHGLSTDSEVVQRESESISRKTLRNSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELIS  120

Query  385  NASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLG  564
            NASDALDKIRFL+LTDK+ LGEGDTAKLEIQIKLDK+ KILSIRDRG+GMTKEDL+KNLG
Sbjct  121  NASDALDKIRFLTLTDKEALGEGDTAKLEIQIKLDKENKILSIRDRGVGMTKEDLIKNLG  180

Query  565  TIAKSGTSAFVEKMQSSGDLNLIGQF  642
            TIAKSGTSAFVEKMQ+ GDLNLIGQF
Sbjct  181  TIAKSGTSAFVEKMQTGGDLNLIGQF  206



>gb|EMS56078.1| Endoplasmin-like protein [Triticum urartu]
Length=875

 Score =   248 bits (634),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  121  GRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEF  300
             +K+  NAE  SD   D PKVEEK+G VPHGLSTD +V +RE+ES+S++TLR  AEKFEF
Sbjct  92   AKKLQVNAEESSDEVGDFPKVEEKLGAVPHGLSTDSEVVQRESESISRKTLRNSAEKFEF  151

Query  301  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqi  480
            QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDK+++GEGDTAKLEIQI
Sbjct  152  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKEVMGEGDTAKLEIQI  211

Query  481  kldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  642
            KLDK+ KILSIRDRG+GMTKEDL+KNLGTIAKSGTSAFVEKMQ+ GDLNLIGQF
Sbjct  212  KLDKENKILSIRDRGVGMTKEDLIKNLGTIAKSGTSAFVEKMQTGGDLNLIGQF  265



>ref|XP_007017830.1| Chaperone protein htpG family protein isoform 3, partial [Theobroma 
cacao]
 gb|EOY15055.1| Chaperone protein htpG family protein isoform 3, partial [Theobroma 
cacao]
Length=712

 Score =   244 bits (622),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 165/176 (94%), Gaps = 3/176 (2%)
 Frame = +1

Query  115  DQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKF  294
            DQGRK+HANA+   +  VDPPKVEEKIG VP+GL TD DV KRE+ES+S R+LR+ AEKF
Sbjct  13   DQGRKVHANAD---EGAVDPPKVEEKIGAVPNGLQTDSDVVKRESESISSRSLRSNAEKF  69

Query  295  EFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAklei  474
            EFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGDTAKLEI
Sbjct  70   EFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTAKLEI  129

Query  475  qikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  642
            QIKLDK+KKIL++RDRGIGMTKEDL+K+LGTIAKSGTSAFVEKMQSSGDLNLIGQF
Sbjct  130  QIKLDKEKKILTLRDRGIGMTKEDLIKHLGTIAKSGTSAFVEKMQSSGDLNLIGQF  185



>gb|ABV21762.1| GRP94 [Pinus taeda]
Length=834

 Score =   245 bits (625),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 169/198 (85%), Gaps = 2/198 (1%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVD-SDAPVDPPKVEEKIGG-VPHGLSTDP  228
            MRKWAVP  LFLL +L  +P Q   + ANAE   +D    PPKVEE IGG +P  LSTD 
Sbjct  1    MRKWAVPTALFLLIILTFVPHQSPHLRANAEASPADENASPPKVEEGIGGAIPDALSTDA  60

Query  229  DVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK  408
            DVA+RE+ES+S++TLRA A+KFEFQAEVSRLMDI+INSLYSNKDIFLRELISNASDALDK
Sbjct  61   DVAQRESESISRKTLRANAQKFEFQAEVSRLMDILINSLYSNKDIFLRELISNASDALDK  120

Query  409  IRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTS  588
            IRF++LTDK++LGEGD  +L+I+IKLDK+ KILSIRDRGIGMTKEDL+KNLGTIAKSGTS
Sbjct  121  IRFMALTDKNVLGEGDNTRLDIKIKLDKENKILSIRDRGIGMTKEDLIKNLGTIAKSGTS  180

Query  589  AFVEKMQSSGDLNLIGQF  642
            AF+E+MQ  GDLNLIGQ 
Sbjct  181  AFLEQMQKGGDLNLIGQL  198



>gb|KJB63502.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
Length=781

 Score =   244 bits (623),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 160/173 (92%), Gaps = 3/173 (2%)
 Frame = +1

Query  124  RKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQ  303
            RK+ ANAE   +  VDPPKVEEKIG VPHGL TD DV KRE+ES+S R+LR  AEKFEFQ
Sbjct  1    RKVQANAE---EGAVDPPKVEEKIGAVPHGLQTDSDVVKRESESISSRSLRNNAEKFEFQ  57

Query  304  AEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqik  483
            AEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGDT+KL+IQIK
Sbjct  58   AEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTSKLDIQIK  117

Query  484  ldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  642
            LDK+KKILS+RDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQSSGDLNLIGQF
Sbjct  118  LDKEKKILSLRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  170



>tpg|DAA46734.1| TPA: hypothetical protein ZEAMMB73_851694 [Zea mays]
Length=377

 Score =   221 bits (563),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +1

Query  124  RKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQ  303
            +K+  NAE  SD   +PPKVEEK+G +PHGLSTD  VA+ EAES+S++TLR+ AEKFEFQ
Sbjct  138  KKLQVNAEESSDDLANPPKVEEKLGAIPHGLSTDSKVAQSEAESISRKTLRSSAEKFEFQ  197

Query  304  AEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqik  483
            AEVSRLMDIIINSLY+NKDIFLRELISNASDALDKIRFLSLTDK++LGEGDTAKLEIQIK
Sbjct  198  AEVSRLMDIIINSLYNNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTAKLEIQIK  257

Query  484  ldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTS  588
            LDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTS
Sbjct  258  LDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTS  292



>tpg|DAA46735.1| TPA: hypothetical protein ZEAMMB73_851694 [Zea mays]
Length=411

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +1

Query  124  RKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQ  303
            +K+  NAE  SD   +PPKVEEK+G +PHGLSTD  VA+ EAES+S++TLR+ AEKFEFQ
Sbjct  138  KKLQVNAEESSDDLANPPKVEEKLGAIPHGLSTDSKVAQSEAESISRKTLRSSAEKFEFQ  197

Query  304  AEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqik  483
            AEVSRLMDIIINSLY+NKDIFLRELISNASDALDKIRFLSLTDK++LGEGDTAKLEIQIK
Sbjct  198  AEVSRLMDIIINSLYNNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTAKLEIQIK  257

Query  484  ldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTS  588
            LDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTS
Sbjct  258  LDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTS  292



>gb|AFW81541.1| hypothetical protein ZEAMMB73_624427 [Zea mays]
 gb|AFW81542.1| hypothetical protein ZEAMMB73_624427 [Zea mays]
Length=411

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  118  QGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFE  297
            Q  K+  NAE  SD   +PPKVEEK+G VPHGLSTD +VA+ EAES+S++TLR+ AEKFE
Sbjct  244  QANKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSEVAQSEAESISRKTLRSSAEKFE  303

Query  298  FQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiq  477
            FQAEVSRLMDIIINSLY+NKDIF RELISNASDALDKIRFLSLTDK++LGE DTAKLEIQ
Sbjct  304  FQAEVSRLMDIIINSLYNNKDIFPRELISNASDALDKIRFLSLTDKEVLGERDTAKLEIQ  363

Query  478  ikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTS  588
            IKLDK+KKILSI DRGIGMTKEDL+KNLGTIAKSGTS
Sbjct  364  IKLDKEKKILSIWDRGIGMTKEDLIKNLGTIAKSGTS  400



>emb|CDY08910.1| BnaC08g11400D [Brassica napus]
Length=783

 Score =   222 bits (566),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 161/180 (89%), Gaps = 2/180 (1%)
 Frame = +1

Query  55   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  234
            MRK A+ +VLFL  LLFLLPDQGRK+HANAE  SD   DPPKVE+K+GG   GLSTD DV
Sbjct  1    MRKRAIVSVLFLFSLLFLLPDQGRKLHANAEDSSDEVTDPPKVEKKLGG-HGGLSTDSDV  59

Query  235  AKR-EAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  411
             +R E+ES+SK++LR+  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI
Sbjct  60   VRRLESESISKKSLRSSGEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  119

Query  412  RFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSA  591
            RFL+LTDKD+LGEGDTAKLEIQIKLDK KKILSIRDRGIGMTKEDL+KNLGTIA+SGTS 
Sbjct  120  RFLALTDKDVLGEGDTAKLEIQIKLDKAKKILSIRDRGIGMTKEDLIKNLGTIAQSGTSV  179



>ref|XP_002969701.1| hypothetical protein SELMODRAFT_451343 [Selaginella moellendorffii]
 gb|EFJ28825.1| hypothetical protein SELMODRAFT_451343 [Selaginella moellendorffii]
Length=867

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 153/181 (85%), Gaps = 4/181 (2%)
 Frame = +1

Query  112  PDQG---RKIHANAEVDSDAPVDPPKVEEKIGG-VPHGLSTDPDVAKREAESMSKRTLRA  279
            PDQG    K+HA     ++    PPK+EE IGG +P  LSTD  V +RE+ES+ ++TLRA
Sbjct  20   PDQGPIRSKVHAEDTGVTEENASPPKIEEPIGGAIPDALSTDSQVVERESESVGQKTLRA  79

Query  280  GAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDT  459
             A++F FQAEVSRLMDII+NSLYSNKDIFLRELISNASDALDKIRFLSLTDK  LGEGD 
Sbjct  80   HAQRFTFQAEVSRLMDIIVNSLYSNKDIFLRELISNASDALDKIRFLSLTDKSQLGEGDE  139

Query  460  AkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQ  639
            +KLEI+IKLDK+KK+LSIRDRGIGMTK++L+KNLGTIAKSGTSAF EKMQS GDLNLIGQ
Sbjct  140  SKLEIRIKLDKEKKLLSIRDRGIGMTKDELIKNLGTIAKSGTSAFFEKMQSGGDLNLIGQ  199

Query  640  F  642
            F
Sbjct  200  F  200



>ref|XP_002981308.1| hypothetical protein SELMODRAFT_444847 [Selaginella moellendorffii]
 gb|EFJ17496.1| hypothetical protein SELMODRAFT_444847 [Selaginella moellendorffii]
Length=867

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 153/181 (85%), Gaps = 4/181 (2%)
 Frame = +1

Query  112  PDQG---RKIHANAEVDSDAPVDPPKVEEKIGG-VPHGLSTDPDVAKREAESMSKRTLRA  279
            PDQG    K+HA     ++    PPK+EE IGG +P  LSTD  V +RE+ES+ ++TLRA
Sbjct  20   PDQGPIRSKVHAEDTGVTEENASPPKIEEPIGGAIPDALSTDSQVVERESESVGQKTLRA  79

Query  280  GAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDT  459
             A++F FQAEVSRLMDII+NSLYSNKDIFLRELISNASDALDKIRFLSLTDK  LGEGD 
Sbjct  80   HAQRFTFQAEVSRLMDIIVNSLYSNKDIFLRELISNASDALDKIRFLSLTDKSQLGEGDE  139

