BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF041D20

Length=648
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009615227.1|  PREDICTED: uncharacterized protein LOC104107982    220   2e-65   Nicotiana tomentosiformis
ref|XP_007032242.1|  Uncharacterized protein isoform 5                  214   7e-65   
ref|XP_009804785.1|  PREDICTED: uncharacterized protein LOC104249949    218   9e-65   Nicotiana sylvestris
ref|XP_007032240.1|  Uncharacterized protein isoform 3                  215   1e-64   
ref|XP_007032243.1|  Uncharacterized protein isoform 6                  215   2e-64   
ref|XP_011101979.1|  PREDICTED: uncharacterized protein LOC105180...    216   3e-64   Sesamum indicum [beniseed]
ref|XP_011101977.1|  PREDICTED: uncharacterized protein LOC105180...    216   6e-64   Sesamum indicum [beniseed]
ref|XP_011101978.1|  PREDICTED: uncharacterized protein LOC105180...    216   6e-64   Sesamum indicum [beniseed]
ref|XP_007032239.1|  Uncharacterized protein isoform 2                  215   9e-64   
ref|XP_007032241.1|  Uncharacterized protein isoform 4                  215   9e-64   
ref|XP_007032238.1|  Uncharacterized protein isoform 1                  215   1e-63   
emb|CDP06352.1|  unnamed protein product                                214   3e-63   Coffea canephora [robusta coffee]
ref|XP_004249013.1|  PREDICTED: uncharacterized protein LOC101255446    214   3e-63   Solanum lycopersicum
ref|XP_002264842.2|  PREDICTED: uncharacterized protein LOC100243...    212   1e-62   Vitis vinifera
ref|XP_010653095.1|  PREDICTED: uncharacterized protein LOC100243...    212   2e-62   Vitis vinifera
ref|XP_006362325.1|  PREDICTED: uncharacterized protein LOC102585892    209   2e-61   Solanum tuberosum [potatoes]
gb|KDO64224.1|  hypothetical protein CISIN_1g025201mg                   202   4e-61   Citrus sinensis [apfelsine]
gb|KDO64222.1|  hypothetical protein CISIN_1g025201mg                   202   1e-60   Citrus sinensis [apfelsine]
gb|KHG16695.1|  Retinal-binding                                         205   8e-60   Gossypium arboreum [tree cotton]
ref|XP_009370848.1|  PREDICTED: uncharacterized protein LOC103960157    202   1e-58   Pyrus x bretschneideri [bai li]
ref|XP_006429676.1|  hypothetical protein CICLE_v10011748mg             201   2e-58   
gb|KDO64221.1|  hypothetical protein CISIN_1g025201mg                   196   2e-58   Citrus sinensis [apfelsine]
ref|XP_006429677.1|  hypothetical protein CICLE_v10011748mg             201   2e-58   
ref|XP_006429678.1|  hypothetical protein CICLE_v10011748mg             201   2e-58   
gb|EYU42069.1|  hypothetical protein MIMGU_mgv1a006657mg                200   2e-58   Erythranthe guttata [common monkey flower]
ref|XP_006429679.1|  hypothetical protein CICLE_v10011748mg             201   3e-58   Citrus clementina [clementine]
ref|XP_010036049.1|  PREDICTED: uncharacterized protein LOC104425150    200   7e-58   Eucalyptus grandis [rose gum]
emb|CDY38154.1|  BnaA07g02290D                                          192   1e-57   Brassica napus [oilseed rape]
gb|EYU42068.1|  hypothetical protein MIMGU_mgv1a006657mg                199   1e-57   Erythranthe guttata [common monkey flower]
gb|EYU42067.1|  hypothetical protein MIMGU_mgv1a006657mg                199   1e-57   Erythranthe guttata [common monkey flower]
ref|XP_009337845.1|  PREDICTED: uncharacterized protein LOC103930264    198   5e-57   Pyrus x bretschneideri [bai li]
gb|KJB27584.1|  hypothetical protein B456_005G0011002                   188   7e-57   Gossypium raimondii
ref|XP_010278895.1|  PREDICTED: uncharacterized protein LOC104612935    196   1e-56   Nelumbo nucifera [Indian lotus]
ref|XP_006599750.1|  PREDICTED: uncharacterized protein LOC100795...    196   2e-56   Glycine max [soybeans]
gb|KDO64223.1|  hypothetical protein CISIN_1g025201mg                   191   2e-56   Citrus sinensis [apfelsine]
gb|KHN24577.1|  hypothetical protein glysoja_014181                     196   3e-56   Glycine soja [wild soybean]
ref|XP_003548341.1|  PREDICTED: uncharacterized protein LOC100795...    196   3e-56   Glycine max [soybeans]
ref|XP_008370316.1|  PREDICTED: uncharacterized protein LOC103433803    195   5e-56   
ref|XP_010113031.1|  hypothetical protein L484_022756                   195   2e-55   
ref|XP_008244213.1|  PREDICTED: uncharacterized protein LOC103342365    193   3e-55   Prunus mume [ume]
gb|EPS68255.1|  hypothetical protein M569_06516                         193   4e-55   Genlisea aurea
ref|XP_004510081.1|  PREDICTED: uncharacterized protein LOC101493...    192   4e-55   Cicer arietinum [garbanzo]
ref|XP_009130614.1|  PREDICTED: uncharacterized protein LOC103855...    191   7e-55   Brassica rapa
ref|XP_009125386.1|  PREDICTED: uncharacterized protein LOC103850397    192   7e-55   Brassica rapa
ref|XP_003521546.1|  PREDICTED: uncharacterized protein LOC100778...    191   1e-54   Glycine max [soybeans]
ref|XP_009130613.1|  PREDICTED: uncharacterized protein LOC103855...    191   2e-54   Brassica rapa
gb|KDP21813.1|  hypothetical protein JCGZ_00600                         191   3e-54   Jatropha curcas
ref|XP_004302492.1|  PREDICTED: uncharacterized protein LOC101292427    191   3e-54   Fragaria vesca subsp. vesca
emb|CDY11168.1|  BnaA03g00040D                                          190   7e-54   Brassica napus [oilseed rape]
gb|AFK45888.1|  unknown                                                 183   8e-54   Lotus japonicus
ref|XP_006398546.1|  hypothetical protein EUTSA_v10013603mg             188   1e-53   
ref|XP_006398547.1|  hypothetical protein EUTSA_v10013603mg             189   1e-53   Eutrema salsugineum [saltwater cress]
ref|XP_006398545.1|  hypothetical protein EUTSA_v10013603mg             188   1e-53   
ref|XP_007134600.1|  hypothetical protein PHAVU_010G060400g             189   2e-53   Phaseolus vulgaris [French bean]
ref|XP_002519981.1|  conserved hypothetical protein                     189   2e-53   Ricinus communis
ref|XP_002872981.1|  hypothetical protein ARALYDRAFT_486867             188   2e-53   
ref|NP_001154688.1|  uncharacterized protein                            187   3e-53   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195721.5|  uncharacterized protein                               187   4e-53   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD43795.1|  unknown protein                                        187   4e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010490476.1|  PREDICTED: uncharacterized protein LOC104768...    187   4e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010490477.1|  PREDICTED: uncharacterized protein LOC104768...    187   4e-53   Camelina sativa [gold-of-pleasure]
dbj|BAH57023.1|  AT5G01010                                              187   4e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010496822.1|  PREDICTED: uncharacterized protein LOC104773850    187   8e-53   Camelina sativa [gold-of-pleasure]
ref|NP_001154687.1|  uncharacterized protein                            187   1e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006842639.1|  hypothetical protein AMTR_s00077p00188630          186   1e-52   Amborella trichopoda
ref|XP_007205211.1|  hypothetical protein PRUPE_ppa005889mg             186   2e-52   
dbj|BAD43433.1|  unknown protein                                        185   3e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006279346.1|  hypothetical protein CARUB_v10012733mg             184   6e-52   Capsella rubella
ref|XP_008463317.1|  PREDICTED: uncharacterized protein LOC103501...    182   3e-51   Cucumis melo [Oriental melon]
ref|XP_010543129.1|  PREDICTED: uncharacterized protein LOC104816...    181   4e-51   Tarenaya hassleriana [spider flower]
ref|XP_008463316.1|  PREDICTED: uncharacterized protein LOC103501...    182   5e-51   Cucumis melo [Oriental melon]
ref|XP_010543128.1|  PREDICTED: uncharacterized protein LOC104816...    181   6e-51   Tarenaya hassleriana [spider flower]
ref|XP_004163944.1|  PREDICTED: uncharacterized LOC101218161            179   7e-51   
ref|XP_010543127.1|  PREDICTED: uncharacterized protein LOC104816...    181   2e-50   Tarenaya hassleriana [spider flower]
ref|XP_010543126.1|  PREDICTED: uncharacterized protein LOC104816...    180   3e-50   Tarenaya hassleriana [spider flower]
ref|XP_004147520.1|  PREDICTED: uncharacterized protein LOC101218161    179   5e-50   Cucumis sativus [cucumbers]
gb|KFK24699.1|  hypothetical protein AALP_AA8G013300                    178   2e-49   Arabis alpina [alpine rockcress]
ref|XP_010673452.1|  PREDICTED: uncharacterized protein LOC104889827    176   1e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010938085.1|  PREDICTED: uncharacterized protein LOC105057...    175   1e-48   Elaeis guineensis
ref|XP_010938084.1|  PREDICTED: uncharacterized protein LOC105057...    175   2e-48   Elaeis guineensis
ref|XP_011006222.1|  PREDICTED: uncharacterized protein LOC105112277    173   1e-47   Populus euphratica
ref|XP_002323111.2|  hypothetical protein POPTR_0016s15030g             172   2e-47   
ref|NP_001190197.1|  uncharacterized protein                            171   1e-46   
ref|XP_008793391.1|  PREDICTED: uncharacterized protein LOC103709...    169   3e-46   
ref|XP_008793389.1|  PREDICTED: uncharacterized protein LOC103709...    169   6e-46   Phoenix dactylifera
ref|XP_003626627.1|  hypothetical protein MTR_8g005040                  164   2e-44   Medicago truncatula
ref|XP_010921251.1|  PREDICTED: uncharacterized protein LOC105044...    163   8e-44   Elaeis guineensis
ref|XP_010921250.1|  PREDICTED: uncharacterized protein LOC105044...    163   8e-44   Elaeis guineensis
gb|AFW77522.1|  hypothetical protein ZEAMMB73_436424                    157   2e-43   
ref|XP_004962482.1|  PREDICTED: uncharacterized protein LOC101772...    161   4e-43   Setaria italica
ref|XP_004962483.1|  PREDICTED: uncharacterized protein LOC101772...    161   4e-43   
ref|XP_004962481.1|  PREDICTED: uncharacterized protein LOC101772...    160   5e-43   Setaria italica
ref|XP_009391656.1|  PREDICTED: uncharacterized protein LOC103977773    160   8e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006654248.1|  PREDICTED: uncharacterized protein LOC102707586    159   2e-42   Oryza brachyantha
gb|AFW77521.1|  hypothetical protein ZEAMMB73_436424                    157   5e-42   
ref|XP_010231534.1|  PREDICTED: uncharacterized protein LOC100826...    155   6e-42   
ref|XP_002440877.1|  hypothetical protein SORBIDRAFT_09g012090          149   2e-41   
dbj|BAJ93195.1|  predicted protein                                      156   2e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003568677.1|  PREDICTED: uncharacterized protein LOC100826...    155   3e-41   Brachypodium distachyon [annual false brome]
ref|XP_010231533.1|  PREDICTED: uncharacterized protein LOC100826...    155   5e-41   
ref|XP_008782731.1|  PREDICTED: uncharacterized protein LOC103702...    154   2e-40   Phoenix dactylifera
ref|XP_008649464.1|  PREDICTED: uncharacterized protein LOC103630...    154   2e-40   Zea mays [maize]
ref|XP_008649463.1|  PREDICTED: uncharacterized protein LOC103630...    154   3e-40   Zea mays [maize]
gb|EEE63181.1|  hypothetical protein OsJ_17990                          150   3e-39   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001055152.1|  Os05g0306000                                       150   3e-39   
gb|EMS49914.1|  hypothetical protein TRIUR3_19770                       148   2e-38   Triticum urartu
gb|EMT26757.1|  hypothetical protein F775_30139                         147   7e-38   
gb|KJB27585.1|  hypothetical protein B456_005G0011002                   122   1e-31   Gossypium raimondii
ref|XP_001765571.1|  predicted protein                                  120   4e-28   
ref|XP_008793390.1|  PREDICTED: uncharacterized protein LOC103709...    115   2e-26   
ref|XP_002991009.1|  hypothetical protein SELMODRAFT_161364             109   2e-24   
ref|XP_002980642.1|  hypothetical protein SELMODRAFT_154057             109   2e-24   
gb|KDO64225.1|  hypothetical protein CISIN_1g025201mg                   105   3e-24   Citrus sinensis [apfelsine]
dbj|BAD43927.1|  unnamed protein product                              82.8    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006381292.1|  hypothetical protein POPTR_0006s11480g           66.2    5e-11   
ref|XP_004353064.1|  serpin, putative                                 70.5    9e-11   Acanthamoeba castellanii str. Neff
ref|XP_010921253.1|  PREDICTED: uncharacterized protein LOC105044...  62.4    4e-08   
ref|XP_010921254.1|  PREDICTED: uncharacterized protein LOC105044...  62.0    4e-08   
ref|XP_010496718.1|  PREDICTED: uncharacterized protein LOC104773766  60.8    9e-08   



>ref|XP_009615227.1| PREDICTED: uncharacterized protein LOC104107982 [Nicotiana tomentosiformis]
Length=439

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGL+PITRAFLASYYDK+ F PLS++VSRL DEI SMA DL +G  L+EGES LV 
Sbjct  1    MASTEGLMPITRAFLASYYDKYPFTPLSEDVSRLSDEIYSMANDLHEGSPLTEGESSLVR  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EAE  PPHK+DEN+WKNREQIEEILFL + SNWP +L+ QSTA+DAEL ++L RL EKF 
Sbjct  61   EAERPPPHKVDENLWKNREQIEEILFLSESSNWPPVLKSQSTAEDAELVSLLGRLGEKFR  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            + L+VL TFQ+RNSE VFNTVMTY+PQD
Sbjct  121  NTLKVLETFQSRNSEFVFNTVMTYMPQD  148



>ref|XP_007032242.1| Uncharacterized protein isoform 5 [Theobroma cacao]
 ref|XP_007032244.1| Uncharacterized protein isoform 5 [Theobroma cacao]
 gb|EOY03168.1| Uncharacterized protein isoform 5 [Theobroma cacao]
 gb|EOY03170.1| Uncharacterized protein isoform 5 [Theobroma cacao]
Length=309

 Score =   214 bits (546),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITR FLASYYDK+ F PLSD+VSRL  EIRS A+DL QG   ++GESLL+ 
Sbjct  1    MASTEGLVPITRTFLASYYDKYPFDPLSDDVSRLSFEIRSFAQDLLQGLPPTQGESLLIQ  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA+S PPHKIDENMWKNRE IEEILFLL+RS+WP +LQQ ST++ AE   +  RLK+KF+
Sbjct  61   EADSQPPHKIDENMWKNREHIEEILFLLERSHWPPLLQQPSTSEVAEFATICGRLKDKFQ  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
              L +L +FQ+RNSE VFNTVMTY+PQD
Sbjct  121  RILRILASFQSRNSERVFNTVMTYMPQD  148



