BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF041D07

Length=658
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP16685.1|  unnamed protein product                                229   2e-66   Coffea canephora [robusta coffee]
gb|KDO43322.1|  hypothetical protein CISIN_1g0039661mg                  209   3e-64   Citrus sinensis [apfelsine]
ref|XP_008353449.1|  PREDICTED: chloride channel protein CLC-b-like     203   6e-62   
ref|XP_004233300.1|  PREDICTED: chloride channel protein CLC-b          215   3e-61   Solanum lycopersicum
ref|XP_009761471.1|  PREDICTED: chloride channel protein CLC-b-like     214   5e-61   Nicotiana sylvestris
gb|AAD29679.1|AF133209_1  CLC-Nt2 protein                               214   5e-61   Nicotiana tabacum [American tobacco]
ref|XP_006357190.1|  PREDICTED: chloride channel protein CLC-b-like     214   7e-61   Solanum tuberosum [potatoes]
ref|XP_009596046.1|  PREDICTED: chloride channel protein CLC-b-like     213   3e-60   Nicotiana tomentosiformis
ref|XP_011097296.1|  PREDICTED: chloride channel protein CLC-b-like     212   5e-60   Sesamum indicum [beniseed]
ref|XP_002300101.1|  Chloride channel protein CLC-a                     209   6e-59   Populus trichocarpa [western balsam poplar]
gb|KDP46292.1|  hypothetical protein JCGZ_10132                         208   1e-58   Jatropha curcas
ref|XP_006447084.1|  hypothetical protein CICLE_v10014341mg             207   2e-58   Citrus clementina [clementine]
ref|NP_001267676.1|  chloride channel protein CLC-b-like                206   6e-58   Cucumis sativus [cucumbers]
ref|XP_011003929.1|  PREDICTED: chloride channel protein CLC-b          206   6e-58   Populus euphratica
ref|XP_010111585.1|  Chloride channel protein CLC-b                     205   1e-57   Morus notabilis
ref|XP_002509531.1|  chloride channel clc, putative                     204   3e-57   Ricinus communis
ref|XP_007151531.1|  hypothetical protein PHAVU_004G054600g             204   4e-57   Phaseolus vulgaris [French bean]
ref|XP_007217037.1|  hypothetical protein PRUPE_ppa001619mg             203   5e-57   Prunus persica
ref|XP_009371657.1|  PREDICTED: chloride channel protein CLC-b-like     203   5e-57   
ref|XP_008379123.1|  PREDICTED: chloride channel protein CLC-b is...    203   7e-57   
gb|KHN01525.1|  Chloride channel protein CLC-b                          202   9e-57   Glycine soja [wild soybean]
ref|NP_001236494.1|  chloride channel                                   202   9e-57   
ref|XP_008379124.1|  PREDICTED: chloride channel protein CLC-b is...    202   1e-56   
ref|XP_008441347.1|  PREDICTED: chloride channel protein CLC-b-like     202   1e-56   Cucumis melo [Oriental melon]
ref|XP_007161741.1|  hypothetical protein PHAVU_001G094700g             201   3e-56   Phaseolus vulgaris [French bean]
ref|XP_003553925.1|  PREDICTED: chloride channel protein CLC-b-li...    201   4e-56   Glycine max [soybeans]
ref|XP_006604142.1|  PREDICTED: chloride channel protein CLC-b-li...    201   4e-56   Glycine max [soybeans]
ref|XP_007161742.1|  hypothetical protein PHAVU_001G094700g             201   4e-56   Phaseolus vulgaris [French bean]
ref|XP_008231135.1|  PREDICTED: chloride channel protein CLC-b          200   7e-56   Prunus mume [ume]
gb|KJB76408.1|  hypothetical protein B456_012G087500                    200   9e-56   Gossypium raimondii
gb|KJB76409.1|  hypothetical protein B456_012G087500                    199   1e-55   Gossypium raimondii
gb|KJB76407.1|  hypothetical protein B456_012G087500                    199   1e-55   Gossypium raimondii
gb|EYU34803.1|  hypothetical protein MIMGU_mgv1a001623mg                198   3e-55   Erythranthe guttata [common monkey flower]
gb|KHN24330.1|  Chloride channel protein CLC-b                          198   4e-55   Glycine soja [wild soybean]
ref|XP_003618847.1|  Chloride channel protein CLC-a                     197   6e-55   
gb|AES75065.2|  ClC chloride channel family protein                     197   7e-55   Medicago truncatula
ref|XP_007031848.1|  Chloride channel B isoform 2                       197   1e-54   
ref|XP_007031850.1|  Chloride channel B isoform 4                       196   1e-54   
gb|KHN10806.1|  Chloride channel protein CLC-b                          195   4e-54   Glycine soja [wild soybean]
ref|XP_010670516.1|  PREDICTED: chloride channel protein CLC-b-like     195   5e-54   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB11653.1|  hypothetical protein B456_001G270200                    194   6e-54   Gossypium raimondii
ref|XP_010029007.1|  PREDICTED: chloride channel protein CLC-b          194   1e-53   Eucalyptus grandis [rose gum]
gb|EYU45399.1|  hypothetical protein MIMGU_mgv1a001597mg                192   5e-53   Erythranthe guttata [common monkey flower]
ref|XP_004513192.1|  PREDICTED: chloride channel protein CLC-b-like     192   5e-53   Cicer arietinum [garbanzo]
ref|XP_011098867.1|  PREDICTED: chloride channel protein CLC-a-like     191   7e-53   Sesamum indicum [beniseed]
gb|KFK33637.1|  hypothetical protein AALP_AA5G039600                    190   2e-52   Arabis alpina [alpine rockcress]
ref|XP_006395477.1|  hypothetical protein EUTSA_v10003679mg             190   3e-52   Eutrema salsugineum [saltwater cress]
ref|NP_189353.1|  chloride channel protein CLC-b                        189   4e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010678325.1|  PREDICTED: chloride channel protein CLC-b-li...    189   5e-52   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010425454.1|  PREDICTED: chloride channel protein CLC-b-li...    189   6e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010425455.1|  PREDICTED: chloride channel protein CLC-b-li...    188   7e-52   Camelina sativa [gold-of-pleasure]
ref|XP_002875360.1|  CLC-B                                              188   1e-51   
ref|XP_010514406.1|  PREDICTED: chloride channel protein CLC-b          187   2e-51   Camelina sativa [gold-of-pleasure]
emb|CDY13685.1|  BnaA06g32380D                                          187   2e-51   Brassica napus [oilseed rape]
ref|XP_010502677.1|  PREDICTED: chloride channel protein CLC-b-li...    187   2e-51   Camelina sativa [gold-of-pleasure]
ref|XP_009151988.1|  PREDICTED: chloride channel protein CLC-b          187   2e-51   Brassica rapa
ref|XP_010502678.1|  PREDICTED: chloride channel protein CLC-b-li...    187   2e-51   Camelina sativa [gold-of-pleasure]
gb|AAB17007.1|  voltage-gated chloride channel                          187   2e-51   Arabidopsis thaliana [mouse-ear cress]
gb|AAL24139.1|  putative anion channel protein                          187   2e-51   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198905.1|  chloride channel protein CLC-a                        187   2e-51   Arabidopsis thaliana [mouse-ear cress]
emb|CDX83663.1|  BnaC07g24030D                                          187   2e-51   
emb|CAA96057.1|  CLC-a chloride channel protein                         187   3e-51   Arabidopsis thaliana [mouse-ear cress]
emb|CAN82189.1|  hypothetical protein VITISV_031114                     187   3e-51   Vitis vinifera
ref|XP_010905204.1|  PREDICTED: chloride channel protein CLC-b-like     187   3e-51   
ref|NP_001268190.1|  uncharacterized protein LOC100260066               187   3e-51   Vitis vinifera
ref|XP_004303984.1|  PREDICTED: chloride channel protein CLC-b-like     187   3e-51   Fragaria vesca subsp. vesca
ref|XP_010660593.1|  PREDICTED: uncharacterized protein LOC100260...    187   3e-51   Vitis vinifera
ref|XP_006290621.1|  hypothetical protein CARUB_v10016713mg             187   4e-51   Capsella rubella
emb|CDX99630.1|  BnaC04g33870D                                          186   9e-51   
gb|KFK33054.1|  hypothetical protein AALP_AA6G324100                    185   1e-50   Arabis alpina [alpine rockcress]
ref|XP_006338691.1|  PREDICTED: chloride channel protein CLC-a-like     183   8e-50   Solanum tuberosum [potatoes]
ref|XP_009129444.1|  PREDICTED: chloride channel protein CLC-b-like     183   9e-50   Brassica rapa
emb|CDY34173.1|  BnaA02g28670D                                          182   9e-50   Brassica napus [oilseed rape]
emb|CDY28488.1|  BnaC02g36720D                                          182   1e-49   Brassica napus [oilseed rape]
ref|XP_008788897.1|  PREDICTED: chloride channel protein CLC-b-like     182   2e-49   
ref|XP_008806046.1|  PREDICTED: chloride channel protein CLC-a-like     182   2e-49   
ref|XP_006285462.1|  hypothetical protein CARUB_v10006880mg             180   7e-49   Capsella rubella
ref|XP_009392485.1|  PREDICTED: chloride channel protein CLC-a-like     180   8e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010248967.1|  PREDICTED: chloride channel protein CLC-b          180   8e-49   Nelumbo nucifera [Indian lotus]
gb|KEH22046.1|  ClC chloride channel family protein                     178   4e-48   Medicago truncatula
ref|XP_002868624.1|  ATCLC-A                                            176   2e-47   
dbj|BAJ33828.1|  unnamed protein product                                170   4e-47   Eutrema halophilum
ref|XP_004231786.1|  PREDICTED: chloride channel protein CLC-a-like     175   6e-47   Solanum lycopersicum
emb|CDY11722.1|  BnaC06g13300D                                          174   9e-47   Brassica napus [oilseed rape]
emb|CDX67478.1|  BnaA07g15180D                                          174   9e-47   
ref|XP_009125164.1|  PREDICTED: chloride channel protein CLC-a-like     174   1e-46   Brassica rapa
ref|XP_010528167.1|  PREDICTED: chloride channel protein CLC-b-like     174   1e-46   Tarenaya hassleriana [spider flower]
dbj|BAJ96369.1|  predicted protein                                      171   1e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ88201.1|  predicted protein                                      171   1e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ92499.1|  predicted protein                                      171   1e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006405416.1|  hypothetical protein EUTSA_v10027650mg             171   2e-45   Eutrema salsugineum [saltwater cress]
ref|XP_010450591.1|  PREDICTED: chloride channel protein CLC-a          170   3e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010441254.1|  PREDICTED: chloride channel protein CLC-a          170   3e-45   Camelina sativa [gold-of-pleasure]
gb|ADD09860.1|  chloride channel A                                      170   3e-45   Eutrema halophilum
ref|XP_010436030.1|  PREDICTED: chloride channel protein CLC-a-like     170   3e-45   Camelina sativa [gold-of-pleasure]
emb|CDY15925.1|  BnaA04g11860D                                          170   3e-45   Brassica napus [oilseed rape]
gb|AFW87644.1|  hypothetical protein ZEAMMB73_318834                    162   4e-45   
ref|XP_009140242.1|  PREDICTED: chloride channel protein CLC-a          170   4e-45   Brassica rapa
gb|EMT23598.1|  hypothetical protein F775_52599                         167   1e-44   
ref|XP_006664534.1|  PREDICTED: chloride channel protein CLC-a-like     168   2e-44   Oryza brachyantha
ref|XP_010929772.1|  PREDICTED: chloride channel protein CLC-b-like     167   4e-44   
ref|XP_003576525.1|  PREDICTED: chloride channel protein CLC-a-like     164   4e-43   Brachypodium distachyon [annual false brome]
ref|XP_004962545.1|  PREDICTED: chloride channel protein CLC-a-li...    164   6e-43   Setaria italica
ref|XP_002438781.1|  hypothetical protein SORBIDRAFT_10g026090          164   8e-43   Sorghum bicolor [broomcorn]
ref|XP_004962544.1|  PREDICTED: chloride channel protein CLC-a-li...    164   1e-42   
ref|XP_008658999.1|  PREDICTED: chloride channel protein isoform X1     163   1e-42   Zea mays [maize]
gb|EEE53145.1|  hypothetical protein OsJ_35963                          162   1e-42   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001183936.1|  chloride channel protein                           163   1e-42   Zea mays [maize]
dbj|BAJ91019.1|  predicted protein                                      162   2e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT27070.1|  Chloride channel protein CLC-b                          160   3e-42   
gb|KDO43323.1|  hypothetical protein CISIN_1g0039661mg                  144   2e-39   Citrus sinensis [apfelsine]
ref|NP_001268053.1|  uncharacterized protein LOC100245380               145   4e-36   Vitis vinifera
ref|XP_010657885.1|  PREDICTED: uncharacterized protein LOC100245...    144   5e-36   Vitis vinifera
ref|XP_010442463.1|  PREDICTED: chloride channel protein CLC-c          142   4e-35   Camelina sativa [gold-of-pleasure]
ref|NP_199800.1|  chloride channel protein CLC-c                        141   9e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010482284.1|  PREDICTED: chloride channel protein CLC-c-like     139   4e-34   Camelina sativa [gold-of-pleasure]
emb|CDX83179.1|  BnaA03g23270D                                          139   5e-34   
emb|CDY21447.1|  BnaC03g27500D                                          139   6e-34   Brassica napus [oilseed rape]
ref|XP_009134029.1|  PREDICTED: chloride channel protein CLC-c          139   6e-34   Brassica rapa
ref|XP_009127371.1|  PREDICTED: chloride channel protein CLC-c          139   6e-34   Brassica rapa
gb|KEH25446.1|  ClC chloride channel family protein                     138   7e-34   Medicago truncatula
ref|XP_006280044.1|  hypothetical protein CARUB_v10025921mg             139   7e-34   Capsella rubella
emb|CDX91539.1|  BnaC02g16210D                                          138   8e-34   
ref|XP_002865761.1|  CLC-C                                              138   8e-34   
ref|XP_011020210.1|  PREDICTED: putative chloride channel-like pr...    138   1e-33   Populus euphratica
gb|EMS65031.1|  Chloride channel protein CLC-b                          135   1e-33   Triticum urartu
ref|NP_001275140.1|  chloride channel protein CLC-c-like                137   2e-33   Solanum tuberosum [potatoes]
ref|XP_010441249.1|  PREDICTED: chloride channel protein CLC-c-like     137   2e-33   Camelina sativa [gold-of-pleasure]
ref|XP_004248849.1|  PREDICTED: chloride channel protein CLC-c-like     137   3e-33   Solanum lycopersicum
emb|CBI29647.3|  unnamed protein product                                136   3e-33   Vitis vinifera
emb|CDO97645.1|  unnamed protein product                                137   4e-33   Coffea canephora [robusta coffee]
ref|XP_011028391.1|  PREDICTED: chloride channel protein CLC-c-like     136   5e-33   Populus euphratica
ref|XP_011016274.1|  PREDICTED: chloride channel protein CLC-c-like     136   5e-33   Populus euphratica
ref|XP_002530769.1|  chloride channel clc, putative                     135   1e-32   Ricinus communis
gb|EYU35026.1|  hypothetical protein MIMGU_mgv1a001577mg                135   1e-32   Erythranthe guttata [common monkey flower]
ref|XP_010682061.1|  PREDICTED: chloride channel protein CLC-c-like     135   1e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009618449.1|  PREDICTED: chloride channel protein CLC-c-like     135   1e-32   Nicotiana tomentosiformis
ref|XP_009791971.1|  PREDICTED: chloride channel protein CLC-c-like     135   1e-32   Nicotiana sylvestris
gb|KDP30234.1|  hypothetical protein JCGZ_17016                         134   2e-32   Jatropha curcas
ref|XP_006389435.1|  chloride channel-like family protein               134   2e-32   Populus trichocarpa [western balsam poplar]
ref|XP_008365471.1|  PREDICTED: chloride channel protein CLC-a-like     124   3e-32   
gb|ADD09861.1|  chloride channel C                                      134   4e-32   Eutrema halophilum
ref|XP_006402220.1|  hypothetical protein EUTSA_v10012744mg             134   4e-32   Eutrema salsugineum [saltwater cress]
ref|XP_011087632.1|  PREDICTED: chloride channel protein CLC-c          134   4e-32   
gb|EEC77341.1|  hypothetical protein OsI_16021                          130   4e-32   Oryza sativa Indica Group [Indian rice]
ref|XP_009108066.1|  PREDICTED: putative chloride channel-like pr...    133   6e-32   Brassica rapa
emb|CDY47559.1|  BnaA08g07280D                                          133   6e-32   Brassica napus [oilseed rape]
ref|XP_006381102.1|  chloride channel-like family protein               133   6e-32   
ref|XP_006349289.1|  PREDICTED: chloride channel protein CLC-c-like     132   9e-32   Solanum tuberosum [potatoes]
ref|XP_008801915.1|  PREDICTED: putative chloride channel-like pr...    132   1e-31   Phoenix dactylifera
ref|XP_008801913.1|  PREDICTED: putative chloride channel-like pr...    132   1e-31   Phoenix dactylifera
ref|XP_001756485.1|  predicted protein                                  131   3e-31   
ref|XP_006652320.1|  PREDICTED: chloride channel protein CLC-c-like     131   3e-31   Oryza brachyantha
ref|XP_010656505.1|  PREDICTED: uncharacterized protein LOC100255...    131   3e-31   Vitis vinifera
ref|NP_001267998.1|  uncharacterized protein LOC100255837               131   4e-31   Vitis vinifera
emb|CAN62616.1|  hypothetical protein VITISV_036165                     131   4e-31   Vitis vinifera
ref|NP_198313.2|  putative chloride channel-like protein CLC-g          130   4e-31   Arabidopsis thaliana [mouse-ear cress]
emb|CDY12393.1|  BnaC08g08120D                                          130   4e-31   Brassica napus [oilseed rape]
ref|XP_003592890.1|  Chloride channel protein CLC-c                     130   5e-31   Medicago truncatula
ref|XP_011017858.1|  PREDICTED: putative chloride channel-like pr...    130   5e-31   Populus euphratica
ref|XP_004230422.1|  PREDICTED: chloride channel protein CLC-c          130   6e-31   Solanum lycopersicum
gb|EEE60792.1|  hypothetical protein OsJ_14377                          130   6e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011017857.1|  PREDICTED: putative chloride channel-like pr...    130   6e-31   Populus euphratica
ref|XP_006395982.1|  hypothetical protein EUTSA_v10003685mg             130   7e-31   Eutrema salsugineum [saltwater cress]
ref|XP_010674330.1|  PREDICTED: chloride channel protein CLC-c-like     130   8e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002870407.1|  hypothetical protein ARALYDRAFT_493576             130   8e-31   
ref|XP_008452224.1|  PREDICTED: LOW QUALITY PROTEIN: chloride cha...    130   1e-30   Cucumis melo [Oriental melon]
gb|EAY94258.1|  hypothetical protein OsI_16029                          130   1e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_010541946.1|  PREDICTED: putative chloride channel-like pr...    129   1e-30   Tarenaya hassleriana [spider flower]
ref|XP_007013578.1|  Voltage-gated chloride channel family protei...    129   1e-30   
emb|CDM85188.1|  unnamed protein product                                129   1e-30   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009363967.1|  PREDICTED: putative chloride channel-like pr...    129   1e-30   Pyrus x bretschneideri [bai li]
ref|XP_008385147.1|  PREDICTED: LOW QUALITY PROTEIN: putative chl...    129   1e-30   
ref|XP_008354360.1|  PREDICTED: putative chloride channel-like pr...    129   2e-30   
ref|XP_007013577.1|  Voltage-gated chloride channel family protei...    129   2e-30   
ref|XP_008336976.1|  PREDICTED: putative chloride channel-like pr...    129   2e-30   
gb|ADF30876.1|  chloride channel protein                                128   3e-30   Citrus trifoliata [hardy orange]
gb|ACF87782.1|  unknown                                                 124   3e-30   Zea mays [maize]
ref|XP_009358559.1|  PREDICTED: putative chloride channel-like pr...    128   4e-30   Pyrus x bretschneideri [bai li]
gb|EMS55037.1|  Chloride channel protein CLC-c                          128   4e-30   Triticum urartu
gb|EMT28663.1|  Chloride channel protein CLC-c                          127   5e-30   
ref|XP_010435388.1|  PREDICTED: putative chloride channel-like pr...    127   7e-30   Camelina sativa [gold-of-pleasure]
ref|XP_003581281.1|  PREDICTED: chloride channel protein CLC-c-like     127   7e-30   Brachypodium distachyon [annual false brome]
ref|XP_010030223.1|  PREDICTED: chloride channel protein CLC-c-li...    127   8e-30   Eucalyptus grandis [rose gum]
ref|XP_006470992.1|  PREDICTED: chloride channel protein CLC-c-li...    127   9e-30   Citrus sinensis [apfelsine]
ref|XP_010450335.1|  PREDICTED: putative chloride channel-like pr...    127   9e-30   Camelina sativa [gold-of-pleasure]
gb|EPS68170.1|  hypothetical protein M569_06601                         127   1e-29   Genlisea aurea
ref|XP_007204268.1|  hypothetical protein PRUPE_ppa001699mg             126   2e-29   Prunus persica
emb|CAJ86158.1|  H0413E07.11                                            126   2e-29   Oryza sativa [red rice]
emb|CAD41919.2|  OSJNBa0033G05.20                                       126   2e-29   Oryza sativa Japonica Group [Japonica rice]
gb|ABB86548.1|  chloride channel-like protein Osclc                     126   2e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006652911.1|  PREDICTED: putative chloride channel-like pr...    126   2e-29   Oryza brachyantha
dbj|BAB97267.1|  chloride channel                                       125   3e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009355373.1|  PREDICTED: chloride channel protein CLC-c-like     125   3e-29   Pyrus x bretschneideri [bai li]
ref|XP_006283171.1|  hypothetical protein CARUB_v10004204mg             125   3e-29   
ref|XP_006431490.1|  hypothetical protein CICLE_v10000336mg             125   3e-29   Citrus clementina [clementine]
ref|XP_008242835.1|  PREDICTED: putative chloride channel-like pr...    125   3e-29   Prunus mume [ume]
gb|KDO42564.1|  hypothetical protein CISIN_1g003885mg                   125   3e-29   Citrus sinensis [apfelsine]
gb|KHN47107.1|  Putative chloride channel-like protein CLC-g            125   3e-29   Glycine soja [wild soybean]
ref|XP_006836849.1|  hypothetical protein AMTR_s00099p00074960          125   3e-29   Amborella trichopoda
ref|XP_010025693.1|  PREDICTED: chloride channel protein CLC-c-like     125   3e-29   Eucalyptus grandis [rose gum]
ref|XP_003542650.1|  PREDICTED: putative chloride channel-like pr...    125   3e-29   Glycine max [soybeans]
gb|EEE61792.1|  hypothetical protein OsJ_16396                          125   3e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009586704.1|  PREDICTED: putative chloride channel-like pr...    125   3e-29   Nicotiana tomentosiformis
ref|XP_010250239.1|  PREDICTED: putative chloride channel-like pr...    125   4e-29   Nelumbo nucifera [Indian lotus]
gb|EMT27046.1|  Chloride channel protein CLC-c                          125   4e-29   
ref|XP_010905336.1|  PREDICTED: putative chloride channel-like pr...    124   1e-28   Elaeis guineensis
gb|ADW93911.1|  chloride channel 1                                      124   1e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDP42489.1|  hypothetical protein JCGZ_00286                         124   1e-28   Jatropha curcas
ref|XP_002447212.1|  hypothetical protein SORBIDRAFT_06g030530          123   2e-28   Sorghum bicolor [broomcorn]
gb|KFK30515.1|  hypothetical protein AALP_AA7G272300                    123   2e-28   Arabis alpina [alpine rockcress]
tpg|DAA35719.1|  TPA: hypothetical protein ZEAMMB73_781870              123   2e-28   
ref|XP_008667038.1|  PREDICTED: chloride channel G isoform X1           123   3e-28   Zea mays [maize]
ref|XP_008378937.1|  PREDICTED: chloride channel protein CLC-c-li...    115   3e-28   
ref|XP_008793993.1|  PREDICTED: putative chloride channel-like pr...    122   3e-28   Phoenix dactylifera
gb|KJB64678.1|  hypothetical protein B456_010G060300                    122   4e-28   Gossypium raimondii
ref|XP_009777968.1|  PREDICTED: putative chloride channel-like pr...    122   4e-28   Nicotiana sylvestris
ref|XP_010241599.1|  PREDICTED: LOW QUALITY PROTEIN: putative chl...    122   5e-28   
ref|XP_009405902.1|  PREDICTED: chloride channel protein CLC-c-like     122   6e-28   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB46914.1|  hypothetical protein B456_008G001200                    121   6e-28   Gossypium raimondii
ref|XP_008365341.1|  PREDICTED: chloride channel protein CLC-c-like     115   7e-28   
ref|XP_009401374.1|  PREDICTED: putative chloride channel-like pr...    121   7e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009401373.1|  PREDICTED: putative chloride channel-like pr...    121   8e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010050093.1|  PREDICTED: putative chloride channel-like pr...    121   9e-28   Eucalyptus grandis [rose gum]
ref|XP_010274995.1|  PREDICTED: chloride channel protein CLC-c          121   9e-28   Nelumbo nucifera [Indian lotus]
ref|XP_008378936.1|  PREDICTED: chloride channel protein CLC-c-li...    114   2e-27   
ref|XP_006852872.1|  hypothetical protein AMTR_s00033p00206270          120   2e-27   Amborella trichopoda
ref|XP_004508447.1|  PREDICTED: putative chloride channel-like pr...    120   2e-27   Cicer arietinum [garbanzo]
ref|XP_010096974.1|  Putative chloride channel-like protein CLC-g       120   3e-27   
ref|XP_010930514.1|  PREDICTED: chloride channel protein CLC-c-like     119   4e-27   Elaeis guineensis
ref|XP_006848424.1|  hypothetical protein AMTR_s00013p00233520          111   5e-27   
ref|XP_004486231.1|  PREDICTED: chloride channel protein CLC-c-like     119   5e-27   Cicer arietinum [garbanzo]
gb|EMT06377.1|  Putative chloride channel-like protein CLC-g            119   5e-27   
ref|XP_004977021.1|  PREDICTED: putative chloride channel-like pr...    119   5e-27   Setaria italica
ref|XP_011084085.1|  PREDICTED: putative chloride channel-like pr...    119   6e-27   Sesamum indicum [beniseed]
gb|KDO73468.1|  hypothetical protein CISIN_1g003801mg                   119   7e-27   Citrus sinensis [apfelsine]
ref|XP_004242745.2|  PREDICTED: putative chloride channel-like pr...    119   8e-27   Solanum lycopersicum
gb|EMS50378.1|  Chloride channel protein CLC-c                          118   1e-26   Triticum urartu
ref|XP_003573678.1|  PREDICTED: putative chloride channel-like pr...    118   1e-26   Brachypodium distachyon [annual false brome]
ref|XP_009403721.1|  PREDICTED: chloride channel protein CLC-c-like     118   1e-26   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC71893.1|  hypothetical protein OsI_04638                          118   1e-26   Oryza sativa Indica Group [Indian rice]
dbj|BAD82092.1|  putative chloride channel                              118   1e-26   Oryza sativa Japonica Group [Japonica rice]
gb|EYU34964.1|  hypothetical protein MIMGU_mgv1a001646mg                117   2e-26   Erythranthe guttata [common monkey flower]
gb|EEE55755.1|  hypothetical protein OsJ_04269                          118   2e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009403199.1|  PREDICTED: putative chloride channel-like pr...    117   2e-26   
ref|XP_007152471.1|  hypothetical protein PHAVU_004G133400g             117   2e-26   Phaseolus vulgaris [French bean]
ref|XP_009403198.1|  PREDICTED: putative chloride channel-like pr...    117   2e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002974253.1|  hypothetical protein SELMODRAFT_100906             117   2e-26   Selaginella moellendorffii
ref|XP_009392135.1|  PREDICTED: putative chloride channel-like pr...    117   3e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010099780.1|  Chloride channel protein CLC-c                     117   3e-26   Morus notabilis
ref|XP_009392134.1|  PREDICTED: putative chloride channel-like pr...    117   3e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009392132.1|  PREDICTED: putative chloride channel-like pr...    117   3e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006385193.1|  Chloride channel protein CLC-c                     117   3e-26   
ref|XP_002985623.1|  hypothetical protein SELMODRAFT_181899             116   4e-26   Selaginella moellendorffii
gb|ADF78069.1|  chloride channel protein                                116   5e-26   Zea mays [maize]
ref|XP_006388251.1|  hypothetical protein POPTR_0261s002202g            110   6e-26   
ref|XP_008788815.1|  PREDICTED: putative chloride channel-like pr...    115   7e-26   Phoenix dactylifera
ref|XP_010927804.1|  PREDICTED: chloride channel protein CLC-c-like     115   7e-26   
ref|XP_008674757.1|  PREDICTED: chloride channel protein CLC-c          115   7e-26   
ref|XP_008786445.1|  PREDICTED: chloride channel protein CLC-c-like     115   8e-26   Phoenix dactylifera
tpg|DAA56573.1|  TPA: chloride channel protein                          115   8e-26   
ref|XP_011047852.1|  PREDICTED: chloride channel protein CLC-c-like     115   8e-26   Populus euphratica
ref|XP_006359489.1|  PREDICTED: putative chloride channel-like pr...    115   9e-26   Solanum tuberosum [potatoes]
ref|XP_004970759.1|  PREDICTED: chloride channel protein CLC-c-like     115   1e-25   Setaria italica
ref|XP_008788814.1|  PREDICTED: putative chloride channel-like pr...    115   1e-25   Phoenix dactylifera
ref|XP_011078419.1|  PREDICTED: putative chloride channel-like pr...    115   1e-25   Sesamum indicum [beniseed]
ref|XP_002456727.1|  hypothetical protein SORBIDRAFT_03g041480          115   1e-25   Sorghum bicolor [broomcorn]
ref|XP_007225226.1|  hypothetical protein PRUPE_ppa001898mg             115   1e-25   
ref|XP_004952777.1|  PREDICTED: chloride channel protein CLC-c-like     115   2e-25   Setaria italica
ref|XP_009393492.1|  PREDICTED: chloride channel protein CLC-c          114   2e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008806106.1|  PREDICTED: chloride channel protein CLC-c-like     114   2e-25   
ref|XP_008218680.1|  PREDICTED: chloride channel protein CLC-c          114   2e-25   
gb|EPS73799.1|  hypothetical protein M569_00956                         114   2e-25   Genlisea aurea
ref|XP_011003711.1|  PREDICTED: chloride channel protein CLC-c-like     114   3e-25   Populus euphratica
ref|XP_006385076.1|  Chloride channel protein CLC-c                     114   3e-25   
gb|KDP44103.1|  hypothetical protein JCGZ_05570                         114   3e-25   Jatropha curcas
ref|XP_010529978.1|  PREDICTED: chloride channel protein CLC-c          114   3e-25   Tarenaya hassleriana [spider flower]
gb|EMS56130.1|  Putative chloride channel-like protein CLC-g            114   3e-25   Triticum urartu
gb|AAQ56538.1|  putative chloride channel                               114   4e-25   Oryza sativa Japonica Group [Japonica rice]
gb|AIY56605.1|  CLC                                                     113   5e-25   
gb|KCW74788.1|  hypothetical protein EUGRSUZ_E03522                     113   5e-25   
ref|XP_009411882.1|  PREDICTED: chloride channel protein CLC-c-like     113   5e-25   
ref|XP_010928311.1|  PREDICTED: putative chloride channel-like pr...    113   5e-25   
gb|AFW58337.1|  hypothetical protein ZEAMMB73_926410                    113   6e-25   
gb|KJB53990.1|  hypothetical protein B456_009G015100                    113   7e-25   
ref|XP_010057598.1|  PREDICTED: putative chloride channel-like pr...    113   7e-25   
ref|XP_007155066.1|  hypothetical protein PHAVU_003G170300g             113   7e-25   
dbj|BAJ97313.1|  predicted protein                                      112   8e-25   
ref|NP_001105216.1|  LOC542114                                          112   1e-24   
ref|XP_004288642.1|  PREDICTED: chloride channel protein CLC-c          112   1e-24   
ref|XP_008644266.1|  PREDICTED: LOC542114 isoform X1                    112   1e-24   
ref|XP_004979167.1|  PREDICTED: putative chloride channel-like pr...    112   1e-24   
ref|XP_010999722.1|  PREDICTED: chloride channel protein CLC-c-like     112   1e-24   
ref|XP_003580671.2|  PREDICTED: putative chloride channel-like pr...    112   2e-24   
ref|XP_009599120.1|  PREDICTED: chloride channel protein CLC-c-like     111   2e-24   
gb|AFW70590.1|  hypothetical protein ZEAMMB73_498282                    106   3e-24   
ref|XP_004287270.1|  PREDICTED: putative chloride channel-like pr...    111   3e-24   
ref|XP_004287269.1|  PREDICTED: putative chloride channel-like pr...    111   3e-24   
ref|XP_003609433.1|  hypothetical protein MTR_4g115640                  110   4e-24   
gb|EMT13398.1|  Chloride channel protein CLC-c                          110   5e-24   
dbj|BAJ97961.1|  predicted protein                                      110   5e-24   
ref|XP_008457165.1|  PREDICTED: putative chloride channel-like pr...    110   5e-24   
tpg|DAA35720.1|  TPA: chloride channel G                                110   5e-24   
gb|EEC73409.1|  hypothetical protein OsI_07665                          110   5e-24   
tpg|DAA35721.1|  TPA: hypothetical protein ZEAMMB73_781870              110   6e-24   
gb|EEC69203.1|  hypothetical protein OsI_38196                          103   6e-24   
gb|EMT23162.1|  Putative chloride channel-like protein CLC-g            111   6e-24   
ref|XP_009768532.1|  PREDICTED: chloride channel protein CLC-c-like     110   6e-24   
ref|NP_001130407.2|  chloride channel G                                 110   6e-24   
dbj|BAJ92873.1|  predicted protein                                      110   7e-24   
ref|XP_004165980.1|  PREDICTED: putative chloride channel-like pr...    110   8e-24   
ref|NP_001267618.1|  putative chloride channel-like protein CLC-g...    110   8e-24   
ref|XP_009418228.1|  PREDICTED: putative chloride channel-like pr...    110   8e-24   
emb|CDP10469.1|  unnamed protein product                                110   9e-24   
dbj|BAD16425.1|  chloride channel                                       109   1e-23   
ref|XP_004975701.1|  PREDICTED: chloride channel protein CLC-c-li...    109   1e-23   
ref|XP_004975699.1|  PREDICTED: chloride channel protein CLC-c-li...    109   1e-23   
ref|XP_010241601.1|  PREDICTED: putative chloride channel-like pr...    109   1e-23   
ref|XP_004975700.1|  PREDICTED: chloride channel protein CLC-c-li...    109   1e-23   
ref|XP_004975698.1|  PREDICTED: chloride channel protein CLC-c-li...    109   2e-23   
ref|XP_006647383.1|  PREDICTED: chloride channel protein CLC-c-like     109   2e-23   
ref|XP_010241600.1|  PREDICTED: putative chloride channel-like pr...    108   2e-23   
emb|CBI27719.3|  unnamed protein product                                108   2e-23   
ref|NP_001268085.1|  uncharacterized protein LOC100259734               108   2e-23   
ref|XP_006453099.1|  hypothetical protein CICLE_v10007502mg             108   2e-23   
ref|XP_002454002.1|  hypothetical protein SORBIDRAFT_04g022890          108   2e-23   
ref|XP_004133730.1|  PREDICTED: chloride channel protein CLC-c-li...    108   3e-23   
dbj|BAB97268.1|  chloride channel                                       107   4e-23   
ref|XP_004512644.1|  PREDICTED: chloride channel protein CLC-c-li...    107   4e-23   
ref|XP_004512643.1|  PREDICTED: chloride channel protein CLC-c-li...    107   5e-23   
ref|XP_010909770.1|  PREDICTED: chloride channel protein CLC-c-like     107   7e-23   
ref|XP_002453459.1|  hypothetical protein SORBIDRAFT_04g006250          107   7e-23   
ref|XP_007214607.1|  hypothetical protein PRUPE_ppa001700mg             107   7e-23   
ref|XP_002447895.1|  hypothetical protein SORBIDRAFT_06g017570          107   9e-23   
gb|EMS56861.1|  Putative chloride channel-like protein CLC-g            106   1e-22   
ref|XP_003575152.1|  PREDICTED: chloride channel protein CLC-c-like     106   1e-22   
ref|XP_008644088.1|  PREDICTED: uncharacterized protein LOC100383...    106   2e-22   
dbj|BAB97269.1|  chloride channel                                       105   2e-22   
ref|XP_006599656.1|  PREDICTED: chloride channel protein CLC-c-li...    105   2e-22   
ref|XP_004499372.1|  PREDICTED: chloride channel protein CLC-c-like     105   2e-22   
ref|XP_003533268.2|  PREDICTED: chloride channel protein CLC-c-li...    105   3e-22   
gb|KHM99790.1|  Chloride channel protein CLC-c                          105   3e-22   
ref|XP_010687880.1|  PREDICTED: putative chloride channel-like pr...    105   3e-22   
gb|EMS67360.1|  Chloride channel protein CLC-c                          105   4e-22   
ref|XP_010687879.1|  PREDICTED: putative chloride channel-like pr...    104   5e-22   
ref|XP_002885387.1|  hypothetical protein ARALYDRAFT_898491           96.3    2e-21   
ref|XP_006599664.1|  PREDICTED: chloride channel protein CLC-c-li...    103   2e-21   
ref|XP_006587397.1|  PREDICTED: chloride channel protein CLC-c-li...    102   3e-21   
ref|XP_007048601.1|  Chloride channel C                                 102   4e-21   
gb|KJB40520.1|  hypothetical protein B456_007G067500                    100   9e-21   
gb|KJB40519.1|  hypothetical protein B456_007G067500                    100   1e-20   
gb|KEH32756.1|  chloride channel ClC1 protein                           100   1e-20   
ref|XP_003619757.1|  Chloride channel protein CLC-c                     100   2e-20   
gb|AES75975.2|  chloride channel ClC1 protein                           100   2e-20   
ref|XP_003567326.1|  PREDICTED: chloride channel protein CLC-c-like   99.0    6e-20   
ref|XP_002980983.1|  hypothetical protein SELMODRAFT_420553           98.6    7e-20   
ref|XP_008227672.1|  PREDICTED: chloride channel protein CLC-c-like   98.2    1e-19   
ref|XP_010030224.1|  PREDICTED: chloride channel protein CLC-c-li...  95.5    7e-19   
ref|XP_004173256.1|  PREDICTED: chloride channel protein CLC-c-like   88.6    6e-18   
ref|XP_002974894.1|  hypothetical protein SELMODRAFT_442632           91.7    2e-17   
ref|XP_002988905.1|  hypothetical protein SELMODRAFT_427560           91.7    2e-17   
ref|XP_009586705.1|  PREDICTED: putative chloride channel-like pr...  89.7    7e-17   
ref|XP_002982464.1|  hypothetical protein SELMODRAFT_233993           87.8    2e-16   
ref|XP_009339814.1|  PREDICTED: chloride channel protein CLC-c-like   86.3    1e-15   
ref|XP_009777969.1|  PREDICTED: putative chloride channel-like pr...  84.7    3e-15   
ref|XP_008368156.1|  PREDICTED: chloride channel protein CLC-c-like   83.6    7e-15   
ref|XP_008361634.1|  PREDICTED: LOW QUALITY PROTEIN: chloride cha...  83.6    7e-15   
ref|XP_010099519.1|  Chloride channel protein CLC-c                   79.7    4e-14   
ref|XP_006584242.1|  PREDICTED: uncharacterized protein LOC102666014  75.9    6e-13   
ref|XP_006838275.1|  hypothetical protein AMTR_s00103p00080940        69.7    2e-10   
dbj|BAK05536.1|  predicted protein                                    68.2    7e-10   
gb|KEH25445.1|  ClC chloride channel family protein                   67.8    8e-10   
gb|KHG13135.1|  Chloride channel CLC-b -like protein                  67.8    1e-09   
ref|XP_006650436.1|  PREDICTED: chloride channel protein CLC-d-like   67.8    1e-09   
ref|XP_007224823.1|  hypothetical protein PRUPE_ppa023512mg           67.4    1e-09   
ref|XP_010546808.1|  PREDICTED: chloride channel protein CLC-d is...  67.0    2e-09   
ref|XP_010546809.1|  PREDICTED: chloride channel protein CLC-d is...  67.0    2e-09   
ref|XP_008222944.1|  PREDICTED: chloride channel protein CLC-d is...  67.0    2e-09   
ref|XP_008222942.1|  PREDICTED: chloride channel protein CLC-d is...  67.0    2e-09   
ref|XP_008222943.1|  PREDICTED: chloride channel protein CLC-d is...  67.0    2e-09   
gb|ABF98346.1|  Chloride channel protein CLC-d, putative, expressed   66.6    2e-09   
ref|XP_008222941.1|  PREDICTED: chloride channel protein CLC-d is...  67.0    2e-09   
gb|AAO19370.1|  putative CLC-d chloride channel protein               67.0    2e-09   
gb|ADP02177.1|  putative chloride channel protein CLC-d               67.0    2e-09   
gb|EEE59743.1|  hypothetical protein OsJ_12209                        66.6    2e-09   
gb|ABF98345.1|  Chloride channel protein CLC-d, putative, expressed   66.6    2e-09   
gb|EEC75998.1|  hypothetical protein OsI_13133                        66.6    2e-09   
ref|XP_010277685.1|  PREDICTED: chloride channel protein CLC-d-li...  66.6    2e-09   
ref|XP_010277677.1|  PREDICTED: chloride channel protein CLC-d-li...  66.6    2e-09   
gb|ADW93910.1|  chloride channel 1                                    66.6    2e-09   
ref|XP_010277691.1|  PREDICTED: chloride channel protein CLC-d-li...  66.6    2e-09   
ref|XP_010277670.1|  PREDICTED: chloride channel protein CLC-d-li...  66.6    2e-09   
ref|XP_010231301.1|  PREDICTED: chloride channel protein CLC-d is...  66.2    3e-09   
ref|XP_008665234.1|  PREDICTED: chloride channel protein CLC-d is...  66.2    3e-09   
ref|XP_003561001.1|  PREDICTED: chloride channel protein CLC-d is...  66.2    3e-09   
ref|XP_008665235.1|  PREDICTED: chloride channel protein CLC-d is...  66.2    3e-09   
ref|XP_001771383.1|  predicted protein                                66.2    3e-09   
ref|XP_008380364.1|  PREDICTED: chloride channel protein CLC-d-like   62.4    3e-09   
ref|XP_008665231.1|  PREDICTED: chloride channel protein CLC-d is...  66.2    4e-09   
ref|XP_008665233.1|  PREDICTED: chloride channel protein CLC-d is...  65.9    4e-09   
ref|XP_002315783.2|  hypothetical protein POPTR_0010s10040g           65.9    4e-09   
ref|XP_011021557.1|  PREDICTED: chloride channel protein CLC-d is...  65.9    4e-09   
ref|XP_011021556.1|  PREDICTED: chloride channel protein CLC-d is...  65.9    4e-09   
ref|XP_010649611.1|  PREDICTED: uncharacterized protein LOC100261...  65.9    4e-09   
ref|XP_006394868.1|  hypothetical protein EUTSA_v10003643mg           65.9    5e-09   
ref|NP_001267905.1|  uncharacterized protein LOC100261408             65.9    5e-09   
ref|XP_010064549.1|  PREDICTED: chloride channel protein CLC-d-like   65.5    5e-09   
ref|XP_006394869.1|  hypothetical protein EUTSA_v10003643mg           65.9    5e-09   
ref|XP_006394870.1|  hypothetical protein EUTSA_v10003643mg           65.9    5e-09   
gb|KCW67762.1|  hypothetical protein EUGRSUZ_F014981                  65.5    5e-09   
ref|XP_004982102.1|  PREDICTED: LOW QUALITY PROTEIN: chloride cha...  65.5    5e-09   
ref|XP_006590397.1|  PREDICTED: chloride channel protein CLC-d-li...  65.5    5e-09   
gb|KHN35186.1|  Chloride channel protein CLC-d                        65.5    5e-09   
ref|XP_003539246.1|  PREDICTED: chloride channel protein CLC-d-li...  65.5    5e-09   
gb|KFK26403.1|  hypothetical protein AALP_AA8G244100                  65.5    6e-09   
gb|KFK26402.1|  hypothetical protein AALP_AA8G244100                  65.5    6e-09   
ref|XP_006573887.1|  PREDICTED: chloride channel protein CLC-d-li...  65.5    6e-09   
dbj|BAC42034.1|  putative CLC-d chloride channel protein              62.4    6e-09   
ref|XP_003517583.1|  PREDICTED: chloride channel protein CLC-d-li...  65.5    6e-09   
ref|XP_006573885.1|  PREDICTED: chloride channel protein CLC-d-li...  65.1    6e-09   
ref|XP_006573886.1|  PREDICTED: chloride channel protein CLC-d-li...  65.1    6e-09   
gb|KDP40151.1|  hypothetical protein JCGZ_02149                       64.7    9e-09   
ref|XP_010255989.1|  PREDICTED: chloride channel protein CLC-d is...  64.7    9e-09   
ref|XP_010255988.1|  PREDICTED: chloride channel protein CLC-d is...  64.7    9e-09   
ref|XP_010255990.1|  PREDICTED: chloride channel protein CLC-d is...  64.7    9e-09   
ref|XP_008801698.1|  PREDICTED: chloride channel protein CLC-d is...  64.7    1e-08   
ref|XP_008801699.1|  PREDICTED: chloride channel protein CLC-d is...  64.7    1e-08   
ref|XP_004296904.1|  PREDICTED: chloride channel protein CLC-d        64.7    1e-08   
ref|XP_006290072.1|  hypothetical protein CARUB_v10003710mg           64.3    1e-08   
gb|KJB12549.1|  hypothetical protein B456_002G024000                  64.3    1e-08   
gb|KJB12550.1|  hypothetical protein B456_002G024000                  64.3    1e-08   
gb|KJB12552.1|  hypothetical protein B456_002G024000                  64.3    1e-08   
ref|XP_010524818.1|  PREDICTED: chloride channel protein CLC-d is...  64.3    1e-08   
ref|XP_010905223.1|  PREDICTED: chloride channel protein CLC-d is...  64.3    1e-08   
gb|AGZ89689.2|  chloride channel protein CLC-d                        64.3    1e-08   
emb|CDY52633.1|  BnaC07g49590D                                        64.3    1e-08   
ref|XP_010524816.1|  PREDICTED: chloride channel protein CLC-d is...  64.3    1e-08   
ref|XP_009151133.1|  PREDICTED: chloride channel protein CLC-d is...  64.3    1e-08   
ref|XP_010905222.1|  PREDICTED: chloride channel protein CLC-d is...  64.3    1e-08   
ref|XP_009151132.1|  PREDICTED: chloride channel protein CLC-d is...  64.3    1e-08   
gb|KHF97413.1|  Chloride channel CLC-b -like protein                  63.9    1e-08   
ref|XP_010524817.1|  PREDICTED: chloride channel protein CLC-d is...  63.9    1e-08   
ref|XP_010454978.1|  PREDICTED: chloride channel protein CLC-d is...  63.9    2e-08   
ref|XP_010454977.1|  PREDICTED: chloride channel protein CLC-d is...  63.9    2e-08   
ref|XP_010421498.1|  PREDICTED: chloride channel protein CLC-d-li...  63.9    2e-08   
ref|XP_010421497.1|  PREDICTED: chloride channel protein CLC-d-li...  63.9    2e-08   
ref|XP_004247370.1|  PREDICTED: chloride channel protein CLC-d        63.9    2e-08   
ref|XP_009364220.1|  PREDICTED: chloride channel protein CLC-d-like   63.5    2e-08   
ref|XP_008390873.1|  PREDICTED: chloride channel protein CLC-d is...  63.5    2e-08   
ref|XP_011071571.1|  PREDICTED: chloride channel protein CLC-d is...  63.5    2e-08   
ref|XP_006359908.1|  PREDICTED: chloride channel protein CLC-d-li...  63.5    2e-08   
ref|XP_006359907.1|  PREDICTED: chloride channel protein CLC-d-li...  63.5    2e-08   
ref|XP_008390872.1|  PREDICTED: chloride channel protein CLC-d is...  63.5    2e-08   
ref|XP_011071569.1|  PREDICTED: chloride channel protein CLC-d is...  63.5    3e-08   
ref|XP_011071568.1|  PREDICTED: chloride channel protein CLC-d is...  63.5    3e-08   
ref|XP_009395587.1|  PREDICTED: chloride channel protein CLC-d is...  63.5    3e-08   
ref|XP_008390871.1|  PREDICTED: chloride channel protein CLC-d is...  63.5    3e-08   
ref|XP_009395586.1|  PREDICTED: chloride channel protein CLC-d is...  63.2    3e-08   
ref|XP_011071570.1|  PREDICTED: chloride channel protein CLC-d is...  63.2    3e-08   
ref|XP_009395588.1|  PREDICTED: chloride channel protein CLC-d is...  63.2    3e-08   
emb|CAA96065.1|  CLC-d chloride channel protein                       63.2    3e-08   
ref|NP_197996.1|  chloride channel protein CLC-d                      63.2    3e-08   
ref|XP_002872208.1|  CLC-D                                            63.2    3e-08   
gb|AAC26247.2|  Arabidopsis thaliana CLC-d chloride channel prote...  63.2    3e-08   
ref|XP_001782456.1|  predicted protein                                63.2    3e-08   
ref|XP_010493890.1|  PREDICTED: chloride channel protein CLC-d-like   62.8    5e-08   
ref|XP_007034700.1|  Chloride channel clc, putative isoform 1         62.4    6e-08   
ref|XP_007034701.1|  Chloride channel clc, putative isoform 2         62.0    6e-08   
ref|XP_007034705.1|  Chloride channel protein CLC-d isoform 6         62.0    6e-08   
ref|XP_007034702.1|  Chloride channel clc, putative isoform 3         62.0    6e-08   
ref|XP_007034703.1|  Chloride channel clc, putative isoform 4         62.0    6e-08   
ref|XP_007157151.1|  hypothetical protein PHAVU_002G0470000g          61.6    8e-08   
ref|XP_002517213.1|  chloride channel clc, putative                   61.6    9e-08   
ref|NP_001066692.1|  Os12g0438600                                     60.8    2e-07   
ref|XP_002963642.1|  hypothetical protein SELMODRAFT_80232            60.8    2e-07   
ref|XP_002974732.1|  hypothetical protein SELMODRAFT_101801           60.8    2e-07   
ref|XP_010667429.1|  PREDICTED: chloride channel protein CLC-d is...  60.5    2e-07   
ref|XP_010667430.1|  PREDICTED: chloride channel protein CLC-d is...  60.1    3e-07   
ref|XP_004511350.1|  PREDICTED: chloride channel protein CLC-d-li...  60.1    3e-07   
ref|XP_009765642.1|  PREDICTED: chloride channel protein CLC-d is...  60.1    3e-07   
ref|XP_009618208.1|  PREDICTED: chloride channel protein CLC-d        60.1    3e-07   
ref|XP_004511351.1|  PREDICTED: chloride channel protein CLC-d-li...  60.1    3e-07   
ref|XP_009765643.1|  PREDICTED: chloride channel protein CLC-d is...  60.1    3e-07   
ref|XP_008348386.1|  PREDICTED: chloride channel protein CLC-d-like   57.8    5e-07   
emb|CDO99033.1|  unnamed protein product                              58.9    8e-07   
ref|XP_003284905.1|  hypothetical protein DICPUDRAFT_93809            58.9    9e-07   
ref|XP_010108000.1|  Chloride channel protein CLC-d                   58.5    9e-07   
ref|XP_004169986.1|  PREDICTED: chloride channel protein CLC-d-like   58.5    1e-06   
ref|XP_008449563.1|  PREDICTED: chloride channel protein CLC-d        58.5    1e-06   
gb|KJB72282.1|  hypothetical protein B456_011G168600                  58.2    1e-06   
gb|KJB72281.1|  hypothetical protein B456_011G168600                  58.2    1e-06   
ref|XP_010678326.1|  PREDICTED: chloride channel protein CLC-b-li...  57.8    1e-06   
gb|KJB72279.1|  hypothetical protein B456_011G168600                  58.2    2e-06   
ref|XP_003610693.1|  Chloride channel protein CLC-d                   57.8    2e-06   
gb|KEH27344.1|  chloride channel protein ClC-D protein, putative      57.8    2e-06   
ref|XP_003610694.1|  Chloride channel protein CLC-d                   57.8    2e-06   
ref|XP_003610692.1|  Chloride channel protein CLC-d                   57.8    2e-06   
ref|XP_006419888.1|  hypothetical protein CICLE_v10004375mg           57.0    3e-06   
gb|KDO74669.1|  hypothetical protein CISIN_1g003732mg                 57.0    3e-06   
ref|XP_006489358.1|  PREDICTED: chloride channel protein CLC-d-li...  57.0    3e-06   