Query  460  AkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQ  639
            +KLEI+IKLDK+KK+LSIRDRGIGMTK++L+KNLGTIAKSGTSAF EKMQS GDLNLIGQ
Sbjct  140  SKLEIRIKLDKEKKLLSIRDRGIGMTKDELIKNLGTIAKSGTSAFFEKMQSGGDLNLIGQ  199

Query  640  F  642
            F
Sbjct  200  F  200



>gb|KHN44921.1| Endoplasmin like [Glycine soja]
Length=283

 Score =   207 bits (526),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 143/179 (80%), Gaps = 17/179 (9%)
 Frame = +1

Query  121  GRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEF  300
            GRK  ANAE DSD  VDPPKV++KI  VPHGL TD +V            +++  EKFEF
Sbjct  92   GRKFQANAEGDSDELVDPPKVKDKISDVPHGLLTDSNV------------IKSNVEKFEF  139

Query  301  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqi  480
            QAEVS LMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK+++GEGD  KL+IQI
Sbjct  140  QAEVSWLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVVGEGDNTKLDIQI  199

Query  481  kldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAF-----VEKMQSSGDLNLIGQF  642
            KLDK+KK LSIR+RGIGMTKEDL+KNLGTIAK GTS       + +MQ+SGDLNLIGQF
Sbjct  200  KLDKEKKSLSIRERGIGMTKEDLIKNLGTIAKFGTSGMYVADIIAEMQTSGDLNLIGQF  258



>ref|XP_001770511.1| predicted protein [Physcomitrella patens]
 gb|EDQ64680.1| predicted protein [Physcomitrella patens]
Length=849

 Score =   218 bits (554),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +1

Query  175  PKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSN  354
            PK+EE +G VP G +TD +V KRE+ESM+ + LR+ AEKFEFQAEVSRLMDIII+SLYSN
Sbjct  51   PKLEENLGAVPAGSTTDSEVVKRESESMTSKNLRSNAEKFEFQAEVSRLMDIIIHSLYSN  110

Query  355  KDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGM  534
            KDIFLRELISNASDALDKIRFLSLTD  +LGEGD AKL+I IKLDK+KK+L+IRDRGIGM
Sbjct  111  KDIFLRELISNASDALDKIRFLSLTDSSVLGEGDDAKLDIHIKLDKEKKVLTIRDRGIGM  170

Query  535  TKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  642
            TK DL+KNLGTIAKSGTSAF+E+MQ  GDLNLIGQF
Sbjct  171  TKNDLIKNLGTIAKSGTSAFLEQMQKGGDLNLIGQF  206



>ref|XP_008660989.1| PREDICTED: endoplasmin homolog [Zea mays]
Length=209

 Score =   198 bits (503),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +1

Query  196  GGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRE  375
              VPHGLSTD +VA+REAES+S++TLR+  EKFEFQAEVSRLMDIIINSLYSNKDIFLRE
Sbjct  13   NAVPHGLSTDSEVAQREAESISRKTLRSSIEKFEFQAEVSRLMDIIINSLYSNKDIFLRE  72

Query  376  LISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVK  555
            LISNASDALDKIRFLSLTDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGMTKEDL+K
Sbjct  73   LISNASDALDKIRFLSLTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIK  132

Query  556  NLGTIAKSGTS  588
            NLGTIAKSGTS
Sbjct  133  NLGTIAKSGTS  143



>ref|XP_008646956.1| PREDICTED: endoplasmin homolog [Zea mays]
Length=215

 Score =   186 bits (473),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +1

Query  175  PKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSN  354
            P+V  +   VP GLSTD +VA+REAES+S++TLR+  EKFEFQAEVSRLMDIIINSLY+ 
Sbjct  69   PRVTTQRSVVPRGLSTDSEVAQREAESISRKTLRSSTEKFEFQAEVSRLMDIIINSLYNK  128

Query  355  KDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGM  534
            KDIFLRE ISNASDALDKIRFLSLTDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGM
Sbjct  129  KDIFLREPISNASDALDKIRFLSLTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGM  188

Query  535  TKEDLVKNLGTIAKSGTS  588
            TKEDL+KNLGTIAKSGTS
Sbjct  189  TKEDLIKNLGTIAKSGTS  206



>ref|XP_002949693.1| hypothetical protein VOLCADRAFT_80696 [Volvox carteri f. nagariensis]
 gb|EFJ49245.1| hypothetical protein VOLCADRAFT_80696 [Volvox carteri f. nagariensis]
Length=808

 Score =   192 bits (489),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 133/171 (78%), Gaps = 6/171 (4%)
 Frame = +1

Query  136  ANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRT--LRAGAEKFEFQAE  309
            A+  +D+ A    PKV+  +    H  +TD     RE ESMS     LR+GAE+F FQAE
Sbjct  24   ADTSIDATAA---PKVDNGVSS-GHATTTDATSIHREKESMSNTANRLRSGAEQFAFQAE  79

Query  310  VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikld  489
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK  LGEG+ A L+I+I LD
Sbjct  80   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKAQLGEGEAANLDIKIWLD  139

Query  490  kdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  642
               + L+IRDRGIGMTK+DLVKNLGTIAKSGTSAF+E+MQ  GD+NLIGQF
Sbjct  140  AASRTLNIRDRGIGMTKDDLVKNLGTIAKSGTSAFLEQMQKGGDMNLIGQF  190



>ref|XP_001701885.1| heat shock protein 90B [Chlamydomonas reinhardtii]
 gb|EDP06860.1| heat shock protein 90B, partial [Chlamydomonas reinhardtii]
Length=768

 Score =   192 bits (487),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 133/165 (81%), Gaps = 4/165 (2%)
 Frame = +1

Query  157  DAPVDP---PKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQAEVSRLMD  327
            D+ VD    PKV+  +    H  +TD     RE E+MSK+ +R   E+F FQAEV+RLMD
Sbjct  1    DSAVDATAAPKVDNGVSS-GHATATDATSIHREKEAMSKQRVRDSGEQFAFQAEVTRLMD  59

Query  328  IIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkkil  507
            III+SLYSNKDIFLRELISNASDALDKIRFLSLTDK ILG+GDT+ LEI+I LD + K+L
Sbjct  60   IIIHSLYSNKDIFLRELISNASDALDKIRFLSLTDKSILGDGDTSNLEIKIWLDPESKVL  119

Query  508  sirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  642
             IRDRGIGMTK+DL+KNLGTIAKSGTSAF+E+MQ  GD+NLIGQF
Sbjct  120  YIRDRGIGMTKDDLIKNLGTIAKSGTSAFLEQMQKGGDMNLIGQF  164



>gb|AFK46854.1| unknown [Medicago truncatula]
Length=121

 Score =   165 bits (417),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 104/107 (97%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  322  MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkk  501
            MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD AKLEIQIKLDK+KK
Sbjct  1    MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDNAKLEIQIKLDKEKK  60

Query  502  ilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  642
            ILSIRDRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQ+SGDLNLIGQF
Sbjct  61   ILSIRDRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQTSGDLNLIGQF  107



>gb|KJB63273.1| hypothetical protein B456_010G0030002, partial [Gossypium raimondii]
Length=178

 Score =   164 bits (414),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 100/107 (93%), Positives = 107/107 (100%), Gaps = 0/107 (0%)
 Frame = +1

Query  322  MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkk  501
            MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGDT+KL+IQIKLDK+KK
Sbjct  1    MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTSKLDIQIKLDKEKK  60

Query  502  ilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  642
            ILS+RDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQSSGDLNLIGQF
Sbjct  61   ILSLRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  107



>ref|XP_006657349.1| PREDICTED: endoplasmin homolog [Oryza brachyantha]
Length=951

 Score =   171 bits (432),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  250  ESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLT  429
            E ++ + LR   E FEFQA ++ L+DIIINS Y N DIFLRELISNASDALDKIRFL+LT
Sbjct  398  EPIATKALRRSGEMFEFQAILTNLIDIIINSPYRNSDIFLRELISNASDALDKIRFLALT  457

Query  430  DKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQ  609
            DK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQ
Sbjct  458  DKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQ  517

Query  610  SSGDLNLIGQF  642
            + GDLNLIG+F
Sbjct  518  TGGDLNLIGKF  528



>gb|KHG15193.1| Endoplasmin [Gossypium arboreum]
Length=718

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 100/107 (93%), Positives = 107/107 (100%), Gaps = 0/107 (0%)
 Frame = +1

Query  322  MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkk  501
            MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGDT+KL+IQIKLDK+KK
Sbjct  1    MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTSKLDIQIKLDKEKK  60

Query  502  ilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  642
            ILS+RDRGIGMTKEDL+KNLGTIAKSGTSAFVEKMQSSGDLNLIGQF
Sbjct  61   ILSLRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  107



>ref|XP_001753222.1| predicted protein [Physcomitrella patens]
 gb|EDQ81851.1| predicted protein [Physcomitrella patens]
Length=759

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 117/134 (87%), Gaps = 1/134 (1%)
 Frame = +1

Query  241  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  420
            RE ++++ +  R G E FEFQAEVSRLMDIIINSLYSNKDIFLREL+SNASDALDKIRFL
Sbjct  4    RERDTLAPKERRNG-ESFEFQAEVSRLMDIIINSLYSNKDIFLRELVSNASDALDKIRFL  62

Query  421  SLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVE  600
            SL DK +L +G  A+L+I IK+DK + +LSIRD G+GMTKEDL+KNLGT+AKSGTS+F++
Sbjct  63   SLMDKTLLSDGKDAELDIHIKVDKKENVLSIRDNGVGMTKEDLIKNLGTVAKSGTSSFLD  122

Query  601  KMQSSGDLNLIGQF  642
            ++QS GDLNLIGQF
Sbjct  123  QIQSGGDLNLIGQF  136



>ref|XP_002508627.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69885.1| predicted protein [Micromonas sp. RCC299]
Length=777

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +1

Query  265  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  444
            +T ++GAE  EFQAEVSRLMDIIINSLYSNKDIFLRELISN SD+LDKIRFLSLTD+ +L
Sbjct  33   KTFKSGAEVSEFQAEVSRLMDIIINSLYSNKDIFLRELISNGSDSLDKIRFLSLTDESVL  92

Query  445  GEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDL  624
            G GD A L+I+IK+DK+  +LSIRDRG+GMTK +L +NLGTIAKSGTSAF+E+MQ  GD+
Sbjct  93   GAGDDANLDIRIKVDKENGVLSIRDRGVGMTKAELKENLGTIAKSGTSAFLEQMQKGGDM  152

Query  625  NLIGQF  642
            NLIGQF
Sbjct  153  NLIGQF  158



>ref|XP_001421809.1| Heat Shock Protein 90, endoplasmic reticulum [Ostreococcus lucimarinus 
CCE9901]
 gb|ABP00103.1| Heat Shock Protein 90, endoplasmic reticulum [Ostreococcus lucimarinus 
CCE9901]
Length=794

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  GAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDT  459
            GAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISN SD+LDKIRF+SLTDK+ LG G+ 
Sbjct  53   GAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNGSDSLDKIRFMSLTDKEQLGGGEN  112

Query  460  AkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQ  639
            A L+I+IK DK++K+L+IRDRGIGMTK+DL+ NLGTIAKSGTSAF+++M S GD++LIGQ
Sbjct  113  ADLDIRIKADKERKVLTIRDRGIGMTKDDLMNNLGTIAKSGTSAFLDQMASGGDMSLIGQ  172