>ref|XP_009804785.1| PREDICTED: uncharacterized protein LOC104249949 [Nicotiana sylvestris]
Length=439

 Score =   218 bits (555),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGL+PITRAFLASYYDK+ F PLS++VSRL D+I SMA DL +   L+EGES LV 
Sbjct  1    MASTEGLMPITRAFLASYYDKYPFTPLSEDVSRLSDQIHSMANDLHEDSPLTEGESSLVR  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EAES PPHK+DEN+WKNREQIEEILFL + SNWP +L+ QSTA+DAEL ++L RL EKF 
Sbjct  61   EAESPPPHKVDENLWKNREQIEEILFLSESSNWPPVLKSQSTAEDAELASLLGRLGEKFR  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            + L+V+ TFQ+RNSE VFNTVMTY+PQD
Sbjct  121  NTLKVVETFQSRNSEFVFNTVMTYMPQD  148



>ref|XP_007032240.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY03166.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=343

 Score =   215 bits (547),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITR FLASYYDK+ F PLSD+VSRL  EIRS A+DL QG   ++GESLL+ 
Sbjct  1    MASTEGLVPITRTFLASYYDKYPFDPLSDDVSRLSFEIRSFAQDLLQGLPPTQGESLLIQ  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA+S PPHKIDENMWKNRE IEEILFLL+RS+WP +LQQ ST++ AE   +  RLK+KF+
Sbjct  61   EADSQPPHKIDENMWKNREHIEEILFLLERSHWPPLLQQPSTSEVAEFATICGRLKDKFQ  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
              L +L +FQ+RNSE VFNTVMTY+PQD
Sbjct  121  RILRILASFQSRNSERVFNTVMTYMPQD  148



>ref|XP_007032243.1| Uncharacterized protein isoform 6, partial [Theobroma cacao]
 gb|EOY03169.1| Uncharacterized protein isoform 6, partial [Theobroma cacao]
Length=372

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITR FLASYYDK+ F PLSD+VSRL  EIRS A+DL QG   ++GESLL+ 
Sbjct  1    MASTEGLVPITRTFLASYYDKYPFDPLSDDVSRLSFEIRSFAQDLLQGLPPTQGESLLIQ  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA+S PPHKIDENMWKNRE IEEILFLL+RS+WP +LQQ ST++ AE   +  RLK+KF+
Sbjct  61   EADSQPPHKIDENMWKNREHIEEILFLLERSHWPPLLQQPSTSEVAEFATICGRLKDKFQ  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
              L +L +FQ+RNSE VFNTVMTY+PQD
Sbjct  121  RILRILASFQSRNSERVFNTVMTYMPQD  148



>ref|XP_011101979.1| PREDICTED: uncharacterized protein LOC105180011 isoform X3 [Sesamum 
indicum]
Length=411

 Score =   216 bits (550),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            M STEGLVPITRAFLASYYDK+ FPPLS +VSRL D I  MA DL +    ++GE LLV 
Sbjct  1    MVSTEGLVPITRAFLASYYDKYPFPPLSIDVSRLSDRIYVMATDLLKDSPPTQGERLLVE  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EAE  PPHK+DENMWKNREQIEEILF+L+  NWP  LQQQSTA+DAEL +VL RL+EKF 
Sbjct  61   EAERQPPHKVDENMWKNREQIEEILFMLEVPNWPRALQQQSTAEDAELASVLERLREKFN  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            S L+ L  FQARNSE VFNTVMTY+PQD
Sbjct  121  STLKTLAYFQARNSEFVFNTVMTYMPQD  148



>ref|XP_011101977.1| PREDICTED: uncharacterized protein LOC105180011 isoform X1 [Sesamum 
indicum]
Length=437

 Score =   216 bits (550),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            M STEGLVPITRAFLASYYDK+ FPPLS +VSRL D I  MA DL +    ++GE LLV 
Sbjct  1    MVSTEGLVPITRAFLASYYDKYPFPPLSIDVSRLSDRIYVMATDLLKDSPPTQGERLLVE  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EAE  PPHK+DENMWKNREQIEEILF+L+  NWP  LQQQSTA+DAEL +VL RL+EKF 
Sbjct  61   EAERQPPHKVDENMWKNREQIEEILFMLEVPNWPRALQQQSTAEDAELASVLERLREKFN  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            S L+ L  FQARNSE VFNTVMTY+PQD
Sbjct  121  STLKTLAYFQARNSEFVFNTVMTYMPQD  148



>ref|XP_011101978.1| PREDICTED: uncharacterized protein LOC105180011 isoform X2 [Sesamum 
indicum]
Length=436

 Score =   216 bits (549),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            M STEGLVPITRAFLASYYDK+ FPPLS +VSRL D I  MA DL +    ++GE LLV 
Sbjct  1    MVSTEGLVPITRAFLASYYDKYPFPPLSIDVSRLSDRIYVMATDLLKDSPPTQGERLLVE  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EAE  PPHK+DENMWKNREQIEEILF+L+  NWP  LQQQSTA+DAEL +VL RL+EKF 
Sbjct  61   EAERQPPHKVDENMWKNREQIEEILFMLEVPNWPRALQQQSTAEDAELASVLERLREKFN  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            S L+ L  FQARNSE VFNTVMTY+PQD
Sbjct  121  STLKTLAYFQARNSEFVFNTVMTYMPQD  148



>ref|XP_007032239.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY03165.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=428

 Score =   215 bits (548),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITR FLASYYDK+ F PLSD+VSRL  EIRS A+DL QG   ++GESLL+ 
Sbjct  1    MASTEGLVPITRTFLASYYDKYPFDPLSDDVSRLSFEIRSFAQDLLQGLPPTQGESLLIQ  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA+S PPHKIDENMWKNRE IEEILFLL+RS+WP +LQQ ST++ AE   +  RLK+KF+
Sbjct  61   EADSQPPHKIDENMWKNREHIEEILFLLERSHWPPLLQQPSTSEVAEFATICGRLKDKFQ  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
              L +L +FQ+RNSE VFNTVMTY+PQD
Sbjct  121  RILRILASFQSRNSERVFNTVMTYMPQD  148



>ref|XP_007032241.1| Uncharacterized protein isoform 4 [Theobroma cacao]
 gb|EOY03167.1| Uncharacterized protein isoform 4 [Theobroma cacao]
Length=422

 Score =   215 bits (547),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITR FLASYYDK+ F PLSD+VSRL  EIRS A+DL QG   ++GESLL+ 
Sbjct  1    MASTEGLVPITRTFLASYYDKYPFDPLSDDVSRLSFEIRSFAQDLLQGLPPTQGESLLIQ  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA+S PPHKIDENMWKNRE IEEILFLL+RS+WP +LQQ ST++ AE   +  RLK+KF+
Sbjct  61   EADSQPPHKIDENMWKNREHIEEILFLLERSHWPPLLQQPSTSEVAEFATICGRLKDKFQ  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
              L +L +FQ+RNSE VFNTVMTY+PQD
Sbjct  121  RILRILASFQSRNSERVFNTVMTYMPQD  148



>ref|XP_007032238.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY03164.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=438

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITR FLASYYDK+ F PLSD+VSRL  EIRS A+DL QG   ++GESLL+ 
Sbjct  1    MASTEGLVPITRTFLASYYDKYPFDPLSDDVSRLSFEIRSFAQDLLQGLPPTQGESLLIQ  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA+S PPHKIDENMWKNRE IEEILFLL+RS+WP +LQQ ST++ AE   +  RLK+KF+
Sbjct  61   EADSQPPHKIDENMWKNREHIEEILFLLERSHWPPLLQQPSTSEVAEFATICGRLKDKFQ  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
              L +L +FQ+RNSE VFNTVMTY+PQD
Sbjct  121  RILRILASFQSRNSERVFNTVMTYMPQD  148



>emb|CDP06352.1| unnamed protein product [Coffea canephora]
Length=433

 Score =   214 bits (545),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITR+FLASYYDK+ FPPLSD+VSRL  EIRS++ DL +    S+GE+LL+ 
Sbjct  1    MASTEGLVPITRSFLASYYDKYMFPPLSDDVSRLSAEIRSLSGDLLKDSPPSQGETLLIR  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            E+E  PPHKIDEN+WKNREQIEEI+FLL+ SNWPT LQQQ T +  EL ++L RLKEKFE
Sbjct  61   ESEKQPPHKIDENLWKNREQIEEIIFLLETSNWPTSLQQQLTGEHTELVSLLSRLKEKFE  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            S  ++L  FQ+RNSE VFNTVMTY+PQD
Sbjct  121  SIFKLLEHFQSRNSEFVFNTVMTYMPQD  148



>ref|XP_004249013.1| PREDICTED: uncharacterized protein LOC101255446 [Solanum lycopersicum]
Length=435

 Score =   214 bits (544),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGL+PITRAFL+SYYDK+ F PLS +VSRL DEI SMA++LQ+   L+EGES LV 
Sbjct  1    MASTEGLMPITRAFLSSYYDKYPFSPLSQDVSRLTDEIHSMAKNLQKDAPLTEGESSLVL  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EAES PPHK+DEN+WKNREQ+EEILFLL+ SNWP  LQ QST +D EL +VL RL EKF 
Sbjct  61   EAESHPPHKVDENLWKNREQLEEILFLLESSNWPPALQLQSTTEDVELVSVLERLGEKFR  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            S L+ L TFQ++NSE VFNTVMTY+PQD
Sbjct  121  STLKSLQTFQSKNSEFVFNTVMTYMPQD  148



>ref|XP_002264842.2| PREDICTED: uncharacterized protein LOC100243295 isoform X1 [Vitis 
vinifera]
 emb|CBI31130.3| unnamed protein product [Vitis vinifera]
Length=439

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITR FLAS+YDK+ F  LSD+VSRL  +IRSMA DL     L+ GE+LLV 
Sbjct  1    MASTEGLVPITRNFLASFYDKYPFQSLSDDVSRLSYQIRSMASDLHNDSPLTPGETLLVK  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA+  PPHKIDENMWKNREQIEEILFLL+RS+WP +LQ+QST +DAELG +L  LK+KF+
Sbjct  61   EADCPPPHKIDENMWKNREQIEEILFLLERSHWPPLLQRQSTPEDAELGLILGHLKDKFQ  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            + +++L  FQ++NSE++FNTVMTY+PQD
Sbjct  121  NTMKILQAFQSKNSENIFNTVMTYMPQD  148



>ref|XP_010653095.1| PREDICTED: uncharacterized protein LOC100243295 isoform X2 [Vitis 
vinifera]
 emb|CAQ58613.1| Unknown gene [Vitis vinifera]
Length=432

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITR FLAS+YDK+ F  LSD+VSRL  +IRSMA DL     L+ GE+LLV 
Sbjct  1    MASTEGLVPITRNFLASFYDKYPFQSLSDDVSRLSYQIRSMASDLHNDSPLTPGETLLVK  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA+  PPHKIDENMWKNREQIEEILFLL+RS+WP +LQ+QST +DAELG +L  LK+KF+
Sbjct  61   EADCPPPHKIDENMWKNREQIEEILFLLERSHWPPLLQRQSTPEDAELGLILGHLKDKFQ  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            + +++L  FQ++NSE++FNTVMTY+PQD
Sbjct  121  NTMKILQAFQSKNSENIFNTVMTYMPQD  148



>ref|XP_006362325.1| PREDICTED: uncharacterized protein LOC102585892 [Solanum tuberosum]
Length=439

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MAST+GL+PITRAFL+SYYDK+ F PLS +VSRL DEI SMA++LQ+   L+EGES LV 
Sbjct  1    MASTDGLMPITRAFLSSYYDKYPFSPLSQDVSRLTDEIHSMAKNLQKDAPLTEGESSLVL  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EAES PPHK+DEN+WKNREQ+EE+LFLL+  NWP  LQ QST +D EL +VL RL EKF+
Sbjct  61   EAESHPPHKVDENLWKNREQLEEMLFLLEIPNWPPALQLQSTTEDVELVSVLGRLGEKFQ  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            S L+ L TFQ++NSE VFNTVMTY+PQD
Sbjct  121  STLKSLQTFQSKNSEFVFNTVMTYMPQD  148



>gb|KDO64224.1| hypothetical protein CISIN_1g025201mg [Citrus sinensis]
Length=209

 Score =   202 bits (513),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 114/148 (77%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITR FLASYYDK+  PPLSD+VSRL  +IRS+A DL      S+ ESLL+ 
Sbjct  1    MASTEGLVPITRNFLASYYDKYPAPPLSDDVSRLSSQIRSLANDLLLDSPPSQEESLLIE  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA+  PPHKIDENMWKNRE +EEI+FLLKRS+WP  LQQ S  +D EL  VL +L EKFE
Sbjct  61   EADRQPPHKIDENMWKNREHMEEIIFLLKRSHWPATLQQSSAPEDVELANVLGKLSEKFE  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
              L  L +FQA NS+ +FNTVMTY+PQD
Sbjct  121  KTLNTLKSFQAVNSDRIFNTVMTYMPQD  148



>gb|KDO64222.1| hypothetical protein CISIN_1g025201mg [Citrus sinensis]
Length=253

 Score =   202 bits (513),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 114/148 (77%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITR FLASYYDK+  PPLSD+VSRL  +IRS+A DL      S+ ESLL+ 
Sbjct  1    MASTEGLVPITRNFLASYYDKYPAPPLSDDVSRLSSQIRSLANDLLLDSPPSQEESLLIE  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA+  PPHKIDENMWKNRE +EEI+FLLKRS+WP  LQQ S  +D EL  VL +L EKFE
Sbjct  61   EADRQPPHKIDENMWKNREHMEEIIFLLKRSHWPATLQQSSAPEDVELANVLGKLSEKFE  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
              L  L +FQA NS+ +FNTVMTY+PQD
Sbjct  121  KTLNTLKSFQAVNSDRIFNTVMTYMPQD  148



>gb|KHG16695.1| Retinal-binding [Gossypium arboreum]
Length=442

 Score =   205 bits (522),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MAST GLVPITRAFLASYY+K+ F PL D+VSRL  +IRS  +DL QG   ++GESLL+ 
Sbjct  1    MASTGGLVPITRAFLASYYEKYPFDPLPDDVSRLSSQIRSFIQDLIQGFPPTQGESLLIQ  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA++ PPHK+DENMWKNRE IEEILFLL+R +WP++LQQ STA+ AE    L +LK+KF+
Sbjct  61   EADTQPPHKMDENMWKNRENIEEILFLLERPHWPSVLQQSSTAEVAEFATTLGQLKDKFQ  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            + L +L +FQ+RNSE VFNTVMTY+PQD
Sbjct  121  ATLTILESFQSRNSERVFNTVMTYMPQD  148