>emb|CDP16685.1| unnamed protein product [Coffea canephora]
Length=786

 Score =   229 bits (585),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 150/168 (89%), Gaps = 3/168 (2%)
 Frame = +2

Query  164  SMEFAGAGSTNEMEGQADD---DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDY  334
            S +FA A  TN+++GQA +   DPESNSLH+PLLKRNRTLSS P+A++GAKVS IESLDY
Sbjct  4    SNQFAAAAVTNDVDGQAQNQERDPESNSLHQPLLKRNRTLSSNPLAVVGAKVSYIESLDY  63

Query  335  EINENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAV  514
            EINENDLFKHDWRSR++  VLQYVFLKWTLAFL+GLLTG+IATLINLA+ENIAGYKLL V
Sbjct  64   EINENDLFKHDWRSRAQVQVLQYVFLKWTLAFLVGLLTGVIATLINLAVENIAGYKLLKV  123

Query  515  LNYIDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            ++YI+N RYLMGF +F GTNFLLT+ A+VLCVF APTAAGPGIPEIKA
Sbjct  124  IDYINNKRYLMGFLFFAGTNFLLTLLAAVLCVFFAPTAAGPGIPEIKA  171



>gb|KDO43322.1| hypothetical protein CISIN_1g0039661mg, partial [Citrus sinensis]
Length=188

 Score =   209 bits (531),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 137/154 (89%), Gaps = 1/154 (1%)
 Frame = +2

Query  200  MEGQADD-DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRS  376
            ME   ++ DPESNSL +PLLKR+RTLSS+P+A++GAKVS IESLDYEINENDLFKHDWRS
Sbjct  16   MEADEEERDPESNSLQQPLLKRSRTLSSSPLALVGAKVSHIESLDYEINENDLFKHDWRS  75

Query  377  RSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFA  556
            RSK  VLQY+FLKW+LA L+GLLTGLIATLINLA+ENIAGYKLLAV+++I+ +RYL GF 
Sbjct  76   RSKVQVLQYIFLKWSLACLVGLLTGLIATLINLAVENIAGYKLLAVVSFIEKDRYLQGFL  135

Query  557  YFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            YF G NFLLT+ A+VLCV  APTAAGPGIPEIKA
Sbjct  136  YFTGVNFLLTLVAAVLCVCFAPTAAGPGIPEIKA  169



>ref|XP_008353449.1| PREDICTED: chloride channel protein CLC-b-like [Malus domestica]
Length=196

 Score =   203 bits (517),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  AGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDL  355
            A    T +  G  + DPES SL +PLLKRNRTLSSTP+AM+GAKVS IESLDYEINEN L
Sbjct  11   AAIPQTMQETGXEERDPESISLQQPLLKRNRTLSSTPLAMVGAKVSHIESLDYEINENXL  70

Query  356  FKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNN  535
            FKHDWRSRSK  VLQYVFLKW LA L+GLLTG+IATLINLA+ENIAGYKLLA +++I+  
Sbjct  71   FKHDWRSRSKVQVLQYVFLKWILACLVGLLTGIIATLINLAVENIAGYKLLAAVSFIEKE  130

Query  536  RYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            RYLMGF +  G N +LT  ASVLCV  APTAAGPGIPEIKA
Sbjct  131  RYLMGFIFIAGANLVLTAIASVLCVCFAPTAAGPGIPEIKA  171



>ref|XP_004233300.1| PREDICTED: chloride channel protein CLC-b [Solanum lycopersicum]
Length=784

 Score =   215 bits (547),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 141/160 (88%), Gaps = 3/160 (2%)
 Frame = +2

Query  188  STNEMEGQADD---DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLF  358
            +TN++ GQ ++   DPESNSL +PLLKRNRTLSS+P A++GAKVS IESLDYEINENDLF
Sbjct  11   TTNDINGQLNEEERDPESNSLRQPLLKRNRTLSSSPFALVGAKVSHIESLDYEINENDLF  70

Query  359  KHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNR  538
            KHDWR RS+  VLQYVFLKW+LAFL+GLLTG+ ATLINLAIENIAGYKL AV++YIDN R
Sbjct  71   KHDWRRRSRVQVLQYVFLKWSLAFLVGLLTGVTATLINLAIENIAGYKLRAVVDYIDNRR  130

Query  539  YLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            YLMGFAYF G NF+LT+ A++LCV  APTAAGPGIPEIKA
Sbjct  131  YLMGFAYFAGANFVLTLIAALLCVCFAPTAAGPGIPEIKA  170



>ref|XP_009761471.1| PREDICTED: chloride channel protein CLC-b-like [Nicotiana sylvestris]
Length=786

 Score =   214 bits (546),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 141/160 (88%), Gaps = 3/160 (2%)
 Frame = +2

Query  188  STNEMEGQADD---DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLF  358
            + N M+GQ ++   DPESNSLH+PLLKRNRTLSS+P A++GAKVS IESLDYEINENDLF
Sbjct  12   TINNMDGQQNEEERDPESNSLHQPLLKRNRTLSSSPFALVGAKVSHIESLDYEINENDLF  71

Query  359  KHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNR  538
            KHDWR RS+  VLQYVFLKWTLAFL+GLLTG+ ATLINLAIEN+AGYKL AV+NYI++ R
Sbjct  72   KHDWRRRSRVQVLQYVFLKWTLAFLVGLLTGVTATLINLAIENMAGYKLRAVVNYIEDRR  131

Query  539  YLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            YLMGFAYF G NF+LT+ A++LCV  APTAAGPGIPEIKA
Sbjct  132  YLMGFAYFAGANFVLTLIAALLCVCFAPTAAGPGIPEIKA  171



>gb|AAD29679.1|AF133209_1 CLC-Nt2 protein [Nicotiana tabacum]
Length=786

 Score =   214 bits (546),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 141/160 (88%), Gaps = 3/160 (2%)
 Frame = +2

Query  188  STNEMEGQADD---DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLF  358
            + N M+GQ ++   DPESNSLH+PLLKRNRTLSS+P A++GAKVS IESLDYEINENDLF
Sbjct  12   TINNMDGQQNEEERDPESNSLHQPLLKRNRTLSSSPFALVGAKVSHIESLDYEINENDLF  71

Query  359  KHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNR  538
            KHDWR RS+  VLQYVFLKWTLAFL+GLLTG+ ATLINLAIEN+AGYKL AV+NYI++ R
Sbjct  72   KHDWRRRSRVQVLQYVFLKWTLAFLVGLLTGVTATLINLAIENMAGYKLRAVVNYIEDRR  131

Query  539  YLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            YLMGFAYF G NF+LT+ A++LCV  APTAAGPGIPEIKA
Sbjct  132  YLMGFAYFAGANFVLTLIAALLCVCFAPTAAGPGIPEIKA  171



>ref|XP_006357190.1| PREDICTED: chloride channel protein CLC-b-like [Solanum tuberosum]
Length=784

 Score =   214 bits (545),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 141/160 (88%), Gaps = 3/160 (2%)
 Frame = +2

Query  188  STNEMEGQADD---DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLF  358
            +TN++ GQ ++   DPESNS+ +PLLKRNRTLSS+P A++GAKVS IESLDYEINENDLF
Sbjct  11   TTNDINGQLNEEERDPESNSMRQPLLKRNRTLSSSPFALVGAKVSHIESLDYEINENDLF  70

Query  359  KHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNR  538
            KHDWR RS+  VLQYVFLKW+LAFL+GLLTG+ ATLINLAIENIAGYKL AV++YIDN R
Sbjct  71   KHDWRRRSRVQVLQYVFLKWSLAFLVGLLTGVTATLINLAIENIAGYKLRAVVDYIDNRR  130

Query  539  YLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            YLMGFAYF G NF+LT+ A++LCV  APTAAGPGIPEIKA
Sbjct  131  YLMGFAYFAGANFVLTLIAALLCVCFAPTAAGPGIPEIKA  170



>ref|XP_009596046.1| PREDICTED: chloride channel protein CLC-b-like [Nicotiana tomentosiformis]
Length=786

 Score =   213 bits (541),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 140/160 (88%), Gaps = 3/160 (2%)
 Frame = +2

Query  188  STNEMEGQADD---DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLF  358
            + N M+GQ ++   DPESNSL +PLLKRNRTLSS+P A++GAKVS IESLDYEINENDLF
Sbjct  12   TINNMDGQQNEEERDPESNSLRQPLLKRNRTLSSSPFALVGAKVSYIESLDYEINENDLF  71

Query  359  KHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNR  538
            KHDWR RS+  VLQYVFLKWTLAFL+GLLTG+ A+LINLAIENIAGYKL AV+NYI+N R
Sbjct  72   KHDWRRRSRVQVLQYVFLKWTLAFLVGLLTGVTASLINLAIENIAGYKLRAVVNYIENRR  131

Query  539  YLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            YL+GFAYF G NF+LT+ A++LCV  APTAAGPGIPEIKA
Sbjct  132  YLVGFAYFAGANFVLTLIAALLCVCFAPTAAGPGIPEIKA  171



>ref|XP_011097296.1| PREDICTED: chloride channel protein CLC-b-like [Sesamum indicum]
Length=787

 Score =   212 bits (539),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = +2

Query  167  MEFAGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINE  346
            +E   A    + E + + DPESN+LH+PLLKRNRTLSS+P+A++GAKVS IESLDYEINE
Sbjct  8    VEAEAANIQRQGEDEEERDPESNTLHQPLLKRNRTLSSSPLAIVGAKVSHIESLDYEINE  67

Query  347  NDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYI  526
            NDLFK DWRSRSK+ VLQY+FLKW LAFL+GLLTGLIATLINLA+ENIAGYKLLAV+ YI
Sbjct  68   NDLFKQDWRSRSKTEVLQYIFLKWLLAFLVGLLTGLIATLINLAVENIAGYKLLAVVKYI  127

Query  527  DNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            +  RYLMGF Y  G NFLLT+ A+VLCV  APTAAGPGIPEIKA
Sbjct  128  EQKRYLMGFIYMAGANFLLTLVAAVLCVCFAPTAAGPGIPEIKA  171



>ref|XP_002300101.1| Chloride channel protein CLC-a [Populus trichocarpa]
 gb|EEE84906.1| Chloride channel protein CLC-a [Populus trichocarpa]
Length=785

 Score =   209 bits (531),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 140/166 (84%), Gaps = 1/166 (1%)
 Frame = +2

Query  164  SMEFAGAGSTNEME-GQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEI  340
            S + A A + + +E G+   DPESN+LH+PLLKRNRTLSS P+A++GAKVS IESLDYEI
Sbjct  5    SSQLAEATAGHNLEVGEEGRDPESNTLHQPLLKRNRTLSSNPLALVGAKVSHIESLDYEI  64

Query  341  NENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLN  520
            NENDLFKHDWRSRSK  VLQY+F KWTLAFL+GLLTGLIAT INLA+ENIAGYK+LAV++
Sbjct  65   NENDLFKHDWRSRSKVQVLQYIFWKWTLAFLVGLLTGLIATFINLAVENIAGYKILAVVH  124

Query  521  YIDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            +I+N RYL G  YF G N LLT+ ASVLCV  APTAAGPGIPEIKA
Sbjct  125  FIENKRYLTGLVYFTGANLLLTLFASVLCVCFAPTAAGPGIPEIKA  170



>gb|KDP46292.1| hypothetical protein JCGZ_10132 [Jatropha curcas]
Length=788

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = +2

Query  161  MSMEFAGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEI  340
            ++ E A   S N   G+ + DPESN+L +PLLKRNRTLSS P+A++GAKVS IESLDYEI
Sbjct  8    LAEEQATVQSHNTEAGEDERDPESNTLQQPLLKRNRTLSSNPLALVGAKVSHIESLDYEI  67

Query  341  NENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLN  520
            NENDLFKHDWRSRS+  VLQY+FLKWTLAFL+GLLTGLIATLINLA+ENIAGYKLLAV++
Sbjct  68   NENDLFKHDWRSRSQIQVLQYIFLKWTLAFLVGLLTGLIATLINLAVENIAGYKLLAVVH  127

Query  521  YIDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            +I+N RYL G AYF G N +LT  AS+LCV  APTAAGPGIPEIKA
Sbjct  128  FIENERYLTGLAYFTGANLVLTAFASILCVCFAPTAAGPGIPEIKA  173



>ref|XP_006447084.1| hypothetical protein CICLE_v10014341mg [Citrus clementina]
 ref|XP_006470044.1| PREDICTED: chloride channel protein CLC-b-like [Citrus sinensis]
 gb|ESR60324.1| hypothetical protein CICLE_v10014341mg [Citrus clementina]
Length=783

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = +2

Query  209  QADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKS  388
            + + DPESNSL +PLLKR+RTLSS+P+A++GAKVS IESLDYEINENDLFKHDWRSRSK 
Sbjct  20   EEERDPESNSLQQPLLKRSRTLSSSPLALVGAKVSHIESLDYEINENDLFKHDWRSRSKV  79

Query  389  HVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVG  568
             VLQY+FLKW+LA L+GLLTGLIATLINLA+ENIAGYKLLAV+++I+ +RYL GF YF G
Sbjct  80   QVLQYIFLKWSLACLVGLLTGLIATLINLAVENIAGYKLLAVVSFIEKDRYLQGFLYFTG  139

Query  569  TNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             NFLLT+ A+VLCV  APTAAGPGIPEIKA
Sbjct  140  VNFLLTLVAAVLCVCFAPTAAGPGIPEIKA  169



>ref|NP_001267676.1| chloride channel protein CLC-b-like [Cucumis sativus]
 gb|AFJ15538.1| chloride channel a [Cucumis sativus]
 gb|KGN63173.1| hypothetical protein Csa_2G406710 [Cucumis sativus]
Length=789

 Score =   206 bits (524),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 134/159 (84%), Gaps = 3/159 (2%)
 Frame = +2

Query  191  TNEMEGQADD---DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFK  361
            TN ME +  D   DPESN L++PLLKRNRTLSS+P+A++GAKVS IESLDYEINENDLFK
Sbjct  14   TNSMEAEPQDEERDPESNPLNQPLLKRNRTLSSSPLAIVGAKVSLIESLDYEINENDLFK  73

Query  362  HDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRY  541
            HDWRSRSK  VLQY+F KWTLA L+GLLTG+IATLINLAIENIAGYKLL V++YI   RY
Sbjct  74   HDWRSRSKVQVLQYIFSKWTLACLVGLLTGIIATLINLAIENIAGYKLLKVVDYIKEERY  133

Query  542  LMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            LMGFAYF   NFLLT  A+ LCV  APTAAGPGIPEIKA
Sbjct  134  LMGFAYFTTANFLLTFVAAALCVCFAPTAAGPGIPEIKA  172



>ref|XP_011003929.1| PREDICTED: chloride channel protein CLC-b [Populus euphratica]
Length=802

 Score =   206 bits (524),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 139/166 (84%), Gaps = 1/166 (1%)
 Frame = +2

Query  164  SMEFAGAGSTNEME-GQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEI  340
            S + A A + + +E G+   DPESN+LH+PLLKRN TLSS P+A++GAKVS IESLDYEI
Sbjct  5    SSQLAEAPADHNLEVGEEGRDPESNALHKPLLKRNTTLSSNPLALVGAKVSHIESLDYEI  64

Query  341  NENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLN  520
            NENDLFKHDWRSRSK  VLQY+F KWTLAFL+GL TGLIATLINLA+ENIAGYK+LAV++
Sbjct  65   NENDLFKHDWRSRSKVQVLQYIFWKWTLAFLVGLSTGLIATLINLAVENIAGYKILAVVH  124

Query  521  YIDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            +I+N RYL G  YF G N LLT+ ASVLCV  APTAAGPGIPEIKA
Sbjct  125  FIENERYLTGLVYFTGANLLLTLFASVLCVCFAPTAAGPGIPEIKA  170



>ref|XP_010111585.1| Chloride channel protein CLC-b [Morus notabilis]
 gb|EXC31330.1| Chloride channel protein CLC-b [Morus notabilis]
Length=788

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = +2

Query  215  DDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHV  394
            + DPESNSL RPLLKRNRTLSS+P+A++G KVS IESLDYEINENDLFKHDWRSRS++ V
Sbjct  25   ERDPESNSLTRPLLKRNRTLSSSPLAIVGTKVSHIESLDYEINENDLFKHDWRSRSRAQV  84

Query  395  LQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTN  574
            LQYVFLKWTLA L+GLLTG+IATLINLA+ENIAGYKLLAV+ YI+  RY+ G  YF   N
Sbjct  85   LQYVFLKWTLACLVGLLTGIIATLINLAVENIAGYKLLAVVAYIEQERYITGLIYFTAVN  144

Query  575  FLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            FLLT  A+VLCVF APTAAGPGIPEIKA
Sbjct  145  FLLTSVAAVLCVFFAPTAAGPGIPEIKA  172



>ref|XP_002509531.1| chloride channel clc, putative [Ricinus communis]
 gb|EEF50918.1| chloride channel clc, putative [Ricinus communis]
Length=787

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = +2

Query  191  TNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDW  370
            T E   + + DPESNSL +PLLKRNRTLSS+P+A++GAKVS IESLDYEINENDLFKHDW
Sbjct  17   TMEASQEEERDPESNSLQQPLLKRNRTLSSSPLAIVGAKVSYIESLDYEINENDLFKHDW  76

Query  371  RSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMG  550
            RSRS   +LQY+FLKW LAFL+GLLTGLIATLINLA+ENIAGYKLLAV+ +I+N RYL G
Sbjct  77   RSRSNVQILQYIFLKWILAFLVGLLTGLIATLINLAVENIAGYKLLAVVRFIENERYLTG  136

Query  551  FAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             AYF G N +LT  AS LCV+ APTAAGPGIPEIKA
Sbjct  137  LAYFTGVNLILTAFASALCVWFAPTAAGPGIPEIKA  172



>ref|XP_007151531.1| hypothetical protein PHAVU_004G054600g [Phaseolus vulgaris]
 gb|ESW23525.1| hypothetical protein PHAVU_004G054600g [Phaseolus vulgaris]
Length=782

 Score =   204 bits (518),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 137/162 (85%), Gaps = 2/162 (1%)
 Frame = +2

Query  179  GAGSTNE--MEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINEND  352
            G+ S N+  +E   + DPESN L+ PLLKRNRTLSS P+A++GAKVS IESLDYEINEND
Sbjct  10   GSTSMNDTMVEEVEERDPESNPLNEPLLKRNRTLSSNPLALVGAKVSYIESLDYEINEND  69

Query  353  LFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDN  532
            LFK DWRSRS++ VLQY+F KW+LAFL+GLLTG+IATLINL++ENIAGYKLLAV+N+I N
Sbjct  70   LFKQDWRSRSRAQVLQYIFWKWSLAFLVGLLTGIIATLINLSVENIAGYKLLAVVNFIQN  129

Query  533  NRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             RYL GF YF G NF+LT  AS+LCV  APTAAGPGIPEIKA
Sbjct  130  ERYLTGFLYFTGANFILTFVASILCVCFAPTAAGPGIPEIKA  171



>ref|XP_007217037.1| hypothetical protein PRUPE_ppa001619mg [Prunus persica]
 gb|EMJ18236.1| hypothetical protein PRUPE_ppa001619mg [Prunus persica]
Length=791

 Score =   203 bits (517),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 135/157 (86%), Gaps = 4/157 (3%)
 Frame = +2

Query  200  MEGQADD----DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHD  367
            MEG+++D    DPES SL +PLL+RNRTLSS+P+A++GAKVS IESLDYEINENDLFKHD
Sbjct  19   MEGESNDGEERDPESISLSQPLLRRNRTLSSSPLAIVGAKVSYIESLDYEINENDLFKHD  78

Query  368  WRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLM  547
            WRSRSK  VLQY+FLKW LAFL+GLLTG+IATLINLA+ENIAGYKLLA +++I+  RYLM
Sbjct  79   WRSRSKVQVLQYIFLKWILAFLVGLLTGIIATLINLAVENIAGYKLLAAVSFIEKERYLM  138

Query  548  GFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            GF Y  G N LLT  ASVLCV  APTAAGPGIPEIKA
Sbjct  139  GFIYLAGANLLLTTVASVLCVCFAPTAAGPGIPEIKA  175



>ref|XP_009371657.1| PREDICTED: chloride channel protein CLC-b-like [Pyrus x bretschneideri]
Length=787

 Score =   203 bits (517),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 132/161 (82%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  AGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDL  355
            A    T +  G  + DPES SL +PLLKR+RTLSSTP+AM+GAKVS IESLDYEINENDL
Sbjct  11   AAIPQTMQETGAEERDPESISLQQPLLKRSRTLSSTPLAMVGAKVSHIESLDYEINENDL  70

Query  356  FKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNN  535
            FKHDWRSRSK  VLQY+FLKW LA L+GLLTG+IATLINLA+ENIAGYKLLA +++I+  
Sbjct  71   FKHDWRSRSKVQVLQYIFLKWILACLVGLLTGIIATLINLAVENIAGYKLLAAVSFIEKE  130

Query  536  RYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            RYLMGF +  G N LLT  ASVLCV  APTAAGPGIPEIKA
Sbjct  131  RYLMGFIFIAGANLLLTAIASVLCVCFAPTAAGPGIPEIKA  171



>ref|XP_008379123.1| PREDICTED: chloride channel protein CLC-b isoform X1 [Malus domestica]
Length=791

 Score =   203 bits (516),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 133/162 (82%), Gaps = 1/162 (1%)
 Frame = +2

Query  176  AGAGSTNEMEGQADDDPESNSLHRPLL-KRNRTLSSTPVAMIGAKVSPIESLDYEINEND  352
            A    T +  G  + DPES +LH+PLL KRNRTLSSTP+AM+GAKVS IESLDYEINEND
Sbjct  14   AAVPQTMQETGAEERDPESIALHQPLLLKRNRTLSSTPLAMVGAKVSHIESLDYEINEND  73

Query  353  LFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDN  532
            LF HDWRSR+K  VLQYVFLKW LAFL+GLLTG+IATLINLA ENIAGYKLLA +++I+ 
Sbjct  74   LFMHDWRSRTKVQVLQYVFLKWILAFLVGLLTGIIATLINLATENIAGYKLLAXVSFIEK  133

Query  533  NRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             RYLMGF +  G N LLT SASVLCV  APTAAGPGIPEIKA
Sbjct  134  ERYLMGFIFIAGVNLLLTASASVLCVCFAPTAAGPGIPEIKA  175



>gb|KHN01525.1| Chloride channel protein CLC-b [Glycine soja]
Length=783

 Score =   202 bits (515),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 132/156 (85%), Gaps = 0/156 (0%)
 Frame = +2

Query  191  TNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDW  370
            TN +E   + DPESN L+ PLLKRNRTLSS P+A++GAKVS IESLDYEINENDLFK DW
Sbjct  17   TNMVEEVEERDPESNPLNEPLLKRNRTLSSNPLALVGAKVSYIESLDYEINENDLFKQDW  76

Query  371  RSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMG  550
            RSRS++ VLQY+F KWTLAFL+GLLTG+IATLINLA+ENIAGYK LAV+N+I   RYL G
Sbjct  77   RSRSRTQVLQYIFWKWTLAFLVGLLTGVIATLINLAVENIAGYKFLAVVNFIQKERYLRG  136

Query  551  FAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            F YF G NFLLT  AS+LCV  APTAAGPGIPEIKA
Sbjct  137  FLYFTGINFLLTFVASILCVCFAPTAAGPGIPEIKA  172



>ref|NP_001236494.1| chloride channel [Glycine max]
 gb|AAY43007.1| chloride channel [Glycine max]
Length=783

 Score =   202 bits (515),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 132/156 (85%), Gaps = 0/156 (0%)
 Frame = +2

Query  191  TNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDW  370
            TN +E   + DPESN L+ PLLKRNRTLSS P+A++GAKVS IESLDYEINENDLFK DW
Sbjct  17   TNMVEEVEERDPESNPLNEPLLKRNRTLSSNPLALVGAKVSYIESLDYEINENDLFKQDW  76

Query  371  RSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMG  550
            RSRS++ VLQY+F KWTLAFL+GLLTG+IATLINLA+ENIAGYK LAV+N+I   RYL G
Sbjct  77   RSRSRTQVLQYIFWKWTLAFLVGLLTGVIATLINLAVENIAGYKFLAVVNFIQKERYLRG  136

Query  551  FAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            F YF G NFLLT  AS+LCV  APTAAGPGIPEIKA
Sbjct  137  FLYFTGINFLLTFVASILCVCFAPTAAGPGIPEIKA  172



>ref|XP_008379124.1| PREDICTED: chloride channel protein CLC-b isoform X2 [Malus domestica]
Length=790

 Score =   202 bits (515),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 133/162 (82%), Gaps = 1/162 (1%)
 Frame = +2

Query  176  AGAGSTNEMEGQADDDPESNSLHRPLL-KRNRTLSSTPVAMIGAKVSPIESLDYEINEND  352
            A    T +  G  + DPES +LH+PLL KRNRTLSSTP+AM+GAKVS IESLDYEINEND
Sbjct  14   AAVPQTMQETGAEERDPESIALHQPLLLKRNRTLSSTPLAMVGAKVSHIESLDYEINEND  73

Query  353  LFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDN  532
            LF HDWRSR+K  VLQYVFLKW LAFL+GLLTG+IATLINLA ENIAGYKLLA +++I+ 
Sbjct  74   LFMHDWRSRTKVQVLQYVFLKWILAFLVGLLTGIIATLINLATENIAGYKLLAXVSFIEK  133

Query  533  NRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             RYLMGF +  G N LLT SASVLCV  APTAAGPGIPEIKA
Sbjct  134  ERYLMGFIFIAGVNLLLTASASVLCVCFAPTAAGPGIPEIKA  175



>ref|XP_008441347.1| PREDICTED: chloride channel protein CLC-b-like [Cucumis melo]
Length=789

 Score =   202 bits (514),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 134/159 (84%), Gaps = 3/159 (2%)
 Frame = +2

Query  191  TNEMEGQADD---DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFK  361
            TN ME +  +   DPESN L++PLLKR+RTLSS+P+A++GAKVS IESLDYEINENDLFK
Sbjct  14   TNSMEAEPQEEERDPESNPLNQPLLKRSRTLSSSPLAIVGAKVSLIESLDYEINENDLFK  73

Query  362  HDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRY  541
            HDWRSRSK  VLQY+F KWTLA L+GLLTG+IATLINLAIENIAGYKLL V++YI   RY
Sbjct  74   HDWRSRSKVQVLQYIFSKWTLACLVGLLTGIIATLINLAIENIAGYKLLKVVDYIKQERY  133

Query  542  LMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            LMGFAYF   NFLLT  A+ LCV  APTAAGPGIPEIKA
Sbjct  134  LMGFAYFTTANFLLTFVAASLCVCFAPTAAGPGIPEIKA  172



>ref|XP_007161741.1| hypothetical protein PHAVU_001G094700g [Phaseolus vulgaris]
 gb|ESW33735.1| hypothetical protein PHAVU_001G094700g [Phaseolus vulgaris]
Length=742