Query  640  F  642
            F
Sbjct  173  F  173



>ref|NP_001146348.1| shepherd-like1 [Zea mays]
 gb|ACL53742.1| unknown [Zea mays]
Length=719

 Score =   162 bits (411),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 101/107 (94%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  322  MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkk  501
            MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGDTAKLEIQIKLDK+KK
Sbjct  1    MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTAKLEIQIKLDKEKK  60

Query  502  ilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  642
            ILSIRDRGIGMTKEDL+ NLGTIAKSGTSAFVEKMQS GDLNLIGQF
Sbjct  61   ILSIRDRGIGMTKEDLINNLGTIAKSGTSAFVEKMQSGGDLNLIGQF  107



>gb|ACR38010.1| unknown [Zea mays]
Length=104

 Score =   150 bits (380),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +1

Query  124  RKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQ  303
            +K+  NAE  SD   +PPKVEEK+G VPHGLSTD +VA+REAES+S++TLR+ AEKFEFQ
Sbjct  12   KKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSEVAQREAESISRKTLRSSAEKFEFQ  71

Query  304  AEVSRLMDIIINSLYSNKDIFLRELISNASDA  399
            AEVSRLMDIIINSLYSNKDIFLRELISNASDA
Sbjct  72   AEVSRLMDIIINSLYSNKDIFLRELISNASDA  103



>ref|XP_003083767.1| heat shock protein 90 (ISS) [Ostreococcus tauri]
Length=788

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  GAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDT  459
            G+EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISN SDALDKIRF+SLTDK+ LG G+ 
Sbjct  51   GSEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNGSDALDKIRFMSLTDKEQLGSGEN  110

Query  460  AkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQ  639
            A L+I+IK DK++K+L+IRDRG+GMTK DL+ NLGTIAKSGTSAF+++M   GD++LIGQ
Sbjct  111  ANLDIRIKADKERKVLTIRDRGVGMTKADLMNNLGTIAKSGTSAFLDQMAKGGDMSLIGQ  170

Query  640  F  642
            F
Sbjct  171  F  171



>ref|XP_003063917.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51539.1| predicted protein [Micromonas pusilla CCMP1545]
Length=820

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  265  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  444
            +  + GAE+ EFQAEVSRLMDIIINSLYSNKDIFLRELISN SD+LDKIRFL+LTD+ +L
Sbjct  41   KAFKEGAEQHEFQAEVSRLMDIIINSLYSNKDIFLRELISNGSDSLDKIRFLALTDESLL  100

Query  445  GEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDL  624
            G GD A LEI+IK+D DKKIL+IRDRG+GMTK+DL +NLGTIAKSGTSAF+E+MQ  GD+
Sbjct  101  GVGDDANLEIRIKVDHDKKILTIRDRGVGMTKKDLKENLGTIAKSGTSAFLEQMQKGGDM  160

Query  625  NLIGQF  642
            +LIGQF
Sbjct  161  SLIGQF  166



>gb|AFW81490.1| hypothetical protein ZEAMMB73_031063, partial [Zea mays]
Length=102

 Score =   149 bits (376),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  124  RKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQ  303
            +K+  NAE  SD   +PPKVEEK+G VPHGLSTD +VA+REAES+S++TLR+ AEKFEFQ
Sbjct  12   KKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSEVAQREAESISRKTLRSSAEKFEFQ  71

Query  304  AEVSRLMDIIINSLYSNKDIFLRELISNASD  396
            AEVSRLMDIIINSLYSNKDIFLRELISNASD
Sbjct  72   AEVSRLMDIIINSLYSNKDIFLRELISNASD  102



>ref|XP_005823214.1| hypothetical protein GUITHDRAFT_160160 [Guillardia theta CCMP2712]
 gb|EKX36234.1| hypothetical protein GUITHDRAFT_160160 [Guillardia theta CCMP2712]
Length=839

 Score =   161 bits (407),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +1

Query  262  KRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDI  441
            K+ L  G +K EFQAEV RLMDIIINSLYS K+IFLRELISNASDALDKIRFLSLTD  +
Sbjct  63   KKALEQGGQKQEFQAEVGRLMDIIINSLYSKKEIFLRELISNASDALDKIRFLSLTDPKV  122

Query  442  LGEGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGD  621
            LGEGD +KLEI+I+ DK+   +SI D GIGMT+EDL+ NLGTIAKSGTS+F+EKM   GD
Sbjct  123  LGEGDQSKLEIRIEADKEAGTISISDTGIGMTREDLMNNLGTIAKSGTSSFLEKMAKEGD  182

Query  622  LNLIGQF  642
            +NLIGQF
Sbjct  183  MNLIGQF  189



>ref|XP_007512535.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17135.1| predicted protein [Bathycoccus prasinos]
Length=1223

 Score =   160 bits (406),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  268  TLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  447
            T +AGAE  EFQAEVSRLMDIIINSLYSNKDIFLRELISN SDALDKIRFLSLTD   LG
Sbjct  461  TFKAGAEVNEFQAEVSRLMDIIINSLYSNKDIFLRELISNGSDALDKIRFLSLTDASQLG  520

Query  448  EGDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLN  627
            +GD A+L+I+IK+DKD+K++SIRD+G+GMTK+++  NLGTIAKSGTSAF+E+MQ  GD++
Sbjct  521  DGDAAQLDIRIKIDKDQKLISIRDKGVGMTKQEIKDNLGTIAKSGTSAFLEQMQKGGDMS  580

Query  628  LIGQF  642
            LIGQF
Sbjct  581  LIGQF  585



>ref|XP_002157524.1| PREDICTED: endoplasmin-like [Hydra vulgaris]
Length=825

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 117/175 (67%), Gaps = 14/175 (8%)
 Frame = +1

Query  154  SDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMS--------KRTLRAGAEKFEFQAE  309
            S+  VD PKV + IG    G  TD +V KRE E+++         + LR  AEK  FQAE
Sbjct  28   SEDEVDTPKVTDDIGKSRDGSKTDDEVVKREEEAINIDGLSVAEVKQLRESAEKHAFQAE  87

Query  310  VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikld  489
            VSR+M +IINSLY NK+IFLRELISNASDALDKIRFLSLTDK +L   D   ++I+   D
Sbjct  88   VSRMMKLIINSLYKNKEIFLRELISNASDALDKIRFLSLTDKSVLSATDEFSVKIKADKD  147

Query  490  kdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLN----LIGQF  642
             +   ++    GIGMTK+DL+K LGTIAKSGTS F +KMQ +G  N    LIGQF
Sbjct  148  NNILHITDT--GIGMTKDDLIKQLGTIAKSGTSEFFQKMQEAGTANQASDLIGQF  200



>ref|XP_005651682.1| heat shock protein Hsp90 [Coccomyxa subellipsoidea C-169]
 gb|EIE27138.1| heat shock protein Hsp90 [Coccomyxa subellipsoidea C-169]
Length=768

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 111/123 (90%), Gaps = 2/123 (2%)
 Frame = +1

Query  274  RAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEG  453
            + GAEKF FQAEV+RLMDI+I+SLYSNK+IFLRELISNA+DALDKIRFLSLTDK  LGE 
Sbjct  49   KEGAEKFTFQAEVNRLMDILIHSLYSNKEIFLRELISNAADALDKIRFLSLTDKGQLGE-  107

Query  454  DTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLI  633
             T+ LEI++K+D D KIL+I+D G+GMT++DLVKNLGTIAKSGTSAF+E+MQ S D+NLI
Sbjct  108  -TSDLEIRVKVDHDNKILTIQDTGVGMTRDDLVKNLGTIAKSGTSAFLEQMQKSNDINLI  166

Query  634  GQF  642
            GQF
Sbjct  167  GQF  169



>emb|CEG00480.1| Histidine kinase-like ATPase, ATP-binding domain [Ostreococcus 
tauri]
Length=789

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 108/121 (89%), Gaps = 2/121 (2%)
 Frame = +1

Query  280  GAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDT  459
            G+EKFEFQAEVSRL  IIINSLYSNKDIFLRELISN SDALDKIRF+SLTDK+ LG G+ 
Sbjct  54   GSEKFEFQAEVSRL--IIINSLYSNKDIFLRELISNGSDALDKIRFMSLTDKEQLGSGEN  111

Query  460  AkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQ  639
            A L+I+IK DK++K+L+IRDRG+GMTK DL+ NLGTIAKSGTSAF+++M   GD++LIGQ
Sbjct  112  ANLDIRIKADKERKVLTIRDRGVGMTKADLMNNLGTIAKSGTSAFLDQMAKGGDMSLIGQ  171

Query  640  F  642
            F
Sbjct  172  F  172



>dbj|GAM27457.1| hypothetical protein SAMD00019534_106330 [Acytostelium subglobosum 
LB1]
Length=821

 Score =   153 bits (386),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 124/169 (73%), Gaps = 12/169 (7%)
 Frame = +1

Query  172  PPKVEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAEKFEFQAEVSRLMD  327
            P +++  + G    L+TD +V +RE E++         ++ ++  AEKF FQAEV++LM+
Sbjct  35   PIELDLDLKGAKTPLTTDSEVVQRENEAIKSEGYSVAEQKLIQENAEKFTFQAEVNKLMN  94

Query  328  IIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkkil  507
            IIINSLYS K+IFLRELISNASDALDKIRFL+LT+  +LG+GD +KL+I+I +D   K+L
Sbjct  95   IIINSLYSKKEIFLRELISNASDALDKIRFLALTNPALLGDGDQSKLDIRIMIDNANKVL  154

Query  508  sirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDL----NLIGQF  642
             I DRGIGMTK+DL+KNLGTIA+SGT  F+ K+  S D     NLIGQF
Sbjct  155  HIIDRGIGMTKDDLIKNLGTIAQSGTKDFINKLAQSNDTKDNSNLIGQF  203



>ref|XP_006588134.1| PREDICTED: endoplasmin homolog [Glycine max]
Length=137

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 100/112 (89%), Gaps = 5/112 (4%)
 Frame = +1

Query  322  MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkk  501
            MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK+++GEGD  KL+IQIKLDK+KK
Sbjct  1    MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVVGEGDNTKLDIQIKLDKEKK  60

Query  502  ilsirdRGIGMTKEDLVKNLGTIAKSGTSAF-----VEKMQSSGDLNLIGQF  642
             LSIR+RGIGMTKEDL+KNLGTIAK GTS       + +MQ+SGDLNLIGQF
Sbjct  61   SLSIRERGIGMTKEDLIKNLGTIAKFGTSGMYVADIIAEMQTSGDLNLIGQF  112



>gb|EFA78289.1| heat shock protein Hsp90 family protein [Polysphondylium pallidum 
PN500]
Length=822

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 125/174 (72%), Gaps = 12/174 (7%)
 Frame = +1

Query  157  DAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAEKFEFQAEV  312
            DA  +  KV+  + G    L TD +V +RE E++         ++ +   +EKF+FQAEV
Sbjct  30   DAARETLKVDLDMKGPKVPLQTDSEVVQRENEAIKSEGFSVAEQQFIEEQSEKFKFQAEV  89

