BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF041C23

Length=654
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009776174.1|  PREDICTED: uncharacterized protein LOC104225989    176   3e-49   Nicotiana sylvestris
ref|XP_009619129.1|  PREDICTED: uncharacterized protein LOC104111192    167   9e-46   Nicotiana tomentosiformis
ref|XP_006366515.1|  PREDICTED: uncharacterized protein LOC102585370    166   1e-45   Solanum tuberosum [potatoes]
ref|XP_004244888.1|  PREDICTED: uncharacterized protein LOC101262938    160   2e-43   Solanum lycopersicum
ref|XP_007011756.1|  Uncharacterized protein TCM_036932                 158   2e-42   
ref|XP_002285361.1|  PREDICTED: uncharacterized protein LOC100262872    157   3e-42   Vitis vinifera
ref|XP_006450316.1|  hypothetical protein CICLE_v10008624mg             155   1e-41   Citrus clementina [clementine]
emb|CAN69699.1|  hypothetical protein VITISV_001515                     155   1e-41   Vitis vinifera
gb|KJB07669.1|  hypothetical protein B456_001G036600                    153   8e-41   Gossypium raimondii
gb|KDP33539.1|  hypothetical protein JCGZ_07110                         153   2e-40   Jatropha curcas
ref|XP_011036648.1|  PREDICTED: uncharacterized protein LOC105134078    146   1e-37   Populus euphratica
gb|KJB55057.1|  hypothetical protein B456_009G060700                    144   3e-37   Gossypium raimondii
ref|XP_008377675.1|  PREDICTED: uncharacterized protein LOC103440754    141   2e-36   
ref|XP_009363946.1|  PREDICTED: uncharacterized protein LOC103953867    141   2e-36   Pyrus x bretschneideri [bai li]
ref|XP_002515453.1|  conserved hypothetical protein                     137   5e-35   
ref|XP_008378697.1|  PREDICTED: uncharacterized protein LOC103441769    137   6e-35   Malus domestica [apple tree]
ref|XP_010048907.1|  PREDICTED: uncharacterized protein LOC104437620    137   9e-35   Eucalyptus grandis [rose gum]
ref|XP_003603315.1|  hypothetical protein MTR_3g106250                  136   2e-34   Medicago truncatula
gb|ABK92441.1|  unknown                                                 132   2e-34   Populus trichocarpa [western balsam poplar]
ref|XP_004501367.1|  PREDICTED: uncharacterized protein LOC101507611    134   2e-33   Cicer arietinum [garbanzo]
ref|XP_003527779.1|  PREDICTED: uncharacterized protein LOC100783731    132   7e-33   Glycine max [soybeans]
ref|XP_002324318.2|  hypothetical protein POPTR_0018s02290g             132   1e-32   Populus trichocarpa [western balsam poplar]
ref|XP_010665861.1|  PREDICTED: uncharacterized protein LOC104883105    131   2e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006579047.1|  PREDICTED: uncharacterized protein LOC100775282    127   1e-31   
ref|XP_004291941.1|  PREDICTED: uncharacterized protein LOC101293553    128   2e-31   Fragaria vesca subsp. vesca
ref|XP_011039597.1|  PREDICTED: uncharacterized protein LOC105136101    128   3e-31   Populus euphratica
ref|XP_010245551.1|  PREDICTED: uncharacterized protein LOC104589062    126   1e-30   Nelumbo nucifera [Indian lotus]
gb|KJB65893.1|  hypothetical protein B456_010G117700                    125   3e-30   Gossypium raimondii
ref|XP_010265675.1|  PREDICTED: uncharacterized protein LOC104603360    125   4e-30   Nelumbo nucifera [Indian lotus]
ref|XP_010033684.1|  PREDICTED: uncharacterized protein LOC104422917    125   5e-30   Eucalyptus grandis [rose gum]
ref|XP_010541582.1|  PREDICTED: uncharacterized protein LOC104815002    124   1e-29   Tarenaya hassleriana [spider flower]
ref|XP_008445586.1|  PREDICTED: uncharacterized protein LOC103488566    121   4e-29   Cucumis melo [Oriental melon]
ref|XP_010519647.1|  PREDICTED: uncharacterized protein LOC104799041    121   8e-29   Tarenaya hassleriana [spider flower]
ref|XP_007136970.1|  hypothetical protein PHAVU_009G089200g             119   3e-28   Phaseolus vulgaris [French bean]
emb|CDP18790.1|  unnamed protein product                                119   3e-28   Coffea canephora [robusta coffee]
ref|XP_004138846.1|  PREDICTED: uncharacterized protein LOC101205493    117   6e-28   
gb|KGN62983.1|  hypothetical protein Csa_2G382560                       118   8e-28   Cucumis sativus [cucumbers]
ref|XP_004160786.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    115   3e-27   
ref|XP_010910592.1|  PREDICTED: uncharacterized protein LOC105036529    115   5e-27   Elaeis guineensis
ref|XP_008220875.1|  PREDICTED: uncharacterized protein LOC103320911    114   3e-26   
ref|XP_008802684.1|  PREDICTED: uncharacterized protein LOC103716457    112   4e-26   Phoenix dactylifera
ref|XP_002872306.1|  hypothetical protein ARALYDRAFT_489643             112   8e-26   
ref|XP_010277409.1|  PREDICTED: uncharacterized protein LOC104611862    110   4e-25   Nelumbo nucifera [Indian lotus]
ref|XP_006395009.1|  hypothetical protein EUTSA_v10004720mg             110   4e-25   Eutrema salsugineum [saltwater cress]
ref|XP_003521743.1|  PREDICTED: uncharacterized protein LOC100791607    110   4e-25   
ref|NP_198167.1|  uncharacterized protein                               109   6e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010674843.1|  PREDICTED: uncharacterized protein LOC104890923    109   6e-25   
ref|XP_006399599.1|  hypothetical protein EUTSA_v10015286mg             110   7e-25   Eutrema salsugineum [saltwater cress]
ref|XP_009402136.1|  PREDICTED: uncharacterized protein LOC103986002    109   8e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004981359.1|  PREDICTED: uncharacterized protein LOC101774579    109   8e-25   Setaria italica
ref|XP_006288375.1|  hypothetical protein CARUB_v10001626mg             109   8e-25   Capsella rubella
ref|XP_010649892.1|  PREDICTED: uncharacterized protein LOC100246068    109   8e-25   Vitis vinifera
ref|XP_010923391.1|  PREDICTED: uncharacterized protein LOC105046501    108   1e-24   Elaeis guineensis
emb|CDP21506.1|  unnamed protein product                                108   1e-24   Coffea canephora [robusta coffee]
gb|ACU18448.1|  unknown                                                 108   1e-24   Glycine max [soybeans]
ref|XP_009407751.1|  PREDICTED: uncharacterized protein LOC103990370    108   2e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007224916.1|  hypothetical protein PRUPE_ppa021934mg             109   2e-24   
gb|AFW67285.1|  hypothetical protein ZEAMMB73_929047                    108   2e-24   
emb|CDX97072.1|  BnaC09g45530D                                          108   2e-24   
gb|KFK25379.1|  hypothetical protein AALP_AA8G105700                    108   2e-24   Arabis alpina [alpine rockcress]
emb|CAN68226.1|  hypothetical protein VITISV_040533                     107   3e-24   Vitis vinifera
ref|XP_010546610.1|  PREDICTED: uncharacterized protein LOC104818644    107   3e-24   Tarenaya hassleriana [spider flower]
ref|XP_010455167.1|  PREDICTED: uncharacterized protein LOC104736806    107   3e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010453134.1|  PREDICTED: uncharacterized protein LOC104735112    108   4e-24   Camelina sativa [gold-of-pleasure]
ref|XP_004302026.1|  PREDICTED: uncharacterized protein LOC101296394    107   4e-24   Fragaria vesca subsp. vesca
ref|XP_008804337.1|  PREDICTED: uncharacterized protein LOC103717650    107   5e-24   Phoenix dactylifera
emb|CDX69793.1|  BnaA10g21420D                                          107   5e-24   
ref|XP_002466252.1|  hypothetical protein SORBIDRAFT_01g004400          107   6e-24   Sorghum bicolor [broomcorn]
ref|XP_010494083.1|  PREDICTED: uncharacterized protein LOC104771271    106   6e-24   Camelina sativa [gold-of-pleasure]
ref|XP_003554710.1|  PREDICTED: uncharacterized protein LOC100806479    106   7e-24   Glycine max [soybeans]
ref|XP_009122005.1|  PREDICTED: uncharacterized protein LOC103846761    107   8e-24   Brassica rapa
ref|NP_001051637.1|  Os03g0806700                                       106   1e-23   
ref|XP_002873490.1|  hypothetical protein ARALYDRAFT_909057             107   1e-23   Arabidopsis lyrata subsp. lyrata
ref|NP_196661.1|  uncharacterized protein                               107   1e-23   Arabidopsis thaliana [mouse-ear cress]
emb|CBI26241.3|  unnamed protein product                                105   1e-23   Vitis vinifera