 Score =   201 bits (510),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 136/169 (80%), Gaps = 4/169 (2%)
 Frame = +2

Query  164  SMEFAGAGSTN----EMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLD  331
            S EF  +   N    E++ + + DPE N L+ PLLKRNRTLSS P+A++G KVS IESLD
Sbjct  5    SREFGESTKINHKMEEVQREEEIDPEGNPLNEPLLKRNRTLSSNPLALVGEKVSYIESLD  64

Query  332  YEINENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLA  511
            YEINENDLFKHDWRSRS+  VLQY+FLKW LAFL+GLLTG+IATLINLA+ENI+GYKLLA
Sbjct  65   YEINENDLFKHDWRSRSRVQVLQYIFLKWLLAFLVGLLTGIIATLINLAVENISGYKLLA  124

Query  512  VLNYIDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            VL+YI   RYL GF YF G NF+LT  A++LCV  APTAAGPGIPEIKA
Sbjct  125  VLSYIHKERYLTGFLYFTGMNFILTFVAAILCVCFAPTAAGPGIPEIKA  173



>ref|XP_003553925.1| PREDICTED: chloride channel protein CLC-b-like isoform X1 [Glycine 
max]
Length=790

 Score =   201 bits (510),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 135/169 (80%), Gaps = 4/169 (2%)
 Frame = +2

Query  164  SMEFAGAGSTNE----MEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLD  331
            S EF  +   N     +E + + DPESN L+ PLLKRNRTLSS P+A++G KVS IESLD
Sbjct  5    SGEFGESTKINHKMENVEREEEIDPESNPLNEPLLKRNRTLSSNPLALVGEKVSYIESLD  64

Query  332  YEINENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLA  511
            YEINENDLFKHDWRSRS+  VLQY+FLKW LAFL+GLLTG+IATLINLA+ENIAGYKLLA
Sbjct  65   YEINENDLFKHDWRSRSRVQVLQYIFLKWLLAFLVGLLTGIIATLINLAVENIAGYKLLA  124

Query  512  VLNYIDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            VL YI   RYL GF YF G NF+LT  A++LCV  APTAAGPGIPEIKA
Sbjct  125  VLKYIHKERYLTGFLYFTGINFVLTFVAAILCVCFAPTAAGPGIPEIKA  173



>ref|XP_006604142.1| PREDICTED: chloride channel protein CLC-b-like isoform X2 [Glycine 
max]
Length=780

 Score =   201 bits (510),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 135/169 (80%), Gaps = 4/169 (2%)
 Frame = +2

Query  164  SMEFAGAGSTNE----MEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLD  331
            S EF  +   N     +E + + DPESN L+ PLLKRNRTLSS P+A++G KVS IESLD
Sbjct  5    SGEFGESTKINHKMENVEREEEIDPESNPLNEPLLKRNRTLSSNPLALVGEKVSYIESLD  64

Query  332  YEINENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLA  511
            YEINENDLFKHDWRSRS+  VLQY+FLKW LAFL+GLLTG+IATLINLA+ENIAGYKLLA
Sbjct  65   YEINENDLFKHDWRSRSRVQVLQYIFLKWLLAFLVGLLTGIIATLINLAVENIAGYKLLA  124

Query  512  VLNYIDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            VL YI   RYL GF YF G NF+LT  A++LCV  APTAAGPGIPEIKA
Sbjct  125  VLKYIHKERYLTGFLYFTGINFVLTFVAAILCVCFAPTAAGPGIPEIKA  173



>ref|XP_007161742.1| hypothetical protein PHAVU_001G094700g [Phaseolus vulgaris]
 gb|ESW33736.1| hypothetical protein PHAVU_001G094700g [Phaseolus vulgaris]
Length=791

 Score =   201 bits (510),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 136/169 (80%), Gaps = 4/169 (2%)
 Frame = +2

Query  164  SMEFAGAGSTN----EMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLD  331
            S EF  +   N    E++ + + DPE N L+ PLLKRNRTLSS P+A++G KVS IESLD
Sbjct  5    SREFGESTKINHKMEEVQREEEIDPEGNPLNEPLLKRNRTLSSNPLALVGEKVSYIESLD  64

Query  332  YEINENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLA  511
            YEINENDLFKHDWRSRS+  VLQY+FLKW LAFL+GLLTG+IATLINLA+ENI+GYKLLA
Sbjct  65   YEINENDLFKHDWRSRSRVQVLQYIFLKWLLAFLVGLLTGIIATLINLAVENISGYKLLA  124

Query  512  VLNYIDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            VL+YI   RYL GF YF G NF+LT  A++LCV  APTAAGPGIPEIKA
Sbjct  125  VLSYIHKERYLTGFLYFTGMNFILTFVAAILCVCFAPTAAGPGIPEIKA  173



>ref|XP_008231135.1| PREDICTED: chloride channel protein CLC-b [Prunus mume]
Length=791

 Score =   200 bits (509),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 134/157 (85%), Gaps = 4/157 (3%)
 Frame = +2

Query  200  MEGQADD----DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHD  367
            MEG+++D    DPES SL +PLL+RNRTLSS+P+A++GAKVS IESLDYEINENDLFKHD
Sbjct  19   MEGESNDGEERDPESISLSQPLLRRNRTLSSSPLAIVGAKVSYIESLDYEINENDLFKHD  78

Query  368  WRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLM  547
            WRSRSK  VLQY+FLKW LAFL+GLLTG+IATLINLA+ENIAGYKLLA +++I   RYLM
Sbjct  79   WRSRSKVQVLQYIFLKWILAFLVGLLTGIIATLINLAVENIAGYKLLAAVSFIQKERYLM  138

Query  548  GFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            GF +  G N LLT  AS+LCV  APTAAGPGIPEIKA
Sbjct  139  GFIHLAGANLLLTTFASILCVCFAPTAAGPGIPEIKA  175



>gb|KJB76408.1| hypothetical protein B456_012G087500 [Gossypium raimondii]
Length=818

 Score =   200 bits (508),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +2

Query  221  DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQ  400
            DPESNSL +PLLKRNRTLSSTP+A++GAKVS IESLDYEINENDLFKHDWR RSK  VLQ
Sbjct  29   DPESNSLRQPLLKRNRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRRRSKVQVLQ  88

Query  401  YVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFL  580
            Y+FLKW+LAFL+GLLTGLIATLINLAIENIAGYKLLA++ +I+  RY+ G  +F G NF 
Sbjct  89   YIFLKWSLAFLVGLLTGLIATLINLAIENIAGYKLLAIVGFIEEGRYISGLIFFTGINFF  148

Query  581  LTMSASVLCVFXAPTAAGPGIPEIKA  658
            LT+ A+VLCV  APTAAGPGIPEIKA
Sbjct  149  LTLIAAVLCVCFAPTAAGPGIPEIKA  174



>gb|KJB76409.1| hypothetical protein B456_012G087500 [Gossypium raimondii]
Length=785

 Score =   199 bits (507),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +2

Query  221  DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQ  400
            DPESNSL +PLLKRNRTLSSTP+A++GAKVS IESLDYEINENDLFKHDWR RSK  VLQ
Sbjct  29   DPESNSLRQPLLKRNRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRRRSKVQVLQ  88

Query  401  YVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFL  580
            Y+FLKW+LAFL+GLLTGLIATLINLAIENIAGYKLLA++ +I+  RY+ G  +F G NF 
Sbjct  89   YIFLKWSLAFLVGLLTGLIATLINLAIENIAGYKLLAIVGFIEEGRYISGLIFFTGINFF  148

Query  581  LTMSASVLCVFXAPTAAGPGIPEIKA  658
            LT+ A+VLCV  APTAAGPGIPEIKA
Sbjct  149  LTLIAAVLCVCFAPTAAGPGIPEIKA  174



>gb|KJB76407.1| hypothetical protein B456_012G087500 [Gossypium raimondii]
Length=785

 Score =   199 bits (507),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +2

Query  221  DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQ  400
            DPESNSL +PLLKRNRTLSSTP+A++GAKVS IESLDYEINENDLFKHDWR RSK  VLQ
Sbjct  29   DPESNSLRQPLLKRNRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRRRSKVQVLQ  88

Query  401  YVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFL  580
            Y+FLKW+LAFL+GLLTGLIATLINLAIENIAGYKLLA++ +I+  RY+ G  +F G NF 
Sbjct  89   YIFLKWSLAFLVGLLTGLIATLINLAIENIAGYKLLAIVGFIEEGRYISGLIFFTGINFF  148

Query  581  LTMSASVLCVFXAPTAAGPGIPEIKA  658
            LT+ A+VLCV  APTAAGPGIPEIKA
Sbjct  149  LTLIAAVLCVCFAPTAAGPGIPEIKA  174



>gb|EYU34803.1| hypothetical protein MIMGU_mgv1a001623mg [Erythranthe guttata]
Length=783

 Score =   198 bits (504),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 129/161 (80%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  AGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDL  355
            A A    + + + + DPESN+LH PLLK NRTLSS  +A++G KVS IESLDYEINENDL
Sbjct  14   AEANIQTQRQDEQEHDPESNTLHEPLLKVNRTLSSNQLAIVGGKVSHIESLDYEINENDL  73

Query  356  FKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNN  535
            FK DWRSRSK  VLQY+FLKW LAFL+GLLTGLIATLINLA+ENIAGYKLL V  YI+  
Sbjct  74   FKQDWRSRSKVQVLQYIFLKWLLAFLVGLLTGLIATLINLAVENIAGYKLLVVAKYIEQK  133

Query  536  RYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            RYL GF Y  G NFLLT+ ASVLCV  APTAAGPGIPEIKA
Sbjct  134  RYLAGFVYLAGANFLLTLVASVLCVCFAPTAAGPGIPEIKA  174



>gb|KHN24330.1| Chloride channel protein CLC-b [Glycine soja]
Length=773

 Score =   198 bits (503),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +2

Query  200  MEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSR  379
            +E + + DPESN L+ PLLKRNRTLSS P+A++G KVS IESLDYEINENDLFKHDWRSR
Sbjct  4    VEREEEIDPESNPLNEPLLKRNRTLSSNPLALVGEKVSYIESLDYEINENDLFKHDWRSR  63

Query  380  SKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAY  559
            S+  VLQY+FLKW LAFL+GLLTG+IATLINLA+ENIAGYKLLAVL YI   RYL GF Y
Sbjct  64   SRVQVLQYIFLKWLLAFLVGLLTGIIATLINLAVENIAGYKLLAVLKYIHKERYLTGFLY  123

Query  560  FVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            F G NF+LT  A++LCV  APTAAGPGIPE KA
Sbjct  124  FTGINFVLTFVAAILCVCSAPTAAGPGIPENKA  156



>ref|XP_003618847.1| Chloride channel protein CLC-a [Medicago truncatula]
Length=780

 Score =   197 bits (501),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = +2

Query  221  DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQ  400
            DPE N ++ PLLKRNRTLSS P+A++GAKVS IESLDYEINENDLFK DWRSRS+  V+Q
Sbjct  22   DPERNPMNEPLLKRNRTLSSNPLALVGAKVSYIESLDYEINENDLFKQDWRSRSRGQVMQ  81

Query  401  YVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFL  580
            Y+ LKW LAFL+GLLTG+IATLINLA+ENI+GYKLL V+ YI   RYLMGF YF+GTNFL
Sbjct  82   YIILKWLLAFLVGLLTGVIATLINLAVENISGYKLLTVVGYIQQERYLMGFLYFLGTNFL  141

Query  581  LTMSASVLCVFXAPTAAGPGIPEIKA  658
            LT  AS+LCV  APTAAGPGIPEIKA
Sbjct  142  LTFIASILCVCFAPTAAGPGIPEIKA  167



>gb|AES75065.2| ClC chloride channel family protein [Medicago truncatula]
Length=775

 Score =   197 bits (501),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = +2

Query  221  DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQ  400
            DPE N ++ PLLKRNRTLSS P+A++GAKVS IESLDYEINENDLFK DWRSRS+  V+Q
Sbjct  22   DPERNPMNEPLLKRNRTLSSNPLALVGAKVSYIESLDYEINENDLFKQDWRSRSRGQVMQ  81

Query  401  YVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFL  580
            Y+ LKW LAFL+GLLTG+IATLINLA+ENI+GYKLL V+ YI   RYLMGF YF+GTNFL
Sbjct  82   YIILKWLLAFLVGLLTGVIATLINLAVENISGYKLLTVVGYIQQERYLMGFLYFLGTNFL  141

Query  581  LTMSASVLCVFXAPTAAGPGIPEIKA  658
            LT  AS+LCV  APTAAGPGIPEIKA
Sbjct  142  LTFIASILCVCFAPTAAGPGIPEIKA  167



>ref|XP_007031848.1| Chloride channel B isoform 2 [Theobroma cacao]
 gb|EOY02774.1| Chloride channel B isoform 2 [Theobroma cacao]
Length=787

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = +2

Query  224  PESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQY  403
            PESNSL  PLLKRNRTLSS+P+A++GAKVS IESLDYEINEND+FKHDWRSRSK+ VLQY
Sbjct  28   PESNSLGEPLLKRNRTLSSSPLALVGAKVSHIESLDYEINENDIFKHDWRSRSKAQVLQY  87

Query  404  VFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFLL  583
            +FLKWTLAFL+GLLTGLIATLINLAIENIAGYKLLA++ +I+  RYL G  +F G NF L
Sbjct  88   IFLKWTLAFLVGLLTGLIATLINLAIENIAGYKLLAIVGFIEEGRYLSGLVFFTGVNFSL  147

Query  584  TMSASVLCVFXAPTAAGPGIPEIKA  658
            T++A++LCV  APTAAGPGIPEIKA
Sbjct  148  TLAAALLCVCFAPTAAGPGIPEIKA  172



>ref|XP_007031850.1| Chloride channel B isoform 4, partial [Theobroma cacao]
 gb|EOY02776.1| Chloride channel B isoform 4, partial [Theobroma cacao]
Length=799

 Score =   196 bits (499),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = +2

Query  224  PESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQY  403
            PESNSL  PLLKRNRTLSS+P+A++GAKVS IESLDYEINEND+FKHDWRSRSK+ VLQY
Sbjct  26   PESNSLGEPLLKRNRTLSSSPLALVGAKVSHIESLDYEINENDIFKHDWRSRSKAQVLQY  85

Query  404  VFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFLL  583
            +FLKWTLAFL+GLLTGLIATLINLAIENIAGYKLLA++ +I+  RYL G  +F G NF L
Sbjct  86   IFLKWTLAFLVGLLTGLIATLINLAIENIAGYKLLAIVGFIEEGRYLSGLVFFTGVNFSL  145

Query  584  TMSASVLCVFXAPTAAGPGIPEIKA  658
            T++A++LCV  APTAAGPGIPEIKA
Sbjct  146  TLAAALLCVCFAPTAAGPGIPEIKA  170



>gb|KHN10806.1| Chloride channel protein CLC-b [Glycine soja]
Length=774

 Score =   195 bits (495),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 130/155 (84%), Gaps = 1/155 (1%)
 Frame = +2

Query  197  EMEGQADDDPESNSLHRPLL-KRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWR  373
            E++ + + DPESN L+ PLL KR RTLSS P+A++G KVS IESLDYEINENDLFKHDWR
Sbjct  3    EVQREEEIDPESNPLNEPLLLKRTRTLSSNPLALVGEKVSYIESLDYEINENDLFKHDWR  62

Query  374  SRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGF  553
            SRS+  VLQY+FLKW LAFL+GLLTG+IATLINLA+ENIAGYKLLAVL YI   RYL GF
Sbjct  63   SRSRVQVLQYIFLKWLLAFLVGLLTGIIATLINLAVENIAGYKLLAVLKYIHKERYLTGF  122

Query  554  AYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             YF G NF+LT  A++LCV  APTAAGPGIPEIKA
Sbjct  123  LYFTGINFVLTFVAAILCVCFAPTAAGPGIPEIKA  157



>ref|XP_010670516.1| PREDICTED: chloride channel protein CLC-b-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010670517.1| PREDICTED: chloride channel protein CLC-b-like [Beta vulgaris 
subsp. vulgaris]
Length=804

 Score =   195 bits (495),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 136/171 (80%), Gaps = 8/171 (5%)
 Frame = +2

Query  158  CMSMEFAGAGSTNEMEGQA----DDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIES  325
            CMS E A   ST  ME +A    D D ESN LH+PLLKRNRTLS++ +AM+GAKVS IES
Sbjct  22   CMS-ELA---STPSMEAEAVANGDADLESNVLHQPLLKRNRTLSASHLAMVGAKVSYIES  77

Query  326  LDYEINENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKL  505
            LDYEINENDLFK DWRSRSK  VLQYVFLKW LAFL+GLLTGL+ATLINLA+ENIAGYKL
Sbjct  78   LDYEINENDLFKQDWRSRSKVQVLQYVFLKWKLAFLVGLLTGLVATLINLAVENIAGYKL  137

Query  506  LAVLNYIDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            L V  YI   RY+MG     G NFLLT+S++VL VF APTAAGPGIPEIKA
Sbjct  138  LLVSGYIVEKRYVMGLIMLTGANFLLTLSSTVLVVFFAPTAAGPGIPEIKA  188



>gb|KJB11653.1| hypothetical protein B456_001G270200 [Gossypium raimondii]
Length=788

 Score =   194 bits (494),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 136/169 (80%), Gaps = 4/169 (2%)
 Frame = +2

Query  164  SMEFAGAGSTNEMEGQAD---DDPESNS-LHRPLLKRNRTLSSTPVAMIGAKVSPIESLD  331
            S  F+   + N M+ +A+    DPESNS L  PLLKRNRTLSS P+A++GA VS IESLD
Sbjct  5    SNHFSKPETPNTMKAEAEAEERDPESNSSLSEPLLKRNRTLSSNPLALVGATVSHIESLD  64

Query  332  YEINENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLA  511
            YEINENDLFKHDWRSRSK  VLQY+FLKWTLAFL+GLLTGLIATLINLAIENIAGYK LA
Sbjct  65   YEINENDLFKHDWRSRSKVQVLQYIFLKWTLAFLVGLLTGLIATLINLAIENIAGYKFLA  124

Query  512  VLNYIDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            ++ +I   RYL G  +F G NF+LT+ A+VLCV  APTAAGPGIPEIKA
Sbjct  125  IVGFIKEERYLSGLVFFTGVNFVLTLVAAVLCVCFAPTAAGPGIPEIKA  173



>ref|XP_010029007.1| PREDICTED: chloride channel protein CLC-b [Eucalyptus grandis]
 gb|KCW55840.1| hypothetical protein EUGRSUZ_I01654 [Eucalyptus grandis]
Length=788

 Score =   194 bits (493),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +2

Query  230  SNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVF  409
            SNSL++PLL+R+RTLSS P+AM+GAKV+ IESLDYEINENDLFKHDWRSRSK  VLQYVF
Sbjct  31   SNSLNQPLLRRHRTLSSNPLAMVGAKVAHIESLDYEINENDLFKHDWRSRSKVQVLQYVF  90

Query  410  LKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFLLTM  589
            LKWTLAFL+GLLTG+IATLINLA+ENIAGYKLLAV+++ID  RY  GF  F G+NF+LT+
Sbjct  91   LKWTLAFLVGLLTGIIATLINLAVENIAGYKLLAVVHFIDEERYFTGFLLFTGSNFVLTL  150

Query  590  SASVLCVFXAPTAAGPGIPEIKA  658
             A+VLCV  APTAAGPGIPEIKA
Sbjct  151  FAAVLCVCFAPTAAGPGIPEIKA  173



>gb|EYU45399.1| hypothetical protein MIMGU_mgv1a001597mg [Erythranthe guttata]
Length=788

 Score =   192 bits (487),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 127/155 (82%), Gaps = 3/155 (2%)
 Frame = +2

Query  194  NEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWR  373
            +E EG+   D  SN+LH+ LLKRNRTLSS  +A +G KVS IESLDYEINENDLFK DWR
Sbjct  19   DEEEGR---DCSSNNLHQSLLKRNRTLSSNQLAFVGTKVSHIESLDYEINENDLFKQDWR  75

Query  374  SRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGF  553
            SRSK  VLQY+FLKW LAFL+GLLTG+IATLINLA+ENIAGYKL AV+ YID  RYLMGF
Sbjct  76   SRSKVQVLQYIFLKWLLAFLVGLLTGVIATLINLAVENIAGYKLRAVVKYIDQERYLMGF  135

Query  554  AYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             Y  G NFLLT  A++LCV  APTAAGPGIPEIKA
Sbjct  136  VYMAGANFLLTFVAAILCVCFAPTAAGPGIPEIKA  170



>ref|XP_004513192.1| PREDICTED: chloride channel protein CLC-b-like [Cicer arietinum]
Length=792

 Score =   192 bits (487),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 126/147 (86%), Gaps = 1/147 (1%)
 Frame = +2

Query  221  DPES-NSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVL  397
            DPES NSL++PL+KRNRTLSS P+A++G KVS IESLDYEINENDLFKH WRSRS+  VL
Sbjct  26   DPESSNSLNQPLIKRNRTLSSNPLALVGEKVSYIESLDYEINENDLFKHGWRSRSRIEVL  85

Query  398  QYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNF  577
            QY+FLKW LAFL+G LTGLIATLINLA+ENIAGYKLLAVL YI   RYL GF +F G NF
Sbjct  86   QYIFLKWLLAFLVGFLTGLIATLINLAVENIAGYKLLAVLKYIQRERYLTGFLFFTGINF  145

Query  578  LLTMSASVLCVFXAPTAAGPGIPEIKA  658
            +LT  A++LCV  APTAAGPGIPEIKA
Sbjct  146  ILTFVAAILCVCFAPTAAGPGIPEIKA  172



>ref|XP_011098867.1| PREDICTED: chloride channel protein CLC-a-like [Sesamum indicum]
Length=787

 Score =   191 bits (486),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +2

Query  230  SNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVF  409
             N+LH+PLLKRNRTLSS+P+A++GAKVS IESLDYEINENDLFK DWRSRS+  VLQY+F
Sbjct  29   CNNLHQPLLKRNRTLSSSPLAIVGAKVSYIESLDYEINENDLFKQDWRSRSRVQVLQYIF  88

Query  410  LKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFLLTM  589
            LKW LAFL+GLLTG IATLINLA+ENI+GYKLLAV+ YI+  RYLMGF Y  G NFLLT+
Sbjct  89   LKWLLAFLVGLLTGGIATLINLAVENISGYKLLAVVRYIEQERYLMGFLYMAGANFLLTL  148

Query  590  SASVLCVFXAPTAAGPGIPEIKA  658
             A+VL V  APTAAGPGIPEIKA
Sbjct  149  VAAVLVVCFAPTAAGPGIPEIKA  171



>gb|KFK33637.1| hypothetical protein AALP_AA5G039600 [Arabis alpina]
Length=778

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = +2

Query  212  ADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSH  391
             + DPESN+L++PL+K NRTLSSTP+A++GAKVS IESLDYEINENDLFKHDWR RSK+ 
Sbjct  16   GEGDPESNTLNQPLVKANRTLSSTPLALVGAKVSYIESLDYEINENDLFKHDWRKRSKAQ  75

Query  392  VLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGT  571
            VLQYVFLKWTLA L+GL TGLIATLINLA+ENIAGYKLLAV +++   RY+ G   F G 
Sbjct  76   VLQYVFLKWTLACLVGLFTGLIATLINLAVENIAGYKLLAVGHFLGQERYVTGLMLFAGA  135

Query  572  NFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            N  LT+ ASVLCV  APTAAGPGIPEIKA
Sbjct  136  NLGLTLVASVLCVCFAPTAAGPGIPEIKA  164



>ref|XP_006395477.1| hypothetical protein EUTSA_v10003679mg [Eutrema salsugineum]
 gb|ESQ32763.1| hypothetical protein EUTSA_v10003679mg [Eutrema salsugineum]
Length=778

 Score =   190 bits (482),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = +2

Query  212  ADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSH  391
             + DPESN+L++PL+K NRTLSSTP+A++GAKVS IESLDYEINENDLFKHDWR RSK+ 
Sbjct  16   GEGDPESNTLNQPLVKANRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRKRSKTQ  75

Query  392  VLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGT  571
            VLQY+FLKWTLA L+GL TGLIAT INLA+ENIAGYKLLAV +++   RY+ G   F G 
Sbjct  76   VLQYIFLKWTLACLVGLFTGLIATFINLAVENIAGYKLLAVGHFLAQERYVTGLMMFAGA  135

Query  572  NFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            N  LT+ ASVLCV  APTAAGPGIPEIKA
Sbjct  136  NLGLTLVASVLCVCFAPTAAGPGIPEIKA  164



>ref|NP_189353.1| chloride channel protein CLC-b [Arabidopsis thaliana]
 sp|P92942.1|CLCB_ARATH RecName: Full=Chloride channel protein CLC-b; Short=AtCLC-b; 
AltName: Full=CBS domain-containing protein CBSCLC7 [Arabidopsis 
thaliana]
 emb|CAA96058.1| CLC-b chloride channel protein [Arabidopsis thaliana]
 dbj|BAB01934.1| CLC-d chloride channel; anion channel protein [Arabidopsis thaliana]
 gb|AAL32596.1| CLC-d chloride channel; anion channel protein [Arabidopsis thaliana]
 gb|AEE77275.1| chloride channel protein CLC-b [Arabidopsis thaliana]
Length=780

 Score =   189 bits (481),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = +2

Query  221  DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQ  400
            DPESN+L++PL+K NRTLSSTP+A++GAKVS IESLDYEINENDLFKHDWR RSK+ VLQ
Sbjct  21   DPESNTLNQPLVKANRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRKRSKAQVLQ  80

Query  401  YVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFL  580
            YVFLKWTLA L+GL TGLIATLINLA+ENIAGYKLLAV +++   RY+ G    VG N  
Sbjct  81   YVFLKWTLACLVGLFTGLIATLINLAVENIAGYKLLAVGHFLTQERYVTGLMVLVGANLG  140

Query  581  LTMSASVLCVFXAPTAAGPGIPEIKA  658
            LT+ ASVLCV  APTAAGPGIPEIKA
Sbjct  141  LTLVASVLCVCFAPTAAGPGIPEIKA  166



>ref|XP_010678325.1| PREDICTED: chloride channel protein CLC-b-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=831

 Score =   189 bits (481),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 134/165 (81%), Gaps = 4/165 (2%)
 Frame = +2

Query  164  SMEFAGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEIN  343
            SME   A +   + G+A+D  ESNSLH+PLLK NRTLS+  +AM+GAKVS IESLDYEIN
Sbjct  55   SME---ADAETLVNGEAED-LESNSLHQPLLKGNRTLSANHLAMVGAKVSHIESLDYEIN  110

Query  344  ENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNY  523
            ENDLFK DWRSRSK  VLQYVFLKW LAFLIGLLTGLIATLINLA+ENIAGYKLL V +Y
Sbjct  111  ENDLFKQDWRSRSKMQVLQYVFLKWKLAFLIGLLTGLIATLINLAVENIAGYKLLLVSDY  170

Query  524  IDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            ++  RY+ G     G NFLLT+SA+VL VF APTAAGPGIPEIKA
Sbjct  171  VEQKRYMTGLIMLTGANFLLTLSATVLVVFFAPTAAGPGIPEIKA  215



>ref|XP_010425454.1| PREDICTED: chloride channel protein CLC-b-like isoform X1 [Camelina 
sativa]
Length=779

 Score =   189 bits (479),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = +2

Query  212  ADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSH  391
             + DPESN+L++PL+K NRTLSSTP+A++G KVS IESLDYEINENDLFKHDWR RSK+ 
Sbjct  17   GEADPESNTLNQPLVKANRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRKRSKAQ  76

Query  392  VLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGT  571
            VLQYVFLKWTLA L+GL TGLIATLINLA+ENIAGYKLLAV +++   RY  G     G 
Sbjct  77   VLQYVFLKWTLACLVGLFTGLIATLINLAVENIAGYKLLAVGHFLSQERYATGLMVLAGA  136

Query  572  NFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            N  LT+ ASVLCVF APTAAGPGIPEIKA
Sbjct  137  NLGLTLVASVLCVFFAPTAAGPGIPEIKA  165



>ref|XP_010425455.1| PREDICTED: chloride channel protein CLC-b-like isoform X2 [Camelina 
sativa]
Length=743

 Score =   188 bits (478),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = +2

Query  212  ADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSH  391
             + DPESN+L++PL+K NRTLSSTP+A++G KVS IESLDYEINENDLFKHDWR RSK+ 
Sbjct  17   GEADPESNTLNQPLVKANRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRKRSKAQ  76

Query  392  VLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGT  571
            VLQYVFLKWTLA L+GL TGLIATLINLA+ENIAGYKLLAV +++   RY  G     G 
Sbjct  77   VLQYVFLKWTLACLVGLFTGLIATLINLAVENIAGYKLLAVGHFLSQERYATGLMVLAGA  136

Query  572  NFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            N  LT+ ASVLCVF APTAAGPGIPEIKA
Sbjct  137  NLGLTLVASVLCVFFAPTAAGPGIPEIKA  165



>ref|XP_002875360.1| CLC-B [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51619.1| CLC-B [Arabidopsis lyrata subsp. lyrata]
Length=779

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 130/159 (82%), Gaps = 4/159 (3%)
 Frame = +2

Query  194  NEMEGQA----DDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFK  361
            N++ G +    + DPESN+L++PL+K NRTLSSTP+A++GAKVS IESLDYEINENDLFK
Sbjct  7    NQISGNSNYNGEADPESNTLNQPLVKANRTLSSTPLALVGAKVSHIESLDYEINENDLFK  66

Query  362  HDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRY  541
            HDWR RSK+ VLQYVFLKWTLA L+GL TGLIATLINLA+ENIAGYKLLAV +++   RY
Sbjct  67   HDWRKRSKAQVLQYVFLKWTLACLVGLFTGLIATLINLAVENIAGYKLLAVGHFLTQERY  126

Query  542  LMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            + G     G N  LT+ ASVLCV  APTAAGPGIPEIKA
Sbjct  127  VTGLMVLAGANLGLTLVASVLCVCFAPTAAGPGIPEIKA  165



>ref|XP_010514406.1| PREDICTED: chloride channel protein CLC-b [Camelina sativa]
Length=779

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 128/158 (81%), Gaps = 2/158 (1%)
 Frame = +2

Query  185  GSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKH  364
            G  +   G+AD  PESN+L++PL+K NRTLSSTP+A++G KVS IESLDYEINENDLFKH
Sbjct  10   GGNSNYNGEAD--PESNTLNQPLVKANRTLSSTPLALVGTKVSHIESLDYEINENDLFKH  67

Query  365  DWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYL  544
            DWR RSK+ VLQYVFLKWTLA L+GL TGLIATLINLA+ENIAGYKLLAV +++   RY 
Sbjct  68   DWRKRSKAQVLQYVFLKWTLACLVGLFTGLIATLINLAVENIAGYKLLAVGHFLSQERYA  127

Query  545  MGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             G     G N  LT+ ASVLCV+ APTAAGPGIPEIKA
Sbjct  128  TGLMVLAGANLGLTLVASVLCVYFAPTAAGPGIPEIKA  165



>emb|CDY13685.1| BnaA06g32380D [Brassica napus]
Length=783

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = +2

Query  203  EGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRS  382
            E +   DPESN+L++PL+K NRTLSSTP+A++G KVS IESLDYEINENDLFKHDWR RS
Sbjct  17   EEEEQGDPESNTLNQPLVKANRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRKRS  76

Query  383  KSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYF  562
            K+ VLQY+FLKWT A LIGL TGLIATLINLA+ENIAGYKLLAV +++   RY+ G   F
Sbjct  77   KTQVLQYIFLKWTFACLIGLFTGLIATLINLAVENIAGYKLLAVGHFLAQERYVTGLMVF  136

Query  563  VGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             G N  LT+ ASVLCV  APTAAGPGIPEIKA
Sbjct  137  AGGNLGLTLVASVLCVCFAPTAAGPGIPEIKA  168



>ref|XP_010502677.1| PREDICTED: chloride channel protein CLC-b-like isoform X1 [Camelina 
sativa]
Length=779

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 128/158 (81%), Gaps = 2/158 (1%)
 Frame = +2

Query  185  GSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKH  364
            G  ++  G+AD  PESN+L++PL+K NRTLSSTP+A++G KVS IESL+YEINENDLFKH
Sbjct  10   GGNSKYNGEAD--PESNTLNQPLVKANRTLSSTPLALVGTKVSHIESLNYEINENDLFKH  67

Query  365  DWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYL  544
            DWR RSK+ VLQYVFLKWTLA  +GL TGLIATLINLA+ENIAGYKLLAV +++   RY 
Sbjct  68   DWRKRSKAQVLQYVFLKWTLACFVGLFTGLIATLINLAVENIAGYKLLAVGHFLSQERYA  127

Query  545  MGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             G     G N  LT+ ASVLCVF APTAAGPGIPEIKA
Sbjct  128  TGLMVLAGANLGLTLVASVLCVFFAPTAAGPGIPEIKA  165



>ref|XP_009151988.1| PREDICTED: chloride channel protein CLC-b [Brassica rapa]
Length=783

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = +2

Query  203  EGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRS  382
            E +   DPESN+L++PL+K NRTLSSTP+A++G KVS IESLDYEINENDLFKHDWR RS
Sbjct  17   EEEEQGDPESNTLNQPLVKANRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRKRS  76

Query  383  KSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYF  562
            K+ VLQY+FLKWT A LIGL TGLIATLINLA+ENIAGYKLLAV +++   RY+ G   F
Sbjct  77   KTQVLQYIFLKWTFACLIGLFTGLIATLINLAVENIAGYKLLAVGHFLAQERYVTGLMVF  136

Query  563  VGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             G N  LT+ ASVLCV  APTAAGPGIPEIKA
Sbjct  137  AGGNLGLTLVASVLCVCFAPTAAGPGIPEIKA  168



>ref|XP_010502678.1| PREDICTED: chloride channel protein CLC-b-like isoform X2 [Camelina 
sativa]
Length=743

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 128/158 (81%), Gaps = 2/158 (1%)
 Frame = +2

Query  185  GSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKH  364
            G  ++  G+AD  PESN+L++PL+K NRTLSSTP+A++G KVS IESL+YEINENDLFKH
Sbjct  10   GGNSKYNGEAD--PESNTLNQPLVKANRTLSSTPLALVGTKVSHIESLNYEINENDLFKH  67

Query  365  DWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYL  544
            DWR RSK+ VLQYVFLKWTLA  +GL TGLIATLINLA+ENIAGYKLLAV +++   RY 
Sbjct  68   DWRKRSKAQVLQYVFLKWTLACFVGLFTGLIATLINLAVENIAGYKLLAVGHFLSQERYA  127

Query  545  MGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             G     G N  LT+ ASVLCVF APTAAGPGIPEIKA
Sbjct  128  TGLMVLAGANLGLTLVASVLCVFFAPTAAGPGIPEIKA  165



>gb|AAB17007.1| voltage-gated chloride channel [Arabidopsis thaliana]
Length=773

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 134/165 (81%), Gaps = 3/165 (2%)
 Frame = +2

Query  164  SMEFAGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEIN  343
            +++ + +    E EG+   DPE+N+L++PLLKR+RTLSSTP+A++GAKVS IESLDYEIN
Sbjct  6    NLQISNSNYNGEEEGE---DPENNTLNQPLLKRHRTLSSTPLALVGAKVSHIESLDYEIN  62

Query  344  ENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNY  523
            ENDLFKHDWRSRSK+ V QY+FLKWTLA L+GL TGLIATLINLA+ENIAGYKLLAV  Y
Sbjct  63   ENDLFKHDWRSRSKAQVFQYIFLKWTLACLVGLFTGLIATLINLAVENIAGYKLLAVGYY  122

Query  524  IDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            I  +R+  G   F G N  LT+ A+VL V+ APTAAGPGIPEIKA
Sbjct  123  IAQDRFWTGLMVFTGANLGLTLVATVLVVYFAPTAAGPGIPEIKA  167



>gb|AAL24139.1| putative anion channel protein [Arabidopsis thaliana]
Length=775

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 134/165 (81%), Gaps = 3/165 (2%)
 Frame = +2

Query  164  SMEFAGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEIN  343
            +++ + +    E EG+   DPE+N+L++PLLKR+RTLSSTP+A++GAKVS IESLDYEIN
Sbjct  6    NLQISNSNYNGEEEGE---DPENNTLNQPLLKRHRTLSSTPLALVGAKVSHIESLDYEIN  62

Query  344  ENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNY  523
            ENDLFKHDWRSRSK+ V QY+FLKWTLA L+GL TGLIATLINLA+ENIAGYKLLAV  Y
Sbjct  63   ENDLFKHDWRSRSKAQVFQYIFLKWTLACLVGLFTGLIATLINLAVENIAGYKLLAVGYY  122

Query  524  IDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            I  +R+  G   F G N  LT+ A+VL V+ APTAAGPGIPEIKA
Sbjct  123  IAQDRFWTGLMVFTGANLGLTLVATVLVVYFAPTAAGPGIPEIKA  167



>ref|NP_198905.1| chloride channel protein CLC-a [Arabidopsis thaliana]
 sp|P92941.2|CLCA_ARATH RecName: Full=Chloride channel protein CLC-a; Short=AtCLC-a; 
AltName: Full=CBS domain-containing protein CBSCLC5 [Arabidopsis 
thaliana]
 gb|AAC05742.1| anion channel protein [Arabidopsis thaliana]
 dbj|BAB11351.1| anion channel protein [Arabidopsis thaliana]
 gb|AAN13022.1| anion channel protein [Arabidopsis thaliana]
 gb|AED94612.1| chloride channel protein CLC-a [Arabidopsis thaliana]
Length=775

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 134/165 (81%), Gaps = 3/165 (2%)
 Frame = +2

Query  164  SMEFAGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEIN  343
            +++ + +    E EG+   DPE+N+L++PLLKR+RTLSSTP+A++GAKVS IESLDYEIN
Sbjct  6    NLQISNSNYNGEEEGE---DPENNTLNQPLLKRHRTLSSTPLALVGAKVSHIESLDYEIN  62

Query  344  ENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNY  523
            ENDLFKHDWRSRSK+ V QY+FLKWTLA L+GL TGLIATLINLA+ENIAGYKLLAV  Y
Sbjct  63   ENDLFKHDWRSRSKAQVFQYIFLKWTLACLVGLFTGLIATLINLAVENIAGYKLLAVGYY  122

Query  524  IDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            I  +R+  G   F G N  LT+ A+VL V+ APTAAGPGIPEIKA
Sbjct  123  IAQDRFWTGLMVFTGANLGLTLVATVLVVYFAPTAAGPGIPEIKA  167



>emb|CDX83663.1| BnaC07g24030D [Brassica napus]
Length=783

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = +2

Query  203  EGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRS  382
            E +   DPESN+L++PL+K NRTLSSTP+A++G KVS IESLDYEINENDLFKHDWR RS
Sbjct  17   EDEEQGDPESNTLNQPLVKANRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRKRS  76

Query  383  KSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYF  562
            K+ VLQY+FLKWT A LIGL TGLIATLINLA+ENIAGYKLLAV +++   RY+ G   F
Sbjct  77   KTQVLQYIFLKWTFACLIGLFTGLIATLINLAVENIAGYKLLAVGHFLAQERYVTGLMVF  136

Query  563  VGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             G N  LT+ A+VLCV  APTAAGPGIPEIKA
Sbjct  137  AGGNLGLTLVATVLCVCFAPTAAGPGIPEIKA  168



>emb|CAA96057.1| CLC-a chloride channel protein [Arabidopsis thaliana]
Length=775

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 134/165 (81%), Gaps = 3/165 (2%)
 Frame = +2

Query  164  SMEFAGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEIN  343
            +++ + +    E EG+   DPE+N+L++PLLKR+RTLSSTP+A++GAKVS IESLDYEIN
Sbjct  6    NLQISNSNYNGEEEGE---DPENNTLNQPLLKRHRTLSSTPLALVGAKVSHIESLDYEIN  62