Query  313  SRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldk  492
            ++LM+IIINSLYS K+IFLRELISNASDALDKIRFL+LT+  +LGEGD A L+I+I +DK
Sbjct  90   NKLMNIIINSLYSKKEIFLRELISNASDALDKIRFLALTNPSLLGEGDQANLDIRIMIDK  149

Query  493  dkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGD----LNLIGQF  642
              K + I DRG+GMTK++LVKNLGTIA+SGT  F++K+  S D     NLIGQF
Sbjct  150  VNKYIHIIDRGVGMTKDELVKNLGTIAQSGTKEFIKKVTESNDPKNSSNLIGQF  203



>gb|AGX25162.1| heat shock protein, partial [Leptinotarsa decemlineata]
Length=291

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 117/167 (70%), Gaps = 14/167 (8%)
 Frame = +1

Query  178  KVEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAEKFEFQAEVSRLMDII  333
            +VE  +G    G  TD +V KRE E++          R LR  +EKF FQ EV+R+M +I
Sbjct  32   EVELDLGASREGSRTDDEVVKREEEAIKLDGLNVAQLRELREKSEKFAFQTEVNRMMKLI  91

Query  334  INSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkkilsi  513
            INSLY NK+IFLRELISNASDALDKIR LSLTDK++L      ++ I+IK DK+  +L I
Sbjct  92   INSLYRNKEIFLRELISNASDALDKIRMLSLTDKEVL--NSQPEMNIRIKADKESGMLHI  149

Query  514  rdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQ---SSGDLN-LIGQF  642
             D GIGMTKEDL+ NLGTIAKSGT+ F+ KMQ   +S D+N +IGQF
Sbjct  150  TDTGIGMTKEDLINNLGTIAKSGTAEFLAKMQTSETSQDMNDMIGQF  196



>tpg|DAA34121.1| TPA_exp: endoplasmic reticulum glucose-regulated protein [Amblyomma 
variegatum]
Length=207

 Score =   139 bits (350),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 116/175 (66%), Gaps = 15/175 (9%)
 Frame = +1

Query  157  DAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAEKFEFQAEV  312
            DA    PKVE+ +G    G  TD  V +RE E++          + +R  AEK  FQAEV
Sbjct  23   DAESSTPKVEDDLGATREGSRTDDQVVEREEEAIKLDGLNVAQMKEMREKAEKHAFQAEV  82

Query  313  SRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldk  492
            +R+M +IINSLY NK+IFLRELISNASDALDKIR LSLT+ D+L      +L I++K DK
Sbjct  83   TRMMKLIINSLYRNKEIFLRELISNASDALDKIRLLSLTNPDVLNSN--PELTIRVKSDK  140

Query  493  dkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGD----LN-LIGQF  642
            +  +L I D GIGMTK DLV NLGTIAKSGT+ F++K+  + D    LN LIGQ 
Sbjct  141  ENGLLHITDTGIGMTKSDLVNNLGTIAKSGTAEFLQKVAETADAPKELNDLIGQL  195



>ref|XP_002117847.1| hypothetical protein TRIADDRAFT_64388 [Trichoplax adhaerens]
 gb|EDV19690.1| hypothetical protein TRIADDRAFT_64388 [Trichoplax adhaerens]
Length=669

 Score =   146 bits (368),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 120/167 (72%), Gaps = 15/167 (9%)
 Frame = +1

Query  181  VEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAEKFEFQAEVSRLMDIII  336
            VEE IG       TD +   RE E++          + LR   EK EFQAEVSR+M +II
Sbjct  15   VEEDIGKSRDASKTDDEAVAREEEAIKIDGLNVAQMKELREKGEKSEFQAEVSRMMKLII  74

Query  337  NSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkkilsir  516
            NSLY NK+IFLRELISN+SDALDKIRF+SLTDK++L  G+  +LEI+IK+DK+ ++L I 
Sbjct  75   NSLYRNKEIFLRELISNSSDALDKIRFMSLTDKEVL--GNNPELEIKIKVDKENRVLHIT  132

Query  517  dRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGD-----LNLIGQF  642
            D GIGMTK+DL+KNLGTIAKSGT+ F +KMQ SG+      +LIGQF
Sbjct  133  DTGIGMTKQDLIKNLGTIAKSGTNEFFKKMQESGEESKQASDLIGQF  179



>gb|AIC62039.1| HSP90B1, partial [synthetic construct]
Length=315

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>gb|AAH09195.1| HSP90B1 protein [Homo sapiens]
Length=315

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>gb|EAW97723.1| heat shock protein 90kDa beta (Grp94), member 1, isoform CRA_a, 
partial [Homo sapiens]
Length=367

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  47   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  101

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  102  EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  161

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  162  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  218

Query  625  NLIGQF  642
             LIGQF
Sbjct  219  -LIGQF  223



>ref|XP_011402246.1| Endoplasmin-like protein [Auxenochlorella protothecoides]
 gb|KFM29193.1| Endoplasmin-like protein [Auxenochlorella protothecoides]
Length=1046

 Score =   145 bits (366),  Expect = 6e-36, Method: Composition-based stats.
 Identities = 82/125 (66%), Positives = 105/125 (84%), Gaps = 1/125 (1%)
 Frame = +1

Query  271  LRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGE  450
             R GAE  +FQAEV+RLMDI+INSLYSNKDIFLRELISNA+DALDKIRFL+LTDK  LG+
Sbjct  30   FRKGAETMQFQAEVNRLMDILINSLYSNKDIFLRELISNAADALDKIRFLALTDKSQLGD  89

Query  451  GDTAkleiqik-ldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLN  627
             + ++       +D+++++LSIRD G+GMT++DLV NLGT+A+SGTSAF+E+ Q  GDL+
Sbjct  90   TEESQALGIRIWVDEERRVLSIRDSGVGMTRQDLVNNLGTVARSGTSAFLEQAQRGGDLS  149

Query  628  LIGQF  642
            LIGQF
Sbjct  150  LIGQF  154



>emb|CBN74418.1| Heat shock protein 90 [Ectocarpus siliculosus]
Length=767

 Score =   144 bits (363),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 92/124 (74%), Gaps = 2/124 (2%)
 Frame = +1

Query  271  LRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGE  450
            L+ GAE FEFQAEV+RLMDIIINSLY NKDIFLRELISNASDALDKIRFLS++D D LG 
Sbjct  50   LKDGAEAFEFQAEVNRLMDIIINSLYKNKDIFLRELISNASDALDKIRFLSVSDPDKLGT  109

Query  451  GDTAkleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNL  630
                ++ I    D     +     G+GMTK DL+ NLGT+A+SGT+ FVE +  +GDL L
Sbjct  110  AKDLEIRISADKDARTLTIRDA--GVGMTKADLISNLGTVARSGTTNFVEALTETGDLGL  167

Query  631  IGQF  642
            IGQF
Sbjct  168  IGQF  171



>ref|XP_011311739.1| PREDICTED: endoplasmin [Fopius arisanus]
Length=794

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 123/181 (68%), Gaps = 14/181 (8%)
 Frame = +1

Query  136  ANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEK  291
            A A+++ D   D P VE+ +G       TD +V +RE+E+++         + LR  AEK
Sbjct  18   ARAQLEIDEADDVPSVEQNLGSSREASRTDDEVVQRESEAINIDGLNPSQIQELRNRAEK  77

Query  292  FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkle  471
            F FQ EV+R+M +IINSLY NK+IFLRELISNASDALDKIR LSLTDK++L      +L 
Sbjct  78   FTFQTEVNRMMKLIINSLYRNKEIFLRELISNASDALDKIRLLSLTDKNVLDTN--PELS  135

Query  472  iqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDL----NLIGQ  639
            I+IK D + KIL I D GIGMTK DL+ NLGTIAKSGT+ F+ KMQ + +     ++IGQ
Sbjct  136  IRIKADAENKILHIIDSGIGMTKTDLINNLGTIAKSGTAEFLGKMQDTKNAQEMNDMIGQ  195

Query  640  F  642
            F
Sbjct  196  F  196



>ref|XP_007893493.1| PREDICTED: endoplasmin [Callorhinchus milii]
Length=805

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 121/180 (67%), Gaps = 15/180 (8%)
 Frame = +1

Query  142  AEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFE  297
            A   +D P+    VEE +G    G  TD +V KRE E++          + LR  +EKF 
Sbjct  17   ASARADEPLADETVEEDLGKSRDGSKTDDEVTKREEEAIQLDGLNPAQIKELRDKSEKFV  76

Query  298  FQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiq  477
            FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD   L  G T ++ I+
Sbjct  77   FQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDDSAL--GGTEEMTIK  134

Query  478  ikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEK---MQSSGDLN--LIGQF  642
            IK DK+K +L I D GIGMTKE+L+KNLGTIAKSGTS F+ K   MQ+ G     LIGQF
Sbjct  135  IKADKEKNMLHITDTGIGMTKEELIKNLGTIAKSGTSEFLNKMTEMQTEGQSTSELIGQF  194



>ref|XP_004373828.1| PREDICTED: endoplasmin [Trichechus manatus latirostris]
Length=803

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 117/184 (64%), Gaps = 20/184 (11%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADGEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQ-----SSGDLNL  630
            ++I+   +K+   ++    GIGMT+E+LVKNLGTIAKSGTS F+ KM      S     L
Sbjct  134  VKIKCDKEKNLLHVTDT--GIGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDSQSTSEL  191

Query  631  IGQF  642
            IGQF
Sbjct  192  IGQF  195



>ref|XP_003907109.1| PREDICTED: endoplasmin [Papio anubis]
Length=800

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 120/182 (66%), Gaps = 20/182 (11%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK----RTLRAGAEKFE  297
            + A+ EVD D  V     EE +G    G  TD +V +RE E++      R LR  +EKF 
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAILNASQIRELREKSEKFA  73

Query  298  FQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiq  477
            FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   ++I+
Sbjct  74   FQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELTVKIK  133

Query  478  ikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDLNLIG  636
               +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ +  LIG
Sbjct  134  CDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE--LIG  189

Query  637  QF  642
            QF
Sbjct  190  QF  191



>dbj|BAD92771.1| tumor rejection antigen (gp96) 1 variant [Homo sapiens]
Length=576

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  45   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  99

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  100  EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  159

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  160  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  216

Query  625  NLIGQF  642
             LIGQF
Sbjct  217  -LIGQF  221



>ref|XP_009065664.1| hypothetical protein LOTGIDRAFT_197084 [Lottia gigantea]
 gb|ESO83635.1| hypothetical protein LOTGIDRAFT_197084 [Lottia gigantea]
Length=792

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 111/177 (63%), Gaps = 14/177 (8%)
 Frame = +1

Query  148  VDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAEKFEFQ  303
            V ++  V  P V E IG       TD +  +RE E++          + LR  AEKF F+
Sbjct  23   VQAEEVVTEPDVVEDIGKSREASRTDDEAVQREEEAIKLDGLNVAQMKELREKAEKFAFE  82

Query  304  AEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqik  483
            AEV+R+M +IINSLY NK+IFLRELISNASDALDKIRF+SLTDK  +   D   ++I+  
Sbjct  83   AEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRFVSLTDKSAMAATDELSIKIKAD  142