ref|XP_003564146.1|  PREDICTED: uncharacterized protein LOC100837549    105   1e-23   Brachypodium distachyon [annual false brome]
ref|XP_003626413.1|  hypothetical protein MTR_7g114790                  105   1e-23   Medicago truncatula
ref|XP_009408456.1|  PREDICTED: uncharacterized protein LOC103990890    105   1e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006289029.1|  hypothetical protein CARUB_v10002414mg             106   1e-23   Capsella rubella
ref|XP_006444048.1|  hypothetical protein CICLE_v10021341mg             105   1e-23   
ref|XP_002880661.1|  hypothetical protein ARALYDRAFT_481378             106   1e-23   Arabidopsis lyrata subsp. lyrata
ref|XP_010419653.1|  PREDICTED: uncharacterized protein LOC104705366    106   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_009151242.1|  PREDICTED: uncharacterized protein LOC103874571    105   2e-23   Brassica rapa
ref|XP_004955779.1|  PREDICTED: uncharacterized protein LOC101785301    105   2e-23   Setaria italica
ref|XP_006650760.1|  PREDICTED: uncharacterized protein LOC102720690    105   3e-23   Oryza brachyantha
emb|CDY00013.1|  BnaC09g02880D                                          105   3e-23   
ref|NP_566240.1|  uncharacterized protein                               104   3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006382769.1|  hypothetical protein POPTR_0005s05250g             104   3e-23   Populus trichocarpa [western balsam poplar]
gb|AAM65821.1|  unknown                                                 104   4e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007147151.1|  hypothetical protein PHAVU_006G100000g             104   4e-23   Phaseolus vulgaris [French bean]
ref|XP_011032437.1|  PREDICTED: uncharacterized protein LOC105131255    104   4e-23   Populus euphratica
gb|KHN43207.1|  hypothetical protein glysoja_001790                     103   5e-23   Glycine soja [wild soybean]
ref|XP_009111920.1|  PREDICTED: uncharacterized protein LOC103837313    104   5e-23   Brassica rapa
ref|XP_010090262.1|  hypothetical protein L484_006168                   104   5e-23   Morus notabilis
emb|CDY52485.1|  BnaC07g49460D                                          104   6e-23   Brassica napus [oilseed rape]
ref|XP_004494682.1|  PREDICTED: uncharacterized protein LOC101496846    104   6e-23   Cicer arietinum [garbanzo]
ref|XP_010421680.1|  PREDICTED: uncharacterized protein LOC104707100    103   6e-23   Camelina sativa [gold-of-pleasure]
dbj|BAJ95878.1|  predicted protein                                      103   6e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010256015.1|  PREDICTED: uncharacterized protein LOC104596517    103   6e-23   Nelumbo nucifera [Indian lotus]
ref|XP_009125261.1|  PREDICTED: uncharacterized protein LOC103850289    104   8e-23   Brassica rapa
ref|XP_004230118.1|  PREDICTED: uncharacterized protein LOC101268432    103   9e-23   Solanum lycopersicum
ref|XP_006347793.1|  PREDICTED: uncharacterized protein LOC102597851    103   1e-22   Solanum tuberosum [potatoes]
ref|XP_009364535.1|  PREDICTED: uncharacterized protein LOC103954432    103   1e-22   Pyrus x bretschneideri [bai li]
ref|XP_006433029.1|  hypothetical protein CICLE_v10001999mg             103   1e-22   Citrus clementina [clementine]
gb|EEE60141.1|  hypothetical protein OsJ_13031                          102   1e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AFW67286.1|  hypothetical protein ZEAMMB73_929047                    101   1e-22   
ref|XP_010491790.1|  PREDICTED: uncharacterized protein LOC104769314    103   1e-22   Camelina sativa [gold-of-pleasure]
ref|XP_006838233.1|  hypothetical protein AMTR_s00103p00021650          103   1e-22   Amborella trichopoda
ref|XP_010090415.1|  hypothetical protein L484_025081                   103   1e-22   Morus notabilis
ref|XP_002977922.1|  hypothetical protein SELMODRAFT_107811             103   1e-22   
ref|XP_002986948.1|  hypothetical protein SELMODRAFT_158336             103   1e-22   
ref|XP_010417285.1|  PREDICTED: uncharacterized protein LOC104703050    103   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_006408140.1|  hypothetical protein EUTSA_v10021255mg             102   2e-22   Eutrema salsugineum [saltwater cress]
ref|XP_008345708.1|  PREDICTED: uncharacterized protein LOC103408652    102   2e-22   
ref|XP_009805050.1|  PREDICTED: uncharacterized protein LOC104250176    102   2e-22   Nicotiana sylvestris
gb|ACU20214.1|  unknown                                                 102   2e-22   Glycine max [soybeans]
ref|XP_003536564.1|  PREDICTED: uncharacterized protein LOC100796685    102   2e-22   
emb|CDY59819.1|  BnaA09g51660D                                          103   2e-22   Brassica napus [oilseed rape]
ref|XP_011071576.1|  PREDICTED: uncharacterized protein LOC105156990    102   2e-22   Sesamum indicum [beniseed]
gb|KJB45005.1|  hypothetical protein B456_007G284600                    102   2e-22   Gossypium raimondii
emb|CDY50761.1|  BnaAnng10680D                                          102   2e-22   Brassica napus [oilseed rape]
ref|XP_007030623.1|  Uncharacterized protein TCM_026394                 102   2e-22   
gb|KDP23639.1|  hypothetical protein JCGZ_23472                         102   2e-22   Jatropha curcas
ref|XP_010419519.1|  PREDICTED: uncharacterized protein LOC104705248    102   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_008388659.1|  PREDICTED: uncharacterized protein LOC103451015    102   3e-22   
ref|XP_002512236.1|  conserved hypothetical protein                     102   3e-22   
ref|XP_009588422.1|  PREDICTED: uncharacterized protein LOC104085995    102   4e-22   Nicotiana tomentosiformis
ref|XP_010429513.1|  PREDICTED: uncharacterized protein LOC104713...    102   4e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010429511.1|  PREDICTED: uncharacterized protein LOC104713...    102   4e-22   Camelina sativa [gold-of-pleasure]
ref|XP_011005698.1|  PREDICTED: uncharacterized protein LOC105111908    101   4e-22   Populus euphratica
gb|ACN25495.1|  unknown                                                 100   5e-22   Zea mays [maize]
ref|NP_001167908.1|  hypothetical protein                               101   5e-22   Zea mays [maize]
ref|XP_009124203.1|  PREDICTED: uncharacterized protein LOC103849150    101   5e-22   Brassica rapa
emb|CDY30020.1|  BnaC01g39880D                                          101   6e-22   Brassica napus [oilseed rape]
ref|XP_002319062.1|  hypothetical protein POPTR_0013s03440g             101   7e-22   Populus trichocarpa [western balsam poplar]
ref|XP_006294490.1|  hypothetical protein CARUB_v10023518mg             101   8e-22   Capsella rubella
ref|XP_002884475.1|  hypothetical protein ARALYDRAFT_477757             100   8e-22   
ref|XP_008452874.1|  PREDICTED: uncharacterized protein LOC103493769    101   9e-22   Cucumis melo [Oriental melon]
emb|CDY21108.1|  BnaA01g33390D                                          100   1e-21   Brassica napus [oilseed rape]
ref|XP_009117076.1|  PREDICTED: uncharacterized protein LOC103842203    101   1e-21   Brassica rapa
gb|KDP21447.1|  hypothetical protein JCGZ_21918                         100   1e-21   Jatropha curcas
gb|ACN33725.1|  unknown                                               97.8    1e-21   Zea mays [maize]
gb|KHN03804.1|  hypothetical protein glysoja_011033                     100   1e-21   Glycine soja [wild soybean]
emb|CDO99050.1|  unnamed protein product                                100   1e-21   Coffea canephora [robusta coffee]
ref|XP_002307590.1|  hypothetical protein POPTR_0005s23240g             100   1e-21   
ref|XP_007050577.1|  Uncharacterized protein isoform 1                  100   1e-21   
ref|XP_010463974.1|  PREDICTED: uncharacterized protein LOC104744596    100   1e-21   Camelina sativa [gold-of-pleasure]
ref|XP_006298244.1|  hypothetical protein CARUB_v10014305mg             100   2e-21   Capsella rubella
ref|XP_003632331.1|  PREDICTED: uncharacterized protein LOC100853449    100   2e-21   Vitis vinifera
ref|XP_010041438.1|  PREDICTED: uncharacterized protein LOC104430401    100   2e-21   Eucalyptus grandis [rose gum]
gb|EMS52757.1|  hypothetical protein TRIUR3_04572                     99.0    2e-21   Triticum urartu