>ref|XP_009370848.1| PREDICTED: uncharacterized protein LOC103960157 [Pyrus x bretschneideri]
Length=440

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 122/149 (82%), Gaps = 1/149 (1%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGES-LLV  381
            MASTEG+VPITRAFLASYYD +QFPPLS++V+RL  EIRS+  DL +    ++GE  LLV
Sbjct  1    MASTEGIVPITRAFLASYYDTYQFPPLSNDVARLSAEIRSLTADLLRHSPAAQGEERLLV  60

Query  382  HEAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKF  561
             E ES PPHK+DENMWKNRE +EEILFLL++S+WP  L++QS+  DAEL  V+ RL +KF
Sbjct  61   SELESEPPHKVDENMWKNREHMEEILFLLEKSHWPQTLRKQSSPDDAELATVIDRLHQKF  120

Query  562  ESALEVLVTFQARNSEHVFNTVMTYLPQD  648
            +++L+ L TFQA+NSE VFNTVMTY+PQD
Sbjct  121  QTSLKTLETFQAKNSERVFNTVMTYIPQD  149



>ref|XP_006429676.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
 gb|ESR42916.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
Length=424

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 114/148 (77%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITR FLASYYDK+  PPLSD+VSRL  +IRS+A DL      S+ ESLL+ 
Sbjct  1    MASTEGLVPITRNFLASYYDKYPAPPLSDDVSRLSSQIRSLANDLLLDSPPSQEESLLIE  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA+  PPHKIDENMWKNRE +EEI+FLLKRS+WP  LQQ S  +D EL  VL +L EKFE
Sbjct  61   EADRQPPHKIDENMWKNREHMEEIIFLLKRSHWPATLQQSSAPEDVELANVLGKLSEKFE  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
              L  L +FQA NS+ +FNTVMTY+PQD
Sbjct  121  KTLNTLKSFQAVNSDRIFNTVMTYMPQD  148



>gb|KDO64221.1| hypothetical protein CISIN_1g025201mg [Citrus sinensis]
Length=256

 Score =   196 bits (498),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 114/151 (75%), Gaps = 3/151 (2%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITR FLASYYDK+  PPLSD+VSRL  +IRS+A DL      S+ ESLL+ 
Sbjct  1    MASTEGLVPITRNFLASYYDKYPAPPLSDDVSRLSSQIRSLANDLLLDSPPSQEESLLIE  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTM---LQQQSTAQDAELGAVLLRLKE  555
            EA+  PPHKIDENMWKNRE +EEI+FLLKRS+WP     LQQ S  +D EL  VL +L E
Sbjct  61   EADRQPPHKIDENMWKNREHMEEIIFLLKRSHWPATVRYLQQSSAPEDVELANVLGKLSE  120

Query  556  KFESALEVLVTFQARNSEHVFNTVMTYLPQD  648
            KFE  L  L +FQA NS+ +FNTVMTY+PQD
Sbjct  121  KFEKTLNTLKSFQAVNSDRIFNTVMTYMPQD  151



>ref|XP_006429677.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
 gb|ESR42917.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
Length=422

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 114/148 (77%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITR FLASYYDK+  PPLSD+VSRL  +IRS+A DL      S+ ESLL+ 
Sbjct  1    MASTEGLVPITRNFLASYYDKYPAPPLSDDVSRLSSQIRSLANDLLLDSPPSQEESLLIE  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA+  PPHKIDENMWKNRE +EEI+FLLKRS+WP  LQQ S  +D EL  VL +L EKFE
Sbjct  61   EADRQPPHKIDENMWKNREHMEEIIFLLKRSHWPATLQQSSAPEDVELANVLGKLSEKFE  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
              L  L +FQA NS+ +FNTVMTY+PQD
Sbjct  121  KTLNTLKSFQAVNSDRIFNTVMTYMPQD  148



>ref|XP_006429678.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
 gb|ESR42918.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
Length=437

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 114/148 (77%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITR FLASYYDK+  PPLSD+VSRL  +IRS+A DL      S+ ESLL+ 
Sbjct  1    MASTEGLVPITRNFLASYYDKYPAPPLSDDVSRLSSQIRSLANDLLLDSPPSQEESLLIE  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA+  PPHKIDENMWKNRE +EEI+FLLKRS+WP  LQQ S  +D EL  VL +L EKFE
Sbjct  61   EADRQPPHKIDENMWKNREHMEEIIFLLKRSHWPATLQQSSAPEDVELANVLGKLSEKFE  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
              L  L +FQA NS+ +FNTVMTY+PQD
Sbjct  121  KTLNTLKSFQAVNSDRIFNTVMTYMPQD  148



>gb|EYU42069.1| hypothetical protein MIMGU_mgv1a006657mg [Erythranthe guttata]
Length=382

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 119/149 (80%), Gaps = 1/149 (1%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMAR-DLQQGRTLSEGESLLV  381
            M STEGLVPITR+FLASYYD + F PLS +VSRL D+I +MA  DL +    ++GESLLV
Sbjct  1    MVSTEGLVPITRSFLASYYDNYPFSPLSSDVSRLTDQIFAMATTDLLKDSPPTQGESLLV  60

Query  382  HEAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKF  561
             EAE  PPHK+DENMWKNREQIEEILF+L+ ++WP   QQQST +DAEL ++L RL+E F
Sbjct  61   QEAERQPPHKVDENMWKNREQIEEILFMLEPTHWPRAFQQQSTVEDAELVSLLGRLQENF  120

Query  562  ESALEVLVTFQARNSEHVFNTVMTYLPQD  648
            +S L  L +FQA+NSE VFNTVMTY+PQD
Sbjct  121  KSTLSTLESFQAKNSEFVFNTVMTYMPQD  149



>ref|XP_006429679.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
 ref|XP_006481275.1| PREDICTED: uncharacterized protein LOC102624894 [Citrus sinensis]
 gb|ESR42919.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
Length=438

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 114/148 (77%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITR FLASYYDK+  PPLSD+VSRL  +IRS+A DL      S+ ESLL+ 
Sbjct  1    MASTEGLVPITRNFLASYYDKYPAPPLSDDVSRLSSQIRSLANDLLLDSPPSQEESLLIE  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA+  PPHKIDENMWKNRE +EEI+FLLKRS+WP  LQQ S  +D EL  VL +L EKFE
Sbjct  61   EADRQPPHKIDENMWKNREHMEEIIFLLKRSHWPATLQQSSAPEDVELANVLGKLSEKFE  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
              L  L +FQA NS+ +FNTVMTY+PQD
Sbjct  121  KTLNTLKSFQAVNSDRIFNTVMTYMPQD  148



>ref|XP_010036049.1| PREDICTED: uncharacterized protein LOC104425150 [Eucalyptus grandis]
 gb|KCW47571.1| hypothetical protein EUGRSUZ_K01318 [Eucalyptus grandis]
Length=439

 Score =   200 bits (509),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 118/148 (80%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            M+S +GLVPITR+FLA+YYDK+ FPPLS++V+ L   IRS++ DL      +EGE LL+ 
Sbjct  1    MSSMDGLVPITRSFLAAYYDKYSFPPLSEDVAALSSRIRSLSNDLLGDVPPTEGEKLLIE  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA+ TPPHKIDENMWKNREQ+EEI+FLL++SNWP  LQQQ T ++ E   +  +LK+K +
Sbjct  61   EADRTPPHKIDENMWKNREQMEEIIFLLEKSNWPAALQQQLTTENTEFATIFSQLKDKVQ  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
             +L +L++FQARNSE VFNTVMTYLPQD
Sbjct  121  ESLSLLISFQARNSERVFNTVMTYLPQD  148



>emb|CDY38154.1| BnaA07g02290D [Brassica napus]
Length=193

 Score =   192 bits (488),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 116/148 (78%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MAST+GLVPITRAFLASYY+K+ FPPLSD+VSRL  ++ S+ + L      S+GE+ L+ 
Sbjct  1    MASTDGLVPITRAFLASYYNKYPFPPLSDDVSRLSSDMASLIQLLTLQSPPSQGEASLIE  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   PPHKIDENMWKNREQ+EEILFLL+ S WP  L++  T++DAEL ++L  LK+ F+
Sbjct  61   EANQQPPHKIDENMWKNREQMEEILFLLQPSRWPVQLREPCTSEDAELSSILRHLKDNFD  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
             AL  +++FQ +NSE VFNTVMTY+PQD
Sbjct  121  KALAAMISFQTKNSERVFNTVMTYMPQD  148



>gb|EYU42068.1| hypothetical protein MIMGU_mgv1a006657mg [Erythranthe guttata]
Length=435

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 119/149 (80%), Gaps = 1/149 (1%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMAR-DLQQGRTLSEGESLLV  381
            M STEGLVPITR+FLASYYD + F PLS +VSRL D+I +MA  DL +    ++GESLLV
Sbjct  1    MVSTEGLVPITRSFLASYYDNYPFSPLSSDVSRLTDQIFAMATTDLLKDSPPTQGESLLV  60

Query  382  HEAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKF  561
             EAE  PPHK+DENMWKNREQIEEILF+L+ ++WP   QQQST +DAEL ++L RL+E F
Sbjct  61   QEAERQPPHKVDENMWKNREQIEEILFMLEPTHWPRAFQQQSTVEDAELVSLLGRLQENF  120

Query  562  ESALEVLVTFQARNSEHVFNTVMTYLPQD  648
            +S L  L +FQA+NSE VFNTVMTY+PQD
Sbjct  121  KSTLSTLESFQAKNSEFVFNTVMTYMPQD  149



>gb|EYU42067.1| hypothetical protein MIMGU_mgv1a006657mg [Erythranthe guttata]
Length=436

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 119/149 (80%), Gaps = 1/149 (1%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMAR-DLQQGRTLSEGESLLV  381
            M STEGLVPITR+FLASYYD + F PLS +VSRL D+I +MA  DL +    ++GESLLV
Sbjct  1    MVSTEGLVPITRSFLASYYDNYPFSPLSSDVSRLTDQIFAMATTDLLKDSPPTQGESLLV  60

Query  382  HEAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKF  561
             EAE  PPHK+DENMWKNREQIEEILF+L+ ++WP   QQQST +DAEL ++L RL+E F
Sbjct  61   QEAERQPPHKVDENMWKNREQIEEILFMLEPTHWPRAFQQQSTVEDAELVSLLGRLQENF  120

Query  562  ESALEVLVTFQARNSEHVFNTVMTYLPQD  648
            +S L  L +FQA+NSE VFNTVMTY+PQD
Sbjct  121  KSTLSTLESFQAKNSEFVFNTVMTYMPQD  149



>ref|XP_009337845.1| PREDICTED: uncharacterized protein LOC103930264 [Pyrus x bretschneideri]
Length=440

 Score =   198 bits (503),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 119/149 (80%), Gaps = 1/149 (1%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGES-LLV  381
            MASTEG+VPITRAFLASYYD +QFPPLS+ V+RL  EIRS   DL      ++GE  LLV
Sbjct  1    MASTEGIVPITRAFLASYYDTYQFPPLSNGVARLSSEIRSFTADLLHHSPAAQGEERLLV  60

Query  382  HEAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKF  561
             E ES PPHK+DENMWKNRE +EEILFLL++ +WP  L++QS+  DAEL  V+ RL++KF
Sbjct  61   SELESEPPHKVDENMWKNREHMEEILFLLEKPHWPQTLREQSSLDDAELATVIDRLRQKF  120

Query  562  ESALEVLVTFQARNSEHVFNTVMTYLPQD  648
            +++L+ L +FQA+NSE VFNTVMTY+PQD
Sbjct  121  QTSLKTLESFQAKNSERVFNTVMTYIPQD  149



>gb|KJB27584.1| hypothetical protein B456_005G0011002, partial [Gossypium raimondii]
 gb|KJB27586.1| hypothetical protein B456_005G0011002, partial [Gossypium raimondii]
 gb|KJB27587.1| hypothetical protein B456_005G0011002, partial [Gossypium raimondii]
Length=140

 Score =   188 bits (478),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 113/140 (81%), Gaps = 0/140 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MAST GLVPITRAFLASYY+K+ F PL D+VSRL  +IRS  +DL QG   ++GESLL+ 
Sbjct  1    MASTGGLVPITRAFLASYYEKYPFDPLPDDVSRLSSQIRSFIQDLIQGFPPTQGESLLIQ  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA+S PPHK+DENMWKNRE IEEILFLL+R +WP++LQQ STA+ AE    L +LK+KF+
Sbjct  61   EADSEPPHKMDENMWKNREHIEEILFLLERPHWPSVLQQSSTAEVAEFATTLGQLKDKFQ  120

Query  565  SALEVLVTFQARNSEHVFNT  624
            + L +L +FQ++NSE VFNT
Sbjct  121  ATLRILESFQSKNSERVFNT  140



>ref|XP_010278895.1| PREDICTED: uncharacterized protein LOC104612935 [Nelumbo nucifera]
Length=432

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITRAFLA YYDK+ F PL D+VS L  E+RSM+ DLQ+   L+E E +L  
Sbjct  1    MASTEGLVPITRAFLARYYDKYPFEPLPDDVSGLTAELRSMSSDLQKEFPLTEAEGVLER  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA+  PPHKID+NMWKNRE IEEILFLL+RS+WP  LQ+QSTA+D E+  VL +L+ K +
Sbjct  61   EADCPPPHKIDQNMWKNREHIEEILFLLERSHWPRSLQEQSTAEDIEIATVLGKLQIKLQ  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            + L++L  FQ++N+E+VFNTVMTY+PQD
Sbjct  121  NCLKLLEAFQSKNAENVFNTVMTYMPQD  148



>ref|XP_006599750.1| PREDICTED: uncharacterized protein LOC100795582 isoform X2 [Glycine 
max]
Length=408

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 110/148 (74%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITRAFLASYYDKH F PLS  VS L  +IRSMA D        +GES+L++
Sbjct  1    MASTEGLVPITRAFLASYYDKHPFTPLSAHVSTLSSQIRSMANDFLTQHPPIQGESILIN  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA+  PPHK+DENMWKNRE IEE +FLL+ SNWP  L+QQSTA   E    L +LK+K  
Sbjct  61   EADQQPPHKMDENMWKNREYIEETIFLLQSSNWPEALKQQSTADSVEFAITLGKLKDKLH  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
              L+ L +FQ +N+EHVFNTVMTYLPQD
Sbjct  121  ITLKALESFQTKNAEHVFNTVMTYLPQD  148



>gb|KDO64223.1| hypothetical protein CISIN_1g025201mg [Citrus sinensis]
Length=250

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 111/148 (75%), Gaps = 3/148 (2%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITR FLASYYDK+  PPLSD+VSRL  +IRS+A DL      S+ ESLL+ 
Sbjct  1    MASTEGLVPITRNFLASYYDKYPAPPLSDDVSRLSSQIRSLANDLLLDSPPSQEESLLIE  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA+  PPHKIDENMWKNRE +EEI+FLLKRS+WP      S  +D EL  VL +L EKFE
Sbjct  61   EADRQPPHKIDENMWKNREHMEEIIFLLKRSHWPAT---SSAPEDVELANVLGKLSEKFE  117