Query  484  ldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDL----NLIGQF  642
                   ++    GIGMTK+DLVKNLGTIAKSGTS F+ K+  S D     +LIGQF
Sbjct  143  KASHVIQITDT--GIGMTKDDLVKNLGTIAKSGTSDFLSKLGESKDQAQMSDLIGQF  197



>gb|AAH81917.1| Tra1 protein [Rattus norvegicus]
Length=643

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDREKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>dbj|BAP28370.1| heat shock protein 90 kDa beta member 1, partial [Canis lupus 
familiaris]
Length=663

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  12   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  66

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  67   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  126

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  127  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  183

Query  625  NLIGQF  642
             LIGQF
Sbjct  184  -LIGQF  188



>ref|XP_005358282.1| PREDICTED: endoplasmin [Microtus ochrogaster]
Length=805

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMTKE+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTKEELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_007109922.1| PREDICTED: endoplasmin [Physeter catodon]
Length=805

 Score =   142 bits (357),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VQADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_006740281.1| PREDICTED: endoplasmin isoform X2 [Leptonychotes weddellii]
Length=748

 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_002428463.1| Hsp90 protein, putative [Pediculus humanus corporis]
 gb|EEB15725.1| Hsp90 protein, putative [Pediculus humanus corporis]
Length=778

 Score =   142 bits (357),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 117/171 (68%), Gaps = 14/171 (8%)
 Frame = +1

Query  166  VDPPKVEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAEKFEFQAEVSRL  321
            V+   VE  +G     L TD +V +RE E++          + LR  AEKF FQAEV+R+
Sbjct  31   VETVTVEPDLGASREALRTDDNVVQREEEAIKLDGLNVAQIKELREKAEKFHFQAEVNRM  90

Query  322  MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkk  501
            M +IINSLY NK+IFLRELISNA+DALDKIR LSLTDK +L      +L I++K DKD  
Sbjct  91   MKLIINSLYRNKEIFLRELISNAADALDKIRLLSLTDKSVLDSN--PELGIRLKADKDNH  148

Query  502  ilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQ---SSGDLN-LIGQF  642
            IL I D GIGMTK+DL+ NLGTIAKSGT+ F+ KMQ   S+ D N +IGQF
Sbjct  149  ILHIIDSGIGMTKKDLINNLGTIAKSGTAEFLAKMQEARSTADFNDMIGQF  199



>gb|KFM57735.1| Endoplasmin, partial [Stegodyphus mimosarum]
Length=785

 Score =   142 bits (357),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 118/170 (69%), Gaps = 14/170 (8%)
 Frame = +1

Query  169  DPPKVEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAEKFEFQAEVSRLM  324
            D P VE  IG    G  TD +V +RE E++          + LR  AEKF FQAEV+R+M
Sbjct  24   DEPTVEPDIGSSREGSRTDDEVVQREEEAIKIDGLNVAQIKELREKAEKFTFQAEVNRMM  83

Query  325  DIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkki  504
             +IINSLY NK+IFLRELISNASDALDKIR +SLTD+  L    T  L I+IK DK+  +
Sbjct  84   KLIINSLYRNKEIFLRELISNASDALDKIRVISLTDRAALSA--TEDLSIRIKSDKENNV  141

Query  505  lsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM---QSSGDL-NLIGQF  642
            L + D GIGMTKE+L+ NLGTIAKSGTS F++K+   QS+ +L ++IGQF
Sbjct  142  LHVTDTGIGMTKEELINNLGTIAKSGTSDFLQKVAETQSAAELSDMIGQF  191



>ref|XP_004269495.1| PREDICTED: endoplasmin [Orcinus orca]
Length=805

 Score =   142 bits (357),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VQADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_004326676.1| PREDICTED: endoplasmin [Tursiops truncatus]
Length=805

 Score =   142 bits (357),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VQADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_007096540.1| PREDICTED: endoplasmin [Panthera tigris altaica]
Length=804

 Score =   141 bits (356),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VQADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_007165840.1| PREDICTED: endoplasmin [Balaenoptera acutorostrata scammoni]
Length=805

 Score =   141 bits (356),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VQADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_004414318.1| PREDICTED: endoplasmin [Odobenus rosmarus divergens]
Length=804

 Score =   141 bits (356),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADNEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>dbj|BAE29874.1| unnamed protein product [Mus musculus]
Length=802

 Score =   141 bits (356),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEEIT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_011218345.1| PREDICTED: endoplasmin isoform X2 [Ailuropoda melanoleuca]
Length=799

 Score =   141 bits (356),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_008703910.1| PREDICTED: endoplasmin [Ursus maritimus]
Length=804

 Score =   141 bits (356),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_004006728.1| PREDICTED: endoplasmin [Ovis aries]
Length=804

 Score =   141 bits (356),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|NP_035761.1| endoplasmin precursor [Mus musculus]
 sp|P08113.2|ENPL_MOUSE RecName: Full=Endoplasmin; AltName: Full=94 kDa glucose-regulated 
protein; Short=GRP-94; AltName: Full=Endoplasmic reticulum 
resident protein 99; Short=ERp99; AltName: Full=Heat shock 
protein 90 kDa beta member 1; AltName: Full=Polymorphic tumor 
rejection antigen 1; AltName: Full=Tumor rejection antigen 
gp96; Flags: Precursor [Mus musculus]
 gb|AAA37573.1| endoplasmic reticulum transmembrane protein precursor [Mus musculus]
 dbj|BAE38494.1| unnamed protein product [Mus musculus]
 dbj|BAE40874.1| unnamed protein product [Mus musculus]
 dbj|BAE27505.1| unnamed protein product [Mus musculus]
 dbj|BAE32087.1| unnamed protein product [Mus musculus]
 dbj|BAE30378.1| unnamed protein product [Mus musculus]
 dbj|BAE35526.1| unnamed protein product [Mus musculus]
 dbj|BAE40758.1| unnamed protein product [Mus musculus]
 gb|EDL21440.1| heat shock protein 90kDa beta (Grp94), member 1 [Mus musculus]
Length=802

 Score =   141 bits (356),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>gb|ELR54024.1| Endoplasmin, partial [Bos mutus]
Length=795

 Score =   141 bits (356),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_003745792.1| PREDICTED: endoplasmin-like [Metaseiulus occidentalis]
Length=785

 Score =   141 bits (355),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 119/173 (69%), Gaps = 14/173 (8%)
 Frame = +1

Query  160  APVDPPKVEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAEKFEFQAEVS  315
            A  DP +VE+ IG +  G  TD +V  RE E++          + +R  AEK  FQAEV+
Sbjct  26   ANFDPTRVEDDIGKMAEGGRTDAEVVGREEEAIKIDSLSVSQLKEIRDKAEKQVFQAEVA  85

Query  316  RLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkd  495
            R+M +IINSLY NK++FLRELISNASDALDKIR LSLT+ D L      +L I+I  DK+
Sbjct  86   RMMKLIINSLYRNKEVFLRELISNASDALDKIRLLSLTNPDALKA--LQELSIRIMADKE  143

Query  496  kkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM---QSSGDLN-LIGQF  642
              +L I D GIGMTKEDLVKNLGTIAKSGT+ F++K+   + S DLN LIGQF
Sbjct  144  NNVLHITDTGIGMTKEDLVKNLGTIAKSGTAEFLQKVNDGEGSKDLNDLIGQF  196



>ref|XP_003929672.1| PREDICTED: endoplasmin [Saimiri boliviensis boliviensis]
Length=804

 Score =   141 bits (356),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+AEVD D  V     E  +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADAEVDVDGTV-----EADLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_009019107.1| hypothetical protein HELRODRAFT_157169 [Helobdella robusta]
 gb|ESO02893.1| hypothetical protein HELRODRAFT_157169 [Helobdella robusta]
Length=736

 Score =   141 bits (355),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 116/170 (68%), Gaps = 18/170 (11%)
 Frame = +1

Query  175  PKVEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAEKFEFQAEVSRLMDI  330
            PKV++ IG    G  TD +V +RE E++          + L+  AEK  FQAEV R+M +
Sbjct  12   PKVDDDIGKAQEGSKTDDEVVQREEEAIKLDGLSVAQMKELKDKAEKHVFQAEVDRMMKL  71

Query  331  IINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkkils  510
            IINSLY NK+IFLRELISNASDALDKIRFLSLTD   +G    A+L I+IK DKD  +L 
Sbjct  72   IINSLYKNKEIFLRELISNASDALDKIRFLSLTDNTAMGSN--AELSIKIKTDKDNHVLH  129

Query  511  irdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM------QSSGDLNLIGQF  642
            + D G+GMTK+DL+KNLGTIAKSGTS F+ K+      Q + D  LIGQF
Sbjct  130  VTDTGVGMTKDDLIKNLGTIAKSGTSEFLTKIGEAKSQQETSD--LIGQF  177



>ref|NP_001012197.2| endoplasmin precursor [Rattus norvegicus]
 sp|Q66HD0.2|ENPL_RAT RecName: Full=Endoplasmin; AltName: Full=94 kDa glucose-regulated 
protein; Short=GRP-94; AltName: Full=Heat shock protein 
90 kDa beta member 1; Flags: Precursor [Rattus norvegicus]
 gb|EDM17052.1| rCG49111 [Rattus norvegicus]
Length=804

 Score =   141 bits (356),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDREKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|NP_777125.1| endoplasmin precursor [Bos taurus]
 ref|XP_005899141.1| PREDICTED: endoplasmin [Bos mutus]
 ref|XP_006077264.1| PREDICTED: endoplasmin [Bubalus bubalis]
 ref|XP_010851722.1| PREDICTED: endoplasmin [Bison bison bison]
 sp|Q95M18.1|ENPL_BOVIN RecName: Full=Endoplasmin; AltName: Full=94 kDa glucose-regulated 
protein; Short=GRP-94; AltName: Full=Heat shock protein 
90 kDa beta member 1; Flags: Precursor [Bos taurus]
 dbj|BAB69766.1| glucose-regulated protein GRP94 precursor [Bos taurus]
 gb|AAI04550.1| Tumor rejection antigen (gp96) 1 [Bos taurus]
 tpg|DAA29741.1| TPA: endoplasmin precursor [Bos taurus]
Length=804

 Score =   141 bits (356),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_006934044.1| PREDICTED: endoplasmin [Felis catus]
Length=804

 Score =   141 bits (356),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>gb|EPY74066.1| endoplasmin precursor [Camelus ferus]
Length=723

 Score =   140 bits (354),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 119/186 (64%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A  EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRAEDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_006979926.1| PREDICTED: endoplasmin [Peromyscus maniculatus bairdii]
Length=802

 Score =   141 bits (356),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_008002644.1| PREDICTED: endoplasmin [Chlorocebus sabaeus]
Length=804

 Score =   141 bits (356),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_006740280.1| PREDICTED: endoplasmin isoform X1 [Leptonychotes weddellii]
Length=803

 Score =   141 bits (356),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_002915502.1| PREDICTED: endoplasmin isoform X1 [Ailuropoda melanoleuca]
Length=803