emb|CDX76763.1|  BnaC08g33490D                                          100   2e-21   
ref|XP_011458574.1|  PREDICTED: uncharacterized protein LOC101299...  99.8    2e-21   Fragaria vesca subsp. vesca
ref|XP_004247361.1|  PREDICTED: uncharacterized protein LOC101254730  99.8    2e-21   Solanum lycopersicum
ref|XP_004290606.1|  PREDICTED: uncharacterized protein LOC101299...  99.8    3e-21   Fragaria vesca subsp. vesca
emb|CAN61445.1|  hypothetical protein VITISV_024138                     100   3e-21   Vitis vinifera
ref|XP_002277386.1|  PREDICTED: uncharacterized protein LOC100267457  99.4    3e-21   
emb|CAN64151.1|  hypothetical protein VITISV_041021                   99.4    3e-21   Vitis vinifera
ref|XP_007050578.1|  Uncharacterized protein isoform 2                98.6    3e-21   
ref|XP_011092005.1|  PREDICTED: uncharacterized protein LOC105172319  99.4    3e-21   
emb|CBI34200.3|  unnamed protein product                              98.6    3e-21   Vitis vinifera
ref|XP_010485871.1|  PREDICTED: uncharacterized protein LOC104764117  99.0    4e-21   Camelina sativa [gold-of-pleasure]
ref|XP_008218232.1|  PREDICTED: uncharacterized protein LOC103318613  99.0    4e-21   
ref|XP_007207341.1|  hypothetical protein PRUPE_ppa009272mg           99.0    4e-21   Prunus persica
ref|XP_006405118.1|  hypothetical protein EUTSA_v10000227mg           99.4    5e-21   Eutrema salsugineum [saltwater cress]
ref|XP_007144641.1|  hypothetical protein PHAVU_007G172700g           99.0    5e-21   Phaseolus vulgaris [French bean]
ref|XP_009124977.1|  PREDICTED: uncharacterized protein LOC103850026  98.6    5e-21   Brassica rapa
ref|XP_009792059.1|  PREDICTED: uncharacterized protein LOC104239187  98.2    8e-21   Nicotiana sylvestris
ref|XP_007144817.1|  hypothetical protein PHAVU_007G186400g           98.2    8e-21   Phaseolus vulgaris [French bean]
ref|XP_008455804.1|  PREDICTED: uncharacterized protein LOC103495897  98.2    8e-21   Cucumis melo [Oriental melon]
ref|XP_004139223.1|  PREDICTED: uncharacterized protein LOC101220430  98.2    9e-21   Cucumis sativus [cucumbers]
emb|CDY72112.1|  BnaC05g52260D                                        97.8    9e-21   Brassica napus [oilseed rape]
ref|XP_006360806.1|  PREDICTED: uncharacterized protein LOC102583145  97.8    1e-20   Solanum tuberosum [potatoes]
ref|XP_003518919.1|  PREDICTED: uncharacterized protein LOC100793503  97.8    1e-20   Glycine max [soybeans]
ref|XP_002300838.1|  hypothetical protein POPTR_0002s05250g           97.8    1e-20   Populus trichocarpa [western balsam poplar]
emb|CBI28703.3|  unnamed protein product                              97.4    1e-20   Vitis vinifera
ref|XP_002520723.1|  conserved hypothetical protein                   97.8    1e-20   Ricinus communis
ref|XP_011090719.1|  PREDICTED: uncharacterized protein LOC105171...  97.8    1e-20   
gb|KGN60826.1|  hypothetical protein Csa_2G011590                     98.2    1e-20   Cucumis sativus [cucumbers]
gb|KJB22971.1|  hypothetical protein B456_004G079100                  97.4    1e-20   Gossypium raimondii
ref|XP_010550936.1|  PREDICTED: uncharacterized protein LOC104821683  97.4    1e-20   Tarenaya hassleriana [spider flower]
ref|XP_011090718.1|  PREDICTED: uncharacterized protein LOC105171...  97.4    2e-20   
gb|KJB46029.1|  hypothetical protein B456_007G344900                  97.1    2e-20   Gossypium raimondii
gb|EYU30508.1|  hypothetical protein MIMGU_mgv1a010362mg              97.1    2e-20   Erythranthe guttata [common monkey flower]
ref|XP_011026156.1|  PREDICTED: uncharacterized protein LOC105126841  96.7    3e-20   Populus euphratica
ref|XP_011032694.1|  PREDICTED: uncharacterized protein LOC105131425  96.3    3e-20   Populus euphratica
ref|XP_009601952.1|  PREDICTED: uncharacterized protein LOC104097132  96.3    3e-20   Nicotiana tomentosiformis
gb|ADG39148.1|  AT5G28150-like protein                                93.2    5e-20   Capsella grandiflora
ref|XP_010089947.1|  hypothetical protein L484_014458                 96.3    6e-20   
gb|ADG39151.1|  AT5G28150-like protein                                93.2    6e-20   Capsella grandiflora
gb|ADG39149.1|  AT5G28150-like protein                                93.2    6e-20   Capsella grandiflora
gb|AEN83173.1|  AT5G28150-like protein                                93.2    7e-20   Capsella rubella
gb|KHN10674.1|  hypothetical protein glysoja_019105                   95.5    7e-20   Glycine soja [wild soybean]
gb|EMT25403.1|  hypothetical protein F775_31443                       95.1    1e-19   
emb|CDY51100.1|  BnaCnng20030D                                        95.5    1e-19   Brassica napus [oilseed rape]
ref|XP_003521248.2|  PREDICTED: uncharacterized protein LOC100799355  95.1    1e-19   Glycine max [soybeans]
ref|XP_001772274.1|  predicted protein                                94.7    1e-19   
gb|AFK40643.1|  unknown                                               94.7    1e-19   Medicago truncatula
gb|KHN33661.1|  hypothetical protein glysoja_013667                   94.4    1e-19   Glycine soja [wild soybean]
ref|XP_006604441.1|  PREDICTED: uncharacterized protein LOC100786850  94.7    1e-19   Glycine max [soybeans]
gb|ADG39147.1|  AT5G28150-like protein                                92.0    1e-19   Capsella grandiflora
gb|ADG39153.1|  AT5G28150-like protein                                92.0    1e-19   Neslia paniculata [ball mustard]
gb|ADG39150.1|  AT5G28150-like protein                                92.0    1e-19   Capsella grandiflora
gb|AES61262.2|  plant/T24G3-80 protein                                94.4    2e-19   Medicago truncatula
ref|XP_009370813.1|  PREDICTED: uncharacterized protein LOC103960122  94.4    2e-19   Pyrus x bretschneideri [bai li]
ref|XP_003556459.1|  PREDICTED: uncharacterized protein LOC100802...  94.4    2e-19   Glycine max [soybeans]
ref|XP_009417441.1|  PREDICTED: uncharacterized protein LOC103997840  94.7    2e-19   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX85733.1|  BnaA02g00800D                                        94.4    2e-19   
gb|ACU19762.1|  unknown                                               93.6    3e-19   Glycine max [soybeans]
ref|XP_003591011.1|  hypothetical protein MTR_1g081260                94.0    3e-19   
ref|XP_007162443.1|  hypothetical protein PHAVU_001G152600g           93.6    3e-19   Phaseolus vulgaris [French bean]
gb|EPS66867.1|  hypothetical protein M569_07907                       93.6    3e-19   Genlisea aurea
ref|XP_009379950.1|  PREDICTED: uncharacterized protein LOC103968448  93.6    4e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009385461.1|  PREDICTED: uncharacterized protein LOC103972819  93.6    4e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007199427.1|  hypothetical protein PRUPE_ppa026525mg           93.2    5e-19   
gb|EYU41493.1|  hypothetical protein MIMGU_mgv1a027106mg              93.2    5e-19   Erythranthe guttata [common monkey flower]
ref|XP_003536115.1|  PREDICTED: uncharacterized protein LOC100778089  93.2    5e-19   Glycine max [soybeans]
ref|XP_010929447.1|  PREDICTED: uncharacterized protein LOC105050916  92.4    8e-19   Elaeis guineensis
ref|XP_008235299.1|  PREDICTED: uncharacterized protein LOC103334...  92.4    8e-19   Prunus mume [ume]
ref|NP_850061.1|  uncharacterized protein                             92.4    1e-18   Arabidopsis thaliana [mouse-ear cress]
gb|KEH23778.1|  plant/T24G3-80 protein                                92.0    1e-18   Medicago truncatula
gb|KJB42124.1|  hypothetical protein B456_007G137800                  91.7    2e-18   Gossypium raimondii
gb|AFK42653.1|  unknown                                               90.9    2e-18   Medicago truncatula
ref|XP_010912954.1|  PREDICTED: uncharacterized protein LOC105038765  91.3    2e-18   Elaeis guineensis
ref|XP_008806297.1|  PREDICTED: uncharacterized protein LOC103719024  92.0    2e-18   Phoenix dactylifera
ref|XP_010552768.1|  PREDICTED: uncharacterized protein LOC104823045  91.3    2e-18   Tarenaya hassleriana [spider flower]
gb|ABR17303.1|  unknown                                               90.5    3e-18   Picea sitchensis