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
              L  L +FQA NS+ +FNTVMTY+PQD
Sbjct  118  KTLNTLKSFQAVNSDRIFNTVMTYMPQD  145



>gb|KHN24577.1| hypothetical protein glysoja_014181 [Glycine soja]
Length=434

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 110/148 (74%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITRAFLASYYDKH F PLS  VS L  +IRSMA D        +GES+L++
Sbjct  1    MASTEGLVPITRAFLASYYDKHPFTPLSAHVSTLSSQIRSMANDFLTQHPPIQGESILIN  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA+  PPHK+DENMWKNRE IEE +FLL+ SNWP  L+QQSTA   E    L +LK+K  
Sbjct  61   EADQQPPHKMDENMWKNREYIEETIFLLQSSNWPEALKQQSTADSVEFAITLGKLKDKLH  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
              L+ L +FQ +N+EHVFNTVMTYLPQD
Sbjct  121  ITLKALESFQTKNAEHVFNTVMTYLPQD  148



>ref|XP_003548341.1| PREDICTED: uncharacterized protein LOC100795582 isoform X1 [Glycine 
max]
Length=434

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 110/148 (74%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITRAFLASYYDKH F PLS  VS L  +IRSMA D        +GES+L++
Sbjct  1    MASTEGLVPITRAFLASYYDKHPFTPLSAHVSTLSSQIRSMANDFLTQHPPIQGESILIN  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA+  PPHK+DENMWKNRE IEE +FLL+ SNWP  L+QQSTA   E    L +LK+K  
Sbjct  61   EADQQPPHKMDENMWKNREYIEETIFLLQSSNWPEALKQQSTADSVEFAITLGKLKDKLH  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
              L+ L +FQ +N+EHVFNTVMTYLPQD
Sbjct  121  ITLKALESFQTKNAEHVFNTVMTYLPQD  148



>ref|XP_008370316.1| PREDICTED: uncharacterized protein LOC103433803 [Malus domestica]
Length=440

 Score =   195 bits (496),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 118/149 (79%), Gaps = 1/149 (1%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGES-LLV  381
            MASTEG+VPITRAFLASYYD +QFPPLS++V+RL  EIRS   DL +    ++GE  LLV
Sbjct  1    MASTEGIVPITRAFLASYYDTYQFPPLSNDVARLSAEIRSXTADLLRHSPAAQGEERLLV  60

Query  382  HEAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKF  561
             E E+ PPHK+DENMWKNRE +EEILFLL++ +WP  L+ Q +  DAEL  V+ RL +KF
Sbjct  61   SELETEPPHKVDENMWKNREHMEEILFLLEKPHWPQTLRMQXSPDDAELATVIDRLHQKF  120

Query  562  ESALEVLVTFQARNSEHVFNTVMTYLPQD  648
            +++L+ L TFQA+NSE VFNTVMTY+PQD
Sbjct  121  QTSLKTLETFQAKNSERVFNTVMTYIPQD  149



>ref|XP_010113031.1| hypothetical protein L484_022756 [Morus notabilis]
 gb|EXC35202.1| hypothetical protein L484_022756 [Morus notabilis]
Length=503

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 116/147 (79%), Gaps = 1/147 (1%)
 Frame = +1

Query  208  ASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVHE  387
            ASTEGLVPITRAFL+SYYDK+ F PLSD+VSRL  EIRS A D+      ++GE LL+ E
Sbjct  67   ASTEGLVPITRAFLSSYYDKYPFSPLSDDVSRLSSEIRSFANDVIADIPPNQGEKLLLDE  126

Query  388  AESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFES  567
            A+  PPHKIDENMWKNRE IEEI+FLL+  +WP +LQQQS   DAEL  VL ++K+KF++
Sbjct  127  ADCRPPHKIDENMWKNREHIEEIIFLLESPHWPPLLQQQSI-DDAELAVVLGQIKDKFQN  185

Query  568  ALEVLVTFQARNSEHVFNTVMTYLPQD  648
             L+ L TFQA NSE +FNTVMTY+PQD
Sbjct  186  TLKTLQTFQAMNSERIFNTVMTYMPQD  212



>ref|XP_008244213.1| PREDICTED: uncharacterized protein LOC103342365 [Prunus mume]
Length=440

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 116/149 (78%), Gaps = 1/149 (1%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGES-LLV  381
            MASTEG+VPITRAFLASYYD +QF PLS++V RL  EIRS   DL      +EGE  LLV
Sbjct  1    MASTEGIVPITRAFLASYYDTYQFSPLSNDVVRLSSEIRSFTADLLNSSPAAEGEERLLV  60

Query  382  HEAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKF  561
             E ES PPHK+DENMWKNRE +EEIL+LL++ +WP  LQQQ +  DAEL  ++ RL +KF
Sbjct  61   SELESEPPHKVDENMWKNREHMEEILYLLEKPHWPRSLQQQLSPDDAELATIIDRLHQKF  120

Query  562  ESALEVLVTFQARNSEHVFNTVMTYLPQD  648
            +++L+ L +FQA+NS+ VFNTVMTY+PQD
Sbjct  121  QTSLKTLESFQAKNSDRVFNTVMTYIPQD  149



>gb|EPS68255.1| hypothetical protein M569_06516, partial [Genlisea aurea]
Length=463

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITRAFLASYYDK+ F PLSDE  RL D+I ++++DL +    ++  SLL+ 
Sbjct  1    MASTEGLVPITRAFLASYYDKYPFDPLSDEFFRLSDQIHAISKDLLRESPSTQETSLLLE  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EAE  PPHK+DENMWKNREQIE+ILFLL+ SN P  LQ+QS  +++E+  +L RL+EKF+
Sbjct  61   EAEREPPHKVDENMWKNREQIEQILFLLEVSNRPGSLQKQSNDENSEISIILCRLEEKFK  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            S L+ L +FQ+RNSE VFNTVMTY+PQD
Sbjct  121  STLKTLESFQSRNSEFVFNTVMTYMPQD  148



>ref|XP_004510081.1| PREDICTED: uncharacterized protein LOC101493369 isoform X1 [Cicer 
arietinum]
Length=434

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 112/148 (76%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITRAFLASYYDKH F PLS +VSRL  E+RSMA DL      ++GE  L++
Sbjct  1    MASTEGLVPITRAFLASYYDKHPFTPLSHDVSRLTTELRSMASDLLAQHPPTQGEIRLIN  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA+S PPHKIDENMWKNRE IEE +FLL+  NWP  L+QQST ++     +L +LK+K  
Sbjct  61   EADSQPPHKIDENMWKNREYIEETIFLLEGFNWPEALKQQSTPENVAFSIMLGKLKDKLR  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
              L  L +FQ +N+EHVFNTVMTYLPQD
Sbjct  121  HTLRSLESFQIKNAEHVFNTVMTYLPQD  148



>ref|XP_009130614.1| PREDICTED: uncharacterized protein LOC103855392 isoform X2 [Brassica 
rapa]
Length=387

 Score =   191 bits (485),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 116/148 (78%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITRAFLASYYDK+ FPPLSD+VSRL  ++ S+ + L      S+GE+ L+ 
Sbjct  1    MASTEGLVPITRAFLASYYDKYPFPPLSDDVSRLYSDMASLIQLLALQSPPSQGEASLIE  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   PPHKIDENMWKNREQ+EEILFLL+ S WP  L++  T++DAEL + L  LK+ F+
Sbjct  61   EANREPPHKIDENMWKNREQMEEILFLLQPSRWPVQLREPCTSEDAELSSTLRHLKDNFD  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
             AL  +++FQ++NSE +F+TVMTY+PQD
Sbjct  121  KALTAMISFQSKNSERIFSTVMTYMPQD  148



>ref|XP_009125386.1| PREDICTED: uncharacterized protein LOC103850397 [Brassica rapa]
 emb|CDY04819.1| BnaAnng00010D [Brassica napus]
Length=440

 Score =   192 bits (488),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 116/148 (78%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MAST+GLVPITRAFLASYY+K+ FPPLSD+VSRL  ++ S+ + L      S+GE+ L+ 
Sbjct  1    MASTDGLVPITRAFLASYYNKYPFPPLSDDVSRLSSDMASLIQLLTLQSPPSQGEASLIE  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   PPHKIDENMWKNREQ+EEILFLL+ S WP  L++  T++DAEL ++L  LK+ F+
Sbjct  61   EANQQPPHKIDENMWKNREQMEEILFLLQPSRWPVQLREPCTSEDAELSSILRHLKDNFD  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
             AL  +++FQ +NSE VFNTVMTY+PQD
Sbjct  121  KALAAMISFQTKNSERVFNTVMTYMPQD  148



>ref|XP_003521546.1| PREDICTED: uncharacterized protein LOC100778827 isoform 1 [Glycine 
max]
 gb|KHN42120.1| hypothetical protein glysoja_021610 [Glycine soja]
Length=434

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 109/148 (74%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITRAFLASYYDKH F PLS  VS L  +IRSMA D        +GE +L++
Sbjct  1    MASTEGLVPITRAFLASYYDKHPFTPLSAHVSTLSSQIRSMANDFLTQHPPIQGERILIN  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA+  PPHK+DENMWKNRE IEE +FLL+ SNWP  L+QQS A   E    L +LK+K  
Sbjct  61   EADQQPPHKMDENMWKNREYIEETIFLLQSSNWPEALKQQSAADCVEFSITLGKLKDKLH  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            + L+ L +FQ +N+EHVFNTVMTYLPQD
Sbjct  121  NTLKALESFQTKNAEHVFNTVMTYLPQD  148



>ref|XP_009130613.1| PREDICTED: uncharacterized protein LOC103855392 isoform X1 [Brassica 
rapa]
Length=432

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 116/148 (78%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITRAFLASYYDK+ FPPLSD+VSRL  ++ S+ + L      S+GE+ L+ 
Sbjct  1    MASTEGLVPITRAFLASYYDKYPFPPLSDDVSRLYSDMASLIQLLALQSPPSQGEASLIE  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   PPHKIDENMWKNREQ+EEILFLL+ S WP  L++  T++DAEL + L  LK+ F+
Sbjct  61   EANREPPHKIDENMWKNREQMEEILFLLQPSRWPVQLREPCTSEDAELSSTLRHLKDNFD  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
             AL  +++FQ++NSE +F+TVMTY+PQD
Sbjct  121  KALTAMISFQSKNSERIFSTVMTYMPQD  148



>gb|KDP21813.1| hypothetical protein JCGZ_00600 [Jatropha curcas]
Length=439

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 111/148 (75%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MAS +GLVPITR FLASYYD++ FPPLSD+VSRL  EIRSMA DL      S+ E LLV 
Sbjct  1    MASMDGLVPITRQFLASYYDRYPFPPLSDDVSRLSSEIRSMASDLINHSPPSQEERLLVE  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA+  P HKIDENMWKNRE +EEILFLL RS WP  ++Q ST +D+EL  V   +++ F 
Sbjct  61   EADRDPIHKIDENMWKNREHMEEILFLLDRSRWPQQIRQPSTPEDSELATVFSNIRDLFH  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            S L+ L +FQ +NSE VFNTVMTY+PQD
Sbjct  121  STLKTLESFQVKNSERVFNTVMTYMPQD  148



>ref|XP_004302492.1| PREDICTED: uncharacterized protein LOC101292427 [Fragaria vesca 
subsp. vesca]
Length=440

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 115/149 (77%), Gaps = 1/149 (1%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGES-LLV  381
            MASTEGLVPITRAFL+SYYD +QFPPLSD++ RL  +IRS+  D       + GE  L+V
Sbjct  1    MASTEGLVPITRAFLSSYYDTYQFPPLSDDIPRLSSDIRSLTSDFLSHSPPTPGEERLVV  60

Query  382  HEAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKF  561
             E+E  PPHK+DENMWKNRE +EEI+FLL R++WP  LQ+ S+ +DA+L  VL RL  KF
Sbjct  61   DESERRPPHKVDENMWKNREHMEEIIFLLDRAHWPQALQEPSSPEDAQLATVLTRLLHKF  120

Query  562  ESALEVLVTFQARNSEHVFNTVMTYLPQD  648
             +AL+ L +FQA+NSE VF+TVMTY+PQD
Sbjct  121  NTALKALESFQAKNSERVFSTVMTYIPQD  149



>emb|CDY11168.1| BnaA03g00040D [Brassica napus]
Length=474

 Score =   190 bits (483),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 116/148 (78%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITRAFLASYYDK+ FPPLSD+VSRL  ++ S+ + L      S+GE+ L+ 
Sbjct  1    MASTEGLVPITRAFLASYYDKYPFPPLSDDVSRLYSDMASLIQLLALQSPPSQGEASLIE  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   PPHKIDENMWKNREQ+EEILFLL+ S WP  L++  T++DAEL + L  LK+ F+
Sbjct  61   EANREPPHKIDENMWKNREQMEEILFLLQPSRWPVQLREPCTSEDAELSSTLRHLKDNFD  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
             AL  +++FQ++NSE +F+TVMTY+PQD
Sbjct  121  KALTAMISFQSKNSERIFSTVMTYMPQD  148



>gb|AFK45888.1| unknown [Lotus japonicus]
Length=212

 Score =   183 bits (464),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 110/147 (75%), Gaps = 0/147 (0%)
 Frame = +1

Query  208  ASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVHE  387
            ASTEGLVPITRAFLASYYD H F PLS  V  L   +RS+A  L      ++GES L+++
Sbjct  3    ASTEGLVPITRAFLASYYDNHPFTPLSPNVDTLSSRLRSIADHLLSQFPPNQGESNLINK  62

Query  388  AESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFES  567
            A++ PPHKIDENMW+NRE IEE +FLL+RSNWP  L+QQST  + EL  +L +LK K  +
Sbjct  63   ADAQPPHKIDENMWRNREYIEETIFLLERSNWPEALKQQSTPDNVELATMLEQLKHKLHN  122

Query  568  ALEVLVTFQARNSEHVFNTVMTYLPQD  648
             L+ L +FQ +N+EHVFNTVMTYLPQD
Sbjct  123  TLKSLESFQIKNAEHVFNTVMTYLPQD  149



>ref|XP_006398546.1| hypothetical protein EUTSA_v10013603mg [Eutrema salsugineum]
 gb|ESQ39999.1| hypothetical protein EUTSA_v10013603mg [Eutrema salsugineum]
Length=418

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITRAFLASYYDK+ FPPLSD+VSRL  +I S+ + L      S+GE+ L+ 
Sbjct  1    MASTEGLVPITRAFLASYYDKYPFPPLSDDVSRLSSDIASLIQLLTLQSPPSQGEASLID  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   PPHKIDENMWKNREQ+EEILFLL+ S WP  L++ ST++DAE  ++L  +K   +
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLQPSRWPLQLREPSTSEDAEFSSMLRHVKANID  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            +AL  +++FQ +NSE VF+TVMTY+PQD
Sbjct  121  NALTAMISFQTKNSERVFSTVMTYMPQD  148



>ref|XP_006398547.1| hypothetical protein EUTSA_v10013603mg [Eutrema salsugineum]
 gb|ESQ40000.1| hypothetical protein EUTSA_v10013603mg [Eutrema salsugineum]
Length=432