Query  344  ENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNY  523
            ENDLFKHDWRSRSK+ V QY+FLKWTLA L+GL TGLIATLINLA+ENIAGYKLLAV  Y
Sbjct  63   ENDLFKHDWRSRSKAQVFQYIFLKWTLACLVGLFTGLIATLINLAVENIAGYKLLAVGYY  122

Query  524  IDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            I  +R+  G   F G N  LT+ A+VL V+ APTAAGPGIPEIKA
Sbjct  123  IAQDRFWTGLMVFTGANLGLTLVATVLVVYFAPTAAGPGIPEIKA  167



>emb|CAN82189.1| hypothetical protein VITISV_031114 [Vitis vinifera]
Length=753

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 132/158 (84%), Gaps = 1/158 (1%)
 Frame = +2

Query  188  STNEMEGQADD-DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKH  364
            S+ E  G+ ++ D ESN L++PLLKR+RTLSS P+A++GAKVS IESLDYEINENDLFKH
Sbjct  12   SSVEGVGEGEERDLESNPLNQPLLKRSRTLSSNPLAIVGAKVSHIESLDYEINENDLFKH  71

Query  365  DWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYL  544
            DWRSRS + VLQY+FLKW+LAFL+GLLTGLIATLINLA+ENIAGYKLLAV   ++  RYL
Sbjct  72   DWRSRSSAQVLQYIFLKWSLAFLVGLLTGLIATLINLAVENIAGYKLLAVSGLVEKKRYL  131

Query  545  MGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             GF Y    NF+LT+ A+ LCV  APTAAGPGIPEIKA
Sbjct  132  TGFIYLTTANFVLTLFAAFLCVCFAPTAAGPGIPEIKA  169



>ref|XP_010905204.1| PREDICTED: chloride channel protein CLC-b-like [Elaeis guineensis]
Length=784

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 133/160 (83%), Gaps = 1/160 (1%)
 Frame = +2

Query  182  AGSTNEMEGQADD-DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLF  358
            A +  E++G+ D+ DPES+SLH+PLLKR  TL++  +AM+GAK+S IESLDYEINENDLF
Sbjct  14   AAADLEVDGEEDEQDPESHSLHQPLLKRTPTLTTHHLAMVGAKISHIESLDYEINENDLF  73

Query  359  KHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNR  538
            KHDWRSRS   VLQY+FLKWTLAFL+GLLTG++A+LINLAIENIAG K+L V   ++ +R
Sbjct  74   KHDWRSRSSVQVLQYIFLKWTLAFLVGLLTGVVASLINLAIENIAGIKMLHVARLVNESR  133

Query  539  YLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            Y+ GFAYF G NF LT+ A+ LCV  APTAAGPG+PEIKA
Sbjct  134  YVTGFAYFTGANFALTIVAATLCVVFAPTAAGPGVPEIKA  173



>ref|NP_001268190.1| uncharacterized protein LOC100260066 [Vitis vinifera]
 gb|ADK66982.1| chloride channel ClC4 [Vitis vinifera]
Length=789

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 132/158 (84%), Gaps = 1/158 (1%)
 Frame = +2

Query  188  STNEMEGQADD-DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKH  364
            S+ E  G+ ++ D ESN L++PLLKR+RTLSS P+A++GAKVS IESLDYEINENDLFKH
Sbjct  17   SSVEGVGEGEERDLESNPLNQPLLKRSRTLSSNPLAIVGAKVSHIESLDYEINENDLFKH  76

Query  365  DWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYL  544
            DWRSRS + VLQY+FLKW+LAFL+GLLTGLIATLINLA+ENIAGYKLLAV   ++  RYL
Sbjct  77   DWRSRSSAQVLQYIFLKWSLAFLVGLLTGLIATLINLAVENIAGYKLLAVSGLVEKKRYL  136

Query  545  MGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             GF Y    NF+LT+ A+ LCV  APTAAGPGIPEIKA
Sbjct  137  TGFIYLTTANFVLTLFAAFLCVCFAPTAAGPGIPEIKA  174



>ref|XP_004303984.1| PREDICTED: chloride channel protein CLC-b-like [Fragaria vesca 
subsp. vesca]
Length=790

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 125/149 (84%), Gaps = 1/149 (1%)
 Frame = +2

Query  215  DDDPESNSLHRPLL-KRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSH  391
            + D ESNSL +PLL KRNRTLSS P+A++GAKVS IESLDYEINENDLFKHDWRSRSK  
Sbjct  26   ERDLESNSLIQPLLLKRNRTLSSNPLALVGAKVSHIESLDYEINENDLFKHDWRSRSKVQ  85

Query  392  VLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGT  571
            VLQY+ LKWTLA LIGLLTGLIATLINLA+ENIAGYKLLAV+ YID  RYLMGF +    
Sbjct  86   VLQYILLKWTLALLIGLLTGLIATLINLAVENIAGYKLLAVVAYIDEERYLMGFIFLAVA  145

Query  572  NFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            N L T  A+VLCV  APTAAGPGIPEIKA
Sbjct  146  NLLFTTVAAVLCVCFAPTAAGPGIPEIKA  174



>ref|XP_010660593.1| PREDICTED: uncharacterized protein LOC100260066 isoform X1 [Vitis 
vinifera]
 ref|XP_010660594.1| PREDICTED: uncharacterized protein LOC100260066 isoform X1 [Vitis 
vinifera]
 emb|CBI21361.3| unnamed protein product [Vitis vinifera]
Length=789

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 132/158 (84%), Gaps = 1/158 (1%)
 Frame = +2

Query  188  STNEMEGQADD-DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKH  364
            S+ E  G+ ++ D ESN L++PLLKR+RTLSS P+A++GAKVS IESLDYEINENDLFKH
Sbjct  17   SSVEGVGEGEERDLESNPLNQPLLKRSRTLSSNPLAIVGAKVSHIESLDYEINENDLFKH  76

Query  365  DWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYL  544
            DWRSRS + VLQY+FLKW+LAFL+GLLTGLIATLINLA+ENIAGYKLLAV   ++  RYL
Sbjct  77   DWRSRSSAQVLQYIFLKWSLAFLVGLLTGLIATLINLAVENIAGYKLLAVSGLVEKKRYL  136

Query  545  MGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             GF Y    NF+LT+ A+ LCV  APTAAGPGIPEIKA
Sbjct  137  TGFIYLTTANFVLTLFAAFLCVCFAPTAAGPGIPEIKA  174



>ref|XP_006290621.1| hypothetical protein CARUB_v10016713mg [Capsella rubella]
 gb|EOA23519.1| hypothetical protein CARUB_v10016713mg [Capsella rubella]
Length=779

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = +2

Query  212  ADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSH  391
             + DPE+N+L++PL+K NRTLSSTP+A++GAKVS IESLDYEINENDLFKHDWR RSK+ 
Sbjct  17   GERDPENNTLNQPLVKANRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRKRSKAQ  76

Query  392  VLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGT  571
            VLQYVFLKWTLA L+GL TGLIATLINLA+ENIAGYKLLAV +++   RY+ G     G 
Sbjct  77   VLQYVFLKWTLACLVGLFTGLIATLINLAVENIAGYKLLAVGHFLTQERYVTGLMVLAGA  136

Query  572  NFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            N  LT+ ASVLCV  APTAAGPGIPEIKA
Sbjct  137  NLGLTLVASVLCVCFAPTAAGPGIPEIKA  165



>emb|CDX99630.1| BnaC04g33870D [Brassica napus]
Length=776

 Score =   186 bits (471),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = +2

Query  206  GQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSK  385
            G+ + DPE+N++++PLLKR+RTLSSTP+A++G KVS IESLDYEINENDLFKHDWRSRSK
Sbjct  16   GEEEADPENNTMNQPLLKRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRSRSK  75

Query  386  SHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFV  565
            + V QY+F KWTLA L+GLLTGLIATLINLA+ENIAGYKLLAV  YI  +RYL G   F 
Sbjct  76   AQVFQYIFAKWTLACLVGLLTGLIATLINLAVENIAGYKLLAVGYYIAQDRYLTGLLIFT  135

Query  566  GTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            G N  LT+ A++L V  APTAAGPGIPEIKA
Sbjct  136  GANLGLTLVATILVVVFAPTAAGPGIPEIKA  166



>gb|KFK33054.1| hypothetical protein AALP_AA6G324100 [Arabis alpina]
Length=776

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 125/151 (83%), Gaps = 0/151 (0%)
 Frame = +2

Query  206  GQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSK  385
            G+ + DPESN L+ PLLKR+RTLSSTP+A++G KVS IESLDYEINENDLFKHDWRSRSK
Sbjct  16   GEEEGDPESNILNTPLLKRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRSRSK  75

Query  386  SHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFV  565
            + V QY+F KWTLA L+GL TGLIATLINLA+ENIAGYKLLAV  YI  +R++ G   F 
Sbjct  76   TQVFQYIFAKWTLACLVGLFTGLIATLINLAVENIAGYKLLAVGYYIGQDRFMTGLLVFT  135

Query  566  GTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            G N  LT+ A++L V+ APTAAGPGIPEIKA
Sbjct  136  GANLGLTLVATILVVYFAPTAAGPGIPEIKA  166



>ref|XP_006338691.1| PREDICTED: chloride channel protein CLC-a-like [Solanum tuberosum]
Length=774

 Score =   183 bits (464),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 126/154 (82%), Gaps = 1/154 (1%)
 Frame = +2

Query  197  EMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRS  376
            E+EGQ +++ E  S     L RNRTLSST VA++GAKVS IESLDYEINENDLFKHDWR 
Sbjct  17   ELEGQHNNEEERESTESNYL-RNRTLSSTSVAIVGAKVSHIESLDYEINENDLFKHDWRK  75

Query  377  RSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFA  556
            RS+   LQYVF+KWTLAFL+GL TG +ATLI+L+IENI+GYKL A +NYID+ RY MGFA
Sbjct  76   RSRLQTLQYVFIKWTLAFLVGLFTGGVATLISLSIENISGYKLRATVNYIDDKRYFMGFA  135

Query  557  YFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            +F G NFLLT+ A+ + V+ APTAAGPG+PEIKA
Sbjct  136  FFAGANFLLTLVAAFITVYFAPTAAGPGVPEIKA  169



>ref|XP_009129444.1| PREDICTED: chloride channel protein CLC-b-like [Brassica rapa]
Length=783

 Score =   183 bits (464),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 123/152 (81%), Gaps = 0/152 (0%)
 Frame = +2

Query  203  EGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRS  382
            E +   D ESN+L++PL+K NR LSSTP+A++G KVS IESLDYEINENDLFKHDWR RS
Sbjct  17   EEREQGDAESNTLNQPLVKANRKLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRKRS  76

Query  383  KSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYF  562
            K+ VLQY+FLKWT A L+GL TGLIATLINLA+ENIAGYKLLAV +++   RY+ G   F
Sbjct  77   KTQVLQYIFLKWTFACLVGLFTGLIATLINLAVENIAGYKLLAVGHFLAQERYVTGLMMF  136

Query  563  VGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             G N  LT+ ASVLCV  APTAAGPGIPEIKA
Sbjct  137  AGANLGLTLIASVLCVCFAPTAAGPGIPEIKA  168



>emb|CDY34173.1| BnaA02g28670D [Brassica napus]
Length=780

 Score =   182 bits (463),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 123/152 (81%), Gaps = 0/152 (0%)
 Frame = +2

Query  203  EGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRS  382
            E +   D ESN+L++PL+K NR LSSTP+A++G KVS IESLDYEINENDLFKHDWR RS
Sbjct  17   EEREQGDAESNTLNQPLVKANRKLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRKRS  76

Query  383  KSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYF  562
            K+ VLQY+FLKWT A L+GL TGLIATLINLA+ENIAGYKLLAV +++   RY+ G   F
Sbjct  77   KTQVLQYIFLKWTFACLVGLFTGLIATLINLAVENIAGYKLLAVGHFLAQERYVTGLMMF  136

Query  563  VGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             G N  LT+ ASVLCV  APTAAGPGIPEIKA
Sbjct  137  AGANLGLTLIASVLCVCFAPTAAGPGIPEIKA  168



>emb|CDY28488.1| BnaC02g36720D [Brassica napus]
Length=783

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 123/152 (81%), Gaps = 0/152 (0%)
 Frame = +2

Query  203  EGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRS  382
            E +   D ESN+L++PL+K NR LSSTP+A++G KVS IESLDYEINENDLFKHDWR RS
Sbjct  17   EEREQGDAESNTLNQPLVKANRKLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRKRS  76

Query  383  KSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYF  562
            K+ VLQY+FLKWT A L+GL TGLIATLINLA+ENIAGYKLLAV +++   RY+ G   F
Sbjct  77   KTQVLQYIFLKWTFACLVGLFTGLIATLINLAVENIAGYKLLAVGHFLAQERYVTGLMMF  136

Query  563  VGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             G N  LT+ ASVLCV  APTAAGPGIPEIKA
Sbjct  137  AGANLGLTLIASVLCVCFAPTAAGPGIPEIKA  168



>ref|XP_008788897.1| PREDICTED: chloride channel protein CLC-b-like [Phoenix dactylifera]
Length=785

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 128/162 (79%), Gaps = 1/162 (1%)
 Frame = +2

Query  176  AGAGSTNEMEGQADD-DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINEND  352
            A A +  E++ + D+ DPE NSLH+PLLKR  TL++  +AM+GAKVS IESLDYEINEND
Sbjct  13   AAAEANLEVDREEDEHDPERNSLHQPLLKRTATLTTNHLAMVGAKVSHIESLDYEINEND  72

Query  353  LFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDN  532
            +FKHDW SRS   VLQYVFLKW  AFL+GLLTG+IA+LINLAIENIAG K+L +   ++ 
Sbjct  73   IFKHDWTSRSSVQVLQYVFLKWMSAFLVGLLTGVIASLINLAIENIAGIKMLLMARLVNE  132

Query  533  NRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            +RY+ GF YF G NF LTM A+ LCV  APTAAGPGIPEIKA
Sbjct  133  SRYINGFVYFAGANFALTMVAATLCVVFAPTAAGPGIPEIKA  174



>ref|XP_008806046.1| PREDICTED: chloride channel protein CLC-a-like [Phoenix dactylifera]
Length=792

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 129/162 (80%), Gaps = 8/162 (5%)
 Frame = +2

Query  197  EMEGQADD-DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWR  373
            E++G+ D+ DPESNSLH+PLL R  TL++  +AM+GAKVS IESLDYEINENDLFKHDWR
Sbjct  19   EVDGEEDEQDPESNSLHQPLLGRTPTLTTNHLAMVGAKVSHIESLDYEINENDLFKHDWR  78

Query  374  SRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNN------  535
            SRS   VLQYVFLKWTL FL+GLLTG+IA+LINLAIENIAG+K+L V   ++        
Sbjct  79   SRSSVQVLQYVFLKWTLVFLVGLLTGVIASLINLAIENIAGFKMLLVGRLVNEKSLFGWW  138

Query  536  -RYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             RYL GFAYF G NF LT+ ++ LCV  APTAAGPGIPEIKA
Sbjct  139  CRYLTGFAYFTGANFALTIVSATLCVVFAPTAAGPGIPEIKA  180



>ref|XP_006285462.1| hypothetical protein CARUB_v10006880mg [Capsella rubella]
 gb|EOA18360.1| hypothetical protein CARUB_v10006880mg [Capsella rubella]
Length=777

 Score =   180 bits (457),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 126/151 (83%), Gaps = 1/151 (1%)
 Frame = +2

Query  209  QADDDPESN-SLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSK  385
            + + DPE+N +L++PLLKR+RTLSSTP+A++GAKVS IESLDYEINENDLFKHDWRSRSK
Sbjct  19   EEEADPENNMALNQPLLKRHRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRSRSK  78

Query  386  SHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFV  565
            + V QY+FLKWTLA L+GL TGLIATLINLA+ENIAGYKLLAV  YI  +R+  G   F 
Sbjct  79   TQVFQYIFLKWTLACLVGLFTGLIATLINLAVENIAGYKLLAVGYYIAQDRFWTGLMVFT  138

Query  566  GTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            G N  LT+ A+VL V  APTAAGPGIPEIKA
Sbjct  139  GANLGLTLVATVLVVCFAPTAAGPGIPEIKA  169



>ref|XP_009392485.1| PREDICTED: chloride channel protein CLC-a-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009392486.1| PREDICTED: chloride channel protein CLC-a-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009392487.1| PREDICTED: chloride channel protein CLC-a-like [Musa acuminata 
subsp. malaccensis]
Length=798

 Score =   180 bits (457),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 123/151 (81%), Gaps = 0/151 (0%)
 Frame = +2

Query  206  GQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSK  385
            G+ + DPESNSL +PLLKR+ TL+S+  AM+GAKVS IESLDYEINENDLFKHDWRSRS 
Sbjct  20   GEGELDPESNSLQQPLLKRSPTLTSSHYAMVGAKVSHIESLDYEINENDLFKHDWRSRSS  79

Query  386  SHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFV  565
            + VLQY+FLKWTLAFL+GLLTG+ A+LINLAIENIAG K+L +  ++ + RY+ GF Y  
Sbjct  80   TEVLQYIFLKWTLAFLVGLLTGVTASLINLAIENIAGIKMLYLARFVKDQRYITGFVYLA  139

Query  566  GTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            G N  LT  A+ LCV  APTAAGPGIPEIKA
Sbjct  140  GVNLALTTVAASLCVVFAPTAAGPGIPEIKA  170



>ref|XP_010248967.1| PREDICTED: chloride channel protein CLC-b [Nelumbo nucifera]
Length=781

 Score =   180 bits (457),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 128/156 (82%), Gaps = 3/156 (2%)
 Frame = +2

Query  200  MEGQADD---DPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDW  370
            M G+A+    + ESN LH+ LLKR+ TL S P+AM+GAKV+ +ESLDYEINENDLFKHDW
Sbjct  1    MGGRAEGGEREVESNYLHQTLLKRSPTLPSNPLAMVGAKVTHMESLDYEINENDLFKHDW  60

Query  371  RSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMG  550
            RSRS+  VLQY+FLKWTLAFL+GLLTG++AT INLA+ENI+G+K+LAV + +   RY++G
Sbjct  61   RSRSRIQVLQYIFLKWTLAFLVGLLTGIVATFINLAVENISGFKILAVTDLVTKRRYVLG  120

Query  551  FAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            F YF G N  LTM A++LCV  APTAAGPGIPEIKA
Sbjct  121  FLYFTGANLALTMVAAILCVCFAPTAAGPGIPEIKA  156



>gb|KEH22046.1| ClC chloride channel family protein [Medicago truncatula]
Length=796

 Score =   178 bits (452),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 126/147 (86%), Gaps = 1/147 (1%)
 Frame = +2

Query  221  DPESNS-LHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVL  397
            DPESN+ L++ L+KR+RTLSS+P+A++G KVS IESLDYE NENDLFK  WRSRS+  VL
Sbjct  33   DPESNNPLNQRLIKRSRTLSSSPLALVGEKVSYIESLDYETNENDLFKDGWRSRSRIEVL  92

Query  398  QYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNF  577
            QY+F+KW LAFL+GLLTG+IATLINLA+ENIAGYK LAVL +I+  RYL GF YF+G NF
Sbjct  93   QYIFMKWVLAFLVGLLTGIIATLINLAVENIAGYKFLAVLKFINRERYLEGFLYFMGINF  152

Query  578  LLTMSASVLCVFXAPTAAGPGIPEIKA  658
            +LT  A++LCV  APTAAGPGIPEIKA
Sbjct  153  VLTFVAAILCVCFAPTAAGPGIPEIKA  179



>ref|XP_002868624.1| ATCLC-A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44883.1| ATCLC-A [Arabidopsis lyrata subsp. lyrata]
Length=776

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +2

Query  236  SLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFLK  415
            +L++PLLKR+RTLSSTP+A++GAKVS IESLDYEINENDLFKHDWRSRSK+ V QY+FLK
Sbjct  28   TLNQPLLKRHRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRSRSKTQVFQYIFLK  87

Query  416  WtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFLLTMSA  595
            WTLA L+GL TGLIATLINLA+ENIAGYKLLAV  YI  +R+  G   F G N  LT+ A
Sbjct  88   WTLACLVGLFTGLIATLINLAVENIAGYKLLAVGYYIGQDRFWTGLMIFTGANLGLTLVA  147

Query  596  SVLCVFXAPTAAGPGIPEIKA  658
            +VL V+ APTAAGPGIPEIKA
Sbjct  148  TVLVVYFAPTAAGPGIPEIKA  168



>dbj|BAJ33828.1| unnamed protein product [Thellungiella halophila]
Length=363

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = +2

Query  206  GQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSK  385
            G+ + DPE+N++++PLLKR+RTLSSTP+A++G KVS IESLDYEINENDLFKHDWRSRSK
Sbjct  16   GEEEADPENNTMNQPLLKRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRSRSK  75

Query  386  SHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFV  565
            + V QY+F KWTLA L+GLLTGLIATLINLA+ENIAGYKLLAV  YI  +RY+ G   F 
Sbjct  76   AQVYQYIFAKWTLACLVGLLTGLIATLINLAVENIAGYKLLAVGYYIGQDRYVTGLLIFT  135

Query  566  GTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            G N  LT+ A+VL V  APTAAGPGIPEIKA
Sbjct  136  GANLGLTLVATVLVVVFAPTAAGPGIPEIKA  166



>ref|XP_004231786.1| PREDICTED: chloride channel protein CLC-a-like [Solanum lycopersicum]
Length=763

 Score =   175 bits (443),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 126/160 (79%), Gaps = 7/160 (4%)
 Frame = +2

Query  179  GAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLF  358
            G  + N+ME    ++ ES  ++     RNRTLSST VA+ GAKVS IESLDYEINENDLF
Sbjct  6    GFATINDME----EERESTDINY---SRNRTLSSTSVALEGAKVSHIESLDYEINENDLF  58

Query  359  KHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNR  538
            KHDWR RS+   LQYVF+KWTLAFL+GL TG +ATLI+L+IENI+GYKL A +NYID+ R
Sbjct  59   KHDWRKRSRVQTLQYVFIKWTLAFLVGLFTGGVATLISLSIENISGYKLRATVNYIDDKR  118

Query  539  YLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            Y MGFA+F G NFLLT+ A+ + V+ APTAAGPG+PEIKA
Sbjct  119  YFMGFAFFAGANFLLTLLAAFITVYFAPTAAGPGVPEIKA  158



>emb|CDY11722.1| BnaC06g13300D [Brassica napus]
Length=770

 Score =   174 bits (442),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = +2

Query  188  STNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHD  367
            S +   G+ + DPE+N++++PLLKR+RTLSSTP+A++G KVS IESLDYEINENDLFKHD
Sbjct  10   SNSNYNGEEEADPENNTMNQPLLKRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHD  69

Query  368  WRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLM  547
            WRSRSK+ VLQY+F KWTLAFL+GLLTGLIATLINLA+ENIAGYKLLAV +YI  +RY+ 
Sbjct  70   WRSRSKTQVLQYIFAKWTLAFLVGLLTGLIATLINLAVENIAGYKLLAVGHYIGQDRYVT  129

Query  548  GFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            G   F G N  LT+  +VL V  APTAAGPGIPEIKA
Sbjct  130  GLLVFTGANLGLTLVGTVLVVVFAPTAAGPGIPEIKA  166



>emb|CDX67478.1| BnaA07g15180D [Brassica napus]
Length=770

 Score =   174 bits (441),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = +2

Query  188  STNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHD  367
            S +   G+ + DPE+N++++PLLKR+RTLSSTP+A++G KVS IESLDYEINENDLFKHD
Sbjct  10   SNSNYNGEEEADPENNTMNQPLLKRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHD  69

Query  368  WRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLM  547
            WRSRSK+ VLQY+F KWTLAFL+GLLTGLIATLINLA+ENIAGYKLLAV +YI  +RY+ 
Sbjct  70   WRSRSKAQVLQYIFAKWTLAFLVGLLTGLIATLINLAVENIAGYKLLAVGHYISQDRYVT  129

Query  548  GFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            G   F G N  LT+ A+VL V  APTAAGPGIPEIKA
Sbjct  130  GLLVFTGANLGLTLVATVLVVVFAPTAAGPGIPEIKA  166



>ref|XP_009125164.1| PREDICTED: chloride channel protein CLC-a-like [Brassica rapa]
Length=770

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = +2

Query  188  STNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHD  367
            S +   G+ + DPE+N++++PLLKR+RTLSSTP+A++G KVS IESLDYEINENDLFKHD
Sbjct  10   SNSNYNGEEEADPENNTMNQPLLKRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHD  69

Query  368  WRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLM  547
            WRSRSK+ VLQY+F KWTLAFL+GLLTGLIATLINLA+ENIAGYKLLAV +YI  +RY+ 
Sbjct  70   WRSRSKAQVLQYIFAKWTLAFLVGLLTGLIATLINLAVENIAGYKLLAVGHYISQDRYVT  129

Query  548  GFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            G   F G N  LT+ A+VL V  APTAAGPGIPEIKA
Sbjct  130  GLLVFTGANLGLTLVATVLVVVFAPTAAGPGIPEIKA  166



>ref|XP_010528167.1| PREDICTED: chloride channel protein CLC-b-like [Tarenaya hassleriana]
Length=781

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 127/158 (80%), Gaps = 3/158 (2%)
 Frame = +2

Query  194  NEMEGQADD-DPESNSL-HRPLLKRN-RTLSSTPVAMIGAKVSPIESLDYEINENDLFKH  364
            N+  G+ ++ DPE+N++  +PLLKR+ RTLSSTP+A++GA VS IESLDYEINENDLFKH
Sbjct  10   NKEHGEGEEADPENNAVNQQPLLKRHTRTLSSTPLALVGANVSKIESLDYEINENDLFKH  69

Query  365  DWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYL  544
            DWRSR K+ V+QY+FLKW LA L+GLLTGLIATLINLA ENI G+KLLAV ++I   RY+
Sbjct  70   DWRSRKKTQVIQYIFLKWALACLVGLLTGLIATLINLAGENITGFKLLAVAHFISQKRYV  129

Query  545  MGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             G   F G N  LT+ A+VLCV  APTAAGP IPEIKA
Sbjct  130  AGLIIFTGANLGLTLVAAVLCVCFAPTAAGPTIPEIKA  167



>dbj|BAJ96369.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=787

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 126/160 (79%), Gaps = 2/160 (1%)
 Frame = +2

Query  179  GAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLF  358
            G GS+ E  G A D    +SL +PLLKR+ TL+S+ +AM+GAKVS IESLDYEI ENDLF
Sbjct  23   GVGSSPEDPGSAGDG--ISSLEKPLLKRSNTLTSSHLAMVGAKVSHIESLDYEIIENDLF  80

Query  359  KHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNR  538
            KHDWRSRS   VLQY+FLKW+LAFL+GLLTG+IA+LINLAIENI+G K+L ++  +   R
Sbjct  81   KHDWRSRSNVEVLQYIFLKWSLAFLVGLLTGVIASLINLAIENISGLKMLHMVQLVREKR  140

Query  539  YLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            Y  GF YF G NF+LT  A+VLCV  APTAAGPGIPEIKA
Sbjct  141  YWAGFFYFSGINFVLTFIAAVLCVVFAPTAAGPGIPEIKA  180



>dbj|BAJ88201.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=787

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 126/160 (79%), Gaps = 2/160 (1%)
 Frame = +2

Query  179  GAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLF  358
            G GS+ E  G A D    +SL +PLLKR+ TL+S+ +AM+GAKVS IESLDYEI ENDLF
Sbjct  23   GVGSSPEDPGSAGDG--ISSLEKPLLKRSNTLTSSHLAMVGAKVSHIESLDYEIIENDLF  80

Query  359  KHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNR  538
            KHDWRSRS   VLQY+FLKW+LAFL+GLLTG+IA+LINLAIENI+G K+L ++  +   R
Sbjct  81   KHDWRSRSNVEVLQYIFLKWSLAFLVGLLTGVIASLINLAIENISGLKMLHMVQLVREKR  140

Query  539  YLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            Y  GF YF G NF+LT  A+VLCV  APTAAGPGIPEIKA
Sbjct  141  YWAGFFYFSGINFVLTFIAAVLCVVFAPTAAGPGIPEIKA  180



>dbj|BAJ92499.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=787

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 126/160 (79%), Gaps = 2/160 (1%)
 Frame = +2

Query  179  GAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLF  358
            G GS+ E  G A D    +SL +PLLKR+ TL+S+ +AM+GAKVS IESLDYEI ENDLF
Sbjct  23   GVGSSPEDPGSAGDG--ISSLEKPLLKRSNTLTSSHLAMVGAKVSHIESLDYEIIENDLF  80

Query  359  KHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNR  538
            KHDWRSRS   VLQY+FLKW+LAFL+GLLTG+IA+LINLAIENI+G K+L ++  +   R
Sbjct  81   KHDWRSRSNVEVLQYIFLKWSLAFLVGLLTGVIASLINLAIENISGLKMLHMVQLVREKR  140

Query  539  YLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            Y  GF YF G NF+LT  A+VLCV  APTAAGPGIPEIKA
Sbjct  141  YWAGFFYFSGINFVLTFIAAVLCVVFAPTAAGPGIPEIKA  180



>ref|XP_006405416.1| hypothetical protein EUTSA_v10027650mg [Eutrema salsugineum]
 gb|ESQ46869.1| hypothetical protein EUTSA_v10027650mg [Eutrema salsugineum]
Length=776

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = +2

Query  206  GQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSK  385
            G+ + DPE+N++++PLLKR+RTLSSTP+A++G KVS IESLDYEINENDLFKHDWRSRSK
Sbjct  16   GEEEADPENNTMNQPLLKRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRSRSK  75

Query  386  SHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFV  565
            + V QY+F KWTLA L+GLLTGLIATLINLA+ENIAGYKLLAV  YI  +RY+ G   F 
Sbjct  76   AQVYQYIFAKWTLACLVGLLTGLIATLINLAVENIAGYKLLAVGYYIGQDRYVTGLLIFT  135

Query  566  GTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            G N  LT+ A+VL V  APTAAGPGIPEIKA
Sbjct  136  GANLGLTLVATVLVVVFAPTAAGPGIPEIKA  166



>ref|XP_010450591.1| PREDICTED: chloride channel protein CLC-a [Camelina sativa]
Length=775

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = +2

Query  209  QADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKS  388
            + + DPE+N+L++PLLKR+RTLSSTP+A++GAKVS IESLDYEINENDLFKHDWRSRSK+
Sbjct  18   EEEVDPENNTLNQPLLKRHRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRSRSKA  77

Query  389  HVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVG  568
             V QY+FLKWTLA L+GL TGLIATLINLA+ENIAGYKLLAV  YI  +R+  G   F G
Sbjct  78   QVFQYIFLKWTLACLVGLFTGLIATLINLAVENIAGYKLLAVGYYIAQDRFWTGLMVFTG  137

Query  569  TNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             N  LT+ A+VL V  APTAAGPGIPEIKA
Sbjct  138  ANLGLTLVATVLVVVFAPTAAGPGIPEIKA  167



>ref|XP_010441254.1| PREDICTED: chloride channel protein CLC-a [Camelina sativa]
Length=775

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = +2

Query  209  QADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKS  388
            + + DPE+N+L++PLLKR+RTLSSTP+A++GAKVS IESLDYEINENDLFKHDWRSRSK+
Sbjct  18   EEEVDPENNTLNQPLLKRHRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRSRSKA  77

Query  389  HVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVG  568
             V QY+FLKWTLA L+GL TGLIATLINLA+ENIAGYKLLAV  YI  +R+  G   F G
Sbjct  78   QVFQYIFLKWTLACLVGLFTGLIATLINLAVENIAGYKLLAVGYYIAQDRFWTGLMVFTG  137

Query  569  TNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             N  LT+ A+VL V  APTAAGPGIPEIKA
Sbjct  138  ANLGLTLVATVLVVVFAPTAAGPGIPEIKA  167



>gb|ADD09860.1| chloride channel A [Eutrema halophilum]
Length=776

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = +2

Query  206  GQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSK  385
            G+ + DPE+N++++PLLKR+RTLSSTP+A++G KVS IESLDYEINENDLFKHDWRSRSK
Sbjct  16   GEEEADPENNTMNQPLLKRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRSRSK  75

Query  386  SHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFV  565
            + V QY+F KWTLA L+GLLTGLIATLINLA+ENIAGYKLLAV  YI  +RY+ G   F 
Sbjct  76   AQVYQYIFAKWTLACLVGLLTGLIATLINLAVENIAGYKLLAVGYYIGQDRYVTGLLIFT  135

Query  566  GTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            G N  LT+ A+VL V  APTAAGPGIPEIKA
Sbjct  136  GANLGLTLVATVLVVVFAPTAAGPGIPEIKA  166



>ref|XP_010436030.1| PREDICTED: chloride channel protein CLC-a-like [Camelina sativa]
Length=775

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = +2

Query  209  QADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKS  388
            + + DPE+N+L++PLLKR+RTLSSTP+A++GAKVS IESLDYEINENDLFKHDWRSRSK+
Sbjct  18   EEEVDPENNTLNQPLLKRHRTLSSTPLALVGAKVSHIESLDYEINENDLFKHDWRSRSKA  77

Query  389  HVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVG  568
             V QY+FLKWTLA L+GL TGLIATLINLA+ENIAGYKLLAV  YI  +R+  G   F G
Sbjct  78   QVFQYIFLKWTLACLVGLFTGLIATLINLAVENIAGYKLLAVGYYIAQDRFWTGLMVFTG  137

Query  569  TNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             N  LT+ A+VL V  APTAAGPGIPEIKA
Sbjct  138  ANLGLTLVATVLVVVFAPTAAGPGIPEIKA  167



>emb|CDY15925.1| BnaA04g11860D [Brassica napus]
Length=776

 Score =   170 bits (430),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = +2

Query  209  QADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKS  388
            + + DPE+N++++PLLKR+RTLSSTP+A++G KVS IESLDYEINENDLFKHDWRSRSK+
Sbjct  17   EEEADPENNTMNQPLLKRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRSRSKA  76

Query  389  HVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVG  568
             V QY+F KWTLA L+GLLTGLIATLINLA+ENIAGYKLLAV  YI  +RYL G   F G
Sbjct  77   QVFQYIFAKWTLACLVGLLTGLIATLINLAVENIAGYKLLAVGYYIAQDRYLTGLLIFTG  136

Query  569  TNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             N  LT+ A+VL V  APTAAGPGIPEIKA
Sbjct  137  ANLGLTLVATVLVVVFAPTAAGPGIPEIKA  166



>gb|AFW87644.1| hypothetical protein ZEAMMB73_318834, partial [Zea mays]
Length=252

 Score =   162 bits (410),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 115/140 (82%), Gaps = 0/140 (0%)
 Frame = +2

Query  239  LHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFLKW  418
            L +PLLKR+ TL+++ +A++GAKVS IESLDYEI ENDLFKHDWRSRS   VLQY+FLKW
Sbjct  55   LEQPLLKRSTTLTASHLAIVGAKVSHIESLDYEIIENDLFKHDWRSRSNVEVLQYIFLKW  114

Query  419  tlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFLLTMSAS  598
             +AFL+GLLTG+IA+LINLAIENI+G K+L ++N +   RY  GF YF G NF LT  A+
Sbjct  115  AMAFLVGLLTGVIASLINLAIENISGLKMLQMVNLVRGKRYWAGFLYFAGVNFALTFVAA  174

Query  599  VLCVFXAPTAAGPGIPEIKA  658
            VLCV  APTAAGPGIPEIKA
Sbjct  175  VLCVVFAPTAAGPGIPEIKA  194



>ref|XP_009140242.1| PREDICTED: chloride channel protein CLC-a [Brassica rapa]
Length=776

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = +2

Query  209  QADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKS  388
            + + DPE+N++++PLLKR+RTLSSTP+A++G KVS IESLDYEINENDLFKHDWRSRSK+
Sbjct  17   EEEADPENNTMNQPLLKRHRTLSSTPLALVGTKVSHIESLDYEINENDLFKHDWRSRSKA  76

Query  389  HVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVG  568
             V QY+F KWTLA L+GLLTGLIATLINLA+ENIAGYKLLAV  YI  +RYL G   F G
Sbjct  77   QVFQYIFAKWTLACLVGLLTGLIATLINLAVENIAGYKLLAVGYYIAQDRYLTGLLIFTG  136

Query  569  TNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             N  LT+ A+VL V  APTAAGPGIPEIKA
Sbjct  137  ANLGLTLVATVLVVVFAPTAAGPGIPEIKA  166



>gb|EMT23598.1| hypothetical protein F775_52599 [Aegilops tauschii]
Length=664

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 127/160 (79%), Gaps = 2/160 (1%)
 Frame = +2

Query  179  GAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLF  358
            G  +++E  G A D    +SL +PLLKR+ TL+S+ +AM+GAKVS IESLDYEI ENDLF
Sbjct  23   GVSNSSEDPGSAGDG--ISSLEKPLLKRSNTLTSSHLAMVGAKVSHIESLDYEIIENDLF  80

Query  359  KHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNR  538
            KHDWRSRS   VLQY+FLKW+LAFL+GLLTG+IA+LINLAIENI+G K+L +++ +   R
Sbjct  81   KHDWRSRSNVEVLQYIFLKWSLAFLVGLLTGVIASLINLAIENISGLKMLHMVHLVREKR  140

Query  539  YLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            Y  GF YF G NF+LT  A+VLCV  APTAAGPGIPEIKA
Sbjct  141  YWAGFFYFSGFNFVLTFIAAVLCVVFAPTAAGPGIPEIKA  180



>ref|XP_006664534.1| PREDICTED: chloride channel protein CLC-a-like [Oryza brachyantha]
Length=784

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 122/154 (79%), Gaps = 5/154 (3%)
 Frame = +2

Query  212  ADDDPESN-----SLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRS  376
             ++DPES      SL +PLLKR+ TL+++ +AM+GAKVS IESLDYEI ENDLFKHDWRS
Sbjct  26   CEEDPESTGGPITSLEQPLLKRSNTLTASHLAMVGAKVSRIESLDYEIIENDLFKHDWRS  85

Query  377  RSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFA  556
            RS   VLQY+FLKW +AFLIGLLTG+IA+LINLAIENI+G K+L ++  + + RY  GF 
Sbjct  86   RSNVEVLQYIFLKWAMAFLIGLLTGVIASLINLAIENISGLKMLHMVQLVRDKRYWAGFL  145

Query  557  YFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            YF G NF LT  A+VLCV  APTAAGPGIPEIKA
Sbjct  146  YFAGINFGLTFVAAVLCVVFAPTAAGPGIPEIKA  179



>ref|XP_010929772.1| PREDICTED: chloride channel protein CLC-b-like [Elaeis guineensis]
Length=795

 Score =   167 bits (423),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 125/167 (75%), Gaps = 6/167 (4%)
 Frame = +2

Query  176  AGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDL  355
            AGA        + +DDPES SLH+PLLKR  TL++  +AM+GAKVS IESLDYEINENDL
Sbjct  13   AGAADLEVDREEEEDDPESISLHQPLLKRTPTLTTNHLAMVGAKVSHIESLDYEINENDL  72

Query  356  FKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNY----  523
            FKHDWRSRS   VLQYVFLKW LAFL+GLLTG IA+LINLAIENIAG K+L V  +    
Sbjct  73   FKHDWRSRSSVQVLQYVFLKWMLAFLVGLLTGAIASLINLAIENIAGIKMLLVGQFCKPE  132

Query  524  --IDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
              I   RY+ GF YF G NF LTM A+ LCV  APTAAGPGIPEIKA
Sbjct  133  IGIVWCRYINGFIYFTGANFALTMVAATLCVMFAPTAAGPGIPEIKA  179



>ref|XP_003576525.1| PREDICTED: chloride channel protein CLC-a-like [Brachypodium 
distachyon]
Length=790

 Score =   164 bits (416),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 125/172 (73%), Gaps = 15/172 (9%)
 Frame = +2

Query  188  STNEMEGQADD-------DPESN--------SLHRPLLKRNRTLSSTPVAMIGAKVSPIE  322
            S    +G+ DD       DPE+         SL +PLLKR+ TL+++ +AM+GAKVS IE
Sbjct  19   SPGAQQGKHDDGVNNDNEDPENQESGNGGIRSLEQPLLKRSNTLTASHLAMVGAKVSHIE  78