ref|XP_009333930.1|  PREDICTED: uncharacterized protein LOC103926780  90.9    3e-18   Pyrus x bretschneideri [bai li]
emb|CBI21089.3|  unnamed protein product                              90.5    3e-18   Vitis vinifera
ref|XP_008380651.1|  PREDICTED: uncharacterized protein LOC103443554  91.3    3e-18   
gb|KJB42120.1|  hypothetical protein B456_007G137800                  90.1    3e-18   Gossypium raimondii
gb|KGN55450.1|  hypothetical protein Csa_4G652140                     90.1    6e-18   Cucumis sativus [cucumbers]
ref|XP_008793736.1|  PREDICTED: uncharacterized protein LOC103709963  89.7    6e-18   Phoenix dactylifera
ref|XP_008235300.1|  PREDICTED: uncharacterized protein LOC103334...  89.0    8e-18   Prunus mume [ume]
gb|EYU45648.1|  hypothetical protein MIMGU_mgv1a010996mg              89.4    8e-18   Erythranthe guttata [common monkey flower]
emb|CDP13671.1|  unnamed protein product                              89.4    9e-18   Coffea canephora [robusta coffee]
ref|NP_001143196.1|  uncharacterized protein LOC100275698             89.0    1e-17   
ref|XP_008651185.1|  PREDICTED: uncharacterized protein LOC100275...  89.0    1e-17   
ref|XP_011079867.1|  PREDICTED: uncharacterized protein LOC105163276  89.0    1e-17   
ref|XP_004493685.1|  PREDICTED: uncharacterized protein LOC101510231  89.0    1e-17   Cicer arietinum [garbanzo]
gb|AFK39419.1|  unknown                                               89.0    1e-17   Lotus japonicus
emb|CDP03641.1|  unnamed protein product                              88.6    2e-17   Coffea canephora [robusta coffee]
ref|NP_001060057.1|  Os07g0572300                                     88.6    2e-17   
ref|XP_010929912.1|  PREDICTED: uncharacterized protein LOC105051269  88.6    2e-17   Elaeis guineensis
ref|XP_008669644.1|  PREDICTED: uncharacterized protein LOC103646740  86.3    2e-17   
ref|XP_008811744.1|  PREDICTED: uncharacterized protein LOC103722827  88.6    2e-17   Phoenix dactylifera
ref|XP_004495197.1|  PREDICTED: uncharacterized protein LOC101503605  88.2    2e-17   Cicer arietinum [garbanzo]
ref|XP_010228241.1|  PREDICTED: uncharacterized protein LOC100838117  88.2    2e-17   
gb|EAZ04414.1|  hypothetical protein OsI_26558                        87.8    3e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_008808239.1|  PREDICTED: uncharacterized protein LOC103720353  89.4    3e-17   Phoenix dactylifera
ref|XP_004495789.1|  PREDICTED: uncharacterized protein LOC101494890  87.8    3e-17   Cicer arietinum [garbanzo]
gb|KJB51117.1|  hypothetical protein B456_008G201900                  87.8    4e-17   Gossypium raimondii
gb|EYU46571.1|  hypothetical protein MIMGU_mgv1a026066mg              87.0    4e-17   Erythranthe guttata [common monkey flower]
ref|XP_008368838.1|  PREDICTED: uncharacterized protein LOC103432425  87.8    4e-17   
ref|XP_007138005.1|  hypothetical protein PHAVU_009G173000g           87.4    5e-17   Phaseolus vulgaris [French bean]
ref|XP_006657868.1|  PREDICTED: uncharacterized protein LOC102710887  86.7    7e-17   Oryza brachyantha
ref|XP_009390571.1|  PREDICTED: uncharacterized protein LOC103976931  87.8    7e-17   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP13674.1|  unnamed protein product                              86.7    8e-17   Coffea canephora [robusta coffee]
gb|ACU18452.1|  unknown                                               85.1    8e-17   Glycine max [soybeans]
ref|XP_007208899.1|  hypothetical protein PRUPE_ppa026898mg           86.7    1e-16   Prunus persica
ref|XP_008239343.1|  PREDICTED: uncharacterized protein LOC103337946  86.7    1e-16   Prunus mume [ume]
ref|XP_009362927.1|  PREDICTED: uncharacterized protein LOC103952942  86.3    1e-16   
ref|XP_008386487.1|  PREDICTED: uncharacterized protein LOC103448992  86.3    1e-16   Malus domestica [apple tree]
gb|EYU22191.1|  hypothetical protein MIMGU_mgv1a010634mg              85.9    1e-16   Erythranthe guttata [common monkey flower]
gb|ACF81406.1|  unknown                                               85.9    1e-16   Zea mays [maize]
ref|XP_004145513.1|  PREDICTED: uncharacterized protein LOC101215936  85.9    1e-16   
gb|KHN30960.1|  hypothetical protein glysoja_017497                   85.9    2e-16   Glycine soja [wild soybean]
ref|XP_003522405.1|  PREDICTED: uncharacterized protein LOC100813254  85.9    2e-16   Glycine max [soybeans]
gb|KEH39864.1|  DUF868 family protein                                 85.9    2e-16   Medicago truncatula
ref|NP_001131873.1|  hypothetical protein                             85.9    2e-16   Zea mays [maize]
ref|XP_010663087.1|  PREDICTED: uncharacterized protein LOC100243254  85.9    2e-16   Vitis vinifera
ref|NP_001241487.1|  uncharacterized protein LOC100798692             85.5    2e-16   Glycine max [soybeans]
emb|CBI14939.3|  unnamed protein product                              85.5    2e-16   Vitis vinifera
gb|KHN27671.1|  hypothetical protein glysoja_026238                   85.5    2e-16   Glycine soja [wild soybean]
gb|ACU18012.1|  unknown                                               84.3    2e-16   Glycine max [soybeans]
gb|KDP26687.1|  hypothetical protein JCGZ_17845                       85.5    2e-16   Jatropha curcas
ref|XP_004501867.1|  PREDICTED: uncharacterized protein LOC101507...  85.1    2e-16   Cicer arietinum [garbanzo]
dbj|BAJ98259.1|  predicted protein                                    86.7    2e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004501866.1|  PREDICTED: uncharacterized protein LOC101507...  85.5    2e-16   
ref|XP_009367630.1|  PREDICTED: uncharacterized protein LOC103957228  85.5    2e-16   
ref|XP_006344483.1|  PREDICTED: uncharacterized protein LOC102586788  85.1    3e-16   
ref|XP_003601156.1|  hypothetical protein MTR_3g076610                85.1    3e-16   
ref|XP_004515862.1|  PREDICTED: uncharacterized protein LOC101502004  85.1    3e-16   
ref|XP_007155488.1|  hypothetical protein PHAVU_003G205700g           85.1    3e-16   
ref|XP_003551067.1|  PREDICTED: uncharacterized protein LOC100775403  84.7    3e-16   
gb|EMS45281.1|  hypothetical protein TRIUR3_16464                     84.7    3e-16   
gb|KEH31766.1|  protein phosphatase 2c, putative                      84.7    3e-16   
gb|KJB10781.1|  hypothetical protein B456_001G224000                  84.7    3e-16   
ref|XP_009763291.1|  PREDICTED: uncharacterized protein LOC104215233  84.7    3e-16   
ref|XP_006581901.1|  PREDICTED: uncharacterized protein LOC100816323  85.1    4e-16   
ref|XP_001770719.1|  predicted protein                                84.3    4e-16   
ref|XP_007150100.1|  hypothetical protein PHAVU_005G126700g           84.7    4e-16   
ref|XP_003525519.1|  PREDICTED: uncharacterized protein LOC100779755  84.7    4e-16   
tpg|DAA38502.1|  TPA: hypothetical protein ZEAMMB73_696161            85.5    4e-16   
ref|XP_010253022.1|  PREDICTED: uncharacterized protein LOC104594441  84.7    5e-16   
ref|XP_006600794.1|  PREDICTED: uncharacterized protein LOC100802...  84.3    5e-16   
ref|XP_003549823.1|  PREDICTED: uncharacterized protein LOC100802...  84.7    5e-16   
ref|XP_002511308.1|  conserved hypothetical protein                   84.3    5e-16   
gb|KHN10445.1|  hypothetical protein glysoja_030881                   84.3    5e-16   
ref|XP_003562863.1|  PREDICTED: uncharacterized protein LOC100826732  84.3    5e-16   
gb|KJB08091.1|  hypothetical protein B456_001G064200                  84.0    6e-16   
gb|KJB08092.1|  hypothetical protein B456_001G064200                  83.6    6e-16   
ref|XP_011071966.1|  PREDICTED: uncharacterized protein LOC105157288  84.0    6e-16   
ref|XP_004236272.1|  PREDICTED: uncharacterized protein LOC101245536  84.0    7e-16   
ref|XP_002530041.1|  protein phosphatase 2c, putative                 86.7    7e-16   
ref|XP_007161151.1|  hypothetical protein PHAVU_001G046800g           84.3    7e-16   
ref|XP_008229762.1|  PREDICTED: uncharacterized protein LOC103329112  84.0    7e-16   
ref|XP_002451729.1|  hypothetical protein SORBIDRAFT_04g006760        83.6    1e-15   
ref|XP_002268230.1|  PREDICTED: uncharacterized protein LOC100255180  83.2    1e-15   
ref|XP_004146978.1|  PREDICTED: uncharacterized protein LOC101203661  83.6    1e-15   
ref|XP_004158912.1|  PREDICTED: uncharacterized protein LOC101227560  83.6    1e-15   