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITRAFLASYYDK+ FPPLSD+VSRL  +I S+ + L      S+GE+ L+ 
Sbjct  1    MASTEGLVPITRAFLASYYDKYPFPPLSDDVSRLSSDIASLIQLLTLQSPPSQGEASLID  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   PPHKIDENMWKNREQ+EEILFLL+ S WP  L++ ST++DAE  ++L  +K   +
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLQPSRWPLQLREPSTSEDAEFSSMLRHVKANID  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            +AL  +++FQ +NSE VF+TVMTY+PQD
Sbjct  121  NALTAMISFQTKNSERVFSTVMTYMPQD  148



>ref|XP_006398545.1| hypothetical protein EUTSA_v10013603mg [Eutrema salsugineum]
 gb|ESQ39998.1| hypothetical protein EUTSA_v10013603mg [Eutrema salsugineum]
Length=412

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITRAFLASYYDK+ FPPLSD+VSRL  +I S+ + L      S+GE+ L+ 
Sbjct  1    MASTEGLVPITRAFLASYYDKYPFPPLSDDVSRLSSDIASLIQLLTLQSPPSQGEASLID  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   PPHKIDENMWKNREQ+EEILFLL+ S WP  L++ ST++DAE  ++L  +K   +
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLQPSRWPLQLREPSTSEDAEFSSMLRHVKANID  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            +AL  +++FQ +NSE VF+TVMTY+PQD
Sbjct  121  NALTAMISFQTKNSERVFSTVMTYMPQD  148



>ref|XP_007134600.1| hypothetical protein PHAVU_010G060400g [Phaseolus vulgaris]
 gb|ESW06594.1| hypothetical protein PHAVU_010G060400g [Phaseolus vulgaris]
Length=445

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 111/148 (75%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITRAFLASYYDKH F PLS +V+RL  +IRS+A D       ++GE++L+ 
Sbjct  1    MASTEGLVPITRAFLASYYDKHPFTPLSADVTRLSSQIRSLANDFLTQHPPTQGEAVLIE  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA+  PPHKIDENMWKNRE IEE +FLL+ SNWP +L+QQS     E      +LK+K  
Sbjct  61   EADRLPPHKIDENMWKNREYIEETIFLLESSNWPEVLKQQSAPDSVEFALTFGQLKDKLY  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            +AL+ + +FQ +N+EHVF TVMTYLPQD
Sbjct  121  NALKAVESFQIKNAEHVFYTVMTYLPQD  148



>ref|XP_002519981.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42305.1| conserved hypothetical protein [Ricinus communis]
Length=439

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 112/148 (76%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGL+PITR FLASYYDK+ F PLSD+VSRL  EIRS+A DL +    S+ E LLV 
Sbjct  1    MASTEGLMPITRQFLASYYDKYPFQPLSDDVSRLTSEIRSIASDLLKDSPPSKDERLLVE  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EAE  P HKIDENMWKNRE +EEILFLL  S WP+ L+Q ST +D+EL   + ++++ F 
Sbjct  61   EAERDPIHKIDENMWKNRELMEEILFLLDHSRWPSALRQPSTPEDSELATAIAKVRDFFR  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
              L+ L  FQA+NSE VFNTVMTY+PQD
Sbjct  121  KTLKTLEIFQAKNSERVFNTVMTYMPQD  148



>ref|XP_002872981.1| hypothetical protein ARALYDRAFT_486867 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49240.1| hypothetical protein ARALYDRAFT_486867 [Arabidopsis lyrata subsp. 
lyrata]
Length=436

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 114/148 (77%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGL+PITRAFLASYYDK+ F PLSD+VSRL  +I S+ + L      S+GE+ L+ 
Sbjct  1    MASTEGLMPITRAFLASYYDKYPFSPLSDDVSRLSSDIASLIQLLTVQSPPSQGETSLID  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   PPHKIDENMWKNREQ+EEILFLL  S WP  L++ ST++DAE  ++L  LK+ F+
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLSPSRWPVQLREPSTSEDAEFASILRTLKDSFD  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            +A   +++FQ +NSE +F+TVMTY+PQD
Sbjct  121  NAFTAMISFQTKNSERIFSTVMTYMPQD  148



>ref|NP_001154688.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAH56815.1| AT5G01010 [Arabidopsis thaliana]
 gb|AED90284.1| uncharacterized protein AT5G01010 [Arabidopsis thaliana]
Length=429

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 114/148 (77%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGL+PITRAFLASYYDK+ F PLSD+VSRL  ++ S+ + L      S+GE+ L+ 
Sbjct  1    MASTEGLMPITRAFLASYYDKYPFSPLSDDVSRLSSDMASLIKLLTVQSPPSQGETSLID  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   PPHKIDENMWKNREQ+EEILFLL  S WP  L++ ST++DAE  ++L  LK+ F+
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLSPSRWPVQLREPSTSEDAEFASILRTLKDSFD  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            +A   +++FQ +NSE +F+TVMTY+PQD
Sbjct  121  NAFTAMISFQTKNSERIFSTVMTYMPQD  148



>ref|NP_195721.5| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAC42982.1| unknown protein [Arabidopsis thaliana]
 dbj|BAC43305.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43143.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43301.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43345.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43526.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43539.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43565.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43716.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43767.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43772.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43786.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43808.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44005.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44013.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44023.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44099.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44270.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44410.1| unknown protein [Arabidopsis thaliana]
 gb|AED90282.1| uncharacterized protein AT5G01010 [Arabidopsis thaliana]
Length=438

 Score =   187 bits (476),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 114/148 (77%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGL+PITRAFLASYYDK+ F PLSD+VSRL  ++ S+ + L      S+GE+ L+ 
Sbjct  1    MASTEGLMPITRAFLASYYDKYPFSPLSDDVSRLSSDMASLIKLLTVQSPPSQGETSLID  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   PPHKIDENMWKNREQ+EEILFLL  S WP  L++ ST++DAE  ++L  LK+ F+
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLSPSRWPVQLREPSTSEDAEFASILRTLKDSFD  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            +A   +++FQ +NSE +F+TVMTY+PQD
Sbjct  121  NAFTAMISFQTKNSERIFSTVMTYMPQD  148



>dbj|BAD43795.1| unknown protein [Arabidopsis thaliana]
Length=438

 Score =   187 bits (476),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 114/148 (77%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGL+PITRAFLASYYDK+ F PLSD+VSRL  ++ S+ + L      S+GE+ L+ 
Sbjct  1    MASTEGLMPITRAFLASYYDKYPFSPLSDDVSRLSSDMASLIKLLTVQSPPSQGETSLID  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   PPHKIDENMWKNREQ+EEILFLL  S WP  L++ ST++DAE  ++L  LK+ F+
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLSPSRWPVQLREPSTSEDAEFASILRTLKDSFD  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            +A   +++FQ +NSE +F+TVMTY+PQD
Sbjct  121  NAFTAMISFQTKNSERIFSTVMTYMPQD  148



>ref|XP_010490476.1| PREDICTED: uncharacterized protein LOC104768250 isoform X1 [Camelina 
sativa]
 ref|XP_010490478.1| PREDICTED: uncharacterized protein LOC104768250 isoform X3 [Camelina 
sativa]
Length=434

 Score =   187 bits (476),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 113/148 (76%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MAST+GLVPITR FLASYYDK+ FPPLSD VSRL  +I ++ + L      SEGE+ L+ 
Sbjct  1    MASTDGLVPITRDFLASYYDKYPFPPLSDGVSRLSSDIATLIQLLTVQSPPSEGETSLID  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   PPHKIDENMWKNREQ+EEILFLL+ S WP  L++ ST++DAE  ++L  LK+ F+
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLEPSRWPIQLREPSTSEDAEFASILRNLKDNFD  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
             A   +++FQ +NSE +F+TVMTY+PQD
Sbjct  121  IAFTAMISFQTKNSERIFSTVMTYMPQD  148



>ref|XP_010490477.1| PREDICTED: uncharacterized protein LOC104768250 isoform X2 [Camelina 
sativa]
Length=434

 Score =   187 bits (476),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 113/148 (76%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MAST+GLVPITR FLASYYDK+ FPPLSD VSRL  +I ++ + L      SEGE+ L+ 
Sbjct  1    MASTDGLVPITRDFLASYYDKYPFPPLSDGVSRLSSDIATLIQLLTVQSPPSEGETSLID  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   PPHKIDENMWKNREQ+EEILFLL+ S WP  L++ ST++DAE  ++L  LK+ F+
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLEPSRWPIQLREPSTSEDAEFASILRNLKDNFD  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
             A   +++FQ +NSE +F+TVMTY+PQD
Sbjct  121  IAFTAMISFQTKNSERIFSTVMTYMPQD  148



>dbj|BAH57023.1| AT5G01010 [Arabidopsis thaliana]
Length=448

 Score =   187 bits (476),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 114/148 (77%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGL+PITRAFLASYYDK+ F PLSD+VSRL  ++ S+ + L      S+GE+ L+ 
Sbjct  1    MASTEGLMPITRAFLASYYDKYPFSPLSDDVSRLSSDMASLIKLLTVQSPPSQGETSLID  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   PPHKIDENMWKNREQ+EEILFLL  S WP  L++ ST++DAE  ++L  LK+ F+
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLSPSRWPVQLREPSTSEDAEFASILRTLKDSFD  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            +A   +++FQ +NSE +F+TVMTY+PQD
Sbjct  121  NAFTAMISFQTKNSERIFSTVMTYMPQD  148



>ref|XP_010496822.1| PREDICTED: uncharacterized protein LOC104773850 [Camelina sativa]
Length=434

 Score =   187 bits (474),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 113/148 (76%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITR FLASYYD + FPPLSD+VSRL  +I ++ + L      SEGE+ L+ 
Sbjct  1    MASTEGLVPITRDFLASYYDTYPFPPLSDDVSRLSSDITTLIQLLTVQSPPSEGETSLID  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   PPHKIDENMWKNREQ+EEILFLL+ S WP  L++ ST++DA+  ++L  LK+ F+
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLQPSRWPIQLREPSTSEDADFASILRNLKDNFD  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
             A   +++FQ +NSE +F+TVMTY+PQD
Sbjct  121  IAFTAMISFQTKNSERIFSTVMTYMPQD  148



>ref|NP_001154687.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AED90283.1| uncharacterized protein AT5G01010 [Arabidopsis thaliana]
Length=479

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 114/148 (77%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGL+PITRAFLASYYDK+ F PLSD+VSRL  ++ S+ + L      S+GE+ L+ 
Sbjct  1    MASTEGLMPITRAFLASYYDKYPFSPLSDDVSRLSSDMASLIKLLTVQSPPSQGETSLID  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   PPHKIDENMWKNREQ+EEILFLL  S WP  L++ ST++DAE  ++L  LK+ F+
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLSPSRWPVQLREPSTSEDAEFASILRTLKDSFD  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            +A   +++FQ +NSE +F+TVMTY+PQD
Sbjct  121  NAFTAMISFQTKNSERIFSTVMTYMPQD  148



>ref|XP_006842639.1| hypothetical protein AMTR_s00077p00188630 [Amborella trichopoda]
 gb|ERN04314.1| hypothetical protein AMTR_s00077p00188630 [Amborella trichopoda]
Length=440

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 113/148 (76%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MAST GLVPITRA L+ YYD H F PLS++V RL DE+R  ++ LQ+      GE++L  
Sbjct  1    MASTAGLVPITRAILSRYYDNHHFNPLSEDVPRLSDELREFSKALQEEVPPIAGEAILAQ  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EAEST PHKIDEN+WKNRE IEEILFLL++S+WPT LQQ S+ +D EL A L +L+ K  
Sbjct  61   EAESTSPHKIDENLWKNREHIEEILFLLEKSHWPTQLQQHSSPEDVELAATLQKLEVKMR  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            + L+ L +FQ++N+E+VFN VMTY+PQD
Sbjct  121  NILKTLESFQSKNTENVFNIVMTYMPQD  148



>ref|XP_007205211.1| hypothetical protein PRUPE_ppa005889mg [Prunus persica]
 gb|EMJ06410.1| hypothetical protein PRUPE_ppa005889mg [Prunus persica]
Length=438

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 115/149 (77%), Gaps = 4/149 (3%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGES-LLV  381
            MASTEG+VPITRAFLASYYD +QF PLS++V+RL  EIRS   DL      +EGE  LLV
Sbjct  1    MASTEGIVPITRAFLASYYDTYQFSPLSNDVARLSSEIRSFTADLLNSSPAAEGEERLLV  60

Query  382  HEAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKF  561
             E ES PPHK+DENMWKNRE +EEIL+LL++ +WP   + Q +  DAEL  ++ RL +KF
Sbjct  61   SELESEPPHKVDENMWKNREHMEEILYLLEKPHWP---RSQLSPDDAELATIIDRLHQKF  117

Query  562  ESALEVLVTFQARNSEHVFNTVMTYLPQD  648
            +++L+ L +FQA+NSE VFNTVMTY+PQD
Sbjct  118  QTSLKTLESFQAKNSERVFNTVMTYIPQD  146



>dbj|BAD43433.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43633.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43683.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43717.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43821.1| unknown protein [Arabidopsis thaliana]
Length=438

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 113/148 (76%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGL+PITRAFLASYYDK+ F PLSD+VSRL  ++ S+ + L      S+GE+ L+ 
Sbjct  1    MASTEGLMPITRAFLASYYDKYPFSPLSDDVSRLSSDMASLIKLLTVQSPPSQGETSLID  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   PPHKIDENMWKNR Q+EEILFLL  S WP  L++ ST++DAE  ++L  LK+ F+
Sbjct  61   EANRQPPHKIDENMWKNRGQMEEILFLLSPSRWPVQLREPSTSEDAEFASILRTLKDSFD  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            +A   +++FQ +NSE +F+TVMTY+PQD
Sbjct  121  NAFTAMISFQTKNSERIFSTVMTYMPQD  148



>ref|XP_006279346.1| hypothetical protein CARUB_v10012733mg [Capsella rubella]
 gb|EOA12244.1| hypothetical protein CARUB_v10012733mg [Capsella rubella]
Length=434

 Score =   184 bits (467),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 114/148 (77%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITRAFLASYY+K+ F PLSD+VSRL  +I S+ + L      S+G + L+ 
Sbjct  1    MASTEGLVPITRAFLASYYEKYPFTPLSDDVSRLSSDIASLIQLLTVQSPPSQGVTSLID  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   PPHKIDENMWKNREQ+EEILFLL+ S WP  L++ ST++DA+  ++L  LK+ F+
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLQPSRWPIQLREPSTSEDADFASILQNLKDNFD  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            +A   +++FQ +NSE +F+TVMTY+PQD
Sbjct  121  NAFTAMISFQTKNSERIFSTVMTYMPQD  148



>ref|XP_008463317.1| PREDICTED: uncharacterized protein LOC103501503 isoform X2 [Cucumis 
melo]
Length=411