Query  323  SLDYEINENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYK  502
            SLDYEI ENDLFKHDWR RS   VLQY+FLKW LAFL+GLLTG+IA+LINLAIENI+G K
Sbjct  79   SLDYEIIENDLFKHDWRRRSNGEVLQYIFLKWALAFLVGLLTGVIASLINLAIENISGLK  138

Query  503  LLAVLNYIDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            +L ++  + + RY  GF YF G NF LT  A+VLCV  APTAAGPGIPEIKA
Sbjct  139  MLHMVQLVRDKRYWAGFLYFSGINFALTFVAAVLCVVFAPTAAGPGIPEIKA  190



>ref|XP_004962545.1| PREDICTED: chloride channel protein CLC-a-like isoform X2 [Setaria 
italica]
Length=794

 Score =   164 bits (415),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 125/170 (74%), Gaps = 12/170 (7%)
 Frame = +2

Query  185  GSTNEMEGQADD------DPES------NSLHRPLLKRNRTLSSTPVAMIGAKVSPIESL  328
            G   E+E + +D      DPES      +SL +PLLKR+ TL+++ +A++GAKVS IESL
Sbjct  18   GPAPELECKNEDGVEDLEDPESTAGNGISSLEQPLLKRSPTLTASHLAIVGAKVSHIESL  77

Query  329  DYEINENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLL  508
            DYEI ENDLFKHDWRSRS   VLQY+FLKW +AFL+GLLTG+IA+LINLAIENI G K+L
Sbjct  78   DYEIIENDLFKHDWRSRSNVEVLQYIFLKWAMAFLVGLLTGVIASLINLAIENITGLKML  137

Query  509  AVLNYIDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             ++  +   RY  GF YF G N  LT  A+VLCV  APTAAGPGIPEIKA
Sbjct  138  HMVGLVREGRYWAGFLYFAGVNLALTFVAAVLCVVFAPTAAGPGIPEIKA  187



>ref|XP_002438781.1| hypothetical protein SORBIDRAFT_10g026090 [Sorghum bicolor]
 gb|EER90148.1| hypothetical protein SORBIDRAFT_10g026090 [Sorghum bicolor]
Length=801

 Score =   164 bits (414),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 128/175 (73%), Gaps = 10/175 (6%)
 Frame = +2

Query  164  SMEFAGAGSTNEMEGQADDDPES----------NSLHRPLLKRNRTLSSTPVAMIGAKVS  313
            S+E+      N+   +  +DPES          +SL +PLLKR+ TL+++ +A++GAKVS
Sbjct  20   SLEWPEPECKNDDGVKDPEDPESTGGGGDGNGISSLEQPLLKRSTTLTASHLAIVGAKVS  79

Query  314  PIESLDYEINENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIA  493
             IESLDYEI ENDLFKHDWRSRS   VLQY+FLKW +AFL+GLLTG+IA+LINLAIENI+
Sbjct  80   HIESLDYEIIENDLFKHDWRSRSNVEVLQYIFLKWAMAFLVGLLTGVIASLINLAIENIS  139

Query  494  GYKLLAVLNYIDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            G K+  ++N +   RY  GF YF G NF LT  A+VLCV  APTAAGPGIPEIKA
Sbjct  140  GLKMQHMVNLVREKRYWAGFLYFAGVNFALTFVAAVLCVVFAPTAAGPGIPEIKA  194



>ref|XP_004962544.1| PREDICTED: chloride channel protein CLC-a-like isoform X1 [Setaria 
italica]
Length=876

 Score =   164 bits (415),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 126/173 (73%), Gaps = 12/173 (7%)
 Frame = +2

Query  176  AGAGSTNEMEGQADD------DPES------NSLHRPLLKRNRTLSSTPVAMIGAKVSPI  319
            A  G   E+E + +D      DPES      +SL +PLLKR+ TL+++ +A++GAKVS I
Sbjct  15   AEPGPAPELECKNEDGVEDLEDPESTAGNGISSLEQPLLKRSPTLTASHLAIVGAKVSHI  74

Query  320  ESLDYEINENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGY  499
            ESLDYEI ENDLFKHDWRSRS   VLQY+FLKW +AFL+GLLTG+IA+LINLAIENI G 
Sbjct  75   ESLDYEIIENDLFKHDWRSRSNVEVLQYIFLKWAMAFLVGLLTGVIASLINLAIENITGL  134

Query  500  KLLAVLNYIDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            K+L ++  +   RY  GF YF G N  LT  A+VLCV  APTAAGPGIPEIKA
Sbjct  135  KMLHMVGLVREGRYWAGFLYFAGVNLALTFVAAVLCVVFAPTAAGPGIPEIKA  187



>ref|XP_008658999.1| PREDICTED: chloride channel protein isoform X1 [Zea mays]
 gb|AFW87643.1| chloride channel protein [Zea mays]
Length=801

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 115/140 (82%), Gaps = 0/140 (0%)
 Frame = +2

Query  239  LHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFLKW  418
            L +PLLKR+ TL+++ +A++GAKVS IESLDYEI ENDLFKHDWRSRS   VLQY+FLKW
Sbjct  55   LEQPLLKRSTTLTASHLAIVGAKVSHIESLDYEIIENDLFKHDWRSRSNVEVLQYIFLKW  114

Query  419  tlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFLLTMSAS  598
             +AFL+GLLTG+IA+LINLAIENI+G K+L ++N +   RY  GF YF G NF LT  A+
Sbjct  115  AMAFLVGLLTGVIASLINLAIENISGLKMLQMVNLVRGKRYWAGFLYFAGVNFALTFVAA  174

Query  599  VLCVFXAPTAAGPGIPEIKA  658
            VLCV  APTAAGPGIPEIKA
Sbjct  175  VLCVVFAPTAAGPGIPEIKA  194



>gb|EEE53145.1| hypothetical protein OsJ_35963 [Oryza sativa Japonica Group]
Length=716

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 120/158 (76%), Gaps = 0/158 (0%)
 Frame = +2

Query  185  GSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKH  364
            G T+  +     +   +SL +PLLKR+ TL+++ +AM+GAKVS IESLDYEI ENDLFKH
Sbjct  21   GVTDAEDPGCTGNAAMSSLEQPLLKRSNTLTASHLAMVGAKVSHIESLDYEIIENDLFKH  80

Query  365  DWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYL  544
            DWR RS   VLQY+FLKW +AFL+GLLTG+IA+LINLAIENI+G K+L ++  +   RY 
Sbjct  81   DWRRRSNVEVLQYIFLKWAMAFLVGLLTGVIASLINLAIENISGLKMLHMVQLVRKKRYW  140

Query  545  MGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             GF YF G NF LT  A++LCV  APTAAGPGIPEIKA
Sbjct  141  AGFLYFAGVNFGLTFIAAMLCVVFAPTAAGPGIPEIKA  178



>ref|NP_001183936.1| chloride channel protein [Zea mays]
 gb|ACV66338.1| chloride channel protein [Zea mays]
Length=792

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 115/140 (82%), Gaps = 0/140 (0%)
 Frame = +2

Query  239  LHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFLKW  418
            L +PLLKR+ TL+++ +A++GAKVS IESLDYEI ENDLFKHDWRSRS   VLQY+FLKW
Sbjct  55   LEQPLLKRSTTLTASHLAIVGAKVSHIESLDYEIIENDLFKHDWRSRSNVEVLQYIFLKW  114

Query  419  tlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFLLTMSAS  598
             +AFL+GLLTG+IA+LINLAIENI+G K+L ++N +   RY  GF YF G NF LT  A+
Sbjct  115  AMAFLVGLLTGVIASLINLAIENISGLKMLQMVNLVRGKRYWAGFLYFAGVNFALTFVAA  174

Query  599  VLCVFXAPTAAGPGIPEIKA  658
            VLCV  APTAAGPGIPEIKA
Sbjct  175  VLCVVFAPTAAGPGIPEIKA  194



>dbj|BAJ91019.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=782

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 124/167 (74%), Gaps = 6/167 (4%)
 Frame = +2

Query  176  AGAGSTNEMEGQAD-DDPES-----NSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYE  337
            AG G   + +   D +DP S     +SL +PLLKR+ TL++  +AM+GAKVS IESLDYE
Sbjct  9    AGPGPGRKHDDGVDSEDPVSTGNGISSLQQPLLKRSNTLTANHLAMVGAKVSHIESLDYE  68

Query  338  INENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVL  517
            I ENDLFKHDWRSRS   VLQYVFLKW LAFL+GLLTG+IA+LINLAIENI+G K+L ++
Sbjct  69   IIENDLFKHDWRSRSTVEVLQYVFLKWALAFLVGLLTGVIASLINLAIENISGIKMLHMV  128

Query  518  NYIDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
              +   RY  GF YF G N  LT  A+VLCV  APTAAGPGIPEIKA
Sbjct  129  QLVREKRYWAGFFYFSGFNLALTFVAAVLCVVFAPTAAGPGIPEIKA  175



>gb|EMT27070.1| Chloride channel protein CLC-b [Aegilops tauschii]
Length=537

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 120/160 (75%), Gaps = 2/160 (1%)
 Frame = +2

Query  179  GAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLF  358
            G     E  G A D    +SL +PLLK++ TL++  +AM+GAKVS IESLDYEI ENDLF
Sbjct  20   GVNDPEEGPGSAGDG--ISSLEQPLLKKSNTLTANHLAMVGAKVSHIESLDYEIIENDLF  77

Query  359  KHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNR  538
            KHDWRSRS   VLQYVFLKW LAFL+GLLTG+IA+LINLAIENI+G K+L ++  + + R
Sbjct  78   KHDWRSRSTVEVLQYVFLKWALAFLVGLLTGVIASLINLAIENISGIKMLHMVQLVRDKR  137

Query  539  YLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            Y  GF YF G N  LT  A+VLCV  APTAAGPGIPEIKA
Sbjct  138  YWAGFFYFSGFNLALTFVAAVLCVVFAPTAAGPGIPEIKA  177



>gb|KDO43323.1| hypothetical protein CISIN_1g0039661mg, partial [Citrus sinensis]
Length=134

 Score =   144 bits (362),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +2

Query  335  EINENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAV  514
             INENDLFKHDWRSRSK  VLQY+FLKW+LA L+GLLTGLIATLINLA+ENIAGYKLLAV
Sbjct  8    RINENDLFKHDWRSRSKVQVLQYIFLKWSLACLVGLLTGLIATLINLAVENIAGYKLLAV  67

Query  515  LNYIDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            +++I+ +RYL GF YF G NFLLT+ A+VLCV  APTAAGPGIPEIKA
Sbjct  68   VSFIEKDRYLQGFLYFTGVNFLLTLVAAVLCVCFAPTAAGPGIPEIKA  115



>ref|NP_001268053.1| uncharacterized protein LOC100245380 [Vitis vinifera]
 gb|ADK66979.1| chloride channel ClC1 [Vitis vinifera]
Length=771

 Score =   145 bits (365),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 110/159 (69%), Gaps = 1/159 (1%)
 Frame = +2

Query  185  GSTNEMEGQADDDPESNSLHR-PLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFK  361
            G   EMEG   D  + ++  R PLL R R  S++ +A++GA V PIESLDYEI EN+LFK
Sbjct  17   GDWREMEGNGSDFSDKDTAMREPLLVRKRLNSTSQIAIVGASVCPIESLDYEIVENELFK  76

Query  362  HDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRY  541
             DWRSR +  + QY+ LKWTLA LIGL TGL+    NLA+ENIAG+KLL   N +  ++Y
Sbjct  77   QDWRSRKRVQIFQYIVLKWTLALLIGLGTGLVGFFNNLAVENIAGFKLLLASNLMLKDKY  136

Query  542  LMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             + F  F G N +L ++A+VLC + AP+AAG GIPE+KA
Sbjct  137  GLAFVTFAGCNMVLAIAAAVLCAYIAPSAAGSGIPEVKA  175



>ref|XP_010657885.1| PREDICTED: uncharacterized protein LOC100245380 isoform X1 [Vitis 
vinifera]
Length=777

 Score =   144 bits (364),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 110/159 (69%), Gaps = 1/159 (1%)
 Frame = +2

Query  185  GSTNEMEGQADDDPESNSLHR-PLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFK  361
            G   EMEG   D  + ++  R PLL R R  S++ +A++GA V PIESLDYEI EN+LFK
Sbjct  17   GDWREMEGNGSDFSDKDTAMREPLLVRKRLNSTSQIAIVGASVCPIESLDYEIVENELFK  76

Query  362  HDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRY  541
             DWRSR +  + QY+ LKWTLA LIGL TGL+    NLA+ENIAG+KLL   N +  ++Y
Sbjct  77   QDWRSRKRVQIFQYIVLKWTLALLIGLGTGLVGFFNNLAVENIAGFKLLLASNLMLKDKY  136

Query  542  LMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             + F  F G N +L ++A+VLC + AP+AAG GIPE+KA
Sbjct  137  GLAFVTFAGCNMVLAIAAAVLCAYIAPSAAGSGIPEVKA  175



>ref|XP_010442463.1| PREDICTED: chloride channel protein CLC-c [Camelina sativa]
Length=777

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 107/164 (65%), Gaps = 2/164 (1%)
 Frame = +2

Query  167  MEFAGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINE  346
            +E  G G   ++ G  DD   S    +PLL RNR  +++ +A++GA   PIESLDYEI E
Sbjct  13   IEVEGHGFERKISGILDDG--SVGFRQPLLARNRKNTTSQIAIVGANSCPIESLDYEIFE  70

Query  347  NDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYI  526
            ND FK DWRSR K  +LQY FLKW LAFLIGL TG++  L NLA+ENIAG+KLL   N +
Sbjct  71   NDFFKQDWRSRKKIEILQYTFLKWALAFLIGLATGVVGFLNNLAVENIAGFKLLLTGNLM  130

Query  527  DNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
               +Y   F  F G N +L  +A+ LC F AP AAG GIPE+KA
Sbjct  131  LKEKYFQAFFAFAGCNLILATAAASLCAFIAPAAAGSGIPEVKA  174



>ref|NP_199800.1| chloride channel protein CLC-c [Arabidopsis thaliana]
 sp|Q96282.1|CLCC_ARATH RecName: Full=Chloride channel protein CLC-c; Short=AtCLC-c; 
AltName: Full=CBS domain-containing protein CBSCLC4 [Arabidopsis 
thaliana]
 emb|CAA70310.1| chloride channel [Arabidopsis thaliana]
 emb|CAA96059.1| CLC-c chloride channel protein [Arabidopsis thaliana]
 dbj|BAA97010.1| chloride channel [Arabidopsis thaliana]
 gb|AAM53312.1| chloride channel [Arabidopsis thaliana]
 gb|AAN65098.1| chloride channel [Arabidopsis thaliana]
 gb|AED95868.1| chloride channel protein CLC-c [Arabidopsis thaliana]
Length=779

 Score =   141 bits (355),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 104/158 (66%), Gaps = 2/158 (1%)
 Frame = +2

Query  185  GSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKH  364
            G   ++ G  DD   S    +PLL RNR  +++ +A++GA   PIESLDYEI END FK 
Sbjct  21   GFERKISGILDDG--SVGFRQPLLARNRKNTTSQIAIVGANTCPIESLDYEIFENDFFKQ  78

Query  365  DWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYL  544
            DWRSR K  +LQY FLKW LAFLIGL TGL+  L NL +ENIAG+KLL + N +   +Y 
Sbjct  79   DWRSRKKIEILQYTFLKWALAFLIGLATGLVGFLNNLGVENIAGFKLLLIGNLMLKEKYF  138

Query  545  MGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
              F  F G N +L  +A+ LC F AP AAG GIPE+KA
Sbjct  139  QAFFAFAGCNLILATAAASLCAFIAPAAAGSGIPEVKA  176



>ref|XP_010482284.1| PREDICTED: chloride channel protein CLC-c-like [Camelina sativa]
Length=778

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 104/158 (66%), Gaps = 2/158 (1%)
 Frame = +2

Query  185  GSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKH  364
            G   ++ G  DD   S    +PLL RNR  +++ +A++GA   PIESLDYEI END FK 
Sbjct  20   GFERKISGILDDG--SVGFRQPLLARNRKNTTSQIAIVGANSCPIESLDYEIFENDFFKQ  77

Query  365  DWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYL  544
            DWRSR K  +LQY FLKW LAFLIGL TG++  L NLA+ENIAG+KLL   N +   +Y 
Sbjct  78   DWRSRKKIEILQYTFLKWALAFLIGLATGVVGFLNNLAVENIAGFKLLLTGNLMLKEKYF  137

Query  545  MGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
              F  F G N +L  +A+ LC F AP AAG GIPE+KA
Sbjct  138  QAFFAFAGCNLILATAAASLCAFIAPAAAGSGIPEVKA  175



>emb|CDX83179.1| BnaA03g23270D [Brassica napus]
Length=775

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 104/164 (63%), Gaps = 0/164 (0%)
 Frame = +2

Query  167  MEFAGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINE  346
            +E  G     E +     D  S    +PLL RNR  +++ +A++GA   PIESLDYEI E
Sbjct  10   IEVEGGNYAYERKISGILDDGSVGFQQPLLARNRKNTTSQIAIVGANTCPIESLDYEIFE  69

Query  347  NDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYI  526
            NDLFK DWRSR K  +LQY  LKW LAFLIGL TGL+  L NLA+ENIAG+KLL   N +
Sbjct  70   NDLFKQDWRSRKKIEILQYTILKWALAFLIGLSTGLVGFLNNLAVENIAGFKLLLTGNLM  129

Query  527  DNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
               +Y   F  F G N +L  +A+ LC F AP AAG GIPE+KA
Sbjct  130  LKEKYFQAFFAFAGCNLILATAAASLCAFIAPAAAGSGIPEVKA  173



>emb|CDY21447.1| BnaC03g27500D [Brassica napus]
Length=775

 Score =   139 bits (349),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 104/164 (63%), Gaps = 0/164 (0%)
 Frame = +2

Query  167  MEFAGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINE  346
            +E  G     E +     D  S    +PLL RNR  +++ +A++GA   PIESLDYEI E
Sbjct  10   IEVEGGNYAYERKISGILDDGSVGFQQPLLARNRKNTTSQIAIVGANTCPIESLDYEIFE  69

Query  347  NDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYI  526
            NDLFK DWRSR K  +LQY  LKW LAFLIGL TGL+  L NLA+ENIAG+KLL   N +
Sbjct  70   NDLFKQDWRSRKKIEILQYTILKWALAFLIGLSTGLVGFLNNLAVENIAGFKLLLTGNLM  129

Query  527  DNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
               +Y   F  F G N +L  +A+ LC F AP AAG GIPE+KA
Sbjct  130  LKEKYFQAFFAFAGCNLILATAAASLCAFIAPAAAGSGIPEVKA  173



>ref|XP_009134029.1| PREDICTED: chloride channel protein CLC-c [Brassica rapa]
Length=775

 Score =   139 bits (349),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 104/164 (63%), Gaps = 0/164 (0%)
 Frame = +2

Query  167  MEFAGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINE  346
            +E  G     E +     D  S    +PLL RNR  +++ +A++GA   PIESLDYEI E
Sbjct  10   IEVEGGNYAYERKISGILDDGSVGFQQPLLARNRKNTTSQIAIVGANTCPIESLDYEIFE  69

Query  347  NDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYI  526
            NDLFK DWRSR K  +LQY  LKW LAFLIGL TGL+  L NLA+ENIAG+KLL   N +
Sbjct  70   NDLFKQDWRSRKKIEILQYTILKWALAFLIGLSTGLVGFLNNLAVENIAGFKLLLTGNLM  129

Query  527  DNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
               +Y   F  F G N +L  +A+ LC F AP AAG GIPE+KA
Sbjct  130  LKEKYFQAFFAFAGCNLILATAAASLCAFIAPAAAGSGIPEVKA  173



>ref|XP_009127371.1| PREDICTED: chloride channel protein CLC-c [Brassica rapa]
 emb|CDY16376.1| BnaA02g11800D [Brassica napus]
Length=775

 Score =   139 bits (349),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 103/154 (67%), Gaps = 2/154 (1%)
 Frame = +2

Query  197  EMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRS  376
            ++ G  DD   S    +PLL RNR  +++ +A++GA   PIESLDYEI ENDLFK DWRS
Sbjct  22   KISGILDDG--SVGFQQPLLARNRKNTTSQIAIVGANTCPIESLDYEIFENDLFKQDWRS  79

Query  377  RSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFA  556
            R K  +LQY  LKW LAFLIGL TGL+  L NLA+ENIAG+KLL   N +   +Y   F 
Sbjct  80   RKKIEILQYTILKWALAFLIGLATGLVGFLNNLAVENIAGFKLLLTGNLMLKEKYFQAFF  139

Query  557  YFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             F G N +L  +A+ LC F AP AAG GIPE+KA
Sbjct  140  AFAGCNLILATAAASLCAFIAPAAAGSGIPEVKA  173



>gb|KEH25446.1| ClC chloride channel family protein [Medicago truncatula]
Length=722

 Score =   138 bits (348),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = +2

Query  335  EINENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAV  514
             INENDLFK DWRSRS+  V+QY+ LKW LAFL+GLLTG+IATLINLA+ENI+GYKLL V
Sbjct  7    RINENDLFKQDWRSRSRGQVMQYIILKWLLAFLVGLLTGVIATLINLAVENISGYKLLTV  66

Query  515  LNYIDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            + YI   RYLMGF YF+GTNFLLT  AS+LCV  APTAAGPGIPEIKA
Sbjct  67   VGYIQQERYLMGFLYFLGTNFLLTFIASILCVCFAPTAAGPGIPEIKA  114



>ref|XP_006280044.1| hypothetical protein CARUB_v10025921mg [Capsella rubella]
 gb|EOA12942.1| hypothetical protein CARUB_v10025921mg [Capsella rubella]
Length=776

 Score =   139 bits (349),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 103/158 (65%), Gaps = 2/158 (1%)
 Frame = +2

Query  185  GSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKH  364
            G   ++ G  DD   S    +PLL RNR  +++ +A++GA   PIESLDYEI END FK 
Sbjct  19   GFDRKISGILDDG--SVGFQQPLLARNRKNTTSQIAIVGANTCPIESLDYEIFENDFFKQ  76

Query  365  DWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYL  544
            DWRSR K  +LQY FLKW LAFLIGL TGL+  L NL +ENIAG+KLL   N +   +Y 
Sbjct  77   DWRSRKKIEILQYTFLKWALAFLIGLATGLVGFLNNLGVENIAGFKLLLTGNLMLKEKYF  136

Query  545  MGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
              F  F G N +L  +A+ LC + AP AAG GIPE+KA
Sbjct  137  QAFFAFAGCNLILATAAASLCAYIAPAAAGSGIPEVKA  174



>emb|CDX91539.1| BnaC02g16210D [Brassica napus]
Length=775

 Score =   138 bits (348),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 102/154 (66%), Gaps = 2/154 (1%)
 Frame = +2

Query  197  EMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRS  376
            ++ G  DD   S    +PLL RNR  +++ +A++GA   PIESLDYEI ENDLFK DWRS
Sbjct  22   KISGILDDG--SVGFQQPLLARNRKNTTSQIAIVGANTCPIESLDYEIFENDLFKQDWRS  79

Query  377  RSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFA  556
            R K  +LQY  LKW LAFLIGL TGL+  L NLA+ENIAG+KLL   N +   +Y   F 
Sbjct  80   RKKIEILQYTILKWALAFLIGLATGLVGFLNNLAVENIAGFKLLLTGNLMLKEKYFQAFF  139

Query  557  YFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             F G N +L  +A  LC F AP AAG GIPE+KA
Sbjct  140  AFAGCNLILATAAGSLCAFIAPAAAGSGIPEVKA  173



>ref|XP_002865761.1| CLC-C [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42020.1| CLC-C [Arabidopsis lyrata subsp. lyrata]
Length=778

 Score =   138 bits (348),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 103/158 (65%), Gaps = 2/158 (1%)
 Frame = +2

Query  185  GSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKH  364
            G   ++ G  DD   S    +PLL RNR  +++ +A++GA   PIESLDYEI END FK 
Sbjct  20   GYERKISGILDDG--SVGFRQPLLARNRKNTTSQIAIVGANSCPIESLDYEIFENDFFKQ  77

Query  365  DWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYL  544
            DWRSR K  +LQY FLKW LAFLIGL TGL+  L NL +ENIAG+KLL +   +   +Y 
Sbjct  78   DWRSRKKIEILQYTFLKWALAFLIGLATGLVGFLNNLGVENIAGFKLLLIGYLMAKEKYF  137

Query  545  MGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
              F  F G N +L  +A+ LC F AP AAG GIPE+KA
Sbjct  138  QAFFAFAGCNLILATAAASLCAFIAPAAAGSGIPEVKA  175



>ref|XP_011020210.1| PREDICTED: putative chloride channel-like protein CLC-g [Populus 
euphratica]
Length=806

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 108/159 (68%), Gaps = 4/159 (3%)
 Frame = +2

Query  188  STNEMEGQADDDPESNSLHRPLLKRNRTL--SSTPVAMIGAKVSPIESLDYEINENDLFK  361
            STN ++G+A+ D ES  L  PLL   R+   S++ VA++GA V PIESLDYEI EN+ FK
Sbjct  33   STNSIDGEANTDQES--LIIPLLSPRRSFINSTSQVAIVGANVCPIESLDYEIAENEFFK  90

Query  362  HDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRY  541
             DWRSR K  + QYVF+KW+L FLIGL+  L+    NLA+ENIAG K +   N +  NR+
Sbjct  91   QDWRSRGKMQIFQYVFMKWSLCFLIGLIVSLVGFFNNLAVENIAGLKFVVTSNMMMANRF  150

Query  542  LMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             M F  F  +N +LT+ AS++  F AP AAG G+PE+KA
Sbjct  151  WMAFLVFSVSNLILTLFASIITAFIAPAAAGSGVPEVKA  189



>gb|EMS65031.1| Chloride channel protein CLC-b [Triticum urartu]
Length=518

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 110/156 (71%), Gaps = 5/156 (3%)
 Frame = +2

Query  161  MSMEFAGAGSTNEMEGQADDDPES-----NSLHRPLLKRNRTLSSTPVAMIGAKVSPIES  325
            M  E A        +G   +DP S     +SL +PLLK++ TL++  +AM+GAKVS IES
Sbjct  1    MEEETATTAGRKHDDGVDSEDPGSAGNGISSLEQPLLKKSNTLTANHLAMVGAKVSHIES  60

Query  326  LDYEINENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKL  505
            LDYEI ENDLFKHDWRSRS   VLQYVFLKW LAFL+GLLTG+IA+LINLAIENI+G K+
Sbjct  61   LDYEIIENDLFKHDWRSRSTVEVLQYVFLKWALAFLVGLLTGVIASLINLAIENISGVKM  120

Query  506  LAVLNYIDNNRYLMGFAYFVGTNFLLTMSASVLCVF  613
            L ++  + + RY  GF YF G N  LT  A+VLC F
Sbjct  121  LHMVRLVRDKRYWAGFFYFSGFNLALTFVAAVLCAF  156



>ref|NP_001275140.1| chloride channel protein CLC-c-like [Solanum tuberosum]
 emb|CAA71369.1| chloride channel Stclc1 [Solanum tuberosum]
Length=764

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 102/155 (66%), Gaps = 1/155 (1%)
 Frame = +2

Query  197  EMEGQADDDPESNSLHRPLLK-RNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWR  373
            ++E       ES S+  PLLK ++R  +++ +A++GA V PIESLDY+I ENDLFK DWR
Sbjct  8    DLERNFSTISESGSIRVPLLKSKSRVNNTSQIAIVGANVYPIESLDYDIVENDLFKQDWR  67

Query  374  SRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGF  553
            SR K  + QY+FLKWTL  LIGL TGL+    N+ +ENIAG+KLL   N + + +Y   F
Sbjct  68   SRKKVEIFQYIFLKWTLVLLIGLSTGLVGFFNNIGVENIAGFKLLLTSNLMLDGKYFQAF  127

Query  554  AYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            A F G N      A+ LC F AP AAG GIPE+KA
Sbjct  128  AAFAGCNVFFATCAAALCAFIAPAAAGSGIPEVKA  162



>ref|XP_010441249.1| PREDICTED: chloride channel protein CLC-c-like [Camelina sativa]
Length=779

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 107/165 (65%), Gaps = 3/165 (2%)
 Frame = +2

Query  167  MEFAGAGS-TNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEIN  343
            +E  G  S   ++ G  DD   S    +PLL RNR  +++ +A++GA   PIESLDYEI 
Sbjct  14   IEIEGGHSFERKISGILDDG--SVGFRQPLLARNRKNTTSQIAIVGANSCPIESLDYEIF  71

Query  344  ENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNY  523
            END FK DWRSR K  +LQY FLKW LAFLIGL TG++  L NLA+ENIAG+KLL   N 
Sbjct  72   ENDFFKQDWRSRKKIEILQYTFLKWALAFLIGLATGVVGFLNNLAVENIAGFKLLLTGNL  131

Query  524  IDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            +   +Y   F  F G N +L  +A+ LC + AP AAG GIPE+KA
Sbjct  132  MLKEKYFQAFFAFAGCNLILATAAASLCAYIAPAAAGSGIPEVKA  176



>ref|XP_004248849.1| PREDICTED: chloride channel protein CLC-c-like [Solanum lycopersicum]
Length=778

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 106/171 (62%), Gaps = 5/171 (3%)
 Frame = +2

Query  161  MSMEFAGAGSTNE----MEGQADDDPESNSLHRPLLK-RNRTLSSTPVAMIGAKVSPIES  325
            + +E  G G   E    +E       E+ S+  PLLK ++R  +++ +A++GA V PIES
Sbjct  6    VDIENDGGGMIEEEKFDLERNFSTISETGSIREPLLKSKSRVNNTSQIAIVGANVYPIES  65

Query  326  LDYEINENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKL  505
            LDY+I ENDLFK DWRSR K  + QY+FLKWTL  LIGL TGL+    N+ +ENIAG+KL
Sbjct  66   LDYDIVENDLFKQDWRSRKKVEIFQYIFLKWTLVLLIGLSTGLVGFFNNIGVENIAGFKL  125

Query  506  LAVLNYIDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            L   N +   +Y   FA F G N      A+ LC F AP AAG GIPE+KA
Sbjct  126  LLTSNLMLEGKYFQAFAAFAGCNVFFATCAAALCAFIAPAAAGSGIPEVKA  176



>emb|CBI29647.3| unnamed protein product [Vitis vinifera]
Length=742

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 101/140 (72%), Gaps = 0/140 (0%)
 Frame = +2

Query  239  LHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFLKW  418
            +  PLL R R  S++ +A++GA V PIESLDYEI EN+LFK DWRSR +  + QY+ LKW
Sbjct  1    MREPLLVRKRLNSTSQIAIVGASVCPIESLDYEIVENELFKQDWRSRKRVQIFQYIVLKW  60

Query  419  tlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFLLTMSAS  598
            TLA LIGL TGL+    NLA+ENIAG+KLL   N +  ++Y + F  F G N +L ++A+
Sbjct  61   TLALLIGLGTGLVGFFNNLAVENIAGFKLLLASNLMLKDKYGLAFVTFAGCNMVLAIAAA  120

Query  599  VLCVFXAPTAAGPGIPEIKA  658
            VLC + AP+AAG GIPE+KA
Sbjct  121  VLCAYIAPSAAGSGIPEVKA  140



>emb|CDO97645.1| unnamed protein product [Coffea canephora]
Length=816

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +2

Query  239  LHRPLLK-RNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFLK  415
            L  PLLK ++R  +++ +A++GA VSPIESLDYEI EN+LFK DWRSR K  + QYVFLK
Sbjct  67   LREPLLKSKSRINTTSQIAIVGANVSPIESLDYEIIENELFKQDWRSRKKVEIYQYVFLK  126

Query  416  WtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFLLTMSA  595
            WTLA LIGL TGL+    NLA+ENIAG+K L   N +  ++Y + FA + G N +L + A
Sbjct  127  WTLALLIGLCTGLVGFFNNLAVENIAGFKFLLTNNLMLKHQYFLAFAAYAGCNVVLAVCA  186

Query  596  SVLCVFXAPTAAGPGIPEIKA  658
            +VLC F AP AAG GIPE+KA
Sbjct  187  AVLCAFIAPAAAGSGIPEVKA  207



>ref|XP_011028391.1| PREDICTED: chloride channel protein CLC-c-like [Populus euphratica]
 ref|XP_011028392.1| PREDICTED: chloride channel protein CLC-c-like [Populus euphratica]
Length=766

 Score =   136 bits (342),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 104/155 (67%), Gaps = 0/155 (0%)
 Frame = +2

Query  194  NEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWR  373
            N++E   D +   + L  P L RNR  +++ VA++GA   PIESLDYEI EN+LFK DWR
Sbjct  10   NDLEIDYDKEHSVSMLREPFLVRNRKNNTSQVAIVGANTCPIESLDYEIVENELFKQDWR  69

Query  374  SRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGF  553
            SR K+ + QYV LKWTLA LIGL TGLI    NLAIEN+AG+KLL   N +  + Y   F
Sbjct  70   SRKKAEIFQYVVLKWTLALLIGLGTGLIGFFNNLAIENLAGFKLLVTNNLMLKDMYYQAF  129

Query  554  AYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            A + G N +L ++A  LC + AP AAG GIPE+KA
Sbjct  130  ATYAGCNVVLAIAAGALCAYVAPAAAGSGIPEVKA  164



>ref|XP_011016274.1| PREDICTED: chloride channel protein CLC-c-like [Populus euphratica]
Length=766

 Score =   136 bits (342),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 104/155 (67%), Gaps = 0/155 (0%)
 Frame = +2

Query  194  NEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWR  373
            N++E   D +   + L  P L RNR  +++ VA++GA   PIESLDYEI EN+LFK DWR
Sbjct  10   NDLEIDYDKEHSVSMLREPFLVRNRKNNTSQVAIVGANTCPIESLDYEIVENELFKQDWR  69

Query  374  SRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGF  553
            SR K+ + QYV LKWTLA LIGL TGLI    NLAIEN+AG+KLL   N +  + Y   F
Sbjct  70   SRKKAEIFQYVVLKWTLALLIGLGTGLIGFFNNLAIENLAGFKLLVTNNLMLKDMYYQAF  129

Query  554  AYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            A + G N +L ++A  LC + AP AAG GIPE+KA
Sbjct  130  ATYAGCNVVLAIAAGALCAYVAPAAAGSGIPEVKA  164



>ref|XP_002530769.1| chloride channel clc, putative [Ricinus communis]
 gb|EEF31629.1| chloride channel clc, putative [Ricinus communis]
Length=775

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 106/158 (67%), Gaps = 4/158 (3%)
 Frame = +2

Query  191  TNEMEGQADDDPESNSLHRPLLKRNRTL--SSTPVAMIGAKVSPIESLDYEINENDLFKH  364
            TN + G+ + + ES +L  PLL   R+L  S++ VA++GA V PIESLDYEI END FK 
Sbjct  4    TNSINGEQEQEHESLTL--PLLTSQRSLINSTSQVAIVGANVCPIESLDYEIAENDFFKQ  61

Query  365  DWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYL  544
            DWR+  K  + QYVF+KW L FL+GL+  LI    NLA+ENIAG K +   N +  NRY 
Sbjct  62   DWRTHKKIQIFQYVFMKWLLCFLVGLIVSLIGFFNNLAVENIAGVKFVITSNMMLANRYG  121

Query  545  MGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            M FA F  +NF+LT+ AS++    AP AAG GIPE+KA
Sbjct  122  MAFAVFSVSNFVLTLFASIITASVAPAAAGSGIPEVKA  159



>gb|EYU35026.1| hypothetical protein MIMGU_mgv1a001577mg [Erythranthe guttata]
Length=791

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 102/147 (69%), Gaps = 1/147 (1%)
 Frame = +2

Query  221  DPESNSLHRPLLK-RNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVL  397
            D E  ++  PLL  R+R  +++ +A++GAKV PIESLDYEI EN+L K DWR+R +  + 
Sbjct  43   DREGGAVREPLLNLRSRVNTTSQIAIVGAKVYPIESLDYEIFENELIKQDWRTRKRIEIF  102

Query  398  QYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNF  577
            QYVFLKWTLA LIGL TG++    NLA+ENIAG KLL   N +   +Y   FA F G N 
Sbjct  103  QYVFLKWTLALLIGLFTGVVGFFNNLAVENIAGVKLLITSNLMLKEKYYQAFAAFAGINM  162

Query  578  LLTMSASVLCVFXAPTAAGPGIPEIKA  658
            +L +SA+ LC F AP AAG GIPE+KA
Sbjct  163  ILAVSAAALCAFIAPAAAGSGIPEVKA  189



>ref|XP_010682061.1| PREDICTED: chloride channel protein CLC-c-like [Beta vulgaris 
subsp. vulgaris]
Length=781

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 100/158 (63%), Gaps = 1/158 (1%)
 Frame = +2

Query  185  GSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKH  364
            G+  E+          +   +PLL R RT  ++ +A++GA VSPIESLDYEI EN+L K 
Sbjct  23   GTNTEVVTTLSRYGSDDEFKQPLL-RKRTNQTSQLAIVGANVSPIESLDYEIMENELLKE  81

Query  365  DWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYL  544
            DWRS     + QY+F KWT+A LIGL TGLI    N+ +ENIAG+K L  +NY+   +Y+
Sbjct  82   DWRSMKNFEIFQYIFFKWTMALLIGLCTGLIGFCNNIGVENIAGFKFLQTINYVRQEKYV  141

Query  545  MGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             GF YF G N LL    + LC + AP AAG GIPE+KA
Sbjct  142  KGFTYFAGCNLLLATVTAALCAYIAPAAAGSGIPEVKA  179



>ref|XP_009618449.1| PREDICTED: chloride channel protein CLC-c-like [Nicotiana tomentosiformis]
Length=782

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 101/143 (71%), Gaps = 1/143 (1%)
 Frame = +2

Query  233  NSLHRPLLK-RNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVF  409
            + + +PLL  ++R  +++ +A+IGA V PIESLDYEI ENDLFK DWRSR K  + QY+F
Sbjct  37   SGVRQPLLSSKSRVNNTSQIAIIGANVCPIESLDYEIIENDLFKQDWRSRKKVQIFQYIF  96

Query  410  LKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFLLTM  589
            LKWTL  LIGL  GL+   +N+A+ENIAG+KLL + + +  ++Y  GFA +   N +L  
Sbjct  97   LKWTLVLLIGLSVGLVGFFLNIAVENIAGFKLLLISDLMLQDKYFRGFAAYACCNLVLAT  156

Query  590  SASVLCVFXAPTAAGPGIPEIKA  658
             A +LC F AP AAG GIPE+KA
Sbjct  157  CAGILCAFIAPAAAGSGIPEVKA  179



>ref|XP_009791971.1| PREDICTED: chloride channel protein CLC-c-like [Nicotiana sylvestris]
 emb|CAA64829.1| C1C-Nt1 [Nicotiana tabacum]
Length=780

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 101/143 (71%), Gaps = 1/143 (1%)
 Frame = +2

Query  233  NSLHRPLLK-RNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVF  409
            + + +PLL  ++R  +++ +A+IGA V PIESLDYEI ENDLFK DWRSR K  + QY+F
Sbjct  35   SGVRQPLLSSKSRVNNTSQIAIIGANVCPIESLDYEIIENDLFKQDWRSRKKVQIFQYIF  94

Query  410  LKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFLLTM  589
            LKWTL  LIGL  GL+   +N+A+ENIAG+KLL + + +  ++Y  GFA +   N +L  
Sbjct  95   LKWTLVLLIGLSVGLVGFFLNIAVENIAGFKLLLISDLMLQDKYFRGFAAYACCNLVLAT  154