 Score =   141 bits (356),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_010219153.1| PREDICTED: endoplasmin-like, partial [Tinamus guttatus]
Length=312

 Score =   136 bits (342),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 114/179 (64%), Gaps = 20/179 (11%)
 Frame = +1

Query  145  EVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF  300
            EVD D  V     E+ +G    G  TD +V +RE E++          + +R  +EKF F
Sbjct  51   EVDVDGTV-----EDDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIKEIREKSEKFAF  105

Query  301  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqi  480
            QAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   ++I+ 
Sbjct  106  QAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELTVKIKC  165

Query  481  kldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQ-----SSGDLNLIGQF  642
              +K+   ++    GIGMTKE+L+KNLGTIAKSGTS F+ KM      S     LIGQF
Sbjct  166  DKEKNMLHVTDT--GIGMTKEELIKNLGTIAKSGTSEFLNKMTEMQDDSQSTSELIGQF  222



>ref|XP_003783342.1| PREDICTED: endoplasmin-like [Otolemur garnettii]
Length=804

 Score =   141 bits (355),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_007619353.1| PREDICTED: endoplasmin [Cricetulus griseus]
 gb|ERE88868.1| endoplasmin [Cricetulus griseus]
Length=802

 Score =   141 bits (355),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_005068020.1| PREDICTED: endoplasmin [Mesocricetus auratus]
Length=802

 Score =   141 bits (355),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_003505898.1| PREDICTED: endoplasmin [Cricetulus griseus]
 gb|EGW09701.1| Endoplasmin [Cricetulus griseus]
Length=803

 Score =   141 bits (355),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_005322404.1| PREDICTED: endoplasmin [Ictidomys tridecemlineatus]
Length=805

 Score =   141 bits (355),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 117/184 (64%), Gaps = 20/184 (11%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQ-----SSGDLNL  630
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM      S     L
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDSQSTSEL  191

Query  631  IGQF  642
            IGQF
Sbjct  192  IGQF  195



>gb|AAH10445.1| Heat shock protein 90, beta (Grp94), member 1 [Mus musculus]
 gb|AAH11439.1| Heat shock protein 90, beta (Grp94), member 1 [Mus musculus]
Length=802

 Score =   141 bits (355),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_004879102.1| PREDICTED: endoplasmin [Heterocephalus glaber]
 ref|XP_004844894.1| PREDICTED: endoplasmin isoform X2 [Heterocephalus glaber]
Length=805

 Score =   141 bits (355),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|NP_001127573.1| endoplasmin precursor [Pongo abelii]
 sp|Q5R6F7.1|ENPL_PONAB RecName: Full=Endoplasmin; AltName: Full=Heat shock protein 90 
kDa beta member 1; Flags: Precursor [Pongo abelii]
 emb|CAH92659.1| hypothetical protein [Pongo abelii]
Length=804

 Score =   141 bits (355),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_008568503.1| PREDICTED: endoplasmin [Galeopterus variegatus]
Length=803

 Score =   141 bits (355),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_003269991.2| PREDICTED: endoplasmin [Nomascus leucogenys]
Length=804

 Score =   141 bits (355),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|NP_001182453.1| heat shock protein 90kDa beta (Grp94), member 1 precursor [Macaca 
mulatta]
 ref|NP_001270655.1| endoplasmin precursor [Macaca fascicularis]
 ref|XP_010355583.1| PREDICTED: endoplasmin [Rhinopithecus roxellana]
 sp|Q4R520.1|ENPL_MACFA RecName: Full=Endoplasmin; AltName: Full=Heat shock protein 90 
kDa beta member 1; Flags: Precursor [Macaca fascicularis]
 dbj|BAE01805.1| unnamed protein product [Macaca fascicularis]
Length=804

 Score =   141 bits (355),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|NP_001003327.1| endoplasmin precursor [Canis lupus familiaris]
 sp|P41148.1|ENPL_CANFA RecName: Full=Endoplasmin; AltName: Full=94 kDa glucose-regulated 
protein; Short=GRP-94; AltName: Full=Heat shock protein 
90 kDa beta member 1; Flags: Precursor [Canis lupus familiaris]
 gb|AAA17708.1| GRP94 [Canis lupus familiaris]
Length=804

 Score =   141 bits (355),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|NP_001233416.1| endoplasmin precursor [Pan troglodytes]
 dbj|BAK62934.1| endoplasmin precursor [Pan troglodytes]
Length=803

 Score =   141 bits (355),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>gb|EFB13451.1| hypothetical protein PANDA_003512 [Ailuropoda melanoleuca]
Length=778

 Score =   141 bits (355),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  3    VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  57

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  58   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  117

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  118  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  174

Query  625  NLIGQF  642
             LIGQF
Sbjct  175  -LIGQF  179



>ref|XP_006888611.1| PREDICTED: endoplasmin [Elephantulus edwardii]
Length=801

 Score =   141 bits (355),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>gb|EHH66650.1| hypothetical protein EGM_03684 [Macaca fascicularis]
Length=804

 Score =   141 bits (355),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>gb|EHH21126.1| hypothetical protein EGK_04124 [Macaca mulatta]
Length=804

 Score =   141 bits (355),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>gb|EHA99498.1| Endoplasmin, partial [Heterocephalus glaber]
Length=792

 Score =   141 bits (355),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_004743081.1| PREDICTED: endoplasmin [Mustela putorius furo]
 ref|XP_004787181.1| PREDICTED: endoplasmin [Mustela putorius furo]
Length=803

 Score =   141 bits (355),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_006084129.1| PREDICTED: endoplasmin [Myotis lucifugus]
Length=804

 Score =   141 bits (355),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_005865309.1| PREDICTED: endoplasmin [Myotis brandtii]
Length=804

 Score =   141 bits (355),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_006141474.1| PREDICTED: endoplasmin [Tupaia chinensis]
 gb|ELW71596.1| Endoplasmin [Tupaia chinensis]
Length=805

 Score =   141 bits (355),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>gb|AAQ02595.1| tumor rejection antigen 1gp96, partial [synthetic construct]
Length=803

 Score =   141 bits (355),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>emb|CAI64497.1| tumor rejection antigen (gp96) 1 [Homo sapiens]
Length=802

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_003202424.1| PREDICTED: endoplasmin [Meleagris gallopavo]
Length=795

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 89/179 (50%), Positives = 116/179 (65%), Gaps = 20/179 (11%)
 Frame = +1

Query  145  EVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF  300
            EVD+DA V     EE +G    G  TD +V +RE E++          + +R  +EKF F
Sbjct  23   EVDADATV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIKEIREKSEKFAF  77

Query  301  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqi  480
            QAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   ++I+ 
Sbjct  78   QAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKC  137

Query  481  kldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQ-----SSGDLNLIGQF  642
              +K+   ++    GIGMTKE+L+KNLGTIAKSGTS F+ KM      S     LIGQF
Sbjct  138  DKEKNMLHVTDT--GIGMTKEELIKNLGTIAKSGTSEFLNKMTEMQDDSQSTSELIGQF  194



>ref|XP_008142964.1| PREDICTED: endoplasmin [Eptesicus fuscus]
Length=804

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_006769416.1| PREDICTED: endoplasmin [Myotis davidii]
Length=804

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|NP_003290.1| endoplasmin precursor [Homo sapiens]
 ref|XP_003832615.1| PREDICTED: endoplasmin [Pan paniscus]
 sp|P14625.1|ENPL_HUMAN RecName: Full=Endoplasmin; AltName: Full=94 kDa glucose-regulated 
protein; Short=GRP-94; AltName: Full=Heat shock protein 
90 kDa beta member 1; AltName: Full=Tumor rejection antigen 
1; AltName: Full=gp96 homolog; Flags: Precursor [Homo sapiens]
 emb|CAA33261.1| precursor polypeptide (AA-21 to 782) [Homo sapiens]
 gb|AAH66656.1| Heat shock protein 90kDa beta (Grp94), member 1 [Homo sapiens]
 gb|EAW97724.1| heat shock protein 90kDa beta (Grp94), member 1, isoform CRA_b 
[Homo sapiens]
 gb|ACJ13662.1| epididymis luminal protein 35 [Homo sapiens]
 gb|ACS44652.1| epididymis secretory sperm binding protein Li 125m [Homo sapiens]
Length=803

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>gb|KDD75133.1| heat shock protein 90 Hsp90 [Helicosporidium sp. ATCC 50920]
Length=774

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 95/116 (82%), Gaps = 6/116 (5%)
 Frame = +1

Query  301  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqi  480
            +AEV+R+MDI+INSLYSNKDIFLRELISNA+DALDKIRFLSLT+ D L     AK +++I
Sbjct  30   RAEVNRMMDILINSLYSNKDIFLRELISNAADALDKIRFLSLTETDALA----AKQDMKI  85

Query  481  kldkdkkilsirdR--GIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF  642
            ++  + +   +  R  G+GMT+EDLV NLGTIAKSGTSAFVE+MQ  GDLNLIGQF
Sbjct  86   QIWAEPEKNRLCIRDTGVGMTREDLVNNLGTIAKSGTSAFVEQMQKGGDLNLIGQF  141



>ref|XP_011385167.1| PREDICTED: endoplasmin [Pteropus vampyrus]
Length=804

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_004418096.1| PREDICTED: endoplasmin [Ceratotherium simum simum]
Length=805

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEEGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_004053833.1| PREDICTED: endoplasmin [Gorilla gorilla gorilla]
Length=803

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|NP_001157345.1| glucose-regulated protein precursor [Equus caballus]
 ref|XP_008535120.1| PREDICTED: endoplasmin [Equus przewalskii]
Length=804

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>gb|EPQ07146.1| Endoplasmin [Myotis brandtii]
Length=825

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_971540.1| PREDICTED: endoplasmin [Tribolium castaneum]
 gb|EFA10013.1| hypothetical protein TcasGA2_TC012185 [Tribolium castaneum]
 gb|AHF20221.1| heat shock protein 90 [Tribolium castaneum]
Length=782

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 117/167 (70%), Gaps = 14/167 (8%)
 Frame = +1

Query  178  KVEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAEKFEFQAEVSRLMDII  333
            KV+  +G    G  TD +V KRE E++          + LR  AEKF FQ EV+R+M +I
Sbjct  31   KVDLDLGASREGSRTDDEVVKREEEAIKLDGLNVAQLKELRDKAEKFTFQTEVNRMMKLI  90

Query  334  INSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkkilsi  513
            INSLY NK+IFLRELISNASDALDKIR LSLTDK++L      +L I+IK DK+  +L I
Sbjct  91   INSLYRNKEIFLRELISNASDALDKIRLLSLTDKNVLDSN--PELNIRIKADKEAGMLHI  148

Query  514  rdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQ---SSGDLN-LIGQF  642
             D GIGMTK+DLV NLGTIAKSGT+ F+ KMQ   ++ D+N +IGQF
Sbjct  149  TDTGIGMTKQDLVNNLGTIAKSGTAEFLSKMQDASTAQDMNDMIGQF  195



>ref|XP_006205953.1| PREDICTED: endoplasmin [Vicugna pacos]
Length=804

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 119/186 (64%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A  EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRAEDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_001365625.1| PREDICTED: endoplasmin [Monodelphis domestica]
Length=804