 Score =   182 bits (461),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 110/148 (74%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MAS EGLVPITR FLASYYDK+ F PLSD VSRL  E+ ++A  L      +  ES L+ 
Sbjct  1    MASMEGLVPITRHFLASYYDKYPFAPLSDHVSRLSTEMLALANSLLDELPPTSEESTLLD  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   PPHKIDENMWKNRE +EEILFLL++S WP  +Q++S    +EL  ++ +L+EK  
Sbjct  61   EANQHPPHKIDENMWKNRENVEEILFLLEKSRWPQEVQKESATGKSELANIIGKLEEKAR  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            +AL VLV FQ++NSEHVFNTVMTY+PQD
Sbjct  121  NALHVLVAFQSKNSEHVFNTVMTYMPQD  148



>ref|XP_010543129.1| PREDICTED: uncharacterized protein LOC104816146 isoform X4 [Tarenaya 
hassleriana]
Length=373

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 110/148 (74%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITRAFLASYYDK+ F PLSD+V RL  EI S+ + L      SEGE  L+ 
Sbjct  1    MASTEGLVPITRAFLASYYDKYPFHPLSDDVPRLSSEIASLLQLLLLHSPPSEGEIPLID  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   PPHKIDENMWKNREQ+EEILFLL+ S WP  L+  +T+ D+E  ++L  L +KF 
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLQPSRWPPQLKDPTTSDDSEFSSMLRHLNDKFR  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            + L  L++FQ +NSE VF+TVMTY+PQD
Sbjct  121  NTLASLISFQTKNSERVFSTVMTYMPQD  148



>ref|XP_008463316.1| PREDICTED: uncharacterized protein LOC103501503 isoform X1 [Cucumis 
melo]
Length=436

 Score =   182 bits (461),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 110/148 (74%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MAS EGLVPITR FLASYYDK+ F PLSD VSRL  E+ ++A  L      +  ES L+ 
Sbjct  1    MASMEGLVPITRHFLASYYDKYPFAPLSDHVSRLSTEMLALANSLLDELPPTSEESTLLD  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   PPHKIDENMWKNRE +EEILFLL++S WP  +Q++S    +EL  ++ +L+EK  
Sbjct  61   EANQHPPHKIDENMWKNRENVEEILFLLEKSRWPQEVQKESATGKSELANIIGKLEEKAR  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            +AL VLV FQ++NSEHVFNTVMTY+PQD
Sbjct  121  NALHVLVAFQSKNSEHVFNTVMTYMPQD  148



>ref|XP_010543128.1| PREDICTED: uncharacterized protein LOC104816146 isoform X3 [Tarenaya 
hassleriana]
Length=384

 Score =   181 bits (458),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 110/148 (74%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITRAFLASYYDK+ F PLSD+V RL  EI S+ + L      SEGE  L+ 
Sbjct  1    MASTEGLVPITRAFLASYYDKYPFHPLSDDVPRLSSEIASLLQLLLLHSPPSEGEIPLID  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   PPHKIDENMWKNREQ+EEILFLL+ S WP  L+  +T+ D+E  ++L  L +KF 
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLQPSRWPPQLKDPTTSDDSEFSSMLRHLNDKFR  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            + L  L++FQ +NSE VF+TVMTY+PQD
Sbjct  121  NTLASLISFQTKNSERVFSTVMTYMPQD  148



>ref|XP_004163944.1| PREDICTED: uncharacterized LOC101218161 [Cucumis sativus]
Length=331

 Score =   179 bits (454),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 109/148 (74%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MAS EGLVPITR FLASYYDK+ F PLSD VSRL  E+ ++A  L      +  ES L+ 
Sbjct  1    MASMEGLVPITRHFLASYYDKYPFTPLSDHVSRLSTEMLALANSLLDELPPTSEESTLLD  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   PPHKIDENMWKNRE +EEILFL ++S WP  +Q++S   ++EL  ++ +L+EK  
Sbjct  61   EANQHPPHKIDENMWKNRENVEEILFLFEKSRWPQEVQKESATGESELANIIGKLEEKAR  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            +AL  LV FQ++NSEHVFNTVMTY+PQD
Sbjct  121  NALHALVAFQSKNSEHVFNTVMTYMPQD  148



>ref|XP_010543127.1| PREDICTED: uncharacterized protein LOC104816146 isoform X2 [Tarenaya 
hassleriana]
Length=437

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 110/148 (74%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITRAFLASYYDK+ F PLSD+V RL  EI S+ + L      SEGE  L+ 
Sbjct  1    MASTEGLVPITRAFLASYYDKYPFHPLSDDVPRLSSEIASLLQLLLLHSPPSEGEIPLID  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   PPHKIDENMWKNREQ+EEILFLL+ S WP  L+  +T+ D+E  ++L  L +KF 
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLQPSRWPPQLKDPTTSDDSEFSSMLRHLNDKFR  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            + L  L++FQ +NSE VF+TVMTY+PQD
Sbjct  121  NTLASLISFQTKNSERVFSTVMTYMPQD  148



>ref|XP_010543126.1| PREDICTED: uncharacterized protein LOC104816146 isoform X1 [Tarenaya 
hassleriana]
Length=448

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 110/148 (74%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITRAFLASYYDK+ F PLSD+V RL  EI S+ + L      SEGE  L+ 
Sbjct  1    MASTEGLVPITRAFLASYYDKYPFHPLSDDVPRLSSEIASLLQLLLLHSPPSEGEIPLID  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   PPHKIDENMWKNREQ+EEILFLL+ S WP  L+  +T+ D+E  ++L  L +KF 
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLQPSRWPPQLKDPTTSDDSEFSSMLRHLNDKFR  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            + L  L++FQ +NSE VF+TVMTY+PQD
Sbjct  121  NTLASLISFQTKNSERVFSTVMTYMPQD  148



>ref|XP_004147520.1| PREDICTED: uncharacterized protein LOC101218161 [Cucumis sativus]
 gb|KGN53967.1| hypothetical protein Csa_4G197820 [Cucumis sativus]
Length=436

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 109/148 (74%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MAS EGLVPITR FLASYYDK+ F PLSD VSRL  E+ ++A  L      +  ES L+ 
Sbjct  1    MASMEGLVPITRHFLASYYDKYPFTPLSDHVSRLSTEMLALANSLLDELPPTSEESTLLD  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   PPHKIDENMWKNRE +EEILFL ++S WP  +Q++S   ++EL  ++ +L+EK  
Sbjct  61   EANQHPPHKIDENMWKNRENVEEILFLFEKSRWPQEVQKESATGESELANIIGKLEEKAR  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            +AL  LV FQ++NSEHVFNTVMTY+PQD
Sbjct  121  NALHALVAFQSKNSEHVFNTVMTYMPQD  148



>gb|KFK24699.1| hypothetical protein AALP_AA8G013300 [Arabis alpina]
Length=427

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 109/148 (74%), Gaps = 5/148 (3%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITRA+L+SYYDK+ FPPLS +VSRL  +I S+   L      S GE+ L+ 
Sbjct  1    MASTEGLVPITRAYLSSYYDKYPFPPLSGDVSRLSCDISSLIHLLTLQSPPSPGEASLID  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   PPHKIDENMWKNREQ+EEILFLL+ S WP  L     ++DAE   +L  LK+KF+
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLQPSRWPLQL-----SEDAEFSCILRHLKDKFD  115

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
             AL  +V+FQ++NSE VF TVMTY+PQD
Sbjct  116  IALAAMVSFQSKNSERVFTTVMTYMPQD  143



>ref|XP_010673452.1| PREDICTED: uncharacterized protein LOC104889827 [Beta vulgaris 
subsp. vulgaris]
Length=428

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 110/148 (74%), Gaps = 4/148 (3%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITRA+LASYY+K+ F PLS +V+ L  +IRS+  + Q      +GES +V 
Sbjct  1    MASTEGLVPITRAYLASYYEKYPFVPLSADVATLSAQIRSIITNFQT----HQGESSVVD  56

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            E +   PHKIDENMWKNRE IEEI+FLL R++WPT  QQQS   D EL   L +LK KFE
Sbjct  57   EVDHEAPHKIDENMWKNREHIEEIIFLLDRTHWPTTFQQQSRLGDVELAPFLEQLKVKFE  116

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            + L+ L  FQ++N+++VFNTVM+Y+PQD
Sbjct  117  NTLKTLEYFQSKNADYVFNTVMSYMPQD  144



>ref|XP_010938085.1| PREDICTED: uncharacterized protein LOC105057244 isoform X2 [Elaeis 
guineensis]
Length=413

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 112/148 (76%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITRAFLA YYDK+  P LSD++ RL  E+R  A  L +    + GE L+V+
Sbjct  1    MASTEGLVPITRAFLARYYDKYPLPRLSDDIPRLTAELRGFADGLLREHAPTSGEELVVN  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA+  PPHKIDEN+WKNRE IEEILFLL  S+ P  LQ+++T +D +L AV   ++ KF+
Sbjct  61   EADCEPPHKIDENLWKNREHIEEILFLLDDSHRPRSLQEKATPEDIDLAAVFGDIEAKFK  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            ++L+ L TFQ RN++++F+TVMTY+PQD
Sbjct  121  TSLKTLETFQLRNADNIFSTVMTYMPQD  148



>ref|XP_010938084.1| PREDICTED: uncharacterized protein LOC105057244 isoform X1 [Elaeis 
guineensis]
Length=438

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 112/148 (76%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITRAFLA YYDK+  P LSD++ RL  E+R  A  L +    + GE L+V+
Sbjct  1    MASTEGLVPITRAFLARYYDKYPLPRLSDDIPRLTAELRGFADGLLREHAPTSGEELVVN  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA+  PPHKIDEN+WKNRE IEEILFLL  S+ P  LQ+++T +D +L AV   ++ KF+
Sbjct  61   EADCEPPHKIDENLWKNREHIEEILFLLDDSHRPRSLQEKATPEDIDLAAVFGDIEAKFK  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            ++L+ L TFQ RN++++F+TVMTY+PQD
Sbjct  121  TSLKTLETFQLRNADNIFSTVMTYMPQD  148



>ref|XP_011006222.1| PREDICTED: uncharacterized protein LOC105112277 [Populus euphratica]
Length=435

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 106/149 (71%), Gaps = 6/149 (4%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARD-LQQGRTLSEGESLLV  381
            MASTEGLVPITR FLASYYDK+ F PL D+VSRL  EIRSM  D L++    S+ ESLL+
Sbjct  1    MASTEGLVPITRIFLASYYDKYPFTPLPDDVSRLSSEIRSMTSDLLKESPPSSQDESLLL  60

Query  382  HEAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKF  561
             E+E   PHKIDENMWKNRE +EEI+FLL  S  P  LQ      D+EL  V   ++ KF
Sbjct  61   KESEGESPHKIDENMWKNREHMEEIIFLLNESRCPQPLQ-----DDSELSTVFNNMRYKF  115

Query  562  ESALEVLVTFQARNSEHVFNTVMTYLPQD  648
            +  L VL  FQA NS+HVFNTVMTY+PQD
Sbjct  116  QKTLNVLQDFQAVNSDHVFNTVMTYMPQD  144



>ref|XP_002323111.2| hypothetical protein POPTR_0016s15030g [Populus trichocarpa]
 gb|EEF04872.2| hypothetical protein POPTR_0016s15030g [Populus trichocarpa]
Length=435

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 106/149 (71%), Gaps = 6/149 (4%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARD-LQQGRTLSEGESLLV  381
            MASTEGLVPITR FLASYYDK+ F PL D+VSRL  EIRSM  D L+     S+ ESLL+
Sbjct  1    MASTEGLVPITRIFLASYYDKYPFTPLPDDVSRLSSEIRSMTSDLLKDSPPSSQDESLLL  60

Query  382  HEAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKF  561
             E+E   PHKIDENMWKNRE +EEI+FLL  S+ P  LQ      D+EL  V   ++ KF
Sbjct  61   KESEGESPHKIDENMWKNREHMEEIIFLLHESHCPQPLQ-----DDSELSTVFNNIRYKF  115

Query  562  ESALEVLVTFQARNSEHVFNTVMTYLPQD  648
            +  L VL  FQA NS+HVFNTVMTY+PQD
Sbjct  116  QKTLNVLQDFQAVNSDHVFNTVMTYMPQD  144



>ref|NP_001190197.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AED90285.1| uncharacterized protein AT5G01010 [Arabidopsis thaliana]
Length=472

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGL+PITRAFLASYYDK+ F PLSD+VSRL  ++ S+ + L      S+GE+ L+ 
Sbjct  1    MASTEGLMPITRAFLASYYDKYPFSPLSDDVSRLSSDMASLIKLLTVQSPPSQGETSLID  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   PPHKIDENMWKNREQ+EEILFLL  S WP  L++ ST++DAE  ++L  LK+ F+
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLSPSRWPVQLREPSTSEDAEFASILRTLKDSFD  120

Query  565  SALEVLVTFQARNSEHVFNT  624
            +A   +++FQ +NSE +F+T
Sbjct  121  NAFTAMISFQTKNSERIFST  140



>ref|XP_008793391.1| PREDICTED: uncharacterized protein LOC103709697 isoform X3 [Phoenix 
dactylifera]
Length=413

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 109/148 (74%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MA  EGLVPITRAFLA YYDK   PPLSD+V RL  E+R     L +    + GE L+V+
Sbjct  1    MALAEGLVPITRAFLARYYDKCPLPPLSDDVPRLTAELRGFVDGLLRELAPTFGEELVVN  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   PPHKIDEN+WKNRE IEEILFLL+ S+ P  LQ+++T +D ++ AV   ++ KF+
Sbjct  61   EANREPPHKIDENLWKNREHIEEILFLLEDSHRPRSLQEKATPEDMDIAAVFGDIEAKFK  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            ++L+ L TFQ RN++++F+TVMTY+PQD
Sbjct  121  TSLKTLETFQLRNADNIFSTVMTYMPQD  148



>ref|XP_008793389.1| PREDICTED: uncharacterized protein LOC103709697 isoform X1 [Phoenix 
dactylifera]
Length=438

 Score =   169 bits (427),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 109/148 (74%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MA  EGLVPITRAFLA YYDK   PPLSD+V RL  E+R     L +    + GE L+V+
Sbjct  1    MALAEGLVPITRAFLARYYDKCPLPPLSDDVPRLTAELRGFVDGLLRELAPTFGEELVVN  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   PPHKIDEN+WKNRE IEEILFLL+ S+ P  LQ+++T +D ++ AV   ++ KF+
Sbjct  61   EANREPPHKIDENLWKNREHIEEILFLLEDSHRPRSLQEKATPEDMDIAAVFGDIEAKFK  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            ++L+ L TFQ RN++++F+TVMTY+PQD
Sbjct  121  TSLKTLETFQLRNADNIFSTVMTYMPQD  148



>ref|XP_003626627.1| hypothetical protein MTR_8g005040 [Medicago truncatula]
 gb|ABE93045.1| Proteinase inhibitor I4, serpin; emp24/gp25L/p24 [Medicago truncatula]
 gb|AET01103.1| serpin, putative [Medicago truncatula]
Length=428

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 106/149 (71%), Gaps = 11/149 (7%)
 Frame = +1