gb|EMT06649.1|  hypothetical protein F775_13550                       83.2    1e-15   
ref|XP_010102967.1|  hypothetical protein L484_018986                 83.2    1e-15   
ref|XP_010929117.1|  PREDICTED: uncharacterized protein LOC105050701  84.3    1e-15   
ref|XP_004970997.1|  PREDICTED: uncharacterized protein LOC101768022  83.2    1e-15   
gb|AFK46289.1|  unknown                                               81.6    1e-15   
ref|XP_008807465.1|  PREDICTED: uncharacterized protein LOC103719825  83.2    1e-15   
gb|KJB22685.1|  hypothetical protein B456_004G060700                  83.2    1e-15   
ref|XP_008380035.1|  PREDICTED: uncharacterized protein LOC103443030  82.8    2e-15   
ref|XP_010932250.1|  PREDICTED: uncharacterized protein LOC105052962  82.8    2e-15   
ref|XP_006857698.1|  hypothetical protein AMTR_s00061p00168530        82.4    2e-15   
ref|XP_010039142.1|  PREDICTED: uncharacterized protein LOC104427810  82.8    2e-15   
ref|XP_010542041.1|  PREDICTED: uncharacterized protein LOC104815373  82.8    2e-15   
ref|XP_011046236.1|  PREDICTED: uncharacterized protein LOC105140891  82.8    2e-15   
ref|XP_009387555.1|  PREDICTED: uncharacterized protein LOC103974443  82.4    2e-15   
ref|XP_010038753.1|  PREDICTED: uncharacterized protein LOC104427347  82.8    2e-15   
ref|XP_008783101.1|  PREDICTED: uncharacterized protein LOC103702440  82.0    2e-15   
ref|XP_008342273.1|  PREDICTED: uncharacterized protein LOC103405081  82.4    2e-15   
ref|XP_007217278.1|  hypothetical protein PRUPE_ppa017616mg           82.4    2e-15   
ref|XP_010070200.1|  PREDICTED: uncharacterized protein LOC104456989  82.8    2e-15   
ref|XP_010107360.1|  hypothetical protein L484_006875                 82.0    3e-15   
ref|XP_008353616.1|  PREDICTED: uncharacterized protein LOC103417205  82.4    3e-15   
gb|AFW70716.1|  hypothetical protein ZEAMMB73_330752                  84.0    3e-15   
ref|XP_002987520.1|  hypothetical protein SELMODRAFT_126257           82.0    3e-15   
gb|KDP31019.1|  hypothetical protein JCGZ_11395                       82.0    3e-15   
ref|XP_010942142.1|  PREDICTED: uncharacterized protein LOC105060228  82.8    3e-15   
ref|XP_008444827.1|  PREDICTED: uncharacterized protein LOC103488057  81.6    4e-15   
ref|XP_008451346.1|  PREDICTED: uncharacterized protein LOC103492661  81.6    4e-15   
ref|XP_002460890.1|  hypothetical protein SORBIDRAFT_02g037000        81.3    5e-15   
ref|XP_004958096.1|  PREDICTED: uncharacterized protein LOC101782767  81.3    5e-15   
ref|XP_004951552.1|  PREDICTED: uncharacterized protein LOC101772581  81.6    5e-15   
ref|XP_010050838.1|  PREDICTED: uncharacterized protein LOC104439472  81.6    5e-15   
ref|XP_006452672.1|  hypothetical protein CICLE_v10010821mg           81.3    5e-15   
gb|KJB19507.1|  hypothetical protein B456_003G106700                  80.9    5e-15   
ref|XP_002322201.2|  hypothetical protein POPTR_0015s09600g           82.8    5e-15   
gb|KJB10213.1|  hypothetical protein B456_001G189700                  81.3    6e-15   
gb|KDO82205.1|  hypothetical protein CISIN_1g020915mg                 81.3    6e-15   
ref|XP_006438240.1|  hypothetical protein CICLE_v10033962mg           81.3    6e-15   
ref|XP_011097721.1|  PREDICTED: uncharacterized protein LOC105176569  81.3    6e-15   
emb|CDO97954.1|  unnamed protein product                              81.3    6e-15   
ref|XP_009628338.1|  PREDICTED: uncharacterized protein LOC104118721  81.3    6e-15   
ref|XP_003615564.1|  hypothetical protein MTR_5g069570                81.3    6e-15   
ref|XP_003578121.1|  PREDICTED: uncharacterized protein LOC100838527  82.4    7e-15   
ref|XP_010532946.1|  PREDICTED: uncharacterized protein LOC104808831  80.9    8e-15   
ref|XP_010644630.1|  PREDICTED: uncharacterized protein LOC100852612  80.9    8e-15   
ref|XP_004135720.1|  PREDICTED: uncharacterized protein LOC101212848  80.9    9e-15   
ref|XP_007049429.1|  Uncharacterized protein TCM_002465               80.5    1e-14   
ref|XP_009798084.1|  PREDICTED: uncharacterized protein LOC104244370  81.3    1e-14   
ref|XP_006848668.1|  hypothetical protein AMTR_s00305p00015080        80.5    1e-14   
ref|XP_007142239.1|  hypothetical protein PHAVU_008G264000g           80.5    1e-14   
gb|ACU17626.1|  unknown                                               79.0    1e-14   
emb|CDY27882.1|  BnaA07g04720D                                        80.1    1e-14   
ref|XP_004490568.1|  PREDICTED: uncharacterized protein LOC101492045  80.1    1e-14   
emb|CDY00849.1|  BnaCnng00490D                                        80.1    1e-14   
ref|XP_002987739.1|  hypothetical protein SELMODRAFT_126470           80.1    1e-14   
ref|XP_009392096.1|  PREDICTED: uncharacterized protein LOC103978120  80.1    1e-14   
ref|XP_010251033.1|  PREDICTED: uncharacterized protein LOC104593063  80.1    2e-14   
emb|CDP12711.1|  unnamed protein product                              80.1    2e-14   
gb|EPS71408.1|  hypothetical protein M569_03349                       79.7    2e-14   
ref|XP_002282388.2|  PREDICTED: probable protein phosphatase 2C 14    82.4    2e-14   
ref|XP_008670186.1|  PREDICTED: uncharacterized protein LOC103647426  80.9    2e-14   
ref|XP_010314094.1|  PREDICTED: uncharacterized protein LOC101244061  79.7    2e-14   
ref|XP_009364857.1|  PREDICTED: uncharacterized protein LOC103954761  79.7    2e-14   
ref|XP_010435360.1|  PREDICTED: uncharacterized protein LOC104719196  79.3    2e-14   
gb|KHN43917.1|  hypothetical protein glysoja_025956                   79.0    2e-14   
ref|XP_010100416.1|  hypothetical protein L484_027727                 79.3    2e-14   
ref|XP_009102402.1|  PREDICTED: uncharacterized protein LOC103828543  79.3    2e-14   
emb|CAN68722.1|  hypothetical protein VITISV_033681                   82.4    2e-14   
ref|XP_006418603.1|  hypothetical protein EUTSA_v10002618mg           79.3    3e-14   
ref|XP_008385436.1|  PREDICTED: uncharacterized protein LOC103447...  78.6    3e-14   
gb|EYU33727.1|  hypothetical protein MIMGU_mgv1a0262881mg             79.3    3e-14   
ref|XP_006645201.1|  PREDICTED: uncharacterized protein LOC102718506  79.3    3e-14   
ref|XP_009381564.1|  PREDICTED: uncharacterized protein LOC103969672  80.5    3e-14   
gb|KDP22998.1|  hypothetical protein JCGZ_01720                       81.6    3e-14   
ref|XP_002883629.1|  hypothetical protein ARALYDRAFT_480071           79.0    3e-14   
ref|XP_006484324.1|  PREDICTED: uncharacterized protein LOC102618638  81.6    3e-14   
ref|XP_008385435.1|  PREDICTED: uncharacterized protein LOC103447...  79.0    3e-14   
ref|XP_008355221.1|  PREDICTED: uncharacterized protein LOC103418890  78.6    4e-14   
ref|NP_193005.1|  uncharacterized protein                             78.6    4e-14   
gb|KFK31798.1|  hypothetical protein AALP_AA6G160300                  79.0    4e-14   
ref|XP_006299727.1|  hypothetical protein CARUB_v10015920mg           79.0    4e-14   
gb|KDO59224.1|  hypothetical protein CISIN_1g036500mg                 78.6    4e-14   
ref|XP_002315660.1|  hypothetical protein POPTR_0010s05770g           78.6    5e-14   
ref|XP_002863234.1|  hypothetical protein ARALYDRAFT_497148           78.2    5e-14   
ref|XP_002318087.2|  hypothetical protein POPTR_0012s09090g           79.0    5e-14   
ref|XP_010496357.1|  PREDICTED: uncharacterized protein LOC104773443  78.2    5e-14   
ref|NP_001054431.1|  Os05g0108400                                     78.2    6e-14   
ref|XP_007044827.1|  Uncharacterized protein TCM_010569               78.6    6e-14   
ref|XP_003545439.1|  PREDICTED: putative uncharacterized protein ...  78.6    6e-14   
ref|XP_006284280.1|  hypothetical protein CARUB_v10005449mg           77.8    6e-14   
ref|NP_178505.1|  uncharacterized protein                             78.2    7e-14   
ref|XP_010466979.1|  PREDICTED: uncharacterized protein LOC104747105  78.2    7e-14   
ref|XP_010488665.1|  PREDICTED: uncharacterized protein LOC104766470  78.2    8e-14   
ref|XP_007224142.1|  hypothetical protein PRUPE_ppa016161mg           78.2    8e-14   
ref|XP_010248684.1|  PREDICTED: uncharacterized protein LOC104591523  80.5    8e-14   