Query  590  SASVLCVFXAPTAAGPGIPEIKA  658
             A +LC F AP AAG GIPE+KA
Sbjct  155  CAGILCAFIAPAAAGSGIPEVKA  177



>gb|KDP30234.1| hypothetical protein JCGZ_17016 [Jatropha curcas]
Length=773

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 107/159 (67%), Gaps = 6/159 (4%)
 Frame = +2

Query  188  STNEMEGQADDDPESNSLHRPLLKRNRTL--SSTPVAMIGAKVSPIESLDYEINENDLFK  361
            STN + G AD +    SL  PLL  +R++  S++ VA++GA V PIESLDYE+ END FK
Sbjct  2    STNSINGAADQE----SLTVPLLTSSRSITNSTSQVAIVGANVCPIESLDYEVAENDFFK  57

Query  362  HDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRY  541
             DWR+R K  + QY+F+KW+L FLIG++  LI    NLA+ENIAG K +   N + +NRY
Sbjct  58   QDWRTRGKIQIFQYLFMKWSLCFLIGIVVSLIGFFNNLAVENIAGVKFVVTSNMMLHNRY  117

Query  542  LMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             M F  F  +NF LT+ + ++  F AP AAG GIPE+KA
Sbjct  118  WMAFLVFSLSNFALTLFSCIITDFIAPAAAGSGIPEVKA  156



>ref|XP_006389435.1| chloride channel-like family protein [Populus trichocarpa]
 gb|ERP48349.1| chloride channel-like family protein [Populus trichocarpa]
Length=775

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 107/159 (67%), Gaps = 4/159 (3%)
 Frame = +2

Query  188  STNEMEGQADDDPESNSLHRPLL--KRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFK  361
            +TN + G+A+DD ES ++  PLL  +R+   S++ VA++GA V PIESLDYEI ENDLFK
Sbjct  2    ATNSINGEANDDHESVTI--PLLTSERSNVNSTSQVAIVGANVCPIESLDYEIAENDLFK  59

Query  362  HDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRY  541
             DWRS  K  + QYVF+KW L FLIGL+  LI    NLA+ENIAG K +   N +   R+
Sbjct  60   QDWRSGGKIQIFQYVFMKWLLCFLIGLIVSLIGFFNNLAVENIAGLKFVVTSNMMLAKRF  119

Query  542  LMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             M F  F  +N  LT+ AS++  F AP AAG GIPE+KA
Sbjct  120  GMAFLVFSVSNLTLTLFASIITAFIAPAAAGSGIPEVKA  158



>ref|XP_008365471.1| PREDICTED: chloride channel protein CLC-a-like [Malus domestica]
Length=117

 Score =   124 bits (312),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +2

Query  176  AGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDL  355
            A    T +  G  + DPES SL +PLLKRNRTLSSTP+AM+GAKVS IESLDYEINEN L
Sbjct  11   AAIPQTMQETGXEERDPESISLQQPLLKRNRTLSSTPLAMVGAKVSHIESLDYEINENXL  70

Query  356  FKHDWRSRSKSHVLQYVFLKW  418
            FKHDWRSRSK  VLQYVFLKW
Sbjct  71   FKHDWRSRSKVQVLQYVFLKW  91



>gb|ADD09861.1| chloride channel C [Eutrema halophilum]
Length=775

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 105/155 (68%), Gaps = 4/155 (3%)
 Frame = +2

Query  197  EMEGQADDDPESNSLHRPLL-KRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWR  373
            ++ G  DD    + +++PLL  RNR  +++ +A++GA   PIESLDYEI ENDLFK DWR
Sbjct  22   KISGITDD---GSVVYQPLLASRNRKNTTSQIAIVGANTCPIESLDYEIFENDLFKQDWR  78

Query  374  SRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGF  553
            SR K  +LQY  LKW LAFLIGL TGL+  L NLA+ENIAG+KLL   N +   +Y   F
Sbjct  79   SRKKIEILQYTILKWALAFLIGLSTGLVGFLNNLAVENIAGFKLLLTGNLMLKEKYFQAF  138

Query  554  AYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
              F G N +L  +A+ LC F AP AAG GIPE+KA
Sbjct  139  FAFSGCNLILATAAASLCAFIAPAAAGSGIPEVKA  173



>ref|XP_006402220.1| hypothetical protein EUTSA_v10012744mg [Eutrema salsugineum]
 gb|ESQ43673.1| hypothetical protein EUTSA_v10012744mg [Eutrema salsugineum]
Length=775

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 105/155 (68%), Gaps = 4/155 (3%)
 Frame = +2

Query  197  EMEGQADDDPESNSLHRPLL-KRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWR  373
            ++ G  DD    + +++PLL  RNR  +++ +A++GA   PIESLDYEI ENDLFK DWR
Sbjct  22   KISGITDD---GSVVYQPLLASRNRKNTTSQIAIVGANTCPIESLDYEIFENDLFKQDWR  78

Query  374  SRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGF  553
            SR K  +LQY  LKW LAFLIGL TGL+  L NLA+ENIAG+KLL   N +   +Y   F
Sbjct  79   SRKKIEILQYTILKWALAFLIGLSTGLVGFLNNLAVENIAGFKLLLTGNLMLKEKYFQAF  138

Query  554  AYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
              F G N +L  +A+ LC F AP AAG GIPE+KA
Sbjct  139  FAFSGCNLILATAAASLCAFIAPAAAGSGIPEVKA  173



>ref|XP_011087632.1| PREDICTED: chloride channel protein CLC-c [Sesamum indicum]
Length=789

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 107/166 (64%), Gaps = 2/166 (1%)
 Frame = +2

Query  167  MEFAGAGSTNEMEGQADDDPE-SNSLHRPLLK-RNRTLSSTPVAMIGAKVSPIESLDYEI  340
            +E  G G    ME +       S S   PLL  ++R  +++ +A++G+KV PIESLDYEI
Sbjct  19   VESGGRGRGGFMERRESGMSSFSESAREPLLHLKSRVNTTSQIAIVGSKVYPIESLDYEI  78

Query  341  NENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLN  520
             EN+L K DWRSR +  + QY+FLKWTLA  IGL TGL+    N+A+ENIAG+KLL   N
Sbjct  79   FENELIKQDWRSRKRVEIFQYIFLKWTLALCIGLFTGLVGFFNNIAVENIAGFKLLLTSN  138

Query  521  YIDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             + N +Y   FA + G N +L  SA+ LC F AP AAG GIPE+KA
Sbjct  139  LMLNAKYFQAFAAYAGINVILAFSAAALCAFIAPAAAGSGIPEVKA  184



>gb|EEC77341.1| hypothetical protein OsI_16021 [Oryza sativa Indica Group]
Length=350

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 96/147 (65%), Gaps = 0/147 (0%)
 Frame = +2

Query  218  DDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVL  397
            DD       +PLL++    +++ +A++GA V PIESLDYEI ENDLFK DWRSR K  + 
Sbjct  50   DDEAGGGPRQPLLRKRTMNTTSQIAIVGANVCPIESLDYEIVENDLFKQDWRSRKKKQIF  109

Query  398  QYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNF  577
            QY+ LKW L  LIG+LTG++    NLA+ENIAG KLL   + +   RY   F  + G N 
Sbjct  110  QYIVLKWALVLLIGMLTGIVGFFNNLAVENIAGLKLLLTSDLMLKQRYFTAFLAYGGCNL  169

Query  578  LLTMSASVLCVFXAPTAAGPGIPEIKA  658
            +L  +A+ +C + AP AAG GIPE+KA
Sbjct  170  VLATTAAAICAYIAPAAAGSGIPEVKA  196



>ref|XP_009108066.1| PREDICTED: putative chloride channel-like protein CLC-g [Brassica 
rapa]
Length=764

 Score =   133 bits (335),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 100/149 (67%), Gaps = 2/149 (1%)
 Frame = +2

Query  218  DDPESNSLHRPLLK--RNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSH  391
            D    +S+  PLL   R+ T SS+ VA++G+ + P+ESLDYEI END FK DWR+RSK+ 
Sbjct  3    DSTREDSVAVPLLPSLRHATNSSSQVAIVGSNLCPVESLDYEIAENDFFKQDWRARSKTQ  62

Query  392  VLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGT  571
            + QYVF+KW L F IG++  LI    NLA+EN+AG K +   N +   RY MGF  F  T
Sbjct  63   IFQYVFMKWLLCFFIGIIVSLIGFTNNLAVENLAGVKFVVTSNMMLAGRYSMGFFVFTVT  122

Query  572  NFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            N +LT+ ASV+  F AP AAG GIPE+KA
Sbjct  123  NLILTLFASVITAFVAPAAAGSGIPEVKA  151



>emb|CDY47559.1| BnaA08g07280D [Brassica napus]
Length=764

 Score =   133 bits (334),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 100/149 (67%), Gaps = 2/149 (1%)
 Frame = +2

Query  218  DDPESNSLHRPLLK--RNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSH  391
            D    +S+  PLL   R+ T SS+ VA++G+ + P+ESLDYEI END FK DWR+RSK+ 
Sbjct  3    DSTREDSVAVPLLPSLRHATNSSSQVAIVGSNLCPVESLDYEIAENDFFKQDWRARSKTQ  62

Query  392  VLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGT  571
            + QYVF+KW L F IG++  LI    NLA+EN+AG K +   N +   RY MGF  F  T
Sbjct  63   IFQYVFMKWLLCFFIGIIVSLIGFTNNLAVENLAGVKFVVTSNMMLAGRYSMGFFVFTVT  122

Query  572  NFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            N +LT+ ASV+  F AP AAG GIPE+KA
Sbjct  123  NLILTLFASVITAFVAPAAAGSGIPEVKA  151



>ref|XP_006381102.1| chloride channel-like family protein [Populus trichocarpa]
 gb|ERP58899.1| chloride channel-like family protein [Populus trichocarpa]
Length=775

 Score =   133 bits (334),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 106/159 (67%), Gaps = 4/159 (3%)
 Frame = +2

Query  188  STNEMEGQADDDPESNSLHRPLLKRNRTL--SSTPVAMIGAKVSPIESLDYEINENDLFK  361
            STN +  +A+ D ES  L  PLL   R+L  S++ VA++GA V PIESLDYEI EN+ FK
Sbjct  2    STNSINREANTDQES--LIIPLLSPRRSLINSTSQVAIVGANVCPIESLDYEIAENEFFK  59

Query  362  HDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRY  541
             DWRSR K  + QYVF+KW+L FLIGL+  LI    NLA+ENIAG K +   N +   R+
Sbjct  60   QDWRSRGKMQIFQYVFMKWSLCFLIGLIVSLIGFFNNLAVENIAGLKFVVTSNMMLAKRF  119

Query  542  LMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             M F  F  +N +LT+ AS++  F AP AAG GIPE+KA
Sbjct  120  GMAFLVFSVSNLILTLFASIITAFIAPAAAGSGIPEVKA  158



>ref|XP_006349289.1| PREDICTED: chloride channel protein CLC-c-like [Solanum tuberosum]
Length=776

 Score =   132 bits (333),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 100/145 (69%), Gaps = 1/145 (1%)
 Frame = +2

Query  227  ESNSLHRPLLK-RNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQY  403
             ++    PLLK ++R  +++ +A+IGA V PIESLDY+I ENDLFK DWRSR K  + QY
Sbjct  30   SASGFREPLLKSKSRVNNTSQIAIIGANVCPIESLDYDIVENDLFKQDWRSRKKVQIYQY  89

Query  404  VFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFLL  583
            +FLKWTL  LIGL TGL+   +N+A+ENIAG+KLL   + +  ++Y   F  F G N  L
Sbjct  90   IFLKWTLVLLIGLSTGLVGFFLNIAVENIAGFKLLLASDLMLEDKYFRAFGTFAGCNLGL  149

Query  584  TMSASVLCVFXAPTAAGPGIPEIKA  658
               A++LC F AP AAG GIPE+KA
Sbjct  150  ATCAAILCAFIAPAAAGSGIPEVKA  174



>ref|XP_008801915.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Phoenix dactylifera]
Length=773

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 98/139 (71%), Gaps = 0/139 (0%)
 Frame = +2

Query  242  HRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFLKWt  421
            HR  L+R+ + +++ VA++GA V PIESLDYE+ END FK DWRSR +SH+ +YV LKW+
Sbjct  19   HRVDLRRSASNTTSQVAIVGAHVCPIESLDYELIENDFFKQDWRSRGRSHIFRYVTLKWS  78

Query  422  lafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFLLTMSASV  601
            L FLIG L G +    NLA+ENIAG K +   N +   +Y   FA F G+NF+LTM ASV
Sbjct  79   LCFLIGALAGAVGFFNNLAVENIAGVKFVVTSNMMLARKYGWAFAVFAGSNFVLTMFASV  138

Query  602  LCVFXAPTAAGPGIPEIKA  658
            +  + AP AAG GIPE+KA
Sbjct  139  ITAYMAPAAAGSGIPEVKA  157



>ref|XP_008801913.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Phoenix dactylifera]
 ref|XP_008801914.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Phoenix dactylifera]
Length=778

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 98/139 (71%), Gaps = 0/139 (0%)
 Frame = +2

Query  242  HRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFLKWt  421
            HR  L+R+ + +++ VA++GA V PIESLDYE+ END FK DWRSR +SH+ +YV LKW+
Sbjct  19   HRVDLRRSASNTTSQVAIVGAHVCPIESLDYELIENDFFKQDWRSRGRSHIFRYVTLKWS  78

Query  422  lafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFLLTMSASV  601
            L FLIG L G +    NLA+ENIAG K +   N +   +Y   FA F G+NF+LTM ASV
Sbjct  79   LCFLIGALAGAVGFFNNLAVENIAGVKFVVTSNMMLARKYGWAFAVFAGSNFVLTMFASV  138

Query  602  LCVFXAPTAAGPGIPEIKA  658
            +  + AP AAG GIPE+KA
Sbjct  139  ITAYMAPAAAGSGIPEVKA  157



>ref|XP_001756485.1| predicted protein [Physcomitrella patens]
 gb|EDQ78881.1| predicted protein [Physcomitrella patens]
Length=801

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 112/172 (65%), Gaps = 15/172 (9%)
 Frame = +2

Query  185  GSTNEMEGQADDD---PESNSLHRPLLKRNRTLSST-----------PVAMIGAKVSPIE  322
            G  +EM G  +++   P    L+ PLL++ +  ++              AMIG +V+PIE
Sbjct  2    GGNDEM-GNVEEESLPPPHLDLYEPLLEKEKVATAGNANGNVINGTHHTAMIGTRVAPIE  60

Query  323  SLDYEINENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYK  502
            SLDYE+ EN+LF+ DWRSR K  +LQYV +KWT  FL+G+LT + A  IN A+ENIAG K
Sbjct  61   SLDYELVENELFRQDWRSRKKREILQYVAVKWTFVFLVGILTAIAALGINTAVENIAGVK  120

Query  503  LLAVLNYIDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             L  + ++++NR++  F  + G N +L MSA++LCV+  P+AAG GIPE+KA
Sbjct  121  FLLTVKFMESNRFVWAFLVYAGFNVMLVMSAALLCVYIGPSAAGSGIPEVKA  172



>ref|XP_006652320.1| PREDICTED: chloride channel protein CLC-c-like [Oryza brachyantha]
Length=803

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 102/160 (64%), Gaps = 1/160 (1%)
 Frame = +2

Query  179  GAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLF  358
            G   ++E   Q DD+ +     +PLL++    +++ +A++GA V PIESLDYEI ENDLF
Sbjct  42   GRNGSSEALLQYDDEGDGGP-RQPLLRKRTINTTSQIAIVGANVCPIESLDYEIVENDLF  100

Query  359  KHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNR  538
            K DWRSR K  + QY+ LKW L  LIG+ TG++    NLA+ENIAG KLL   + +   R
Sbjct  101  KQDWRSRKKKQIFQYIVLKWALVLLIGMSTGIVGFFNNLAVENIAGLKLLLTSDLMLKQR  160

Query  539  YLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            Y   F  + G N +L  +AS +C + AP AAG GIPE+KA
Sbjct  161  YFTAFLAYGGCNLVLAATASAICAYIAPAAAGSGIPEVKA  200



>ref|XP_010656505.1| PREDICTED: uncharacterized protein LOC100255837 isoform X1 [Vitis 
vinifera]
 emb|CBI25542.3| unnamed protein product [Vitis vinifera]
Length=772

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 100/149 (67%), Gaps = 0/149 (0%)
 Frame = +2

Query  212  ADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSH  391
            AD++ ++  L  P L R+ +  ++ VA++G+ V PIESLDYEI END FK DWRSR K  
Sbjct  7    ADEESQAQPLLDPSLHRSLSNVTSQVAIVGSNVCPIESLDYEIYENDFFKQDWRSRGKVQ  66

Query  392  VLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGT  571
            + QY+F+KW L FLIGL+  LI    NLA+EN+AG K +   N +   RY M F  F  +
Sbjct  67   IFQYIFVKWLLCFLIGLIVSLIGFCNNLAVENLAGVKFVITSNMMLVKRYGMAFLVFFSS  126

Query  572  NFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            NF+LT+ AS++  F AP AAG GIPE+KA
Sbjct  127  NFVLTLFASIITAFIAPAAAGSGIPEVKA  155



>ref|NP_001267998.1| uncharacterized protein LOC100255837 [Vitis vinifera]
 gb|ADK66983.1| chloride channel ClC5 [Vitis vinifera]
Length=770

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 100/149 (67%), Gaps = 0/149 (0%)
 Frame = +2

Query  212  ADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSH  391
            AD++ ++  L  P L R+ +  ++ VA++G+ V PIESLDYEI END FK DWRSR K  
Sbjct  7    ADEESQAQPLLDPSLHRSLSNVTSQVAIVGSNVCPIESLDYEIYENDFFKQDWRSRGKVQ  66

Query  392  VLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGT  571
            + QY+F+KW L FLIGL+  LI    NLA+EN+AG K +   N +   RY M F  F  +
Sbjct  67   IFQYIFVKWLLCFLIGLIVSLIGFCNNLAVENLAGVKFVITSNMMLVKRYGMAFLVFFSS  126

Query  572  NFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            NF+LT+ AS++  F AP AAG GIPE+KA
Sbjct  127  NFVLTLFASIITAFIAPAAAGSGIPEVKA  155



>emb|CAN62616.1| hypothetical protein VITISV_036165 [Vitis vinifera]
Length=805

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 100/149 (67%), Gaps = 0/149 (0%)
 Frame = +2

Query  212  ADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSH  391
            AD++ ++  L  P L R+ +  ++ VA++G+ V PIESLDYEI END FK DWRSR K  
Sbjct  7    ADEESQAQPLLDPSLHRSLSNVTSQVAIVGSNVCPIESLDYEIYENDFFKQDWRSRGKVQ  66

Query  392  VLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGT  571
            + QY+F+KW L FLIGL+  LI    NLA+EN+AG K +   N +   RY M F  F  +
Sbjct  67   IFQYIFVKWLLCFLIGLIVSLIGFCNNLAVENLAGVKFVITSNMMLVKRYGMAFLVFFSS  126

Query  572  NFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            NF+LT+ AS++  F AP AAG GIPE+KA
Sbjct  127  NFVLTLFASIITAFIAPAAAGSGIPEVKA  155



>ref|NP_198313.2| putative chloride channel-like protein CLC-g [Arabidopsis thaliana]
 sp|P60300.2|CLCG_ARATH RecName: Full=Putative chloride channel-like protein CLC-g; AltName: 
Full=CBS domain-containing protein CBSCLC6 [Arabidopsis 
thaliana]
 gb|AED93891.1| putative chloride channel-like protein CLC-g [Arabidopsis thaliana]
Length=765

 Score =   130 bits (328),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 96/144 (67%), Gaps = 2/144 (1%)
 Frame = +2

Query  233  NSLHRPLLK--RNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYV  406
            +S+  PLL   R  T S++ VA++GA V PIESLDYEI END FK DWR RSK  + QYV
Sbjct  8    DSVAVPLLPSLRRATNSTSQVAIVGANVCPIESLDYEIAENDFFKQDWRGRSKVEIFQYV  67

Query  407  FLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFLLT  586
            F+KW L F IG++  LI    NLA+EN+AG K +   N +   R+ MGF  F  TN +LT
Sbjct  68   FMKWLLCFCIGIIVSLIGFANNLAVENLAGVKFVVTSNMMIAGRFAMGFVVFSVTNLILT  127

Query  587  MSASVLCVFXAPTAAGPGIPEIKA  658
            + ASV+  F AP AAG GIPE+KA
Sbjct  128  LFASVITAFVAPAAAGSGIPEVKA  151



>emb|CDY12393.1| BnaC08g08120D [Brassica napus]
Length=764

 Score =   130 bits (328),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 99/149 (66%), Gaps = 2/149 (1%)
 Frame = +2

Query  218  DDPESNSLHRPLLK--RNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSH  391
            D    +S+   LL   R+ T SS+ VA++G+ + P+ESLDYEI END FK DWR+RSK+ 
Sbjct  3    DSTTEDSVAVALLPSLRHATNSSSQVAIVGSNLCPVESLDYEIAENDFFKQDWRARSKTQ  62

Query  392  VLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGT  571
            + QYVF+KW L F +G++  LI    NLA+EN+AG K +   N +   RY MGF  F  T
Sbjct  63   IFQYVFMKWLLCFFVGIIVSLIGFTNNLAVENLAGVKFVVTSNMMLAGRYSMGFFVFTVT  122

Query  572  NFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            N LLT+ ASV+  F AP AAG GIPE+KA
Sbjct  123  NLLLTLFASVITAFVAPAAAGSGIPEVKA  151



>ref|XP_003592890.1| Chloride channel protein CLC-c [Medicago truncatula]
 gb|ABE91957.1| CBS; Cl- channel, voltage gated; Twin-arginine translocation 
pathway signal [Medicago truncatula]
 gb|AES63141.1| chloride channel ClC1 protein [Medicago truncatula]
Length=761

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 105/154 (68%), Gaps = 1/154 (1%)
 Frame = +2

Query  200  MEGQADDDPESNSLHR-PLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRS  376
            ME   ++  E    H+ PLL R+R  +S+ +A++GA + PI+SLDYE+ ENDL K DWRS
Sbjct  1    MESLTEERIEIRDDHKQPLLIRSRINNSSQLAIVGANICPIQSLDYELIENDLLKQDWRS  60

Query  377  RSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFA  556
            R+K  + QYV LKWTLA LIGL+TGL+    NL +ENIAG+KLL   N +   +Y   FA
Sbjct  61   RTKVEIYQYVVLKWTLALLIGLITGLVGFFNNLGVENIAGFKLLLTNNLMLKQKYHEAFA  120

Query  557  YFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             +VG N +L + A+ LC + AP AAG GIPE+KA
Sbjct  121  VYVGCNMILGVGAAALCAYIAPAAAGSGIPEVKA  154



>ref|XP_011017858.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Populus euphratica]
Length=751

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 106/159 (67%), Gaps = 4/159 (3%)
 Frame = +2

Query  188  STNEMEGQADDDPESNSLHRPLL--KRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFK  361
            +T+ + G+A+DD ES ++  PLL  +R+   S++ VA++GA V PIESLDYEI ENDLFK
Sbjct  2    ATHSINGEANDDQESVTI--PLLTSERSNVNSTSQVAIVGANVCPIESLDYEIAENDLFK  59

Query  362  HDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRY  541
             DWRS  +  + QYV +KW L F IGL+  LI    NLA+ENIAG K +   N +   R+
Sbjct  60   QDWRSGGRIQIFQYVLVKWLLCFFIGLIVSLIGFFNNLAVENIAGLKFVVTSNMMLAKRF  119

Query  542  LMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             M F  F  +N +LT+ AS++  F AP AAG GIPE+KA
Sbjct  120  EMAFFVFSVSNLILTLFASIITAFIAPAAAGSGIPEVKA  158



>ref|XP_004230422.1| PREDICTED: chloride channel protein CLC-c [Solanum lycopersicum]
Length=776

 Score =   130 bits (327),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 98/143 (69%), Gaps = 1/143 (1%)
 Frame = +2

Query  233  NSLHRPLLK-RNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVF  409
                 PLLK ++R  +++ +A+IGA V PIESLDY+I ENDLFK DWRSR K  + QY+F
Sbjct  32   GGFREPLLKSKSRVNNTSQIAIIGANVCPIESLDYDIVENDLFKQDWRSRKKVQIYQYIF  91

Query  410  LKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFLLTM  589
            LKWTL  LIGL TGL+   +N+A+ENIAG+KLL   + +  ++Y   FA F G N  L  
Sbjct  92   LKWTLVLLIGLFTGLVGFFLNIAVENIAGFKLLLASDLMLEDKYFRAFAIFAGCNLGLAT  151

Query  590  SASVLCVFXAPTAAGPGIPEIKA  658
             A++LC   AP AAG GIPE+KA
Sbjct  152  CAAILCACIAPAAAGSGIPEVKA  174



>gb|EEE60792.1| hypothetical protein OsJ_14377 [Oryza sativa Japonica Group]
Length=773

 Score =   130 bits (327),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 99/154 (64%), Gaps = 0/154 (0%)
 Frame = +2

Query  197  EMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRS  376
            E +G  + D       +PLL++    +++ +A++GA V PIESLDYEI ENDLFK DWRS
Sbjct  17   ERDGSFNYDEAGGGPRQPLLRKRTMNTTSQIAIVGANVCPIESLDYEIVENDLFKQDWRS  76

Query  377  RSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFA  556
            R K  + QY+ LKW L  LIG+LTG++    NLA+ENIAG KLL   + +   RY   F 
Sbjct  77   RKKKQIFQYIVLKWALVLLIGMLTGIVGFFNNLAVENIAGLKLLLTSDLMLKQRYFTAFL  136

Query  557  YFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             + G N +L  +A+ +C + AP AAG GIPE+KA
Sbjct  137  AYGGCNLVLATTAAAICAYIAPAAAGSGIPEVKA  170



>ref|XP_011017857.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Populus euphratica]
 ref|XP_011017859.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X3 [Populus euphratica]
Length=775

 Score =   130 bits (327),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 106/159 (67%), Gaps = 4/159 (3%)
 Frame = +2

Query  188  STNEMEGQADDDPESNSLHRPLL--KRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFK  361
            +T+ + G+A+DD ES ++  PLL  +R+   S++ VA++GA V PIESLDYEI ENDLFK
Sbjct  2    ATHSINGEANDDQESVTI--PLLTSERSNVNSTSQVAIVGANVCPIESLDYEIAENDLFK  59

Query  362  HDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRY  541
             DWRS  +  + QYV +KW L F IGL+  LI    NLA+ENIAG K +   N +   R+
Sbjct  60   QDWRSGGRIQIFQYVLVKWLLCFFIGLIVSLIGFFNNLAVENIAGLKFVVTSNMMLAKRF  119

Query  542  LMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             M F  F  +N +LT+ AS++  F AP AAG GIPE+KA
Sbjct  120  EMAFFVFSVSNLILTLFASIITAFIAPAAAGSGIPEVKA  158



>ref|XP_006395982.1| hypothetical protein EUTSA_v10003685mg [Eutrema salsugineum]
 gb|ESQ33268.1| hypothetical protein EUTSA_v10003685mg [Eutrema salsugineum]
Length=765

 Score =   130 bits (327),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 98/143 (69%), Gaps = 2/143 (1%)
 Frame = +2

Query  236  SLHRPLLK--RNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVF  409
            S+  PLL   R+ T SS+ VA++G+ V PIESLDYEI END FK DWR+RSK+ + QYVF
Sbjct  9    SVTVPLLPSLRHATNSSSQVAIVGSNVCPIESLDYEIAENDFFKQDWRARSKTQIFQYVF  68

Query  410  LKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFLLTM  589
            +KW L F IG++  LI    NLA+EN+AG K +   N +   R+ MGF  F  TN +LT+
Sbjct  69   MKWLLCFFIGIIVSLIGFANNLAVENLAGVKFVITSNMMLVGRFSMGFFVFTVTNLVLTL  128

Query  590  SASVLCVFXAPTAAGPGIPEIKA  658
             ASV+  F AP AAG GIPE+KA
Sbjct  129  FASVITAFVAPAAAGSGIPEVKA  151



>ref|XP_010674330.1| PREDICTED: chloride channel protein CLC-c-like [Beta vulgaris 
subsp. vulgaris]
Length=783

 Score =   130 bits (326),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 100/166 (60%), Gaps = 3/166 (2%)
 Frame = +2

Query  167  MEFAGAGSTNEMEGQADDDPESN--SLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEI  340
            +EF G     E E       E N  S+  PLL R RT +++ +A+IGA   PIESLDYEI
Sbjct  17   VEFLGELDGKEEERLWSSMSERNMSSMRMPLL-RKRTNTTSQIAVIGANSCPIESLDYEI  75

Query  341  NENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLN  520
            NEN+LFK DWRSR K  + QYVFLKW LA LIGL TGL+    N+A+ENIAG+KLL    
Sbjct  76   NENELFKQDWRSRKKVQIFQYVFLKWALALLIGLSTGLVGFFSNIAVENIAGFKLLLTNK  135

Query  521  YIDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             +    Y   F  F G N      A  LC F AP AAG GIPE+K+
Sbjct  136  LMLQGSYFKAFLAFAGCNIAFATLAGTLCAFVAPAAAGSGIPEVKS  181



>ref|XP_002870407.1| hypothetical protein ARALYDRAFT_493576 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46666.1| hypothetical protein ARALYDRAFT_493576 [Arabidopsis lyrata subsp. 
lyrata]
Length=763

 Score =   130 bits (326),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 96/144 (67%), Gaps = 2/144 (1%)
 Frame = +2

Query  233  NSLHRPLLK--RNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYV  406
            +S+  PLL   R  T S++ VA++GA V PIESLDYEI END FK DWR RSK  + QYV
Sbjct  8    DSVAVPLLPSLRRATNSTSQVAIVGANVCPIESLDYEIAENDFFKQDWRGRSKVEIFQYV  67

Query  407  FLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFLLT  586
            F+KW L F IG++  LI    NLA+EN+AG K +   N +   R+ MGF  F  TN +LT
Sbjct  68   FMKWLLCFCIGIIVSLIGFANNLAVENLAGVKFVVTSNMMIAGRFGMGFVVFSVTNLVLT  127

Query  587  MSASVLCVFXAPTAAGPGIPEIKA  658
            + ASV+  F AP AAG GIPE+KA
Sbjct  128  LFASVITAFVAPAAAGSGIPEVKA  151



>ref|XP_008452224.1| PREDICTED: LOW QUALITY PROTEIN: chloride channel protein CLC-c 
[Cucumis melo]
Length=789

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 103/150 (69%), Gaps = 2/150 (1%)
 Frame = +2

Query  215  DDDPESNSLHRPLLKRN--RTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKS  388
            D D  S +L  PLL+ +  R  +++ +A++G+ + PIESLDYEI EN+LFK DWRSR K 
Sbjct  38   DRDSVSLTLGEPLLRTSTARISTTSQLAIVGSNICPIESLDYEIIENELFKQDWRSRRKI  97

Query  389  HVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVG  568
             + QY+ LKW L   IGL+TGL+    N+A+ENIAG+KLL   N +   +Y   F  +VG
Sbjct  98   EIFQYIILKWALCLCIGLITGLVGFFNNIAVENIAGHKLLLTNNLMLKEKYFQAFVVYVG  157

Query  569  TNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            +N +L ++A++LC + AP AAG GIPE+KA
Sbjct  158  SNSVLAVAAAILCAYIAPAAAGSGIPEVKA  187



>gb|EAY94258.1| hypothetical protein OsI_16029 [Oryza sativa Indica Group]
Length=803

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 96/147 (65%), Gaps = 0/147 (0%)
 Frame = +2

Query  218  DDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVL  397
            DD       +PLL++    +++ +A++GA V PIESLDYEI ENDLFK DWRSR K  + 
Sbjct  54   DDEAGGGPRQPLLRKRTMNTTSQIAIVGANVCPIESLDYEIVENDLFKQDWRSRKKKQIF  113

Query  398  QYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNF  577
            QY+ LKW L  LIG+LTG++    NLA+ENIAG KLL   + +   RY   F  + G N 
Sbjct  114  QYIVLKWALVLLIGMLTGIVGFFNNLAVENIAGLKLLLTSDLMLKQRYFTAFLAYGGCNL  173

Query  578  LLTMSASVLCVFXAPTAAGPGIPEIKA  658
            +L  +A+ +C + AP AAG GIPE+KA
Sbjct  174  VLATTAAAICAYIAPAAAGSGIPEVKA  200



>ref|XP_010541946.1| PREDICTED: putative chloride channel-like protein CLC-g [Tarenaya 
hassleriana]
Length=775

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 101/144 (70%), Gaps = 1/144 (1%)
 Frame = +2

Query  227  ESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYV  406
             S S+  PLL R+ T S++ VA++G+ VSPIESLDYEI END FK DWR+R K+ + QYV
Sbjct  13   HSYSVSVPLL-RSATNSTSQVAIVGSDVSPIESLDYEIAENDFFKQDWRARGKAQIFQYV  71

Query  407  FLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFLLT  586
            F+KW L F +G++  LI   INLA+EN+AG K +   N + + R+ MGF  F  +N +LT
Sbjct  72   FMKWLLCFFLGVIVSLIGFAINLAVENLAGVKFVVTSNMMLSRRFGMGFLVFTVSNLVLT  131

Query  587  MSASVLCVFXAPTAAGPGIPEIKA  658
            + ASV+  F +P AAG GIPE+KA
Sbjct  132  LFASVITAFVSPAAAGSGIPEVKA  155



>ref|XP_007013578.1| Voltage-gated chloride channel family protein isoform 2 [Theobroma 
cacao]
 gb|EOY31197.1| Voltage-gated chloride channel family protein isoform 2 [Theobroma 
cacao]
Length=788

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 98/149 (66%), Gaps = 1/149 (1%)
 Frame = +2

Query  215  DDDPESNSLHRPLLKRNRTLSSTP-VAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSH  391
            D + +  SL  PLL   R+L+ST  VA++GA V PIES DYEI END FK DWR+R+K  
Sbjct  8    DQNQDHESLTIPLLSHERSLNSTSQVAIVGANVCPIESFDYEIAENDFFKQDWRTRAKIQ  67

Query  392  VLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGT  571
            + QY+F+KW L FLIG +  L+    NLA+ENIAG K +   N +   RY M F  F  +
Sbjct  68   IFQYIFMKWLLCFLIGAIVSLVGFCNNLAVENIAGIKFVVTSNMMLARRYGMAFLVFSLS  127

Query  572  NFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            N +LT+ A+++  F +P AAG GIPE+KA
Sbjct  128  NLVLTLFAAIITAFISPAAAGSGIPEVKA  156



>emb|CDM85188.1| unnamed protein product [Triticum aestivum]
Length=771

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 97/149 (65%), Gaps = 0/149 (0%)
 Frame = +2

Query  212  ADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSH  391
             D +  +  L RPLL++  + +++ +A++G  V PIESLDYEI ENDL+K DWRSR +  
Sbjct  45   GDLEDAAGGLERPLLRQRGSNTTSQMAVVGTNVCPIESLDYEIVENDLYKQDWRSRGRIQ  104

Query  392  VLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGT  571
            V QY  LKW +A L+G   GL+    N+A+ENIAGYKLL   N +  NR L  F  ++  
Sbjct  105  VFQYQVLKWLMALLVGSFVGLVGFFNNIAVENIAGYKLLLTSNLMRQNRNLEAFLLYMAC  164

Query  572  NFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            N +L  SA+ +C + AP AAG GIPE+KA
Sbjct  165  NAVLAGSAAAICAYLAPAAAGSGIPEVKA  193



>ref|XP_009363967.1| PREDICTED: putative chloride channel-like protein CLC-g [Pyrus 
x bretschneideri]
Length=778

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 100/151 (66%), Gaps = 4/151 (3%)
 Frame = +2

Query  212  ADDDPESNSLHRPLLKRNRTL--SSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSK  385
            A +DPES  +  PL+ R R+   S++ VA++GA V PIESLDYEI EN+ FK DWRSR K
Sbjct  13   AAEDPES--ITAPLISRQRSAPNSTSQVALVGANVCPIESLDYEILENECFKQDWRSRGK  70

Query  386  SHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFV  565
             H  QY+F+KW   FLIG++ GLI    NLA+ENIAG K +   N +   R+ + FA F 
Sbjct  71   VHAFQYLFMKWVSCFLIGIVVGLIGFCNNLAVENIAGIKFVVTSNMMLQRRFWLAFAVFF  130

Query  566  GTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             +NF LT+ A V+    AP AAG GIPE+KA
Sbjct  131  FSNFGLTLFAVVITALVAPAAAGSGIPEVKA  161



>ref|XP_008385147.1| PREDICTED: LOW QUALITY PROTEIN: putative chloride channel-like 
protein CLC-g, partial [Malus domestica]
Length=719

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 102/160 (64%), Gaps = 9/160 (6%)
 Frame = +2

Query  185  GSTNEMEGQADDDPESNSLHRPLLKRNRTL--SSTPVAMIGAKVSPIESLDYEINENDLF  358
            GS N  E     DPES  +  PL+ R R+   S++ VA++GA V PIESLDYEI EN+ F
Sbjct  4    GSLNTAE-----DPES--ITAPLISRQRSAPNSTSQVALVGANVCPIESLDYEILENEFF  56

Query  359  KHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNR  538
            K DWRSR K H  QY+F+KW   FLIG++ GLI    NLA+ENIAG K +   N +   R
Sbjct  57   KQDWRSRGKVHAFQYLFMKWVSCFLIGIVVGLIGFCNNLAVENIAGIKFVVTSNMMLQRR  116

Query  539  YLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            + + FA F  +NF LT+ A V+    AP AAG GIPE+KA
Sbjct  117  FWLAFAVFFLSNFGLTLFAVVITALVAPAAAGSGIPEVKA  156



>ref|XP_008354360.1| PREDICTED: putative chloride channel-like protein CLC-g [Malus 
domestica]
Length=773

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 102/161 (63%), Gaps = 9/161 (6%)
 Frame = +2

Query  182  AGSTNEMEGQADDDPESNSLHRPLLKRNRTL--SSTPVAMIGAKVSPIESLDYEINENDL  355
             GS N  E     DPES  +  PL+ R R+   S++ VA++GA V PIESLDYEI EN+ 
Sbjct  3    VGSLNTAE-----DPES--ITAPLISRQRSAPNSTSQVALVGANVCPIESLDYEILENEF  55

Query  356  FKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNN  535
            FK DWRSR K H  QY+F+KW   FLIG++ GLI    NLA+ENIAG K +   N +   
Sbjct  56   FKQDWRSRGKVHAFQYLFMKWVSCFLIGIVVGLIGFCNNLAVENIAGIKFVVTSNMMLQR  115

Query  536  RYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            R+ + FA F  +NF LT+ A V+    AP AAG GIPE+KA
Sbjct  116  RFXLAFAVFFLSNFGLTLFAVVITALVAPAAAGSGIPEVKA  156



>ref|XP_007013577.1| Voltage-gated chloride channel family protein isoform 1 [Theobroma 
cacao]
 gb|EOY31196.1| Voltage-gated chloride channel family protein isoform 1 [Theobroma 
cacao]
Length=773

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 98/149 (66%), Gaps = 1/149 (1%)
 Frame = +2

Query  215  DDDPESNSLHRPLLKRNRTLSSTP-VAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSH  391
            D + +  SL  PLL   R+L+ST  VA++GA V PIES DYEI END FK DWR+R+K  
Sbjct  8    DQNQDHESLTIPLLSHERSLNSTSQVAIVGANVCPIESFDYEIAENDFFKQDWRTRAKIQ  67

Query  392  VLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGT  571
            + QY+F+KW L FLIG +  L+    NLA+ENIAG K +   N +   RY M F  F  +
Sbjct  68   IFQYIFMKWLLCFLIGAIVSLVGFCNNLAVENIAGIKFVVTSNMMLARRYGMAFLVFSLS  127

Query  572  NFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            N +LT+ A+++  F +P AAG GIPE+KA
Sbjct  128  NLVLTLFAAIITAFISPAAAGSGIPEVKA  156



>ref|XP_008336976.1| PREDICTED: putative chloride channel-like protein CLC-g [Malus 
domestica]
Length=778