Query  208  ASTEGLVPITRAFLASYYDKHQF-PPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            ASTEGLVPITRAFL+SYYDKH F PPLS +VS L   +R+MA DL       + E+L   
Sbjct  3    ASTEGLVPITRAFLSSYYDKHPFTPPLSSDVSHLTSLLRTMATDLG-----IDDEALTF-  56

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTML-QQQSTAQDAELGAVLLRLKEKF  561
               + PPHKIDENMWKNRE IEE +FLL++SNWP  L QQQST  + +   +L +LK+K 
Sbjct  57   ---TQPPHKIDENMWKNREYIEETIFLLQQSNWPDPLKQQQSTPDNIQFSIILGKLKDKL  113

Query  562  ESALEVLVTFQARNSEHVFNTVMTYLPQD  648
               L  L +FQ +N++HVFNTVMTYLPQD
Sbjct  114  HRTLTTLESFQIKNADHVFNTVMTYLPQD  142



>ref|XP_010921251.1| PREDICTED: uncharacterized protein LOC105044884 isoform X2 [Elaeis 
guineensis]
Length=438

 Score =   163 bits (412),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 106/148 (72%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITR FLA YYDK+  PPL+D+V R   E+R  +  L +   L+ GE L+V+
Sbjct  1    MASTEGLVPITRDFLARYYDKYPLPPLADDVPRFTAELRGFSDSLLREFPLTSGEELVVN  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            E +  PP KIDEN+WKNRE IEEILFLL+ S  P +LQQ ++ +  ++ AV   ++ K +
Sbjct  61   EVDREPPRKIDENLWKNREHIEEILFLLEDSYQPRLLQQNASPEYVDIAAVFGDIEAKLK  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            + L+ L  FQ +N+++VFNTVMTY+PQD
Sbjct  121  TTLKTLEMFQLKNADNVFNTVMTYMPQD  148



>ref|XP_010921250.1| PREDICTED: uncharacterized protein LOC105044884 isoform X1 [Elaeis 
guineensis]
Length=449

 Score =   163 bits (412),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 106/148 (72%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITR FLA YYDK+  PPL+D+V R   E+R  +  L +   L+ GE L+V+
Sbjct  1    MASTEGLVPITRDFLARYYDKYPLPPLADDVPRFTAELRGFSDSLLREFPLTSGEELVVN  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            E +  PP KIDEN+WKNRE IEEILFLL+ S  P +LQQ ++ +  ++ AV   ++ K +
Sbjct  61   EVDREPPRKIDENLWKNREHIEEILFLLEDSYQPRLLQQNASPEYVDIAAVFGDIEAKLK  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            + L+ L  FQ +N+++VFNTVMTY+PQD
Sbjct  121  TTLKTLEMFQLKNADNVFNTVMTYMPQD  148



>gb|AFW77522.1| hypothetical protein ZEAMMB73_436424, partial [Zea mays]
Length=248

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 102/148 (69%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MA TEGLVPITR +LA YYDK+  PPL D  + L   +R+++ DL     ++  E LL  
Sbjct  1    MAMTEGLVPITRTYLARYYDKYPLPPLPDATTDLAARLRALSADLAAVAPIAPDEELLEQ  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   P HKIDEN+WKNREQ+EEILFL+  S+ P  LQQ+ST +DAE+   L  ++ K +
Sbjct  61   EAAGIPAHKIDENLWKNREQMEEILFLINTSHRPVALQQKSTPEDAEIVCTLDDIEAKLK  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
              L+ L  FQ +N+++VFNTVMTY+PQD
Sbjct  121  DMLKNLEQFQLKNADNVFNTVMTYMPQD  148



>ref|XP_004962482.1| PREDICTED: uncharacterized protein LOC101772803 isoform X2 [Setaria 
italica]
Length=437

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 103/148 (70%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MA+TEGLVPITRA+LA YYDK+  PPL D  + L   +R+++ DL     ++  E LL  
Sbjct  1    MATTEGLVPITRAYLARYYDKYPLPPLPDAATDLAARLRALSADLAAVAPITPDEELLKQ  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   P HKIDENMWKNREQ+EEILFLL  S  P  LQQ+ST +D E+ + L  ++ K +
Sbjct  61   EAAGIPAHKIDENMWKNREQMEEILFLLNTSRRPVALQQKSTPEDTEIVSKLDDIEAKLK  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
              L+ L  FQ +N+++VFNTVMTY+PQD
Sbjct  121  DMLKKLEQFQLKNADNVFNTVMTYMPQD  148



>ref|XP_004962483.1| PREDICTED: uncharacterized protein LOC101772803 isoform X3 [Setaria 
italica]
Length=437

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 103/148 (70%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MA+TEGLVPITRA+LA YYDK+  PPL D  + L   +R+++ DL     ++  E LL  
Sbjct  1    MATTEGLVPITRAYLARYYDKYPLPPLPDAATDLAARLRALSADLAAVAPITPDEELLKQ  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   P HKIDENMWKNREQ+EEILFLL  S  P  LQQ+ST +D E+ + L  ++ K +
Sbjct  61   EAAGIPAHKIDENMWKNREQMEEILFLLNTSRRPVQLQQKSTPEDTEIVSKLDDIEAKLK  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
              L+ L  FQ +N+++VFNTVMTY+PQD
Sbjct  121  DMLKKLEQFQLKNADNVFNTVMTYMPQD  148



>ref|XP_004962481.1| PREDICTED: uncharacterized protein LOC101772803 isoform X1 [Setaria 
italica]
Length=439

 Score =   160 bits (406),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 103/148 (70%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MA+TEGLVPITRA+LA YYDK+  PPL D  + L   +R+++ DL     ++  E LL  
Sbjct  1    MATTEGLVPITRAYLARYYDKYPLPPLPDAATDLAARLRALSADLAAVAPITPDEELLKQ  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   P HKIDENMWKNREQ+EEILFLL  S  P  LQQ+ST +D E+ + L  ++ K +
Sbjct  61   EAAGIPAHKIDENMWKNREQMEEILFLLNTSRRPVALQQKSTPEDTEIVSKLDDIEAKLK  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
              L+ L  FQ +N+++VFNTVMTY+PQD
Sbjct  121  DMLKKLEQFQLKNADNVFNTVMTYMPQD  148



>ref|XP_009391656.1| PREDICTED: uncharacterized protein LOC103977773 [Musa acuminata 
subsp. malaccensis]
Length=439

 Score =   160 bits (405),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 104/147 (71%), Gaps = 0/147 (0%)
 Frame = +1

Query  208  ASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVHE  387
            +S EGLVPITRAFLA YYD    PPLS++VSRL  E+R ++  L +   L+ GE LLVHE
Sbjct  3    SSAEGLVPITRAFLARYYDTCPLPPLSEDVSRLTAELRELSDGLARESPLTSGEELLVHE  62

Query  388  AESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFES  567
             +  P HKIDEN+WKNRE IEEIL LL+ S+ P +LQ+++  +  ++ A L  L+ K  S
Sbjct  63   VDHQPAHKIDENLWKNRENIEEILVLLEESHRPRLLQEKAIPEYVDIAATLGELEVKLRS  122

Query  568  ALEVLVTFQARNSEHVFNTVMTYLPQD  648
             L+ L  FQ  N+++VFNTVMTY+PQD
Sbjct  123  TLKTLEAFQQTNADNVFNTVMTYMPQD  149



>ref|XP_006654248.1| PREDICTED: uncharacterized protein LOC102707586 [Oryza brachyantha]
Length=437

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 103/146 (71%), Gaps = 0/146 (0%)
 Frame = +1

Query  211  STEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVHEA  390
            +TEGLVPITRA+LA YYDK+  PPL D V+ L D +R+++  L     ++  E LL  EA
Sbjct  2    ATEGLVPITRAYLARYYDKYPLPPLPDAVTDLADRLRALSAGLAAVAPITPDEELLEKEA  61

Query  391  ESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFESA  570
               P HKIDEN+WKNREQ+EEILFLL +S  P  LQQ STA+D +  ++L  ++ K +  
Sbjct  62   SGIPAHKIDENLWKNREQMEEILFLLSKSCRPVALQQNSTAEDTQTFSILDDVETKLKDM  121

Query  571  LEVLVTFQARNSEHVFNTVMTYLPQD  648
            L+ L  FQ +N+++VFNTVMTY+PQD
Sbjct  122  LKKLEQFQIKNADNVFNTVMTYMPQD  147



>gb|AFW77521.1| hypothetical protein ZEAMMB73_436424 [Zea mays]
Length=412

 Score =   157 bits (398),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 102/148 (69%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MA TEGLVPITR +LA YYDK+  PPL D  + L   +R+++ DL     ++  E LL  
Sbjct  1    MAMTEGLVPITRTYLARYYDKYPLPPLPDATTDLAARLRALSADLAAVAPIAPDEELLEQ  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   P HKIDEN+WKNREQ+EEILFL+  S+ P  LQQ+ST +DAE+   L  ++ K +
Sbjct  61   EAAGIPAHKIDENLWKNREQMEEILFLINTSHRPVALQQKSTPEDAEIVCTLDDIEAKLK  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
              L+ L  FQ +N+++VFNTVMTY+PQD
Sbjct  121  DMLKNLEQFQLKNADNVFNTVMTYMPQD  148



>ref|XP_010231534.1| PREDICTED: uncharacterized protein LOC100826543 isoform X3 [Brachypodium 
distachyon]
Length=339

 Score =   155 bits (393),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 99/146 (68%), Gaps = 0/146 (0%)
 Frame = +1

Query  211  STEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVHEA  390
            +TEGLVPITR +LA YYDK+  PPL D V+ L   +R M+ DL     +S  E LL  EA
Sbjct  2    ATEGLVPITRDYLARYYDKYPLPPLPDGVTTLAARLRDMSADLAAVAPMSPDEELLGREA  61

Query  391  ESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFESA  570
               P HKIDENMWKNREQ+EEILFLL +S  P  LQQ+ST +D E+   L  ++ K +  
Sbjct  62   GGIPAHKIDENMWKNREQMEEILFLLNKSRRPNPLQQKSTPEDDEIACKLDVVETKIKDM  121

Query  571  LEVLVTFQARNSEHVFNTVMTYLPQD  648
            L+ L  FQ  N+++VFNTVMTY+PQD
Sbjct  122  LKKLEQFQLTNADNVFNTVMTYMPQD  147



>ref|XP_002440877.1| hypothetical protein SORBIDRAFT_09g012090 [Sorghum bicolor]
 gb|EES19307.1| hypothetical protein SORBIDRAFT_09g012090 [Sorghum bicolor]
Length=152

 Score =   149 bits (376),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 97/147 (66%), Gaps = 0/147 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MA+TEGLVPITR +LA YYD +  PPL D  + L   +R+++ DL     ++  E LL  
Sbjct  1    MATTEGLVPITRTYLARYYDNYPLPPLPDATTDLAARLRALSADLAAVAPITPDEELLEQ  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   P HKIDEN+WKNREQ+EEILFL+  S  P  LQQ+ST +DA++   L  ++ K +
Sbjct  61   EAAGIPAHKIDENLWKNREQMEEILFLINTSRRPVALQQKSTPEDAQIVCTLDDIEAKLK  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQ  645
              L+ L  FQ  N++ VFNTVMTY P+
Sbjct  121  DMLKKLEQFQLENADSVFNTVMTYSPK  147



>dbj|BAJ93195.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=437

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 100/146 (68%), Gaps = 0/146 (0%)
 Frame = +1

Query  211  STEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVHEA  390
            +TEGLVPITR +LA YYDK+  PP+ D V+ L   +R+++ DL      S  E  L  EA
Sbjct  2    TTEGLVPITRDYLARYYDKYPLPPIPDGVTALAARLRALSTDLAAAFPFSPDEEHLEQEA  61

Query  391  ESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFESA  570
               P HKIDENMWKNREQ+EEILFLL +S  P  LQQ+ST +DAE+ + L   + K +  
Sbjct  62   SGVPAHKIDENMWKNREQMEEILFLLNKSRRPIALQQKSTQEDAEIVSTLDNCETKLKEM  121

Query  571  LEVLVTFQARNSEHVFNTVMTYLPQD  648
            L+ L  FQ +N+++VFNTVMTY+PQD
Sbjct  122  LKKLEQFQLKNADNVFNTVMTYMPQD  147



>ref|XP_003568677.1| PREDICTED: uncharacterized protein LOC100826543 isoform X1 [Brachypodium 
distachyon]
Length=437

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 99/146 (68%), Gaps = 0/146 (0%)
 Frame = +1

Query  211  STEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVHEA  390
            +TEGLVPITR +LA YYDK+  PPL D V+ L   +R M+ DL     +S  E LL  EA
Sbjct  2    ATEGLVPITRDYLARYYDKYPLPPLPDGVTTLAARLRDMSADLAAVAPMSPDEELLGREA  61

Query  391  ESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFESA  570
               P HKIDENMWKNREQ+EEILFLL +S  P  LQQ+ST +D E+   L  ++ K +  
Sbjct  62   GGIPAHKIDENMWKNREQMEEILFLLNKSRRPNPLQQKSTPEDDEIACKLDVVETKIKDM  121

Query  571  LEVLVTFQARNSEHVFNTVMTYLPQD  648
            L+ L  FQ  N+++VFNTVMTY+PQD
Sbjct  122  LKKLEQFQLTNADNVFNTVMTYMPQD  147



>ref|XP_010231533.1| PREDICTED: uncharacterized protein LOC100826543 isoform X2 [Brachypodium 
distachyon]
Length=423

 Score =   155 bits (392),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 99/146 (68%), Gaps = 0/146 (0%)
 Frame = +1

Query  211  STEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVHEA  390
            +TEGLVPITR +LA YYDK+  PPL D V+ L   +R M+ DL     +S  E LL  EA
Sbjct  2    ATEGLVPITRDYLARYYDKYPLPPLPDGVTTLAARLRDMSADLAAVAPMSPDEELLGREA  61

Query  391  ESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFESA  570
               P HKIDENMWKNREQ+EEILFLL +S  P  LQQ+ST +D E+   L  ++ K +  
Sbjct  62   GGIPAHKIDENMWKNREQMEEILFLLNKSRRPNPLQQKSTPEDDEIACKLDVVETKIKDM  121

Query  571  LEVLVTFQARNSEHVFNTVMTYLPQD  648
            L+ L  FQ  N+++VFNTVMTY+PQD
Sbjct  122  LKKLEQFQLTNADNVFNTVMTYMPQD  147



>ref|XP_008782731.1| PREDICTED: uncharacterized protein LOC103702180 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008782732.1| PREDICTED: uncharacterized protein LOC103702180 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008782733.1| PREDICTED: uncharacterized protein LOC103702180 isoform X1 [Phoenix 
dactylifera]
Length=438

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 109/148 (74%), Gaps = 0/148 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITRAFLA YYDK+  PPL D+V RL  E+R  +  L +   L+ GE L V+
Sbjct  1    MASTEGLVPITRAFLARYYDKYPLPPLPDDVPRLTAELRGFSDSLLREFPLTSGEELEVN  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   PP KIDEN+WKNRE IEEILFLL+ S+ P +LQ+++T +  ++ AV   ++ K +
Sbjct  61   EAGREPPQKIDENLWKNREHIEEILFLLEESHQPRLLQEKATPEYIDIAAVFGDIEAKLK  120