ref|XP_003549308.1|  PREDICTED: putative uncharacterized protein ...  78.6    8e-14   
ref|NP_001136825.1|  uncharacterized protein LOC100216973             79.3    8e-14   
ref|XP_011031123.1|  PREDICTED: uncharacterized protein LOC105130358  78.2    8e-14   
gb|ABK28164.1|  unknown                                               77.8    8e-14   
ref|XP_010552346.1|  PREDICTED: uncharacterized protein LOC104822...  77.4    9e-14   
ref|XP_002532169.1|  conserved hypothetical protein                   77.8    1e-13   
gb|KJB09027.1|  hypothetical protein B456_001G120000                  77.4    1e-13   
ref|XP_011042396.1|  PREDICTED: uncharacterized protein LOC105138...  77.4    1e-13   
ref|XP_010552345.1|  PREDICTED: uncharacterized protein LOC104822...  77.0    1e-13   
ref|XP_011042397.1|  PREDICTED: uncharacterized protein LOC105138...  77.4    1e-13   
emb|CDM85597.1|  unnamed protein product                              77.4    1e-13   
ref|XP_007206363.1|  hypothetical protein PRUPE_ppa017788mg           77.0    1e-13   
ref|XP_009359202.1|  PREDICTED: uncharacterized protein LOC103949811  77.4    1e-13   
ref|NP_683561.1|  uncharacterized protein                             77.0    1e-13   
gb|KHN46178.1|  hypothetical protein glysoja_022820                   76.6    2e-13   
ref|XP_007132388.1|  hypothetical protein PHAVU_011G090700g           77.0    2e-13   
ref|XP_006471404.1|  PREDICTED: uncharacterized protein LOC102616852  76.6    2e-13   
emb|CDY66553.1|  BnaCnng51410D                                        76.6    2e-13   
ref|XP_003574544.1|  PREDICTED: uncharacterized protein LOC100835247  78.2    2e-13   
ref|XP_004502142.1|  PREDICTED: uncharacterized protein LOC101513281  77.0    2e-13   
ref|XP_007015933.1|  Uncharacterized protein TCM_041499               76.6    2e-13   
ref|XP_002307050.1|  hypothetical protein POPTR_0005s06920g           76.6    2e-13   
ref|XP_006424321.1|  hypothetical protein CICLE_v10029846mg           76.6    2e-13   
gb|KDO45483.1|  hypothetical protein CISIN_1g021977mg                 76.6    2e-13   
ref|XP_006439940.1|  hypothetical protein CICLE_v10023489mg           77.0    2e-13   
gb|KDP32618.1|  hypothetical protein JCGZ_13168                       76.6    3e-13   
ref|NP_001132137.1|  hypothetical protein                             76.6    3e-13   
ref|XP_003518296.1|  PREDICTED: uncharacterized protein LOC100796483  76.6    3e-13   
ref|XP_008227203.1|  PREDICTED: uncharacterized protein LOC103326739  76.3    3e-13   
ref|XP_010278217.1|  PREDICTED: uncharacterized protein LOC104612487  76.3    3e-13   
emb|CDX82547.1|  BnaA03g32740D                                        76.3    3e-13   
ref|XP_010450329.1|  PREDICTED: uncharacterized protein LOC104732477  75.9    3e-13   
ref|XP_009135291.1|  PREDICTED: uncharacterized protein LOC103859505  75.9    4e-13   
ref|XP_008221896.1|  PREDICTED: uncharacterized protein LOC103321834  78.2    4e-13   
dbj|BAK05996.1|  predicted protein                                    76.3    4e-13   
gb|EAY84891.1|  hypothetical protein OsI_06256                        76.3    4e-13   
ref|XP_003544282.1|  PREDICTED: uncharacterized protein LOC100810973  75.9    4e-13   
ref|NP_001046211.1|  Os02g0198800                                     75.9    5e-13   
ref|XP_011462197.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  75.5    5e-13   
ref|XP_004305864.1|  PREDICTED: uncharacterized protein LOC101301230  75.5    6e-13   
gb|KDP34380.1|  hypothetical protein JCGZ_11263                       75.5    6e-13   
ref|XP_011072457.1|  PREDICTED: uncharacterized protein LOC105157708  75.5    6e-13   
ref|XP_006343140.1|  PREDICTED: uncharacterized protein LOC102583919  75.5    6e-13   
ref|XP_004960541.1|  PREDICTED: uncharacterized protein LOC101780495  75.5    7e-13   
ref|XP_007207266.1|  hypothetical protein PRUPE_ppa025212m1g          75.1    7e-13   
ref|XP_007142451.1|  hypothetical protein PHAVU_008G281700g           75.5    7e-13   
ref|XP_002458958.1|  hypothetical protein SORBIDRAFT_03g043380        75.5    7e-13   
ref|XP_010551974.1|  PREDICTED: uncharacterized protein LOC104822...  75.9    7e-13   
gb|EEE56506.1|  hypothetical protein OsJ_05776                        75.9    8e-13   
ref|XP_010465151.1|  PREDICTED: uncharacterized protein LOC104745569  74.7    8e-13   
ref|XP_002884958.1|  hypothetical protein ARALYDRAFT_478708           74.7    9e-13   
ref|XP_009777340.1|  PREDICTED: uncharacterized protein LOC104226933  75.1    9e-13   
ref|XP_004235628.1|  PREDICTED: uncharacterized protein LOC101250288  75.1    1e-12   
ref|XP_006299636.1|  hypothetical protein CARUB_v10015817mg           74.7    1e-12   
ref|XP_010045255.1|  PREDICTED: uncharacterized protein LOC104434...  74.7    1e-12   
gb|EPS70677.1|  hypothetical protein M569_04081                       74.7    1e-12   
ref|XP_008340356.1|  PREDICTED: uncharacterized protein LOC103403320  74.7    1e-12   
ref|XP_010514327.1|  PREDICTED: uncharacterized protein LOC104790300  74.7    1e-12   
ref|XP_003564890.1|  PREDICTED: uncharacterized protein LOC100831420  74.7    1e-12   
ref|XP_008372607.1|  PREDICTED: uncharacterized protein LOC103435955  75.9    1e-12   
ref|XP_009622577.1|  PREDICTED: uncharacterized protein LOC104113961  74.3    1e-12   
emb|CBI28480.3|  unnamed protein product                              73.9    1e-12   
gb|KJB55669.1|  hypothetical protein B456_009G088000                  74.3    1e-12   
ref|XP_010500251.1|  PREDICTED: uncharacterized protein LOC104777658  74.3    1e-12   
ref|XP_006395202.1|  hypothetical protein EUTSA_v10005686mg           74.7    2e-12   
ref|XP_010484925.1|  PREDICTED: uncharacterized protein LOC104763219  74.3    2e-12   
ref|XP_010487076.1|  PREDICTED: uncharacterized protein LOC104765...  73.9    2e-12   
emb|CDY19961.1|  BnaA09g02900D                                        74.3    2e-12   
ref|XP_007020399.1|  Uncharacterized protein TCM_030574               73.9    2e-12   
ref|XP_010487075.1|  PREDICTED: uncharacterized protein LOC104765...  73.9    2e-12   
ref|XP_002533604.1|  conserved hypothetical protein                   73.9    2e-12   
ref|XP_009111832.1|  PREDICTED: uncharacterized protein LOC103837244  74.3    2e-12   
ref|XP_010045254.1|  PREDICTED: uncharacterized protein LOC104434...  74.3    2e-12   
gb|KFK31309.1|  hypothetical protein AALP_AA6G096000                  74.3    2e-12   
ref|XP_011022881.1|  PREDICTED: uncharacterized protein LOC105124530  73.9    2e-12   
emb|CDX85324.1|  BnaC07g26350D                                        73.2    3e-12   
ref|XP_002310533.1|  hypothetical protein POPTR_0007s04630g           73.9    3e-12   
gb|KHN38664.1|  hypothetical protein glysoja_008213                   73.9    3e-12   
ref|XP_010495442.1|  PREDICTED: uncharacterized protein LOC104772538  73.9    3e-12   
ref|NP_199638.1|  uncharacterized protein                             73.9    3e-12   
gb|ACU18815.1|  unknown                                               73.9    3e-12   
ref|XP_008351057.1|  PREDICTED: probable protein phosphatase 2C 14    75.5    3e-12   
ref|XP_003538138.1|  PREDICTED: uncharacterized protein LOC100797969  73.9    3e-12   
ref|XP_008390094.1|  PREDICTED: uncharacterized protein LOC103452380  75.5    3e-12   
emb|CDY48744.1|  BnaA02g30050D                                        73.6    3e-12   
ref|XP_002266988.1|  PREDICTED: uncharacterized protein LOC100249414  73.6    3e-12   
ref|XP_006447854.1|  hypothetical protein CICLE_v10017488mg           73.6    3e-12   
gb|KHN21116.1|  hypothetical protein glysoja_006595                   73.6    3e-12   
emb|CDY00069.1|  BnaC09g02320D                                        73.6    3e-12   
ref|XP_006469407.1|  PREDICTED: uncharacterized protein LOC102629245  73.6    3e-12   
ref|XP_002865625.1|  hypothetical protein ARALYDRAFT_917720           73.6    3e-12   
ref|XP_010678886.1|  PREDICTED: uncharacterized protein LOC104894363  73.6    3e-12   
ref|XP_009151628.1|  PREDICTED: uncharacterized protein LOC103874...  73.6    4e-12   
emb|CDX86317.1|  BnaA06g30340D                                        73.2    4e-12   
ref|XP_008353192.1|  PREDICTED: uncharacterized protein LOC103416744  73.6    4e-12   