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 118/179 (66%), Gaps = 16/179 (9%)
 Frame = +1

Query  148  VDSDAPVD-PPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF  300
            V +D PVD    VEE +G    G  TD +V +RE E++          + +R  +EKF F
Sbjct  20   VKADDPVDVEATVEEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIKEIREKSEKFAF  79

Query  301  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqi  480
            QAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   ++I+ 
Sbjct  80   QAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELTVKIKC  139

Query  481  kldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM---QSSGDLN--LIGQF  642
              +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM   QS G     LIGQF
Sbjct  140  DKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQSDGQSTSELIGQF  196



>ref|XP_004349108.2| glucose-regulated protein 94 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE91193.1| glucose-regulated protein 94 [Capsaspora owczarzaki ATCC 30864]
Length=816

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 115/169 (68%), Gaps = 13/169 (8%)
 Frame = +1

Query  169  DPPKVEEKIGGVPHGLSTDPDVAKREAESMS--------KRTLRAGAEKFEFQAEVSRLM  324
            D PKV   I G   G  TD  V +RE +++          + LR  ++KF FQ EV+R+M
Sbjct  40   DLPKVANDIAGDRVGSKTDDQVVEREEQAIHIDGLSVSEVKQLRERSDKFAFQTEVNRMM  99

Query  325  DIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkki  504
             +IINSLY NKDIFLRELISNASDALDKIRFLS++D  +LGE  T +L IQI  D   K+
Sbjct  100  KLIINSLYKNKDIFLRELISNASDALDKIRFLSVSDPKLLGE--TTQLRIQIFADAANKV  157

Query  505  lsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLN---LIGQF  642
            L I D G+GMT++DL++NLGTIAKSGT+ F+ +MQ S   +   LIGQF
Sbjct  158  LHITDTGVGMTRDDLIRNLGTIAKSGTAEFLHQMQESQTADASSLIGQF  206



>ref|XP_006193753.1| PREDICTED: endoplasmin [Camelus ferus]
 ref|XP_010968744.1| PREDICTED: endoplasmin [Camelus bactrianus]
 ref|XP_010988330.1| PREDICTED: endoplasmin [Camelus dromedarius]
Length=804

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 119/186 (64%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A  EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRAEDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_004844893.1| PREDICTED: endoplasmin isoform X1 [Heterocephalus glaber]
Length=844

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_010629639.1| PREDICTED: endoplasmin [Fukomys damarensis]
 gb|KFO30279.1| Endoplasmin [Fukomys damarensis]
Length=806

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDLDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_004589651.1| PREDICTED: endoplasmin [Ochotona princeps]
Length=803

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 119/186 (64%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD+  L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDEQALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_011494775.1| PREDICTED: endoplasmin [Ceratosolen solmsi marchali]
Length=786

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 116/166 (70%), Gaps = 14/166 (8%)
 Frame = +1

Query  181  VEEKIGGVPHGLSTDPDVAKREAESMS--------KRTLRAGAEKFEFQAEVSRLMDIII  336
            +++ +G     L TD  V +REAE+++         + LR  AEKF+FQ EV+R+M +II
Sbjct  31   IDDDLGASREALRTDEQVVQREAEAINIDGLNVSQVKELRDKAEKFQFQTEVNRMMKLII  90

Query  337  NSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkkilsir  516
            NSLY NK+IFLRELISNASDALDKIR LSLTDK+IL      +  I+IK D + KIL I 
Sbjct  91   NSLYRNKEIFLRELISNASDALDKIRLLSLTDKNILESN--PETCIRIKADVENKILRIS  148

Query  517  dRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDL----NLIGQF  642
            D GIGMTK+DL+ NLGTIAKSGT+ F+ KMQ + +     ++IGQF
Sbjct  149  DSGIGMTKKDLINNLGTIAKSGTAEFLGKMQDTSNTQEMNDMIGQF  194



>ref|XP_003405348.1| PREDICTED: endoplasmin [Loxodonta africana]
Length=801

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ +M       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNRMTEAQEEGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>sp|Q29092.3|ENPL_PIG RecName: Full=Endoplasmin; AltName: Full=94 kDa glucose-regulated 
protein; Short=GRP-94; AltName: Full=98 kDa protein kinase; 
Short=PPK 98; Short=ppk98; AltName: Full=Heat shock protein 
90 kDa beta member 1; AltName: Full=gp96 homolog; Flags: 
Precursor [Sus scrofa]
 emb|CAA53948.1| Ppk 98; a protein kinase [Sus scrofa]
Length=804

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 119/186 (64%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A  EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRAEDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMAEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>gb|ADR79285.1| Hsp90 beta [Brachionus ibericus]
Length=802

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 126/187 (67%), Gaps = 19/187 (10%)
 Frame = +1

Query  127  KIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAG  282
            ++HA  +++ D     PKV+E IG    G  TD +V +RE E +          + LR  
Sbjct  24   RVHAEDDIEVDES-SAPKVDEDIGKSREGSRTDDEVVQREEEQIKLDGLSVAEMKELRES  82

Query  283  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA  462
            +++ EF AEV+R+M +IINSLY NK+IFLRELISNASDALDKIRF+SLTDKD+LGE  T 
Sbjct  83   SKQ-EFVAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRFMSLTDKDVLGE--TE  139

Query  463  kleiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSS-------GD  621
            +L I+IK DK+ ++L I D GIGMTK+D++K LGTIAKS TS F+ K Q +         
Sbjct  140  ELSIRIKSDKENRMLHITDTGIGMTKDDMIKYLGTIAKSQTSEFLTKFQEAQASDNKQSM  199

Query  622  LNLIGQF  642
             +LIGQF
Sbjct  200  SDLIGQF  206



>ref|XP_005680600.1| PREDICTED: endoplasmin [Capra hircus]
Length=800

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 119/186 (64%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  15   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  69

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD+  L   +   
Sbjct  70   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDETALAGNEELT  129

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  130  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  186

Query  625  NLIGQF  642
             LIGQF
Sbjct  187  -LIGQF  191



>emb|CAA62352.1| protein kinase [Sus scrofa]
Length=808

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 119/186 (64%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A  EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRAEDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMAEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_005374635.1| PREDICTED: endoplasmin [Chinchilla lanigera]
Length=806

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 119/186 (64%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD+  L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDESALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_004623907.1| PREDICTED: endoplasmin [Octodon degus]
Length=806

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 119/186 (64%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD+  L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDESALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|NP_001039228.1| heat shock protein 90kDa beta (Grp94), member 1 precursor [Xenopus 
(Silurana) tropicalis]
 emb|CAJ82870.1| tumor rejection antigen (gp96) 1 [Xenopus (Silurana) tropicalis]
 gb|AAI21251.1| heat shock protein 90kDa beta (Grp94), member 1 [Xenopus (Silurana) 
tropicalis]
Length=803

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 119/186 (64%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A  EV+ DA V     E+ IG    G  TD +V  RE E++          + LR  +
Sbjct  19   VQAEDEVEVDATV-----EDDIGKSRDGSRTDDEVVSREEEAIQIDGLNAAQIKELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAANEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    GIGMTKEDLVKNLGTIAKSGTS F+ K+       QS+ + 
Sbjct  134  IKIKCDKEKNMLHITDT--GIGMTKEDLVKNLGTIAKSGTSEFLSKLTDAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|XP_001637407.1| predicted protein [Nematostella vectensis]
 gb|EDO45344.1| predicted protein [Nematostella vectensis]
Length=847

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 113/179 (63%), Gaps = 14/179 (8%)
 Frame = +1

Query  142  AEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAEKFE  297
            AE   + P   PKV++  G       TD +  +RE E++          + LR  AEK E
Sbjct  21   AEETKEEPESAPKVDDDAGKSRDASRTDDEAVQREEEAIKLDGLNVAQMKELRDKAEKHE  80

Query  298  FQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiq  477
            FQAEV+R+M +IINSLY NK+IFLRELISN+SDALDKIR +SLTDK     GD   ++I+
Sbjct  81   FQAEVNRMMKLIINSLYRNKEIFLRELISNSSDALDKIRLMSLTDKTAFDSGDELSIKIK  140

Query  478  ikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQ----SSGDLNLIGQF  642
               + +   ++    GIGMTKE+L+KNLGTIAKSGTS F +K+Q    S    +LIGQF
Sbjct  141  ADKENNILHVTDT--GIGMTKEELIKNLGTIAKSGTSEFFQKIQEAASSDSASDLIGQF  197



>emb|CAA28629.1| hsp 108 [Gallus gallus]
Length=792

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/179 (50%), Positives = 115/179 (64%), Gaps = 20/179 (11%)
 Frame = +1

Query  145  EVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF  300
            EVD DA V     EE +G    G  TD +V +RE E++          + +R  +EKF F
Sbjct  23   EVDVDATV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIKEIREKSEKFAF  77

Query  301  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqi  480
            QAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   ++I+ 
Sbjct  78   QAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKC  137

Query  481  kldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQ-----SSGDLNLIGQF  642
              +K+   ++    GIGMTKE+L+KNLGTIAKSGTS F+ KM      S     LIGQF
Sbjct  138  DKEKNMLHVTDT--GIGMTKEELIKNLGTIAKSGTSEFLNKMTEMQDDSQSTSELIGQF  194



>ref|XP_007454336.1| PREDICTED: endoplasmin [Lipotes vexillifer]
Length=803

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 120/186 (65%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ EVD D  V     E+ +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VQADDEVDVDGTV-----EDDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>gb|AAA48827.1| 108K heat shock protein [Gallus gallus]
Length=795

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/179 (50%), Positives = 115/179 (64%), Gaps = 20/179 (11%)
 Frame = +1

Query  145  EVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF  300
            EVD DA V     EE +G    G  TD +V +RE E++          + +R  +EKF F
Sbjct  23   EVDVDATV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIKEIREKSEKFAF  77

Query  301  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqi  480
            QAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   ++I+ 
Sbjct  78   QAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKC  137

Query  481  kldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQ-----SSGDLNLIGQF  642
              +K+   ++    GIGMTKE+L+KNLGTIAKSGTS F+ KM      S     LIGQF
Sbjct  138  DKEKNMLHVTDT--GIGMTKEELIKNLGTIAKSGTSEFLNKMTEMQDDSQSTSELIGQF  194



>gb|AEE63339.1| unknown [Dendroctonus ponderosae]
Length=781

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 119/176 (68%), Gaps = 15/176 (9%)
 Frame = +1

Query  151  DSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAEKFEFQA  306
            D DA  + P VE  +G    G  TD +V +RE E++          + +R  AEKF FQ 
Sbjct  21   DLDA-TETPSVEADLGAGKEGSRTDDEVVQREEEAIKLDGLNVAQLKEIRDRAEKFTFQT  79

Query  307  EVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikl  486
            EV+R+M +IINSLY NK+IFLRELISNASDA+DKIR LSLTDK +L      +L I+IK 
Sbjct  80   EVNRMMKLIINSLYRNKEIFLRELISNASDAIDKIRLLSLTDKSVLDA--VPELSIRIKA  137

Query  487  dkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQ---SSGDLN-LIGQF  642
            DK+  +L I D GIGMTK DLV NLGTIAKSGT+ F+ KMQ   SS DLN +IGQF
Sbjct  138  DKETGMLHITDTGIGMTKADLVNNLGTIAKSGTAEFLGKMQSAESSQDLNDMIGQF  193