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 105/160 (66%), Gaps = 5/160 (3%)
 Frame = +2

Query  185  GSTNEMEGQADDDPESNSLHRPLLKRNRTL--SSTPVAMIGAKVSPIESLDYEINENDLF  358
            G+TN     A +DPES  +  PL+ R R    S++ VA++GA V PIESLDYEI E++ F
Sbjct  5    GNTNA-SLNAAEDPES--ITAPLISRQRYAPNSTSQVALVGANVRPIESLDYEILEBEFF  61

Query  359  KHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNR  538
            K DWRS  K+HVLQY+F+KW   FL+G++ GLIA   NLA+ENIAG K +   N +   R
Sbjct  62   KQDWRSCGKAHVLQYIFMKWVSCFLVGIVVGLIAFCNNLAVENIAGIKFVVTSNMMLQRR  121

Query  539  YLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            + + FA F  +N  LT  A V+  F AP AAG GIPE+KA
Sbjct  122  FWLAFAVFFFSNLGLTFFAVVVTAFVAPAAAGSGIPEVKA  161



>gb|ADF30876.1| chloride channel protein [Citrus trifoliata]
Length=789

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 109/172 (63%), Gaps = 8/172 (5%)
 Frame = +2

Query  167  MEFAGAGSTNEMEGQ--------ADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIE  322
            +E  G G     E +             E ++L  PLL + RT +++ +A++GA +SPIE
Sbjct  14   IEVEGGGHNGSFESERRKFVERMGSGTSEDHNLREPLLLKCRTNTTSQIAIVGANISPIE  73

Query  323  SLDYEINENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYK  502
            SLDYEI EN+LFK DWR+R K  + QYV LKWTLA LIG+LTGL A   N  +ENIAG+K
Sbjct  74   SLDYEIVENELFKQDWRARRKVEIFQYVVLKWTLALLIGVLTGLAAVFCNFFVENIAGFK  133

Query  503  LLAVLNYIDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            LL + N + N+R+ MGF      N  L + A++LC + AP AAG GIPE+KA
Sbjct  134  LLLINNLMLNDRHFMGFVANTSINLGLAILAAILCAYIAPAAAGSGIPEVKA  185



>gb|ACF87782.1| unknown [Zea mays]
 tpg|DAA35718.1| TPA: hypothetical protein ZEAMMB73_781870 [Zea mays]
Length=302

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 98/155 (63%), Gaps = 2/155 (1%)
 Frame = +2

Query  200  MEGQADDDPESNSLHRPLLKRNRTLSSTP--VAMIGAKVSPIESLDYEINENDLFKHDWR  373
            +E     D E     R  L  + T S+T   VA++GA V PIESLDYE+ END+FK DWR
Sbjct  41   LEDGGGGDEEQRRRRRRFLHGSHTHSNTTSQVALVGADVCPIESLDYELIENDVFKQDWR  100

Query  374  SRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGF  553
            +R + H+L+YV LKW L FL+G L      + NL +EN+AG K +   + + + R+   F
Sbjct  101  ARGRGHILRYVALKWALCFLVGALAAAAGFVANLGVENVAGAKFVVTSDLMLDGRHGSAF  160

Query  554  AYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            A F+ +NF LTM A+VL V+ AP AAG GIPE+KA
Sbjct  161  AVFLASNFALTMLAAVLTVYVAPAAAGSGIPEVKA  195



>ref|XP_009358559.1| PREDICTED: putative chloride channel-like protein CLC-g [Pyrus 
x bretschneideri]
Length=778

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 105/160 (66%), Gaps = 5/160 (3%)
 Frame = +2

Query  185  GSTNEMEGQADDDPESNSLHRPLLKRNRTL--SSTPVAMIGAKVSPIESLDYEINENDLF  358
            G+TN     A +DPES  +  PL+   R    S++ VA++GA V PIESLDYEI EN+ F
Sbjct  5    GNTNA-SLNAAEDPES--ITAPLISHQRYAPNSTSQVALVGANVRPIESLDYEILENEFF  61

Query  359  KHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNR  538
            K DWRS  K+HVLQY+F+KW   FL+G++ GLIA   NLA+ENIAG K +   N +   R
Sbjct  62   KQDWRSCGKAHVLQYIFMKWVSCFLVGIVVGLIAFCNNLAVENIAGVKFVVTSNMMLQRR  121

Query  539  YLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            + + FA F  +N  LT+ A V+  F AP AAG GIPE+KA
Sbjct  122  FWLAFAVFFFSNLGLTLFAVVVTAFVAPAAAGSGIPEVKA  161



>gb|EMS55037.1| Chloride channel protein CLC-c [Triticum urartu]
Length=778

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 97/149 (65%), Gaps = 0/149 (0%)
 Frame = +2

Query  212  ADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSH  391
             D +  +  L RPLL++  + +++ +A++G  V PIESLDYEI END++K DWRSR +  
Sbjct  45   GDLEDAAGGLERPLLRQRGSNTTSQMAVVGTNVCPIESLDYEIVENDVYKQDWRSRGRIQ  104

Query  392  VLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGT  571
            + QY  LKW +A L+G   GL+    N+A+ENIAGYKLL   N +  NR L  F  ++  
Sbjct  105  IFQYQVLKWLMALLVGSFVGLVGFFNNIAVENIAGYKLLLTSNLMRQNRNLEAFLLYMAC  164

Query  572  NFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            N +L  SA+ +C + AP AAG GIPE+KA
Sbjct  165  NAVLAGSAAAICAYLAPAAAGSGIPEVKA  193



>gb|EMT28663.1| Chloride channel protein CLC-c [Aegilops tauschii]
Length=792

 Score =   127 bits (320),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 97/149 (65%), Gaps = 0/149 (0%)
 Frame = +2

Query  212  ADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSH  391
             D +  +  L RPLL++  + +++ +A++G  V PIESLDYEI END++K DWRSR +  
Sbjct  42   GDLEDAAGGLERPLLRQRGSNTTSQMAVVGTNVCPIESLDYEIVENDVYKQDWRSRGRIQ  101

Query  392  VLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGT  571
            + QY  LKW +A L+G   GL+    N+A+ENIAGYKLL   N +  NR L  F  ++  
Sbjct  102  IFQYQVLKWLMALLVGSFVGLVGFFNNIAVENIAGYKLLLTSNLMRQNRNLEAFLLYMAC  161

Query  572  NFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            N +L  SA+ +C + AP AAG GIPE+KA
Sbjct  162  NAVLAGSAAAICAYLAPAAAGSGIPEVKA  190



>ref|XP_010435388.1| PREDICTED: putative chloride channel-like protein CLC-g [Camelina 
sativa]
Length=767

 Score =   127 bits (319),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 96/150 (64%), Gaps = 2/150 (1%)
 Frame = +2

Query  215  DDDPESNSLHRPLLK--RNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKS  388
             +    +S+  PLL   R  T S++ VA++G+ V PIESLDYEI END FK DWR RSK 
Sbjct  2    SNSTTEDSVAVPLLSSLRRATNSTSQVAIVGSDVCPIESLDYEIAENDFFKQDWRGRSKV  61

Query  389  HVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVG  568
             + QYV +KW L F IG++  LI    NLA+EN+AG K +   N +   R+ MGF  F  
Sbjct  62   EIFQYVVMKWLLCFCIGIIVSLIGFANNLAVENLAGIKFVFTSNMMIAGRFGMGFVVFTA  121

Query  569  TNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            TN +LT+ ASV+  F AP AAG GIPE+KA
Sbjct  122  TNLVLTLFASVITAFVAPAAAGSGIPEVKA  151



>ref|XP_003581281.1| PREDICTED: chloride channel protein CLC-c-like [Brachypodium 
distachyon]
 ref|XP_010239959.1| PREDICTED: chloride channel protein CLC-c-like [Brachypodium 
distachyon]
Length=795

 Score =   127 bits (319),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 97/147 (66%), Gaps = 2/147 (1%)
 Frame = +2

Query  218  DDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVL  397
            DD E      PLL++    +++ +A++GA V PIESLDYEI ENDLFK DWRSR K  + 
Sbjct  48   DDGEGP--REPLLRKRTMNTTSQIAIVGANVFPIESLDYEIVENDLFKQDWRSRKKKQIF  105

Query  398  QYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNF  577
            QY+ LKW L  LIG+LTGL+    NLA+ENIAG+KLL   + +   RY   F  + G N 
Sbjct  106  QYIVLKWALVLLIGVLTGLVGFFNNLAVENIAGFKLLLTGDLMLQERYFTAFLAYGGCNL  165

Query  578  LLTMSASVLCVFXAPTAAGPGIPEIKA  658
            +L  +A+ +C + AP AAG GIPE+KA
Sbjct  166  VLGATAAAICAYIAPAAAGSGIPEVKA  192



>ref|XP_010030223.1| PREDICTED: chloride channel protein CLC-c-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW57159.1| hypothetical protein EUGRSUZ_I02790 [Eucalyptus grandis]
Length=778

 Score =   127 bits (319),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 103/159 (65%), Gaps = 8/159 (5%)
 Frame = +2

Query  197  EMEGQADDDPESNSLHRPLLKR-----NRTLSSTPVAMIGAKVSPIESLDYEINENDLFK  361
            E+EG+   +     + +PLL R     +R   ++ +A++GA + PIESLDYEI ENDLFK
Sbjct  21   EIEGK---ESSPKGMRQPLLSRKHDSGSRINRTSQIAIVGANLCPIESLDYEIVENDLFK  77

Query  362  HDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRY  541
             DWRSR+KS + QYV LKWTLA LIGL TGL+    N+A+ENIAG+K L   N +   RY
Sbjct  78   QDWRSRTKSEIYQYVVLKWTLALLIGLGTGLVGFFNNIAVENIAGFKFLLANNLMLKERY  137

Query  542  LMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
               F  +   N +L ++A  LC + AP AAG GIPE+KA
Sbjct  138  YQAFVAYASCNIVLAVAAGALCAYIAPAAAGSGIPEVKA  176



>ref|XP_006470992.1| PREDICTED: chloride channel protein CLC-c-like isoform X1 [Citrus 
sinensis]
Length=789

 Score =   127 bits (319),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 108/172 (63%), Gaps = 8/172 (5%)
 Frame = +2

Query  167  MEFAGAGSTNEMEGQ--------ADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIE  322
            +E  G G     E +             E ++L  PLL + RT +++ +A++GA + PIE
Sbjct  14   IEVEGGGHNGSFESERRKFVERMGSGTSEDHNLREPLLLKCRTNTTSQIAIVGANICPIE  73

Query  323  SLDYEINENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYK  502
            SLDYEI EN+LFK DWR+R K  + QYV LKWTLA LIG+LTGL A   N  +ENIAG+K
Sbjct  74   SLDYEIVENELFKQDWRARRKVEIFQYVVLKWTLALLIGVLTGLAAVFCNFFVENIAGFK  133

Query  503  LLAVLNYIDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            LL + N + N+R+ MGF      N  L + A++LC + AP AAG GIPE+KA
Sbjct  134  LLLINNLMLNDRHFMGFVANTSINLGLAILAAILCAYIAPAAAGSGIPEVKA  185



>ref|XP_010450335.1| PREDICTED: putative chloride channel-like protein CLC-g [Camelina 
sativa]
Length=765

 Score =   127 bits (318),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 95/150 (63%), Gaps = 2/150 (1%)
 Frame = +2

Query  215  DDDPESNSLHRPLLK--RNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKS  388
             +    +S+  PLL   R  T S++ VA++G+ V PIESLDYEI END FK DWR RSK 
Sbjct  2    SNSTTEDSVAVPLLASLRRATNSTSQVAIVGSDVCPIESLDYEIAENDFFKQDWRGRSKV  61

Query  389  HVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVG  568
             + QYVF+KW L F IG+   LI    NLA+EN+AG K +   N +   R+ MG   F  
Sbjct  62   EIFQYVFMKWLLCFCIGITVSLIGFANNLAVENLAGIKFVFTSNMMIAGRFGMGIVVFTT  121

Query  569  TNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            TN +LT+ ASV+  F AP AAG GIPE+KA
Sbjct  122  TNLVLTLFASVITAFVAPAAAGSGIPEVKA  151



>gb|EPS68170.1| hypothetical protein M569_06601 [Genlisea aurea]
Length=782

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 111/167 (66%), Gaps = 4/167 (2%)
 Frame = +2

Query  167  MEFAGAGSTNEMEGQADDDPESNSLHRPLLK---RNRTLSSTPVAMIGAKVSPIESLDYE  337
            +E  G+G   ++E +  +         PLL    ++R  +++ +A++G+KV PIESLDYE
Sbjct  15   IENDGSGD-GQLERKESNWSSDGGAREPLLLHHLKHRVNTTSQIAIVGSKVYPIESLDYE  73

Query  338  INENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVL  517
            I EN+LFK DWRSR K  + QY+FLKWTL+ LIGLLTGL+    NLA+ENIAG KLL   
Sbjct  74   IIENELFKQDWRSRKKIQIFQYIFLKWTLSLLIGLLTGLVGFFNNLAVENIAGLKLLYTS  133

Query  518  NYIDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            N + N+RY   FA F G N +L   A+VLC F AP AAG GIPE+KA
Sbjct  134  NLMLNDRYFAAFAAFAGMNVILATCAAVLCAFFAPAAAGSGIPEVKA  180



>ref|XP_007204268.1| hypothetical protein PRUPE_ppa001699mg [Prunus persica]
 gb|EMJ05467.1| hypothetical protein PRUPE_ppa001699mg [Prunus persica]
Length=777

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 101/149 (68%), Gaps = 4/149 (3%)
 Frame = +2

Query  218  DDPESNSLHRPLLKRNRTL--SSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSH  391
            +DPES  +  PL+   R+   S++ VA++GA V PIESLDYEI EN+ FK DWRSR K  
Sbjct  14   EDPES--ITAPLISGQRSAPNSTSQVALVGANVCPIESLDYEILENEFFKQDWRSRGKMQ  71

Query  392  VLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGT  571
            V QY+F+KW L FL+GL+ GLI    NLA+ENIAG K +   N +  +R+L+ F  F  +
Sbjct  72   VFQYIFMKWFLCFLVGLIVGLIGFCNNLAVENIAGIKFVITSNMMLKSRFLLAFIVFFFS  131

Query  572  NFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            N  LT+ AS++  F AP AAG GIPE+KA
Sbjct  132  NLALTLFASMITSFVAPVAAGSGIPEVKA  160



>emb|CAJ86158.1| H0413E07.11 [Oryza sativa Indica Group]
 gb|EAY95784.1| hypothetical protein OsI_17659 [Oryza sativa Indica Group]
Length=802

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 100/152 (66%), Gaps = 0/152 (0%)
 Frame = +2

Query  203  EGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRS  382
            +G  D++         L  R+++ +++ VA++G  V PIESLDYE+ EN++FK DWR+R 
Sbjct  39   DGDGDEEARRRRRRFLLAGRSQSNTTSQVALVGVGVCPIESLDYELIENEVFKQDWRARG  98

Query  383  KSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYF  562
            + H+L+YV LKW L FL+G+L+     + NL +EN+AG K +   N +   RY   FA F
Sbjct  99   RGHILRYVALKWALCFLVGVLSAAAGFVANLGVENVAGAKFVVTSNLMLAGRYGTAFAVF  158

Query  563  VGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            + +NF LTM A+VL V+ AP AAG GIPE+KA
Sbjct  159  LVSNFALTMLATVLTVYVAPAAAGSGIPEVKA  190



>emb|CAD41919.2| OSJNBa0033G05.20 [Oryza sativa Japonica Group]
Length=802

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 100/152 (66%), Gaps = 0/152 (0%)
 Frame = +2

Query  203  EGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRS  382
            +G  D++         L  R+++ +++ VA++G  V PIESLDYE+ EN++FK DWR+R 
Sbjct  39   DGDGDEEARRRRRRFLLAGRSQSNTTSQVALVGVGVCPIESLDYELIENEVFKQDWRARG  98

Query  383  KSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYF  562
            + H+L+YV LKW L FL+G+L+     + NL +EN+AG K +   N +   RY   FA F
Sbjct  99   RGHILRYVALKWALCFLVGVLSAAAGFVANLGVENVAGAKFVVTSNLMLAGRYGTAFAVF  158

Query  563  VGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            + +NF LTM A+VL V+ AP AAG GIPE+KA
Sbjct  159  LVSNFALTMLATVLTVYVAPAAAGSGIPEVKA  190



>gb|ABB86548.1| chloride channel-like protein Osclc [Oryza sativa Japonica Group]
Length=808

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 100/152 (66%), Gaps = 0/152 (0%)
 Frame = +2

Query  203  EGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRS  382
            +G  D++         L  R+++ +++ VA++G  V PIESLDYE+ EN++FK DWR+R 
Sbjct  39   DGDGDEEARRRRRRFLLAGRSQSNTTSQVALVGVGVCPIESLDYELIENEVFKQDWRARG  98

Query  383  KSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYF  562
            + H+L+YV LKW L FL+G+L+     + NL +EN+AG K +   N +   RY   FA F
Sbjct  99   RGHILRYVALKWALCFLVGVLSAAAGFVANLGVENVAGAKFVVTSNLMLAGRYGTAFAVF  158

Query  563  VGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            + +NF LTM A+VL V+ AP AAG GIPE+KA
Sbjct  159  LVSNFALTMLATVLTVYVAPAAAGSGIPEVKA  190



>ref|XP_006652911.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
[Oryza brachyantha]
Length=808

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 98/152 (64%), Gaps = 0/152 (0%)
 Frame = +2

Query  203  EGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRS  382
            +G+ D++         L  R+ T +++ VAM+G+   PIESLDYE+ END+FK DWR+R 
Sbjct  40   DGEGDEEQRRRXXXXXLPHRSATNNTSQVAMVGSNPCPIESLDYELIENDVFKQDWRARG  99

Query  383  KSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYF  562
            + H+L+YV LKW L FL+G L      + NL +EN+AG K +   N +   RY   FA F
Sbjct  100  RGHILRYVALKWGLCFLVGALAAAAGFVANLGVENVAGAKFVVTSNLMLAGRYGAAFAVF  159

Query  563  VGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            + +NF LTM A+VL V+ AP AAG GIPE+KA
Sbjct  160  MVSNFGLTMFATVLTVYVAPAAAGSGIPEVKA  191



>dbj|BAB97267.1| chloride channel [Oryza sativa Japonica Group]
Length=801

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 96/149 (64%), Gaps = 2/149 (1%)
 Frame = +2

Query  218  DDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVL  397
            DD       +PLL++    +++ +A++GA V PIESLDYEI ENDLFK DWRSR K  + 
Sbjct  50   DDEAGGGPRQPLLRKRTMNTTSQIAIVGANVCPIESLDYEIVENDLFKQDWRSRKKKQIF  109

Query  398  QYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYI--DNNRYLMGFAYFVGT  571
            QY+ LKW L  LIG+LTG++    NLA+ENIAG KLL   + +     RY   F  + G 
Sbjct  110  QYIVLKWALVLLIGMLTGIVGFFNNLAVENIAGLKLLLTSDLMLKQKCRYFTAFLAYGGC  169

Query  572  NFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            N +L  +A+ +C + AP AAG GIPE+KA
Sbjct  170  NLVLATTAAAICAYIAPAAAGSGIPEVKA  198



>ref|XP_009355373.1| PREDICTED: chloride channel protein CLC-c-like [Pyrus x bretschneideri]
Length=758

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 104/155 (67%), Gaps = 1/155 (1%)
 Frame = +2

Query  197  EMEGQADDDPESNSLHRPLLKRNRTLSSTP-VAMIGAKVSPIESLDYEINENDLFKHDWR  373
            E+E +   + E   L  PLL+RNR  ++T  +A++GA  SPIESLDYEI ENDLFK DWR
Sbjct  2    ELEEEKSIEIERGGLREPLLERNRRRNTTSQLAIVGANFSPIESLDYEIIENDLFKQDWR  61

Query  374  SRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGF  553
            SR+K  + QYV LKW L  LIGL TGL+    NLA+ENIAG+KLL   N +  ++Y   F
Sbjct  62   SRTKGEIFQYVCLKWALVLLIGLSTGLVGFFNNLAVENIAGFKLLLTNNLMLQDKYYQAF  121

Query  554  AYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            A FV  N  L  +A+ LC + AP AAG GIPE+KA
Sbjct  122  AAFVCCNMTLAAAAAALCAYIAPAAAGSGIPEVKA  156



>ref|XP_006283171.1| hypothetical protein CARUB_v10004204mg [Capsella rubella]
 ref|XP_006283172.1| hypothetical protein CARUB_v10004204mg [Capsella rubella]
 gb|EOA16069.1| hypothetical protein CARUB_v10004204mg [Capsella rubella]
 gb|EOA16070.1| hypothetical protein CARUB_v10004204mg [Capsella rubella]
Length=766

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 97/152 (64%), Gaps = 2/152 (1%)
 Frame = +2

Query  209  QADDDPESNSLHRPLLK--RNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRS  382
             + +    +++  PL+   R  T S++ VA++G+ V PIESLDYEI END FK DWR RS
Sbjct  1    MSSNSTTEDTVAVPLISSLRRATNSTSQVAIVGSNVCPIESLDYEIAENDFFKQDWRGRS  60

Query  383  KSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYF  562
            K  + QYVF+KW L F IG++  LI    NLA+EN+AG K +   N +   R+ MGF  F
Sbjct  61   KVEIFQYVFMKWLLCFCIGIIVSLIGFANNLAVENLAGVKFVFTSNMMIARRFGMGFVVF  120

Query  563  VGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
               N +LT+ ASV+  F AP AAG GIPE+KA
Sbjct  121  TVINLVLTLFASVITAFVAPAAAGSGIPEVKA  152



>ref|XP_006431490.1| hypothetical protein CICLE_v10000336mg [Citrus clementina]
 gb|ESR44730.1| hypothetical protein CICLE_v10000336mg [Citrus clementina]
Length=789

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 107/172 (62%), Gaps = 8/172 (5%)
 Frame = +2

Query  167  MEFAGAGSTNEMEGQ--------ADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIE  322
            +E  G G     E +             E ++L  PLL + RT +++ +A++GA + PIE
Sbjct  14   IEVEGGGHNGSFESERRKFVERMGSGTSEDHNLREPLLLKCRTNTTSQIAIVGANICPIE  73

Query  323  SLDYEINENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYK  502
            SLDYEI EN+LFK DWR+R K  + QYV  KWTLA LIG+LTGL A   N  +ENIAG+K
Sbjct  74   SLDYEIVENELFKQDWRARRKVEIFQYVVFKWTLALLIGVLTGLAAVFCNFFVENIAGFK  133

Query  503  LLAVLNYIDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            LL + N + N+R+ MGF      N  L + A++LC + AP AAG GIPE+KA
Sbjct  134  LLLINNLMLNDRHFMGFVANTSINLGLAILAAILCAYIAPAAAGSGIPEVKA  185



>ref|XP_008242835.1| PREDICTED: putative chloride channel-like protein CLC-g [Prunus 
mume]
Length=775

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 100/149 (67%), Gaps = 4/149 (3%)
 Frame = +2

Query  218  DDPESNSLHRPLLKRNRTL--SSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSH  391
            +DPES  +  PL+   R+   S++ VA++GA V P+ESLDYEI EN+ FK DWRSR K  
Sbjct  14   EDPES--ITAPLISGQRSAPNSTSQVALVGANVCPVESLDYEILENEFFKQDWRSRGKMQ  71

Query  392  VLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGT  571
            V QY+F+KW L FL+GL+ GLI    NLA+ENIAG K +   N +   R+L+ F  F  +
Sbjct  72   VFQYIFMKWILCFLVGLIVGLIGFCNNLAVENIAGIKFVITSNMMLKRRFLLAFIVFFFS  131

Query  572  NFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            N  LT+ AS++  F AP AAG GIPE+KA
Sbjct  132  NLALTLFASMITSFVAPVAAGSGIPEVKA  160



>gb|KDO42564.1| hypothetical protein CISIN_1g003885mg [Citrus sinensis]
Length=789

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 107/172 (62%), Gaps = 8/172 (5%)
 Frame = +2

Query  167  MEFAGAGSTNEMEGQ--------ADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIE  322
            +E  G G     E +             E ++L  PLL + RT +++ +A++GA + PIE
Sbjct  14   IEVEGGGHNGSFESERRKFVERMGSGTSEDHNLREPLLLKCRTNTTSQIAIVGANICPIE  73

Query  323  SLDYEINENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYK  502
            SLDYEI EN+LFK DWR+R K  + QYV  KWTLA LIG+LTGL A   N  +ENIAG+K
Sbjct  74   SLDYEIVENELFKQDWRARRKVEIFQYVVFKWTLALLIGVLTGLAAVFCNFFVENIAGFK  133

Query  503  LLAVLNYIDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            LL + N + N+R+ MGF      N  L + A++LC + AP AAG GIPE+KA
Sbjct  134  LLLINNLMLNDRHFMGFVANTSINLGLAILAAILCAYIAPAAAGSGIPEVKA  185



>gb|KHN47107.1| Putative chloride channel-like protein CLC-g [Glycine soja]
Length=765

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 95/142 (67%), Gaps = 2/142 (1%)
 Frame = +2

Query  239  LHRPLLKRNRTL--SSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  412
            L RPLL   R++  S++ VA++G+ VSPIESLDYEI EN+ FKHDWRSR K+ + Q++ +
Sbjct  15   LRRPLLSSQRSIVNSTSQVAIVGSNVSPIESLDYEIFENEFFKHDWRSRGKAQIFQFMIM  74

Query  413  KWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFLLTMS  592
            KW L  LIG++  L+    NLA+EN+AG K +   N +   R+LM F  F  +N +LT+ 
Sbjct  75   KWLLCLLIGMIVCLVGFCNNLAVENLAGIKFVVTSNMMLERRFLMAFLVFFVSNLVLTVF  134

Query  593  ASVLCVFXAPTAAGPGIPEIKA  658
            A  +    APTA G GIPE+KA
Sbjct  135  ACTITALIAPTATGSGIPEVKA  156



>ref|XP_006836849.1| hypothetical protein AMTR_s00099p00074960 [Amborella trichopoda]
 gb|ERM99702.1| hypothetical protein AMTR_s00099p00074960 [Amborella trichopoda]
Length=772

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 99/150 (66%), Gaps = 1/150 (1%)
 Frame = +2

Query  209  QADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKS  388
            +++       L  PLLK+ R  +S  +A++G+ V P+ESLDYEI END FK DWRSR + 
Sbjct  21   RSESAHSGKHLRVPLLKQRRNTTSQ-LAIVGSNVCPVESLDYEIIENDTFKQDWRSRKRV  79

Query  389  HVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVG  568
             + QYVFLKWTLA LIGL TG +    N+A+ENIAG+KLL   N +   +Y++ F  + G
Sbjct  80   QIFQYVFLKWTLALLIGLCTGFVGFFNNIAVENIAGFKLLLTNNLMLQQKYVLAFFAYAG  139

Query  569  TNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             N +L   ++ +C + AP AAG GIPE+KA
Sbjct  140  CNLVLAAVSATVCAYIAPAAAGSGIPEVKA  169



>ref|XP_010025693.1| PREDICTED: chloride channel protein CLC-c-like [Eucalyptus grandis]
 gb|KCW62414.1| hypothetical protein EUGRSUZ_H05062 [Eucalyptus grandis]
Length=783

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 101/164 (62%), Gaps = 0/164 (0%)
 Frame = +2

Query  167  MEFAGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINE  346
            +E  G     E+E       E N   R  L   R  +++ +A++G+ V PIESLDYEI E
Sbjct  16   VESEGLLDGKEIERYWSGISEKNMTFREPLLVKRVNTTSQIAIVGSNVCPIESLDYEIVE  75

Query  347  NDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYI  526
            N+LFK DWRSR K  + QY+ LKW  A +IGL TGL+    N+A+ENIAGYKLL   + +
Sbjct  76   NELFKQDWRSRKKIQIFQYILLKWAFALIIGLGTGLVGFFNNIAVENIAGYKLLLATDLM  135

Query  527  DNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
              +RY   FA F G N +L ++A  LC F AP AAG GIPE+KA
Sbjct  136  SKDRYFAAFAAFAGCNVVLAIAAGALCAFIAPAAAGSGIPEVKA  179



>ref|XP_003542650.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
[Glycine max]
Length=765

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 95/142 (67%), Gaps = 2/142 (1%)
 Frame = +2

Query  239  LHRPLLKRNRTL--SSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFL  412
            L RPLL   R++  S++ VA++G+ VSPIESLDYEI EN+ FKHDWRSR K+ + Q++ +
Sbjct  15   LRRPLLSSQRSIVNSTSQVAIVGSNVSPIESLDYEIFENEFFKHDWRSRGKAQIFQFMIM  74

Query  413  KWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFLLTMS  592
            KW L  LIG++  L+    NLA+EN+AG K +   N +   R+LM F  F  +N +LT+ 
Sbjct  75   KWLLCLLIGMIVCLVGFCNNLAVENLAGIKFVVTSNMMLERRFLMAFLVFFVSNLVLTVF  134

Query  593  ASVLCVFXAPTAAGPGIPEIKA  658
            A  +    APTA G GIPE+KA
Sbjct  135  ACTITALIAPTATGSGIPEVKA  156



>gb|EEE61792.1| hypothetical protein OsJ_16396 [Oryza sativa Japonica Group]
Length=844

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 100/152 (66%), Gaps = 0/152 (0%)
 Frame = +2

Query  203  EGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRS  382
            +G  D++         L  R+++ +++ VA++G  V PIESLDYE+ EN++FK DWR+R 
Sbjct  75   DGDGDEEARRRRRRFLLAGRSQSNTTSQVALVGVGVCPIESLDYELIENEVFKQDWRARG  134

Query  383  KSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYF  562
            + H+L+YV LKW L FL+G+L+     + NL +EN+AG K +   N +   RY   FA F
Sbjct  135  RGHILRYVALKWALCFLVGVLSAAAGFVANLGVENVAGAKFVVTSNLMLAGRYGTAFAVF  194

Query  563  VGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            + +NF LTM A+VL V+ AP AAG GIPE+KA
Sbjct  195  LVSNFALTMLATVLTVYVAPAAAGSGIPEVKA  226



>ref|XP_009586704.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Nicotiana tomentosiformis]
Length=788

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 100/152 (66%), Gaps = 0/152 (0%)
 Frame = +2

Query  203  EGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRS  382
            E +AD++  +  L    L+R+ + +++ VA++G+ V PIESLDYEI+END FK DWR R 
Sbjct  20   ETEADEESLTQPLLLNGLRRSASNTTSQVAIVGSNVCPIESLDYEISENDYFKQDWRRRE  79

Query  383  KSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYF  562
            K   LQYVF+KW + F IGLL GL+    NLA+ENIAG K +   N +   RY   F  F
Sbjct  80   KIQTLQYVFMKWMMCFFIGLLVGLVGFCNNLAVENIAGTKFVVTSNMMLARRYTTAFLVF  139

Query  563  VGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
              +NF LT+ AS++  F AP AAG GIPE+KA
Sbjct  140  ASSNFGLTLFASLITAFIAPEAAGSGIPEVKA  171



>ref|XP_010250239.1| PREDICTED: putative chloride channel-like protein CLC-g [Nelumbo 
nucifera]
Length=776

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 102/156 (65%), Gaps = 8/156 (5%)
 Frame = +2

Query  215  DDDPESNSLHRPLL--------KRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDW  370
            + D E+  L  PLL        +R+ + +++ VA++G+ V PIESLDYEI END FK DW
Sbjct  4    EADEEAPPLTEPLLNNHLQFQLRRSASNTTSQVAIVGSNVCPIESLDYEIIENDFFKQDW  63

Query  371  RSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMG  550
            RSR K  + QY+F+KW+L FLIGL  GL+  LINLA+ENIAG K +   N +   RY   
Sbjct  64   RSRGKIQIFQYIFMKWSLCFLIGLFAGLVGFLINLAVENIAGIKFVITSNMMLEKRYATA  123

Query  551  FAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            F  F  +NF+L + +SV+  F AP AAG GIPE+KA
Sbjct  124  FGVFAASNFVLILFSSVITTFIAPAAAGSGIPEVKA  159



>gb|EMT27046.1| Chloride channel protein CLC-c [Aegilops tauschii]
Length=768

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 104/163 (64%), Gaps = 8/163 (5%)
 Frame = +2

Query  179  GAG---STNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINEN  349
            GAG   S++ +    DD P       PLL++    +++ +A++GA V  IESLDYEI EN
Sbjct  45   GAGRYASSDALLRYDDDGPR-----EPLLRKRTMNTTSQIAIVGANVFAIESLDYEIVEN  99

Query  350  DLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYID  529
            DLFK DWRSR K+ + QYV LKW L  LIGLLTGL+    NLA+ENIAG+KL+   + + 
Sbjct  100  DLFKQDWRSRKKNQIFQYVVLKWALVLLIGLLTGLVGFFNNLAVENIAGFKLVLTGDLML  159

Query  530  NNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
              RY   F  + G N +L  +A+ LC + AP AAG GIPE+KA
Sbjct  160  QKRYFTAFLAYGGCNLVLGATAAALCAYIAPAAAGSGIPEVKA  202



>ref|XP_010905336.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Elaeis guineensis]
 ref|XP_010905338.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Elaeis guineensis]
 ref|XP_010905339.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Elaeis guineensis]
Length=779

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 97/139 (70%), Gaps = 0/139 (0%)
 Frame = +2

Query  242  HRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFLKWt  421
            HR  L R  + +++ VA++GA V PIESLDYE+ EN+ FK DWRSR ++++ +YV LKW+
Sbjct  20   HRINLLRLASNTTSQVAIVGAHVCPIESLDYELIENEFFKQDWRSRGRAYIFRYVTLKWS  79

Query  422  lafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFLLTMSASV  601
            L FLIG L G +    NLA+ENIAG K +   N + + +Y   FA F G+NF+LTM ASV
Sbjct  80   LCFLIGALAGAVGFFNNLAVENIAGVKFVVTSNMMLSRKYGWAFAVFAGSNFVLTMFASV  139

Query  602  LCVFXAPTAAGPGIPEIKA  658
            +  + AP AAG GIPE+KA
Sbjct  140  ITAYMAPAAAGSGIPEVKA  158



>gb|ADW93911.1| chloride channel 1 [Hordeum vulgare subsp. vulgare]
Length=799

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 103/163 (63%), Gaps = 8/163 (5%)
 Frame = +2

Query  179  GAG---STNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINEN  349
            GAG   S++ +    DD P       PL+++    +++ +A++GA V  IESLDYEI EN
Sbjct  39   GAGRYASSDALLRYDDDGPR-----EPLMRKRTMNTTSQIAIVGANVFAIESLDYEIVEN  93

Query  350  DLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYID  529
            DLFK DWRSR K+ + QYV LKW L  LIGLLTGL+    NLA+ENIAG+KL+   + + 
Sbjct  94   DLFKQDWRSRKKNQIFQYVVLKWALVLLIGLLTGLVGFFNNLAVENIAGFKLVLTGDLML  153

Query  530  NNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
              RY   F  + G N  L  +A+ LC + AP AAG GIPE+KA
Sbjct  154  QKRYFTAFLAYGGCNLFLGATAAALCAYIAPAAAGSGIPEVKA  196



>gb|KDP42489.1| hypothetical protein JCGZ_00286 [Jatropha curcas]
Length=768

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 114/167 (68%), Gaps = 4/167 (2%)
 Frame = +2

Query  167  MEFAGAGSTNEMEGQ---ADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYE  337
            M+    G   E+EG     ++D E NS+  PLL RNR  +++ +A++GA V PIESLDYE
Sbjct  1    MDHTREGYDIEVEGSFAGMEEDKEFNSMREPLL-RNRKNTTSQIAIVGANVCPIESLDYE  59

Query  338  INENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVL  517
            I EN+L K DWRSR K  + QY+FLKWTLA LIGL T L+    NLA+ENIAG+KLL   
Sbjct  60   IFENELIKQDWRSRKKIEIFQYIFLKWTLALLIGLGTALVGLFNNLAVENIAGFKLLWTN  119

Query  518  NYIDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            + +  ++Y  GFA + G+N +L ++A+ LC + AP AAG GIPE+KA
Sbjct  120  SLMLQDKYYQGFAAYAGSNLILAIAAAALCAYVAPAAAGSGIPEVKA  166



>ref|XP_002447212.1| hypothetical protein SORBIDRAFT_06g030530 [Sorghum bicolor]
 gb|EES11540.1| hypothetical protein SORBIDRAFT_06g030530 [Sorghum bicolor]
Length=814

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 98/155 (63%), Gaps = 2/155 (1%)
 Frame = +2

Query  200  MEGQADDDPESNSLHRPLLKRNRTLSSTP--VAMIGAKVSPIESLDYEINENDLFKHDWR  373
            +E     D E     R  +  + T S+T   VA++G  V PIESLDYE+ END+FK DWR
Sbjct  43   LEDGGGGDEEQRRRRRRFIHGSHTHSNTTSQVALVGTDVCPIESLDYELIENDVFKQDWR  102

Query  374  SRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGF  553
            +R + H+L+YV LKW L FL+G LT     + NL +EN+AG K +   N + + R+   F
Sbjct  103  ARGRGHILRYVALKWALCFLVGALTAAAGFVANLGVENVAGAKFVVTSNLMLDGRHGSAF  162

Query  554  AYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            A F+ +NF LTM A+VL V+ AP AAG GIPE+KA
Sbjct  163  AVFLSSNFALTMLATVLTVYVAPAAAGSGIPEVKA  197



>gb|KFK30515.1| hypothetical protein AALP_AA7G272300 [Arabis alpina]
Length=765

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 96/143 (67%), Gaps = 2/143 (1%)
 Frame = +2

Query  236  SLHRPLL-KRNRTLSSTP-VAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVF  409
            S+  PLL    RT++ST  VA++G+ + PIESLDYEI END FK DWR+RSK  + QYVF
Sbjct  9    SVAVPLLPSLRRTINSTSQVAIVGSNLCPIESLDYEIEENDFFKQDWRARSKVQIFQYVF  68

Query  410  LKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFLLTM  589
            +KW L F IG++  LI    NLA+EN+AG K +   N +   R+ MGF  F  TN +LT+
Sbjct  69   MKWLLCFFIGIIVSLIGFTNNLAVENLAGVKFVITSNMMLAGRFSMGFLVFSLTNLVLTL  128

Query  590  SASVLCVFXAPTAAGPGIPEIKA  658
             AS +  F AP AAG GIPE+KA
Sbjct  129  FASAVTSFVAPAAAGSGIPEVKA  151



>tpg|DAA35719.1| TPA: hypothetical protein ZEAMMB73_781870, partial [Zea mays]
Length=827

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 98/155 (63%), Gaps = 2/155 (1%)
 Frame = +2

Query  200  MEGQADDDPESNSLHRPLLKRNRTLSSTP--VAMIGAKVSPIESLDYEINENDLFKHDWR  373
            +E     D E     R  L  + T S+T   VA++GA V PIESLDYE+ END+FK DWR
Sbjct  41   LEDGGGGDEEQRRRRRRFLHGSHTHSNTTSQVALVGADVCPIESLDYELIENDVFKQDWR  100

Query  374  SRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGF  553
            +R + H+L+YV LKW L FL+G L      + NL +EN+AG K +   + + + R+   F
Sbjct  101  ARGRGHILRYVALKWALCFLVGALAAAAGFVANLGVENVAGAKFVVTSDLMLDGRHGSAF  160

Query  554  AYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            A F+ +NF LTM A+VL V+ AP AAG GIPE+KA
Sbjct  161  AVFLASNFALTMLAAVLTVYVAPAAAGSGIPEVKA  195



>ref|XP_008667038.1| PREDICTED: chloride channel G isoform X1 [Zea mays]
Length=812

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 98/155 (63%), Gaps = 2/155 (1%)
 Frame = +2