>ref|XP_009776174.1| PREDICTED: uncharacterized protein LOC104225989 [Nicotiana sylvestris]
Length=386

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 115/173 (66%), Gaps = 16/173 (9%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y+T LGLFA+TWSR+L GRSFH+HFLL+DS    A  ++       S +  PSFH  IKP
Sbjct  56   YQTHLGLFALTWSRNLFGRSFHIHFLLNDSDGVGADYNNTISSPHLSSTSTPSFHLNIKP  115

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
            F+F KK GSKKL     G  K  ++FWDLS+AKFGSGPEP+SGFY+AV+V GE VLL+GD
Sbjct  116  FIFWKKHGSKKLD----GDNKVVHIFWDLSKAKFGSGPEPISGFYVAVIVNGEMVLLVGD  171

Query  532  CQXEAYAKTRARHAGNGQ------------ALVLKREHVYGGKLYATKSNVGG  654
               EAYAKTRAR     +             LVL+REHV G KLY TK+N GG
Sbjct  172  LNKEAYAKTRARMPEKKENQNQNPNPNPNPNLVLRREHVCGNKLYKTKANFGG  224



>ref|XP_009619129.1| PREDICTED: uncharacterized protein LOC104111192 [Nicotiana tomentosiformis]
Length=383

 Score =   167 bits (423),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 116/174 (67%), Gaps = 21/174 (12%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDD-----ssaaaagessPRDFYFSSLSGAPSFH  336
            Y+T LGLFA+TWSR+L GRSFH+HFLL+D     +       SSP   + SS S  PSFH
Sbjct  56   YQTHLGLFALTWSRNLFGRSFHIHFLLNDSDGVGADYNNNTISSP---HLSSTS-TPSFH  111

Query  337  FRIKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETV  516
              IKPF+F KK GSKKL     G  K  ++FWDLS++KFGSGPEP+SGFY+AV+V  E V
Sbjct  112  LNIKPFIFWKKHGSKKLD----GDNKVVHIFWDLSKSKFGSGPEPISGFYVAVIVNEEMV  167

Query  517  LLIGDCQXEAYAKTRARHAGNGQ--------ALVLKREHVYGGKLYATKSNVGG  654
            LL+GD   EAYAKTRAR     Q         LVL+REHV G KLY TK+N GG
Sbjct  168  LLVGDLNKEAYAKTRARKPEKKQNLNPNPNPNLVLRREHVCGNKLYKTKANFGG  221



>ref|XP_006366515.1| PREDICTED: uncharacterized protein LOC102585370 [Solanum tuberosum]
Length=349

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 106/163 (65%), Gaps = 24/163 (15%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y T LGLFA+TWSR+L GRSFH+HFLL+                 SS   +PSFH  IKP
Sbjct  55   YNTHLGLFALTWSRNLFGRSFHIHFLLNG---------------LSSPHVSPSFHLHIKP  99

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
            F+F KK GSKKL         N ++FWDLS+AKFGSGPEP SGFY+A +V GE VLL+GD
Sbjct  100  FVFWKKHGSKKLD-------NNVHIFWDLSKAKFGSGPEPRSGFYVAAIVNGEMVLLVGD  152

Query  532  CQXEAYAKTRARHAG--NGQALVLKREHVYGGKLYATKSNVGG  654
               EAY++TRAR     +   +VL+REHV G KLY TK+  GG
Sbjct  153  LPKEAYSRTRARKPDKYSNSNMVLRREHVCGNKLYITKAKFGG  195