>gb|ACF35012.1| heat shock protein 108 [Gallus gallus]
Length=790

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/179 (50%), Positives = 115/179 (64%), Gaps = 20/179 (11%)
 Frame = +1

Query  145  EVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF  300
            EVD DA V     EE +G    G  TD +V +RE E++          + +R  +EKF F
Sbjct  23   EVDVDATV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIKEIREKSEKFAF  77

Query  301  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqi  480
            QAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   ++I+ 
Sbjct  78   QAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKC  137

Query  481  kldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQ-----SSGDLNLIGQF  642
              +K+   ++    GIGMTKE+L+KNLGTIAKSGTS F+ KM      S     LIGQF
Sbjct  138  DKEKNMLHVTDT--GIGMTKEELIKNLGTIAKSGTSEFLNKMTEMQDDSQSTSELIGQF  194



>ref|XP_003694125.1| PREDICTED: endoplasmin-like [Apis florea]
Length=831

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 120/173 (69%), Gaps = 21/173 (12%)
 Frame = +1

Query  181  VEEKIGGVPHGLS-------TDPDVAKREAESM--------SKRTLRAGAEKFEFQAEVS  315
            VEE IG V + LS       TD +V +RE E++          + LR  AEKF FQ EV+
Sbjct  57   VEEDIGTVENDLSASREGSRTDNEVIQREEEAIKLDGLNVAQIKELREKAEKFTFQTEVN  116

Query  316  RLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkd  495
            R+M +IINSLY NKDIFLRELISNASDALDKIR LSLTDK++L      +L I+IK DK+
Sbjct  117  RIMKLIINSLYRNKDIFLRELISNASDALDKIRLLSLTDKNVLDTN--PELAIRIKSDKE  174

Query  496  kkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSG---DLN-LIGQF  642
             KILSI D GIGMTK +L+ NLGTIAKSGT+ F+ KMQ +    DLN +IGQF
Sbjct  175  NKILSITDSGIGMTKHELINNLGTIAKSGTAEFLGKMQETSNTQDLNDMIGQF  227



>dbj|BAI23208.1| heat shock protein 90kDa beta (Grp94), member 1 [Coturnix japonica]
Length=794

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/179 (50%), Positives = 115/179 (64%), Gaps = 20/179 (11%)
 Frame = +1

Query  145  EVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF  300
            EVD DA V     EE +G    G  TD +V +RE E++          + +R  +EKF F
Sbjct  23   EVDVDATV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIKEIREKSEKFAF  77

Query  301  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqi  480
            QAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   ++I+ 
Sbjct  78   QAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKC  137

Query  481  kldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQ-----SSGDLNLIGQF  642
              +K+   ++    GIGMTKE+L+KNLGTIAKSGTS F+ KM      S     LIGQF
Sbjct  138  DKEKNMLHVTDT--GIGMTKEELIKNLGTIAKSGTSEFLNKMTEMQNDSQSTSELIGQF  194



>ref|XP_006619420.1| PREDICTED: endoplasmin-like [Apis dorsata]
Length=798

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 121/173 (70%), Gaps = 21/173 (12%)
 Frame = +1

Query  181  VEEKIGGVPHGLS-------TDPDVAKREAESM--------SKRTLRAGAEKFEFQAEVS  315
            +EE IG V + LS       TD +V +RE E++          + LR  AEKF FQ EV+
Sbjct  24   MEEDIGTVENDLSASREGSRTDNEVIQREEEAIKLDGLNVAQIKELREKAEKFTFQTEVN  83

Query  316  RLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkd  495
            R+M +IINSLY NKDIFLRELISNASDALDKIR LSLTDK++L     ++L I+IK DK+
Sbjct  84   RIMKLIINSLYRNKDIFLRELISNASDALDKIRLLSLTDKNVLDTN--SELAIRIKSDKE  141

Query  496  kkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSG---DLN-LIGQF  642
             KILSI D GIGMTK +L+ NLGTIAKSGT+ F+ KMQ +    DLN +IGQF
Sbjct  142  NKILSITDSGIGMTKHELINNLGTIAKSGTAEFLGKMQETSNTQDLNDMIGQF  194



>ref|NP_999268.1| endoplasmin precursor [Sus scrofa]
 emb|CAA70347.1| gp96/GRP94 [Sus scrofa]
Length=804

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 119/186 (64%), Gaps = 24/186 (13%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A  EVD D  V     EE +G    G  TD ++ +RE E++          R LR  +
Sbjct  19   VRAEDEVDVDGTV-----EEDLGKSREGSRTDDEIVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDL  624
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ + 
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE-  190

Query  625  NLIGQF  642
             LIGQF
Sbjct  191  -LIGQF  195



>ref|NP_989620.1| endoplasmin precursor [Gallus gallus]
 sp|P08110.1|ENPL_CHICK RecName: Full=Endoplasmin; AltName: Full=Heat shock 108 kDa protein; 
Short=HSP 108; Short=HSP108; AltName: Full=Heat shock 
protein 90 kDa beta member 1; AltName: Full=Transferrin-binding 
protein; Flags: Precursor [Gallus gallus]
 gb|AAA48826.1| heat shock protein 108 [Gallus gallus]
Length=795

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/179 (50%), Positives = 115/179 (64%), Gaps = 20/179 (11%)
 Frame = +1

Query  145  EVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF  300
            EVD DA V     EE +G    G  TD +V +RE E++          + +R  +EKF F
Sbjct  23   EVDVDATV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIKEIREKSEKFAF  77

Query  301  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqi  480
            QAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   ++I+ 
Sbjct  78   QAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKC  137

Query  481  kldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQ-----SSGDLNLIGQF  642
              +K+   ++    GIGMTKE+L+KNLGTIAKSGTS F+ KM      S     LIGQF
Sbjct  138  DKEKNMLHVTDT--GIGMTKEELIKNLGTIAKSGTSEFLNKMTEMQDDSQSTSELIGQF  194



>gb|ERL91651.1| hypothetical protein D910_08979 [Dendroctonus ponderosae]
Length=781

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 119/176 (68%), Gaps = 15/176 (9%)
 Frame = +1

Query  151  DSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAEKFEFQA  306
            D DA  + P VE  +G    G  TD +V +RE E++          + +R  AEKF FQ 
Sbjct  21   DLDA-TETPSVEADLGAGKEGSRTDDEVVQREEEAIKLDGLNVAQLKEIRDRAEKFTFQT  79

Query  307  EVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikl  486
            EV+R+M +IINSLY NK+IFLRELISNASDA+DKIR LSLTDK +L      +L I+IK 
Sbjct  80   EVNRMMKLIINSLYRNKEIFLRELISNASDAIDKIRLLSLTDKSVLDA--VPELSIRIKA  137

Query  487  dkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQ---SSGDLN-LIGQF  642
            DK+  +L I D GIGMTK DLV NLGTIAKSGT+ F+ KMQ   SS DLN +IGQF
Sbjct  138  DKETGMLHITDTGIGMTKADLVNNLGTIAKSGTAEFLGKMQSAESSQDLNDMIGQF  193



>ref|NP_001083114.1| uncharacterized protein LOC398753 precursor [Xenopus laevis]
 gb|AAH60352.1| MGC68448 protein [Xenopus laevis]
Length=805

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 117/184 (64%), Gaps = 20/184 (11%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A  EV+ DA V     E+ IG    G  TD +V  RE E++          + +R  +
Sbjct  19   VQAEDEVEVDATV-----EDDIGKSREGSRTDDEVVSREEEAIQLDGLNAAQIKEIREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLMSLTDENALAANEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGD-----LNL  630
            ++I+   +K+   ++    GIGMTKE+LVKNLGTIAKSGTS F+ K+  + D       L
Sbjct  134  IKIKCDKEKNMLQITDT--GIGMTKEELVKNLGTIAKSGTSEFLSKLTEAQDDGQSTSEL  191

Query  631  IGQF  642
            IGQF
Sbjct  192  IGQF  195



>ref|XP_008062311.1| PREDICTED: endoplasmin isoform X1 [Tarsius syrichta]
Length=804

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 119/184 (65%), Gaps = 24/184 (13%)
 Frame = +1

Query  136  ANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEK  291
            A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +EK
Sbjct  21   ADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKSEK  75

Query  292  FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkle  471
            F FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   ++
Sbjct  76   FAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELTVK  135

Query  472  iqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDLNL  630
            I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM       QS+ +  L
Sbjct  136  IKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE--L  191

Query  631  IGQF  642
            IGQF
Sbjct  192  IGQF  195



>ref|XP_003401925.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmin-like [Bombus terrestris]
Length=798

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 116/166 (70%), Gaps = 14/166 (8%)
 Frame = +1

Query  181  VEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAEKFEFQAEVSRLMDIII  336
            VE  +G    G  TD +V +RE E++          + LR  AEKF FQ EV+R+M +II
Sbjct  31   VENDLGASREGSRTDNEVVQREEEAIKLDGLNVAQIKELREKAEKFTFQTEVNRMMKLII  90

Query  337  NSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkkilsir  516
            NSLY NKDIFLRELISNASDALDKIR LSLTDK++L      +L I+IK DK+ KILSI 
Sbjct  91   NSLYRNKDIFLRELISNASDALDKIRLLSLTDKNVLDTN--PELAIRIKTDKENKILSIT  148

Query  517  dRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSG---DLN-LIGQF  642
            D GIGMTK +L+ NLGTIAKSGT+ F+ KMQ +    DLN +IGQF
Sbjct  149  DSGIGMTKNELINNLGTIAKSGTAEFLGKMQDTSNAQDLNDMIGQF  194



>ref|XP_004602837.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmin [Sorex araneus]
Length=759

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 117/184 (64%), Gaps = 20/184 (11%)
 Frame = +1

Query  130  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  285
            + A+ E+D D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDELDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  286  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAk  465
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT  133

Query  466  leiqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQ-----SSGDLNL  630
            ++I+   +K+   ++    G+GMT+E+LVKNLGTIAKSGTS F+ KM      S     L
Sbjct  134  VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDSQSTSEL  191

Query  631  IGQF  642
            IGQF
Sbjct  192  IGQF  195



>ref|XP_003461118.1| PREDICTED: endoplasmin isoform X1 [Cavia porcellus]
Length=807

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 118/184 (64%), Gaps = 24/184 (13%)
 Frame = +1

Query  136  ANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEK  291
            A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +EK
Sbjct  21   ADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKSEK  75

Query  292  FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkle  471
            F FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD+  L   +   ++
Sbjct  76   FAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDESALSGNEELTVK  135

Query  472  iqikldkdkkilsirdRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDLNL  630
            I+   +K+   ++    GIGMT+E+LVKNLGTIAKSGTS F+ KM       QS+ +  L
Sbjct  136  IKCDKEKNLLHVTDT--GIGMTREELVKNLGTIAKSGTSEFLNKMTEAQEEGQSTSE--L  191

Query  631  IGQF  642
            IGQF
Sbjct  192  IGQF  195



Lambda      K        H        a         alpha
   0.315    0.132    0.359    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 960833956375