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            + L+ L TFQ +N+++VFNTVMTY+PQD
Sbjct  121  TTLKTLETFQLKNADNVFNTVMTYMPQD  148



>ref|XP_008649464.1| PREDICTED: uncharacterized protein LOC103630158 isoform X2 [Zea 
mays]
Length=499

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 100/145 (69%), Gaps = 0/145 (0%)
 Frame = +1

Query  214  TEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVHEAE  393
            TEGLVPITR +LA YYDK+  PPL D  + L   +R+++ DL     ++  E LL  EA 
Sbjct  66   TEGLVPITRTYLARYYDKYPLPPLPDATTDLAARLRALSADLAAVAPIAPDEELLEQEAA  125

Query  394  STPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFESAL  573
              P HKIDEN+WKNREQ+EEILFL+  S+ P  LQQ+ST +DAE+   L  ++ K +  L
Sbjct  126  GIPAHKIDENLWKNREQMEEILFLINTSHRPVALQQKSTPEDAEIVCTLDDIEAKLKDML  185

Query  574  EVLVTFQARNSEHVFNTVMTYLPQD  648
            + L  FQ +N+++VFNTVMTY+PQD
Sbjct  186  KNLEQFQLKNADNVFNTVMTYMPQD  210



>ref|XP_008649463.1| PREDICTED: uncharacterized protein LOC103630158 isoform X1 [Zea 
mays]
Length=501

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 100/145 (69%), Gaps = 0/145 (0%)
 Frame = +1

Query  214  TEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVHEAE  393
            TEGLVPITR +LA YYDK+  PPL D  + L   +R+++ DL     ++  E LL  EA 
Sbjct  66   TEGLVPITRTYLARYYDKYPLPPLPDATTDLAARLRALSADLAAVAPIAPDEELLEQEAA  125

Query  394  STPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFESAL  573
              P HKIDEN+WKNREQ+EEILFL+  S+ P  LQQ+ST +DAE+   L  ++ K +  L
Sbjct  126  GIPAHKIDENLWKNREQMEEILFLINTSHRPVALQQKSTPEDAEIVCTLDDIEAKLKDML  185

Query  574  EVLVTFQARNSEHVFNTVMTYLPQD  648
            + L  FQ +N+++VFNTVMTY+PQD
Sbjct  186  KNLEQFQLKNADNVFNTVMTYMPQD  210



>gb|EEE63181.1| hypothetical protein OsJ_17990 [Oryza sativa Japonica Group]
Length=431

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 101/148 (68%), Gaps = 2/148 (1%)
 Frame = +1

Query  211  STEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRT--LSEGESLLVH  384
            +TEGLVPITRA+LA YYDK+  PPL D  + L D +R+++  L       ++  E LL  
Sbjct  2    ATEGLVPITRAYLARYYDKYPLPPLPDAATALADRLRAISAALALAAAAPITPDEELLEK  61

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   P HKIDEN+WKNREQ+EEIL LL +S  P  LQQ+STA+D E   +L  ++ K +
Sbjct  62   EANGIPAHKIDENLWKNREQMEEILLLLNKSRRPVALQQRSTAEDTETFIILDDVETKLK  121

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
              L+ L  FQ +N+++VFNTVMTY+PQD
Sbjct  122  DMLKKLEQFQIKNADNVFNTVMTYMPQD  149



>ref|NP_001055152.1| Os05g0306000 [Oryza sativa Japonica Group]
 dbj|BAF17066.1| Os05g0306000 [Oryza sativa Japonica Group]
 dbj|BAG92466.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC78947.1| hypothetical protein OsI_19396 [Oryza sativa Indica Group]
Length=439

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 101/148 (68%), Gaps = 2/148 (1%)
 Frame = +1

Query  211  STEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRT--LSEGESLLVH  384
            +TEGLVPITRA+LA YYDK+  PPL D  + L D +R+++  L       ++  E LL  
Sbjct  2    ATEGLVPITRAYLARYYDKYPLPPLPDAATALADRLRAISAALALAAAAPITPDEELLEK  61

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            EA   P HKIDEN+WKNREQ+EEIL LL +S  P  LQQ+STA+D E   +L  ++ K +
Sbjct  62   EANGIPAHKIDENLWKNREQMEEILLLLNKSRRPVALQQRSTAEDTETFIILDDVETKLK  121

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
              L+ L  FQ +N+++VFNTVMTY+PQD
Sbjct  122  DMLKKLEQFQIKNADNVFNTVMTYMPQD  149



>gb|EMS49914.1| hypothetical protein TRIUR3_19770 [Triticum urartu]
Length=402

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 100/146 (68%), Gaps = 0/146 (0%)
 Frame = +1

Query  211  STEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVHEA  390
            +TEGLVPITR +LA YYDK+  PP+ D V+ L   +R+++ +L      S  E  L  EA
Sbjct  2    TTEGLVPITRDYLARYYDKYPLPPIPDGVTALAARLRALSAELAAASPFSPEEEHLEQEA  61

Query  391  ESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFESA  570
               P HKIDENMWKNREQ+EEILFLL +S  P  LQQ+ST +DAE+ + L   + K +  
Sbjct  62   SGVPAHKIDENMWKNREQMEEILFLLNKSRRPVALQQKSTLEDAEIVSTLDDCETKLKEM  121

Query  571  LEVLVTFQARNSEHVFNTVMTYLPQD  648
            L+ L  FQ +N+++VFNTVMTY+PQD
Sbjct  122  LKKLEQFQLKNADNVFNTVMTYMPQD  147



>gb|EMT26757.1| hypothetical protein F775_30139 [Aegilops tauschii]
Length=451

 Score =   147 bits (371),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 100/146 (68%), Gaps = 0/146 (0%)
 Frame = +1

Query  211  STEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVHEA  390
            +TEGLVPITR +LA YYDK+  PP+ D V+ L   +R+++ +L      S  E  L  EA
Sbjct  135  TTEGLVPITRDYLARYYDKYPLPPIPDGVTALAARLRALSAELAAASPFSPEEEHLEQEA  194

Query  391  ESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFESA  570
               P HKIDENMWKNREQ+EEILFLL +S  P  LQQ+ST +DAE+ + L   + K +  
Sbjct  195  SVVPAHKIDENMWKNREQMEEILFLLNKSRRPVALQQKSTPEDAEIVSTLDDCETKLKEM  254

Query  571  LEVLVTFQARNSEHVFNTVMTYLPQD  648
            L+ L  FQ +N+++VFNTVMTY+PQD
Sbjct  255  LKKLEQFQLKNADNVFNTVMTYMPQD  280



>gb|KJB27585.1| hypothetical protein B456_005G0011002, partial [Gossypium raimondii]
Length=99

 Score =   122 bits (306),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +1

Query  364  GESLLVHEAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLL  543
            GESLL+ EA+S PPHK+DENMWKNRE IEEILFLL+R +WP++LQQ STA+ AE    L 
Sbjct  13   GESLLIQEADSEPPHKMDENMWKNREHIEEILFLLERPHWPSVLQQSSTAEVAEFATTLG  72

Query  544  RLKEKFESALEVLVTFQARNSEHVFNT  624
            +LK+KF++ L +L +FQ++NSE VFNT
Sbjct  73   QLKDKFQATLRILESFQSKNSERVFNT  99



>ref|XP_001765571.1| predicted protein [Physcomitrella patens]
 gb|EDQ69621.1| predicted protein [Physcomitrella patens]
Length=444

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 87/147 (59%), Gaps = 0/147 (0%)
 Frame = +1

Query  208  ASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVHE  387
            AST GLVPI RAFLA +YDK+ F PL+ EV  L   +R      Q     S     L+ +
Sbjct  3    ASTAGLVPINRAFLAKFYDKYPFAPLAPEVETLLALLREHVHKAQTVSPGSRDNGALIGQ  62

Query  388  AESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFES  567
              +  PHK+DEN+WKNRE IEE+L LL +  WP+ L+   +++   +   + +++   + 
Sbjct  63   FNNPAPHKLDENLWKNREMIEEMLHLLSKRKWPSSLKGNVSSELEPVAERIKKMEVGLQQ  122

Query  568  ALEVLVTFQARNSEHVFNTVMTYLPQD  648
             L+ LV FQ   SE +F+ V+TY+PQD
Sbjct  123  LLDKLVAFQKVQSERIFSMVLTYMPQD  149



>ref|XP_008793390.1| PREDICTED: uncharacterized protein LOC103709697 isoform X2 [Phoenix 
dactylifera]
Length=419

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MA  EGLVPITRAFLA YYDK   PPLSD+V RL  E+R     L +    + GE L+V+
Sbjct  1    MALAEGLVPITRAFLARYYDKCPLPPLSDDVPRLTAELRGFVDGLLRELAPTFGEELVVN  60

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWP  486
            EA   PPHKIDEN+WKNRE IEEILFLL+ S+ P
Sbjct  61   EANREPPHKIDENLWKNREHIEEILFLLEDSHRP  94



>ref|XP_002991009.1| hypothetical protein SELMODRAFT_161364 [Selaginella moellendorffii]
 gb|EFJ07817.1| hypothetical protein SELMODRAFT_161364 [Selaginella moellendorffii]
Length=429

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 91/148 (61%), Gaps = 7/148 (5%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITR FL+ +YD++ F  L+  ++    ++R     + +      G  L++ 
Sbjct  1    MASTEGLVPITRDFLSRFYDRYPFEALAPGIAAADSQLREENERMSKHCAEESGNDLIL-  59

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            +     PHKIDEN+WKNREQ+EEIL+LL++ +WP      ST    ++   L +L  + +
Sbjct  60   DLSFDSPHKIDENLWKNREQVEEILYLLEKRHWP------STLNGPQMPDKLYKLALELQ  113

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
              L+ +  +Q+ +SE +F+ ++TY+PQD
Sbjct  114  GLLKFIEDYQSFSSEKIFSMILTYMPQD  141



>ref|XP_002980642.1| hypothetical protein SELMODRAFT_154057 [Selaginella moellendorffii]
 gb|EFJ18293.1| hypothetical protein SELMODRAFT_154057 [Selaginella moellendorffii]
Length=429

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 91/148 (61%), Gaps = 7/148 (5%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  384
            MASTEGLVPITR FL+ +YD++ F  L+  ++    ++R     + +      G  L++ 
Sbjct  1    MASTEGLVPITRDFLSRFYDRYPFEALAPGIAAADSQLREENERMSKHYAEESGNDLIL-  59

Query  385  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  564
            +     PHKIDEN+WKNREQ+EEIL+LL++ +WP      S+    ++   L +L  + +
Sbjct  60   DLSFDSPHKIDENLWKNREQVEEILYLLEKRHWP------SSLNGPQMPDKLYKLALELQ  113

Query  565  SALEVLVTFQARNSEHVFNTVMTYLPQD  648
            S L+ +  +Q  +SE +F+ ++TY+PQD
Sbjct  114  SLLKFIEDYQYFSSEKIFSMILTYMPQD  141



>gb|KDO64225.1| hypothetical protein CISIN_1g025201mg [Citrus sinensis]
Length=180

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = +1

Query  424  MWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFESALEVLVTFQARN  603
            MWKNRE +EEI+FLLKRS+WP  LQQ S  +D EL  VL +L EKFE  L  L +FQA N
Sbjct  1    MWKNREHMEEIIFLLKRSHWPATLQQSSAPEDVELANVLGKLSEKFEKTLNTLKSFQAVN  60

Query  604  SEHVFNTVMTYLPQD  648
            S+ +FNTVMTY+PQD
Sbjct  61   SDRIFNTVMTYMPQD  75



>dbj|BAD43927.1| unnamed protein product [Arabidopsis thaliana]
Length=358

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  445  IEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFESALEVLVTFQARNSEHVFNT  624
            +EEILFLL  S WP  L++ ST++DAE  ++L  LK+ F++A   +++FQ +NSE +F+T
Sbjct  1    MEEILFLLSPSRWPVQLREPSTSEDAEFASILRTLKDSFDNAFTAMISFQTKNSERIFST  60

Query  625  VMTYLPQD  648
            VMTY+PQD
Sbjct  61   VMTYMPQD  68



>ref|XP_006381292.1| hypothetical protein POPTR_0006s11480g [Populus trichocarpa]
 gb|ERP59089.1| hypothetical protein POPTR_0006s11480g [Populus trichocarpa]
Length=71

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDL  339
            MASTEGLVPITR FLASY DK+ F PL D+VSRL  EIRS+  DL
Sbjct  1    MASTEGLVPITRKFLASYDDKYPFAPLPDDVSRLSSEIRSIITDL  45



>ref|XP_004353064.1| serpin, putative [Acanthamoeba castellanii str. Neff]
 gb|ELR23536.1| serpin, putative [Acanthamoeba castellanii str. Neff]
Length=490

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 79/166 (48%), Gaps = 30/166 (18%)
 Frame = +1

Query  223  LVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTL-----SEGESLLVHE  387
            LVPITR  L  YY+ +   P SD +  L  E+++ A  L  G  L      EGES    +
Sbjct  11   LVPITREILRQYYETYPADPPSDNLKALRAEVQTAAHKL--GLKLPEKWNHEGESGAEVQ  68

Query  388  AES------------TPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELG  531
            A+             T PHK+DEN+W++R+Q+EEIL LL+    P  L    TA     G
Sbjct  69   ADDELNREVLGQNLLTVPHKMDENIWRSRQQLEEILHLLE----PAQLDDVETAAKGASG  124

Query  532  -------AVLLRLKEKFESALEVLVTFQARNSEHVFNTVMTYLPQD  648
                   A +  ++ K  +A E L  FQ    + V + + T+LP D
Sbjct  125  VSFDEWKAAVDGIRTKANAAFERLQEFQKGGMKKVQHIISTFLPND  170



>ref|XP_010921253.1| PREDICTED: uncharacterized protein LOC105044884 isoform X3 [Elaeis 
guineensis]
Length=396

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDL  339
            MASTEGLVPITR FLA YYDK+  PPL+D+V R   E+R  +  L
Sbjct  1    MASTEGLVPITRDFLARYYDKYPLPPLADDVPRFTAELRGFSDSL  45



>ref|XP_010921254.1| PREDICTED: uncharacterized protein LOC105044884 isoform X4 [Elaeis 
guineensis]
Length=362

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +1

Query  205  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDL  339
            MASTEGLVPITR FLA YYDK+  PPL+D+V R   E+R  +  L
Sbjct  1    MASTEGLVPITRDFLARYYDKYPLPPLADDVPRFTAELRGFSDSL  45



>ref|XP_010496718.1| PREDICTED: uncharacterized protein LOC104773766, partial [Camelina 
sativa]
Length=303

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +1

Query  493  LQQQSTAQDAELGAVLLRLKEKFESALEVLVTFQARNSEHVFNTVMTYLPQD  648
            L++ ST++DA+  ++L  LK+ F+ A   +++FQ +NSE +F+TVMTY+PQD
Sbjct  4    LREPSTSEDADFASILRNLKDNFDIAFTAMISFQTKNSERIFSTVMTYMPQD  55



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 987899701625