Query  200  MEGQADDDPESNSLHRPLLKRNRTLSSTP--VAMIGAKVSPIESLDYEINENDLFKHDWR  373
            +E     D E     R  L  + T S+T   VA++GA V PIESLDYE+ END+FK DWR
Sbjct  41   LEDGGGGDEEQRRRRRRFLHGSHTHSNTTSQVALVGADVCPIESLDYELIENDVFKQDWR  100

Query  374  SRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGF  553
            +R + H+L+YV LKW L FL+G L      + NL +EN+AG K +   + + + R+   F
Sbjct  101  ARGRGHILRYVALKWALCFLVGALAAAAGFVANLGVENVAGAKFVVTSDLMLDGRHGSAF  160

Query  554  AYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            A F+ +NF LTM A+VL V+ AP AAG GIPE+KA
Sbjct  161  AVFLASNFALTMLAAVLTVYVAPAAAGSGIPEVKA  195



>ref|XP_008378937.1| PREDICTED: chloride channel protein CLC-c-like isoform X2 [Malus 
domestica]
Length=181

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 95/140 (68%), Gaps = 1/140 (1%)
 Frame = +2

Query  242  HRPLLKRNRTLSSTP-VAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFLKW  418
              PLL+RNR  ++T  +A++GA +SPIESLDYEI ENDLFK +WRSR+K+ + QYV L W
Sbjct  17   REPLLERNRRRNTTSQLAIVGAXLSPIESLDYEIIENDLFKQBWRSRTKAEIFQYVCLXW  76

Query  419  tlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFLLTMSAS  598
             L  LI L T L+    NLA+ENIAG+KLL     +  ++Y   FA FV  N  L  +A+
Sbjct  77   ALVLLIXLXTXLVGFFNNLAVENIAGFKLLLTNXLMLQDKYYQAFAAFVCCNITLAAAAA  136

Query  599  VLCVFXAPTAAGPGIPEIKA  658
             LC + AP AAG GIPE+KA
Sbjct  137  ALCAYIAPAAAGSGIPEVKA  156



>ref|XP_008793993.1| PREDICTED: putative chloride channel-like protein CLC-g [Phoenix 
dactylifera]
Length=774

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 96/139 (69%), Gaps = 1/139 (1%)
 Frame = +2

Query  242  HRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFLKWt  421
            HR  L+R+ +  ++ VA++G+ V PIESLDYE+ ENDLFK DWR R ++H++ YV LKW+
Sbjct  16   HRINLRRSASNVTSQVAIVGSHVCPIESLDYELVENDLFK-DWRHRGRAHIICYVTLKWS  74

Query  422  lafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFLLTMSASV  601
            L FLIG L G +    NLA+ENIAG+K +   N +   +Y   F  F G+NF+L M ASV
Sbjct  75   LCFLIGALAGAVGFFNNLAVENIAGFKFVVTSNLMLAKKYAWAFGVFAGSNFVLAMFASV  134

Query  602  LCVFXAPTAAGPGIPEIKA  658
            L  + AP AAG GIPE+KA
Sbjct  135  LTAYIAPAAAGSGIPEVKA  153



>gb|KJB64678.1| hypothetical protein B456_010G060300 [Gossypium raimondii]
Length=774

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 95/146 (65%), Gaps = 2/146 (1%)
 Frame = +2

Query  227  ESNSLHRPLLK-RNRTLSSTP-VAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQ  400
            + +SL  PLL  + R+++ST  VA++GA V PIESLDYEI END FK DWR+R K  + Q
Sbjct  12   DHDSLTIPLLSHQQRSINSTSQVAIVGANVCPIESLDYEIVENDFFKQDWRARGKVQIFQ  71

Query  401  YVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFL  580
            Y+F+KW L FLIG    L     NLA+ENIAG K +   N +   RY M F  F  +N  
Sbjct  72   YIFMKWLLCFLIGGFVSLAGFFNNLAVENIAGVKFVITSNMMLAQRYWMAFLVFSLSNLA  131

Query  581  LTMSASVLCVFXAPTAAGPGIPEIKA  658
            LT+ A+++  F +P AAG GIPE+KA
Sbjct  132  LTLFAAIITAFISPAAAGSGIPEVKA  157



>ref|XP_009777968.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Nicotiana sylvestris]
Length=788

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 103/162 (64%), Gaps = 8/162 (5%)
 Frame = +2

Query  185  GSTNEMEGQADDDPESNSLHRPLL----KRNRTLSSTPVAMIGAKVSPIESLDYEINEND  352
            G+    E +AD++    SL RPLL    +R+ + +++ VA++G+ V PIESLDYEI+END
Sbjct  14   GTAPSPETEADEE----SLTRPLLLNGLRRSASNTTSQVAIVGSNVCPIESLDYEISEND  69

Query  353  LFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDN  532
             FK DWR   K   LQY+F+KW + F IGLL GL+    NLA+ENIAG K +   N +  
Sbjct  70   YFKQDWRRGEKIQTLQYIFMKWMMCFFIGLLVGLVGFCNNLAVENIAGTKFVVTSNMMLA  129

Query  533  NRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             RY   F  F  +NF LT+ A ++  F AP AAG GIPE+KA
Sbjct  130  RRYTTAFLVFASSNFGLTLFAGLITAFIAPEAAGSGIPEVKA  171



>ref|XP_010241599.1| PREDICTED: LOW QUALITY PROTEIN: putative chloride channel-like 
protein CLC-g [Nelumbo nucifera]
Length=781

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 99/152 (65%), Gaps = 0/152 (0%)
 Frame = +2

Query  203  EGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRS  382
            E     +P  +S    LL+R+ + +++ VA +G+ V PIESLDYEI END FK DWRSR 
Sbjct  8    EAPPPTEPLLDSHQLLLLRRSASNTTSQVAFVGSNVCPIESLDYEIIENDFFKQDWRSRG  67

Query  383  KSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYF  562
            K  +LQY+F+KWTL FL+G+  GLI    NLA+ENIAG K +   N +   RY   F  F
Sbjct  68   KVQILQYIFMKWTLCFLVGIFAGLIGFFNNLAVENIAGMKFVITSNMMLERRYAAAFGVF  127

Query  563  VGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
              TNF++ + +S++  F AP AAG GIPE+KA
Sbjct  128  ASTNFVVILFSSLITTFIAPAAAGSGIPEVKA  159



>ref|XP_009405902.1| PREDICTED: chloride channel protein CLC-c-like [Musa acuminata 
subsp. malaccensis]
Length=780

 Score =   122 bits (305),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 110/162 (68%), Gaps = 4/162 (2%)
 Frame = +2

Query  185  GSTNEMEGQA----DDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINEND  352
            G+  EME  A    +++ ++ S+ +PLL++    +++ +A++GA V PIESLDYEI END
Sbjct  16   GARREMERNASGFYENENDAGSVRQPLLRKRTMNTTSQIAIVGANVCPIESLDYEIVEND  75

Query  353  LFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDN  532
            LFK DWRSR K  + QYV LKWTLA LIGL TG+I  L NLA+ENIAG KLL   N +  
Sbjct  76   LFKQDWRSRKKVQIFQYVLLKWTLALLIGLATGIIGFLNNLAVENIAGLKLLLTSNLMLE  135

Query  533  NRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            NRY   F  + G N +L  +A+ LC + AP AAG GIPE+KA
Sbjct  136  NRYFTAFLAYGGINLILAAAAAALCAYVAPAAAGSGIPEVKA  177



>gb|KJB46914.1| hypothetical protein B456_008G001200 [Gossypium raimondii]
Length=761

 Score =   121 bits (304),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 97/151 (64%), Gaps = 5/151 (3%)
 Frame = +2

Query  218  DDPESNSLHR----PLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSK  385
            DD ES  + R    PLL + R  +++ +A++GA V P+ESLDYE+ EN+L   DWRSR  
Sbjct  10   DDFESEVMERIYSKPLLIK-RVNTTSQIAIVGANVCPVESLDYEVPENELVNEDWRSRRT  68

Query  386  SHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFV  565
              ++QY+ LKW  A +IGL TGL+    N+A+ENIAG+KLL     +  ++Y   FA + 
Sbjct  69   VQIVQYILLKWAFALIIGLSTGLVGIFNNIAVENIAGFKLLLTTELMLKHKYYKAFAAYA  128

Query  566  GTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            G N  L  SA+ LC F AP AAG GIPE+KA
Sbjct  129  GCNLGLATSAAALCAFIAPAAAGSGIPEVKA  159



>ref|XP_008365341.1| PREDICTED: chloride channel protein CLC-c-like [Malus domestica]
Length=216

 Score =   115 bits (289),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 95/140 (68%), Gaps = 1/140 (1%)
 Frame = +2

Query  242  HRPLLKRNRTLSSTP-VAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFLKW  418
              PLL+RNR  ++T  +A++GA +SPIESLDYEI ENDLFK +WRSR+K+ + QYV L W
Sbjct  17   REPLLERNRRRNTTSQLAIVGAXLSPIESLDYEIIENDLFKQBWRSRTKAEIFQYVCLXW  76

Query  419  tlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFLLTMSAS  598
             L  LI L T L+    NLA+ENIAG+KLL     +  ++Y   FA FV  N  L  +A+
Sbjct  77   ALVLLIXLXTXLVGFFNNLAVENIAGFKLLLTNXLMLQDKYYQAFAAFVCCNITLAAAAA  136

Query  599  VLCVFXAPTAAGPGIPEIKA  658
             LC + AP AAG GIPE+KA
Sbjct  137  ALCAYIAPAAAGSGIPEVKA  156



>ref|XP_009401374.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=742

 Score =   121 bits (304),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 94/139 (68%), Gaps = 0/139 (0%)
 Frame = +2

Query  242  HRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFLKWt  421
            HR  ++R+ + +++ VA+IG+ + PIESLDYE+ END  K DWRSR   H+++YV LKWT
Sbjct  27   HRSRIRRSTSNTTSQVALIGSNLCPIESLDYELIENDFLKQDWRSRGPGHIVRYVILKWT  86

Query  422  lafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFLLTMSASV  601
            L FL+G L G +    NLA+ENIAG K +   N +   ++   F  F GTNF+L M AS+
Sbjct  87   LCFLVGALAGAVGFFNNLAVENIAGVKFVITSNMMLVRKFGWAFGVFAGTNFVLLMFASM  146

Query  602  LCVFXAPTAAGPGIPEIKA  658
            +  F +P AAG GIPE+KA
Sbjct  147  ITTFISPAAAGSGIPEVKA  165



>ref|XP_009401373.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=786

 Score =   121 bits (304),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 94/139 (68%), Gaps = 0/139 (0%)
 Frame = +2

Query  242  HRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFLKWt  421
            HR  ++R+ + +++ VA+IG+ + PIESLDYE+ END  K DWRSR   H+++YV LKWT
Sbjct  27   HRSRIRRSTSNTTSQVALIGSNLCPIESLDYELIENDFLKQDWRSRGPGHIVRYVILKWT  86

Query  422  lafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFLLTMSASV  601
            L FL+G L G +    NLA+ENIAG K +   N +   ++   F  F GTNF+L M AS+
Sbjct  87   LCFLVGALAGAVGFFNNLAVENIAGVKFVITSNMMLVRKFGWAFGVFAGTNFVLLMFASM  146

Query  602  LCVFXAPTAAGPGIPEIKA  658
            +  F +P AAG GIPE+KA
Sbjct  147  ITTFISPAAAGSGIPEVKA  165



>ref|XP_010050093.1| PREDICTED: putative chloride channel-like protein CLC-g [Eucalyptus 
grandis]
 gb|KCW82982.1| hypothetical protein EUGRSUZ_C04372 [Eucalyptus grandis]
Length=770

 Score =   121 bits (304),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 101/155 (65%), Gaps = 4/155 (3%)
 Frame = +2

Query  200  MEGQADDDPESNSLHRPLLKRNRTL--SSTPVAMIGAKVSPIESLDYEINENDLFKHDWR  373
            M  + + DPES  L +P L   R+   S++ VA++GA V PIESLDYEI END FK DWR
Sbjct  1    MAAEPNGDPES--LTQPFLALQRSTINSTSQVAIVGANVCPIESLDYEIAENDFFKQDWR  58

Query  374  SRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGF  553
            +R K  + QY+F+KW L FLIG + G+I   INLA+EN+AG K +   + +   R+ M F
Sbjct  59   TRGKMQIFQYIFMKWLLCFLIGGIVGVIGFCINLAVENLAGVKFVVTSDMMLQRRFGMAF  118

Query  554  AYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
              F  +NF LT+ A+++    +P +AG GIPE+KA
Sbjct  119  LVFSLSNFGLTLFAALITALVSPASAGSGIPEVKA  153



>ref|XP_010274995.1| PREDICTED: chloride channel protein CLC-c [Nelumbo nucifera]
Length=773

 Score =   121 bits (303),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 107/166 (64%), Gaps = 1/166 (1%)
 Frame = +2

Query  161  MSMEFAGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEI  340
            + +E  G  S   +E       +   +  PLLK+ RT +++ +A++GA V PIESLDYEI
Sbjct  7    IDIESDGMFSKGRLERNGSGISDDMIIREPLLKK-RTNTTSQIAIVGANVCPIESLDYEI  65

Query  341  NENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLN  520
             ENDLFK DWRSR K  + QYV LKWTLA LIGL TGL+    NL +ENIAG+KLL   +
Sbjct  66   VENDLFKQDWRSRKKIQIFQYVVLKWTLALLIGLATGLVGFFNNLGVENIAGFKLLLTND  125

Query  521  YIDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             +  +RY   F  F G N  L ++A+VLC + AP AAG GIPE+KA
Sbjct  126  LMLKDRYFKAFLAFAGCNLGLAVAAAVLCAYIAPAAAGSGIPEVKA  171



>ref|XP_008378936.1| PREDICTED: chloride channel protein CLC-c-like isoform X1 [Malus 
domestica]
Length=204

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +2

Query  248  PLLKRNRTLSSTP-VAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFLKWtl  424
            PLL+RNR  ++T  +A++GA +SPIESLDYEI ENDLFK +WRSR+K+ + QYV L W L
Sbjct  19   PLLERNRRRNTTSQLAIVGAXLSPIESLDYEIIENDLFKQBWRSRTKAEIFQYVCLXWAL  78

Query  425  afliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFLLTMSASVL  604
              LI L T L+    NLA+ENIAG+KLL     +  ++Y   FA FV  N  L  +A+ L
Sbjct  79   VLLIXLXTXLVGFFNNLAVENIAGFKLLLTNXLMLQDKYYQAFAAFVCCNITLAAAAAAL  138

Query  605  CVFXAPTAAGPGIPEIKA  658
            C + AP AAG GIPE+KA
Sbjct  139  CAYIAPAAAGSGIPEVKA  156



>ref|XP_006852872.1| hypothetical protein AMTR_s00033p00206270 [Amborella trichopoda]
 gb|ERN14339.1| hypothetical protein AMTR_s00033p00206270 [Amborella trichopoda]
Length=785

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 96/144 (67%), Gaps = 0/144 (0%)
 Frame = +2

Query  227  ESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYV  406
            + +S  + +L+  ++  ++ VA++GA V PIESLDYEI END FK DWR+    H+LQY+
Sbjct  20   QQSSEEQQVLRSIQSNRTSQVAIVGANVCPIESLDYEIFENDFFKQDWRNCGCGHILQYI  79

Query  407  FLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFLLT  586
            FLKWTL FL+G+LT L+    NLA+EN+AG K +   N +  N+Y   FA F   NF LT
Sbjct  80   FLKWTLCFLLGILTALVGFFNNLAVENVAGIKFVITSNLMRTNKYFQAFAVFASFNFFLT  139

Query  587  MSASVLCVFXAPTAAGPGIPEIKA  658
            + +S++     P AAG GIPE+KA
Sbjct  140  LFSSIITACIGPAAAGSGIPEVKA  163



>ref|XP_004508447.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
[Cicer arietinum]
Length=777

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 100/151 (66%), Gaps = 3/151 (2%)
 Frame = +2

Query  212  ADDDPESNSLHRPLLKRNRTL--SSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSK  385
            ++ D E++ L  PLL   R++  S++ VA++GA V PIESLDYEI EN+ FK DWRSR  
Sbjct  7    SNGDFETH-LRHPLLSSQRSIINSTSQVAIVGANVCPIESLDYEIFENEFFKQDWRSRGV  65

Query  386  SHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFV  565
              + QY+ +KW L F+IG++ GL+    NLA+EN+AG K +   N +   R+L+ F  F 
Sbjct  66   VQIFQYICMKWLLCFMIGMIVGLVGFCNNLAVENLAGIKFVITSNMMLERRFLLAFVIFF  125

Query  566  GTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             +N  LT+ AS++  F APTAAG GI E+KA
Sbjct  126  ASNLSLTLFASIITAFIAPTAAGSGISEVKA  156



>ref|XP_010096974.1| Putative chloride channel-like protein CLC-g [Morus notabilis]
 gb|EXB66601.1| Putative chloride channel-like protein CLC-g [Morus notabilis]
Length=796

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 99/157 (63%), Gaps = 2/157 (1%)
 Frame = +2

Query  194  NEMEGQADDDPESNSLHRPLLKRNRTL--SSTPVAMIGAKVSPIESLDYEINENDLFKHD  367
            +E   + + D +   L  PLL  +R+   S++ VA++G+ V PIESLDYEI EN+ FK D
Sbjct  7    HEQTQEQEYDRDREFLTVPLLSSHRSNPNSTSQVAIVGSHVCPIESLDYEIFENEFFKQD  66

Query  368  WRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLM  547
            WRSR K+ + QY+F+KW   FLIGL+  LI    NLA+EN+AG K +   N +   RY  
Sbjct  67   WRSRRKTEIFQYIFMKWLTCFLIGLIVSLIGFCNNLAVENLAGVKFVFTSNMMLQQRYAT  126

Query  548  GFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             F  F  +N +LT+ AS++    AP AAG GIPE+KA
Sbjct  127  AFFVFFTSNLVLTLFASMITALIAPAAAGSGIPEVKA  163



>ref|XP_010930514.1| PREDICTED: chloride channel protein CLC-c-like [Elaeis guineensis]
Length=778

 Score =   119 bits (298),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 110/166 (66%), Gaps = 3/166 (2%)
 Frame = +2

Query  164  SMEFAGAGSTNEMEGQADDDPESNSLHRPLLKRNRTLSSTP-VAMIGAKVSPIESLDYEI  340
            SME  G G   E  G   +D +   + +PLL R RT+++T  +A++GA V PIESLDYEI
Sbjct  12   SME--GLGMDVERNGSGFEDEKEAGMRQPLLLRKRTMNTTSQIAIVGANVCPIESLDYEI  69

Query  341  NENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLN  520
             ENDLFK DWRSR K  + QY+ LKWTLA LIGL TGL+    NLA+ENIAG+KLL   +
Sbjct  70   VENDLFKQDWRSRKKVQIFQYIVLKWTLALLIGLATGLVGFFNNLAVENIAGFKLLLTSD  129

Query  521  YIDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             +  +R+   F  + G N +L  +A+ +C + AP AAG GIPE+KA
Sbjct  130  LMLKDRFFAAFLAYSGCNLVLAAAAAAICAYIAPAAAGSGIPEVKA  175



>ref|XP_006848424.1| hypothetical protein AMTR_s00013p00233520 [Amborella trichopoda]
 gb|ERN10005.1| hypothetical protein AMTR_s00013p00233520 [Amborella trichopoda]
Length=127

 Score =   111 bits (277),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 83/99 (84%), Gaps = 3/99 (3%)
 Frame = +2

Query  236  SLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFLK  415
            +LHRPLLKR RT   + +A+IGAK+SPIESLDYEINENDLFKHDWRSRS+  VLQY+ +K
Sbjct  30   NLHRPLLKRVRT---SQLALIGAKLSPIESLDYEINENDLFKHDWRSRSRVEVLQYIIMK  86

Query  416  WtlafliglltgliatlinlaiENIAGYKLLAVLNYIDN  532
            WT AFL+GLLTGL+A  IN A+ENIAG KLLAV + +D 
Sbjct  87   WTFAFLVGLLTGLVAVFINFAVENIAGRKLLAVSHMVDQ  125



>ref|XP_004486231.1| PREDICTED: chloride channel protein CLC-c-like [Cicer arietinum]
Length=766

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 103/158 (65%), Gaps = 4/158 (3%)
 Frame = +2

Query  197  EMEGQAD-DDPESNSLHRPLLKRNRTL---SSTPVAMIGAKVSPIESLDYEINENDLFKH  364
            +ME + D ++     +   LL   R +   +S+ +A++G+ + PI+SLDYEI ENDL K 
Sbjct  10   KMERKGDIEERIERGMSEALLSGRRKIINNTSSQLAIVGSNICPIQSLDYEIIENDLLKQ  69

Query  365  DWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYL  544
            DWRSR K  + QYV LKWTLA LIGL+TG++  L N+ +ENI+G K+L   N +   +Y 
Sbjct  70   DWRSRRKVEIYQYVVLKWTLALLIGLITGIVGFLNNIGVENISGLKVLLTNNLMQQQKYE  129

Query  545  MGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
              FA +VG N +L + A+ LC + AP AAG GIPE+KA
Sbjct  130  EAFAMYVGCNMILAVGAAALCAYIAPAAAGSGIPEVKA  167



>gb|EMT06377.1| Putative chloride channel-like protein CLC-g [Aegilops tauschii]
Length=816

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 101/148 (68%), Gaps = 0/148 (0%)
 Frame = +2

Query  215  DDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHV  394
            +D+ +   L RPLL R+ T + + VAM+G+K  PIESLDYEI ENDLF  +WR+R+K+  
Sbjct  14   EDEEQRPPLTRPLLHRSATNNISQVAMVGSKACPIESLDYEIIENDLFDQNWRTRAKADQ  73

Query  395  LQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTN  574
            ++YV LKWT  F IG++TG++  LINLA+EN+AG+K  AV + +D++ Y   F  F G N
Sbjct  74   VRYVVLKWTFCFAIGIITGVVGFLINLAVENVAGFKHAAVSSLMDSSSYWTAFWVFAGAN  133

Query  575  FLLTMSASVLCVFXAPTAAGPGIPEIKA  658
              L + AS +    +P A G GIPE+KA
Sbjct  134  LALLLFASAITASVSPAAGGSGIPEVKA  161



>ref|XP_004977021.1| PREDICTED: putative chloride channel-like protein CLC-g-like 
[Setaria italica]
Length=820

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 88/128 (69%), Gaps = 0/128 (0%)
 Frame = +2

Query  275  SSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgl  454
            +++ VA++GA V PI+SLDYE+ END+FK DWR+R + H+L+YV LKW L FL+G L   
Sbjct  73   TTSQVALVGADVCPIQSLDYELIENDVFKQDWRARGRGHILRYVALKWALCFLVGALAAA  132

Query  455  iatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAG  634
               + N+ +EN+AG K +   N +    +   FA F+ +NF LTM A+VL V+ AP AAG
Sbjct  133  AGFVANIGVENVAGAKFVVTSNLMLEGEHGSAFAVFLASNFALTMLAAVLTVYVAPAAAG  192

Query  635  PGIPEIKA  658
             GIPE+KA
Sbjct  193  SGIPEVKA  200



>ref|XP_011084085.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Sesamum indicum]
Length=787

 Score =   119 bits (297),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 101/155 (65%), Gaps = 3/155 (2%)
 Frame = +2

Query  194  NEMEGQADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWR  373
            + +    DDD  +  LH+PLL  + +++   VA++G+ V PIESLDYE+ END FK DWR
Sbjct  7    SSLASSVDDD--TALLHQPLLP-SESITVAEVAIVGSSVCPIESLDYEVIENDFFKADWR  63

Query  374  SRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGF  553
            SR K    QY+F+KW L FLIGL+ GL+   INLA+ENIAG K +     +   ++++ F
Sbjct  64   SRGKIQKYQYIFMKWILCFLIGLIVGLLGFFINLAVENIAGMKFVVTSKMMLTGKFMVAF  123

Query  554  AYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
              F  +N  LT+ AS++  F AP AAG GIPE+KA
Sbjct  124  LVFTSSNLGLTLLASLITAFVAPEAAGSGIPEVKA  158



>gb|KDO73468.1| hypothetical protein CISIN_1g003801mg [Citrus sinensis]
Length=794

 Score =   119 bits (297),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 102/155 (66%), Gaps = 7/155 (5%)
 Frame = +2

Query  209  QADDDPESNSLHRPLLKRNRTLSST-----PVAMIGAKVSPIESLDYEINENDLFKHDWR  373
            +   DPES  L  PLL   R+ SS       VA++GA V PIESLDYEI END FK DWR
Sbjct  25   EGGQDPES--LTVPLLSHQRSRSSISNSTSQVALVGADVCPIESLDYEIAENDFFKEDWR  82

Query  374  SRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGF  553
            +R ++ ++QY+F+KW+L FLIGL+ GLI  L NLA+ENIAG K +   N +  N++ M F
Sbjct  83   TRGRNQMIQYIFMKWSLCFLIGLIVGLIGFLNNLAVENIAGTKFVVTSNMMLANKFGMAF  142

Query  554  AYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
              F   N +LT+ AS++    AP AAG GIPE+KA
Sbjct  143  LSFSIPNLVLTLFASIVTATVAPVAAGSGIPEVKA  177



>ref|XP_004242745.2| PREDICTED: putative chloride channel-like protein CLC-g [Solanum 
lycopersicum]
Length=788

 Score =   119 bits (297),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 97/151 (64%), Gaps = 3/151 (2%)
 Frame = +2

Query  215  DDDPESNSLHRPLLKR-NRTLS--STPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSK  385
            D + +  SL  PLL R +R+ S  ++ VA++G+ VSPIESLDYEI END FK DWR   K
Sbjct  21   DTEEDEESLTHPLLNRLSRSASNNTSQVAIVGSSVSPIESLDYEIMENDYFKQDWRRGEK  80

Query  386  SHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFV  565
              +LQYV +KW + F IGLL GL+    NLA+ENIAG K +   + +   RY   F  F 
Sbjct  81   IQILQYVSMKWMMCFFIGLLVGLVGFCNNLAVENIAGMKFVVTSDLMRARRYTTAFLVFA  140

Query  566  GTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             +NF LT+ A ++  F AP AAG GIPE+KA
Sbjct  141  SSNFGLTLFAGLITAFIAPEAAGSGIPEVKA  171



>gb|EMS50378.1| Chloride channel protein CLC-c [Triticum urartu]
Length=783

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 89/128 (70%), Gaps = 0/128 (0%)
 Frame = +2

Query  275  SSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgl  454
            +++ +A++GA V  IESLDYEI ENDLFK DWRSR K+ + QYV LKW L  LIGLLTGL
Sbjct  3    TTSQIAIVGANVFAIESLDYEIVENDLFKQDWRSRKKNQIFQYVVLKWALVLLIGLLTGL  62

Query  455  iatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAG  634
            +    NLA+ENIAG+KL+   + +   RY   F  + G N +L  +A+ LC + AP AAG
Sbjct  63   VGFFNNLAVENIAGFKLVLTGDLMLQKRYFTAFLAYGGCNLVLGATAAALCAYIAPAAAG  122

Query  635  PGIPEIKA  658
             GIPE+KA
Sbjct  123  SGIPEVKA  130



>ref|XP_003573678.1| PREDICTED: putative chloride channel-like protein CLC-g [Brachypodium 
distachyon]
Length=806

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 99/148 (67%), Gaps = 0/148 (0%)
 Frame = +2

Query  215  DDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHV  394
            +DD +   L R LL R+ T + + VAM+G+   PIESLDYEI ENDLF  +WRSR K+  
Sbjct  13   EDDEQRPPLTRALLHRSATNNISQVAMVGSNPCPIESLDYEIIENDLFDQNWRSRGKADQ  72

Query  395  LQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTN  574
            ++YV LKWT  F IG+LTG++  LINLA+EN+AG+K  AV + ++++ Y   F  F G N
Sbjct  73   VRYVVLKWTFCFAIGILTGIVGFLINLAVENVAGFKHTAVSSLMESSSYWTAFLVFAGAN  132

Query  575  FLLTMSASVLCVFXAPTAAGPGIPEIKA  658
              L + AS +  F AP A G GIPE+KA
Sbjct  133  LALLLFASSITAFIAPAAGGSGIPEVKA  160



>ref|XP_009403721.1| PREDICTED: chloride channel protein CLC-c-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403722.1| PREDICTED: chloride channel protein CLC-c-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403723.1| PREDICTED: chloride channel protein CLC-c-like [Musa acuminata 
subsp. malaccensis]
Length=778

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 101/147 (69%), Gaps = 0/147 (0%)
 Frame = +2

Query  218  DDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVL  397
            ++ E+ S+  PLL++    +++ +A++GA V  IESLDYEI ENDLF+ DWRSR K  + 
Sbjct  29   ENEEAGSMREPLLRKRTMNTTSQIAIVGANVCTIESLDYEIVENDLFEQDWRSRKKVQIF  88

Query  398  QYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNF  577
            QY+ LKWTLA LIGL TGL+    NLA+ENIAG+KLL   N +  +RY   F  +  TN 
Sbjct  89   QYIVLKWTLALLIGLATGLVGFFNNLAVENIAGFKLLLTSNLMLEHRYFAAFLAYCSTNA  148

Query  578  LLTMSASVLCVFXAPTAAGPGIPEIKA  658
            +L  SA+ LC + AP AAG GIPE+KA
Sbjct  149  ILAASAAALCAYVAPAAAGSGIPEVKA  175



>gb|EEC71893.1| hypothetical protein OsI_04638 [Oryza sativa Indica Group]
Length=793

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 98/148 (66%), Gaps = 0/148 (0%)
 Frame = +2

Query  215  DDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHV  394
            D +     L RPLL+R  T +++ +A++GA V PIESLDYE+ EN+++K DWRSR K  +
Sbjct  42   DIEEGGGGLERPLLRRRGTNTTSQMAIVGANVCPIESLDYELVENEVYKQDWRSRGKLQI  101

Query  395  LQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTN  574
              Y  LKW LA L+GL+ GLI    N+A+ENIAG+KLL   N +  NRY   F +F+  N
Sbjct  102  FHYQILKWVLALLVGLIVGLIGFFNNIAVENIAGFKLLLTTNLMLQNRYKAAFLWFISCN  161

Query  575  FLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             +L  +A+ LC +  P AAG GIPE+KA
Sbjct  162  AMLAAAAAALCAYFGPAAAGSGIPEVKA  189



>dbj|BAD82092.1| putative chloride channel [Oryza sativa Japonica Group]
Length=793

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 98/148 (66%), Gaps = 0/148 (0%)
 Frame = +2

Query  215  DDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHV  394
            D +     L RPLL+R  T +++ +A++GA V PIESLDYE+ EN+++K DWRSR K  +
Sbjct  42   DIEEGGGGLERPLLRRRGTNTTSQMAIVGANVCPIESLDYELVENEVYKQDWRSRGKLQI  101

Query  395  LQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTN  574
              Y  LKW LA L+GL+ GLI    N+A+ENIAG+KLL   N +  NRY   F +F+  N
Sbjct  102  FHYQILKWVLALLVGLIVGLIGFFNNIAVENIAGFKLLLTTNLMLQNRYKAAFLWFISCN  161

Query  575  FLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             +L  +A+ LC +  P AAG GIPE+KA
Sbjct  162  AMLAAAAAALCAYFGPAAAGSGIPEVKA  189



>gb|EYU34964.1| hypothetical protein MIMGU_mgv1a001646mg [Erythranthe guttata]
Length=779

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 95/150 (63%), Gaps = 7/150 (5%)
 Frame = +2

Query  209  QADDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKS  388
            Q D  P       PLL+R+R+ S++ VA++G+ + P+ESLDYEI END FK DWR R K+
Sbjct  24   QQDQPP-------PLLQRSRSNSTSQVAVVGSNLCPVESLDYEIIENDFFKQDWRGRGKT  76

Query  389  HVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVG  568
             + QY+ +KW    LIGL+  LI    NLAIENI+G K +     + + R+ + F  F  
Sbjct  77   EIFQYISMKWIFCLLIGLIVSLIGFFNNLAIENISGMKFVITSYMMLHRRFGVAFTVFAA  136

Query  569  TNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            +NF L + AS++  F AP AAG GIPE+KA
Sbjct  137  SNFSLALLASLITAFIAPEAAGSGIPEVKA  166



>gb|EEE55755.1| hypothetical protein OsJ_04269 [Oryza sativa Japonica Group]
Length=863

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 98/148 (66%), Gaps = 0/148 (0%)
 Frame = +2

Query  215  DDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHV  394
            D +     L RPLL+R  T +++ +A++GA V PIESLDYE+ EN+++K DWRSR K  +
Sbjct  42   DIEEGGGGLERPLLRRRGTNTTSQMAIVGANVCPIESLDYELVENEVYKQDWRSRGKLQI  101

Query  395  LQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTN  574
              Y  LKW LA L+GL+ GLI    N+A+ENIAG+KLL   N +  NRY   F +F+  N
Sbjct  102  FHYQILKWVLALLVGLIVGLIGFFNNIAVENIAGFKLLLTTNLMLQNRYKAAFLWFISCN  161

Query  575  FLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             +L  +A+ LC +  P AAG GIPE+KA
Sbjct  162  AMLAAAAAALCAYFGPAAAGSGIPEVKA  189



>ref|XP_009403199.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=727

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 101/163 (62%), Gaps = 10/163 (6%)
 Frame = +2

Query  200  MEGQADDDPESNSLHRP----------LLKRNRTLSSTPVAMIGAKVSPIESLDYEINEN  349
            M  +  DD E+  LH             ++R+  ++++ +A+IG+ + PIESLDYE+ EN
Sbjct  1    MGSEELDDVETPLLHSASDSHLEDHFLRIRRSAPVTTSQLAIIGSSLCPIESLDYELIEN  60

Query  350  DLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYID  529
            D FK DWRSR ++H+++YV LKWTL FL+G + G +    NLAIENIAG K +   N + 
Sbjct  61   DFFKQDWRSRGEAHIVRYVILKWTLCFLVGAVAGAVGFFNNLAIENIAGVKFVVTSNMML  120

Query  530  NNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
              +Y   F  F  TNF+L M ASV+  + +P AAG GIPE+ A
Sbjct  121  AGKYKWAFLVFASTNFVLLMFASVITTYISPAAAGSGIPEVMA  163



>ref|XP_007152471.1| hypothetical protein PHAVU_004G133400g [Phaseolus vulgaris]
 gb|ESW24465.1| hypothetical protein PHAVU_004G133400g [Phaseolus vulgaris]
Length=807

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 103/165 (62%), Gaps = 12/165 (7%)
 Frame = +2

Query  197  EMEGQADDDPE-----------SNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEIN  343
            E+EG  D + E           S +  +PLL + R  +++ +A++GA +SPIESLDYEI 
Sbjct  22   EIEGLLDGNEENGRYLSGLSDRSMAHTKPLLVK-RINTTSQIAIVGANLSPIESLDYEIF  80

Query  344  ENDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNY  523
             N++ KHDWRSR KS  +QYV LKW  A LIGL TGL+    + A+ENIAG+KLL     
Sbjct  81   YNEILKHDWRSRKKSQTIQYVVLKWGFALLIGLGTGLVGFFNSYAVENIAGFKLLMTTTL  140

Query  524  IDNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
            +  NRYL  F  + G N  L  +A+ LC F AP AAG GIPE+KA
Sbjct  141  MSKNRYLEAFLAYAGVNICLAAAAAALCAFIAPAAAGSGIPEVKA  185



>ref|XP_009403198.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=831

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 101/164 (62%), Gaps = 10/164 (6%)
 Frame = +2

Query  197  EMEGQADDDPESNSLHRP----------LLKRNRTLSSTPVAMIGAKVSPIESLDYEINE  346
             M  +  DD E+  LH             ++R+  ++++ +A+IG+ + PIESLDYE+ E
Sbjct  43   SMGSEELDDVETPLLHSASDSHLEDHFLRIRRSAPVTTSQLAIIGSSLCPIESLDYELIE  102

Query  347  NDLFKHDWRSRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYI  526
            ND FK DWRSR ++H+++YV LKWTL FL+G + G +    NLAIENIAG K +   N +
Sbjct  103  NDFFKQDWRSRGEAHIVRYVILKWTLCFLVGAVAGAVGFFNNLAIENIAGVKFVVTSNMM  162

Query  527  DNNRYLMGFAYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
               +Y   F  F  TNF+L M ASV+  + +P AAG GIPE+ A
Sbjct  163  LAGKYKWAFLVFASTNFVLLMFASVITTYISPAAAGSGIPEVMA  206



>ref|XP_002974253.1| hypothetical protein SELMODRAFT_100906 [Selaginella moellendorffii]
 gb|EFJ24475.1| hypothetical protein SELMODRAFT_100906 [Selaginella moellendorffii]
Length=786

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 99/155 (64%), Gaps = 9/155 (6%)
 Frame = +2

Query  221  DPESNSLHRPLLKRNRTL---------SSTPVAMIGAKVSPIESLDYEINENDLFKHDWR  373
            D        PLL R ++          S +   +I + VS +ESLDYEI END+FK DWR
Sbjct  15   DVNGTDFKEPLLPRKKSHFPVFATGNESVSFTGIIKSNVSSLESLDYEIVENDVFKQDWR  74

Query  374  SRSKSHVLQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGF  553
            +R+   VLQYV +KWT A LIG+LTGL+A LINLA+ENIAG KLL  L  + +NRY++  
Sbjct  75   ARTNYEVLQYVIMKWTFACLIGVLTGLVALLINLAVENIAGAKLLITLKLLQSNRYVLAG  134

Query  554  AYFVGTNFLLTMSASVLCVFXAPTAAGPGIPEIKA  658
                G N +L + +SVLCV+  P AAG GIPE+KA
Sbjct  135  LLLTGINLVLVLFSSVLCVYFGPAAAGSGIPEVKA  169



>ref|XP_009392135.1| PREDICTED: putative chloride channel-like protein CLC-g isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=757

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 93/140 (66%), Gaps = 1/140 (1%)
 Frame = +2

Query  242  HRPL-LKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHVLQYVFLKW  418
            H P+ L+R+   +++ +A++G+ + PIESLDYE+ ENDLF  DWRSR ++ +L+YVFLKW
Sbjct  44   HHPINLRRHAPNNTSQLAIVGSNLCPIESLDYELIENDLFNQDWRSRGRAAILRYVFLKW  103

Query  419  tlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTNFLLTMSAS  598
            T    IG++ G +    NLA+ENIAGYK   V + +  N+Y   F  F GTN  L + A+
Sbjct  104  TFCLFIGIVAGAVGFFNNLAVENIAGYKFFTVSDLMLANKYWTAFWVFAGTNLALLLFAT  163

Query  599  VLCVFXAPTAAGPGIPEIKA  658
            V+  F +  A G GIPE+KA
Sbjct  164  VITAFVSTAAGGSGIPEVKA  183



>ref|XP_010099780.1| Chloride channel protein CLC-c [Morus notabilis]
 gb|EXB80398.1| Chloride channel protein CLC-c [Morus notabilis]
Length=763

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 99/148 (67%), Gaps = 1/148 (1%)
 Frame = +2

Query  215  DDDPESNSLHRPLLKRNRTLSSTPVAMIGAKVSPIESLDYEINENDLFKHDWRSRSKSHV  394
            + +     L  PLLK +R   ++ +A++GA V PIESLDYEI ENDLFK DWRSR K  +
Sbjct  13   EREGSGACLKEPLLK-SRIKYTSQIAIVGANVCPIESLDYEIVENDLFKQDWRSRKKVEI  71

Query  395  LQYVFLKWtlafliglltgliatlinlaiENIAGYKLLAVLNYIDNNRYLMGFAYFVGTN  574
             QYVF KW LA LIGL TGL+    N+A+ENIAG+KLL   N +   +Y + F  +V  N
Sbjct  72   YQYVFFKWALALLIGLCTGLVGFFNNIAVENIAGFKLLLTNNLMLKEKYFLAFIVYVSCN  131

Query  575  FLLTMSASVLCVFXAPTAAGPGIPEIKA  658
             +L  +A+VLC + AP AAG GIPE+KA
Sbjct  132  MVLAAAAAVLCAYIAPAAAGSGIPEVKA  159



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1028498319500