>ref|XP_004244888.1| PREDICTED: uncharacterized protein LOC101262938 [Solanum lycopersicum]
Length=339

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 103/162 (64%), Gaps = 23/162 (14%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y T LGLFA+TWSR+L GRSFH+HFLL+                 SS   +PSF   IKP
Sbjct  45   YNTHLGLFALTWSRNLFGRSFHIHFLLNG---------------LSSPHLSPSFQLHIKP  89

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
            F+F KK GS KL         N ++FWD S+AKFGSGPEP SGFY+A  V GE VLL+GD
Sbjct  90   FVFWKKHGSNKLH-------NNVHIFWDFSKAKFGSGPEPRSGFYMAATVNGEMVLLVGD  142

Query  532  CQXEAYAKTRARHAGNGQALVLKREHVY-GGKLYATKSNVGG  654
               EAY++TRAR+      +VL+REHVY G KLY TK+  GG
Sbjct  143  LLKEAYSRTRARNKYMNMNMVLRREHVYCGNKLYITKAKFGG  184



>ref|XP_007011756.1| Uncharacterized protein TCM_036932 [Theobroma cacao]
 gb|EOY29375.1| Uncharacterized protein TCM_036932 [Theobroma cacao]
Length=384

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 107/161 (66%), Gaps = 7/161 (4%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y+T LGLF++TWSR  LG S HLH       + ++  S P    FS+L     FH  IKP
Sbjct  52   YQTNLGLFSLTWSRTFLGHSLHLHLHPSSHYSFSSPLSLPNSLSFSTLH----FHLHIKP  107

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
            F+F KKQG KKL   SS  + N  VFWDLSRAKFGSGPEP SGFYIAV+V GE  LL+GD
Sbjct  108  FIFWKKQGYKKL---SSATVPNVQVFWDLSRAKFGSGPEPDSGFYIAVVVDGEMTLLVGD  164

Query  532  CQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
                AYA+TRA+     QALVL+REHV+G K+Y TK+  GG
Sbjct  165  STKAAYARTRAQKPRRSQALVLRREHVFGSKVYNTKARFGG  205



>ref|XP_002285361.1| PREDICTED: uncharacterized protein LOC100262872 [Vitis vinifera]
Length=371

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 105/161 (65%), Gaps = 5/161 (3%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y T LG+F +TWSR+  GRS HL         +AA   SP           P+FH  IKP
Sbjct  49   YHTDLGIFTLTWSRNFFGRSLHLQL-----HPSAAANLSPLSLSNPLSLSTPAFHLHIKP  103

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
            F+F KK GSKKL ++ + G ++  VFWDL+RAKFGS PEP  GFY+AV+  GE +LL+GD
Sbjct  104  FVFWKKYGSKKLHVAGAPGGRDIRVFWDLTRAKFGSWPEPQHGFYVAVVADGEMILLVGD  163

Query  532  CQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
             + EAY KTRA+ A   Q LVL+REHV+G K+Y T+++ GG
Sbjct  164  SEKEAYNKTRAKKAERTQVLVLRREHVFGNKVYTTRASFGG  204



>ref|XP_006450316.1| hypothetical protein CICLE_v10008624mg [Citrus clementina]
 ref|XP_006483448.1| PREDICTED: uncharacterized protein LOC102620001 [Citrus sinensis]
 gb|ESR63556.1| hypothetical protein CICLE_v10008624mg [Citrus clementina]
 gb|KDO67512.1| hypothetical protein CISIN_1g016824mg [Citrus sinensis]
Length=382

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 110/167 (66%), Gaps = 11/167 (7%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYF-SSLSGAP-SFHFRI  345
            Y T LGLF++TWS  L G S HL     D      G SSP  F   SS S A  SFH  I
Sbjct  51   YNTHLGLFSLTWSMTLFGHSLHL-----DHHPFDYGNSSPISFCSNSSFSHAAFSFHLHI  105

Query  346  KPFMFSKKQGSKKLQ-ISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLL  522
            KP +F KK+GSKKL  I+++   KN  +FWDLS+AKFGSGPEP SGFYIAV+V GE  LL
Sbjct  106  KPLIFWKKRGSKKLSVITTNKASKNIQLFWDLSKAKFGSGPEPQSGFYIAVVVDGEMSLL  165

Query  523  IGDCQXEAYAKTRARHAGNG---QALVLKREHVYGGKLYATKSNVGG  654
            +GDC  EAYAKT+A+        QALVL+REHV+G K+Y TK+  GG
Sbjct  166  VGDCIKEAYAKTKAQKPERSQAPQALVLRREHVFGNKVYTTKAKFGG  212



>emb|CAN69699.1| hypothetical protein VITISV_001515 [Vitis vinifera]
Length=372

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 104/161 (65%), Gaps = 5/161 (3%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y T LG+F +TWSR+  GRS HL         +AA   SP           P+FH  IKP
Sbjct  49   YHTDLGIFTLTWSRNFFGRSLHLQL-----HPSAAANLSPLSLSNPLSLSTPAFHLHIKP  103

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
            F+F KK GSKKL ++ + G ++  VFWDL+RAKFGS PEP  GFY+ V+  GE +LL+GD
Sbjct  104  FVFWKKYGSKKLHVAGAPGGRDIRVFWDLTRAKFGSXPEPQHGFYVXVVADGEMILLVGD  163

Query  532  CQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
             + EAY KTRA+ A   Q LVL+REHV+G K+Y T+++ GG
Sbjct  164  SEKEAYNKTRAKKAERTQVLVLRREHVFGNKVYTTRASFGG  204



>gb|KJB07669.1| hypothetical protein B456_001G036600 [Gossypium raimondii]
Length=362

 Score =   153 bits (387),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 103/161 (64%), Gaps = 11/161 (7%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y T LGLF++TWS   LG S  LH        +    SSP    FS+L     FH  IKP
Sbjct  53   YHTNLGLFSLTWSCTFLGHSLLLHLY----PCSHFSPSSPTSLSFSTLL----FHLHIKP  104

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
            F+F KK G+KKL   ++    N +VFWDLSRAKFGSGPEP SGFY+A++V GE VLL+GD
Sbjct  105  FIFWKKYGNKKLSCDTTS---NVHVFWDLSRAKFGSGPEPESGFYVALVVDGEMVLLVGD  161

Query  532  CQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
               EAYA+TR +  G  QALV +REH+YG KLY TK+  G 
Sbjct  162  SIKEAYARTRVQKPGKPQALVSRREHLYGNKLYTTKARFGS  202



>gb|KDP33539.1| hypothetical protein JCGZ_07110 [Jatropha curcas]
Length=384

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 105/164 (64%), Gaps = 8/164 (5%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y+T LGLF++TWSR  +G S HL     D++ A+    S      S LS    FH  IKP
Sbjct  48   YQTELGLFSLTWSRSFIGHSLHLQLHSGDTATASPFSFS-NPSSLSILS----FHVHIKP  102

Query  352  FMFSKKQGSKKLQI---SSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLL  522
            F+F KK GSKKL +     +  +    +FWDLSRAKFGSGPEP SGFYIAV+V  E +LL
Sbjct  103  FIFWKKHGSKKLHVINQEPNASVPGVQIFWDLSRAKFGSGPEPQSGFYIAVVVDREIILL  162

Query  523  IGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
            +GD   +A AKTRA+ A   Q LVL+REHVYG ++Y TK+  GG
Sbjct  163  VGDLTKQACAKTRAKRADRSQVLVLRREHVYGNRVYTTKARFGG  206



>ref|XP_011036648.1| PREDICTED: uncharacterized protein LOC105134078 [Populus euphratica]
Length=407

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 104/165 (63%), Gaps = 8/165 (5%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHF-LLDDssaaaagessPRDFYFSSLSGAPSFHFRIK  348
            Y+T LGLF++TWS  LLG S HL    +DD+++  +  S       S++S    FH  IK
Sbjct  50   YQTDLGLFSLTWSSSLLGHSLHLRLHPIDDNASYCSPVSLCNPLCLSTIS----FHLNIK  105

Query  349  PFMFSKKQGSKKLQI---SSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVL  519
            PF+F K+ GSK+L +             +FWDLSRA+FGSGPEP S FYIAV+V  E VL
Sbjct  106  PFLFWKRHGSKRLHVINQEPDTPTPRIQIFWDLSRARFGSGPEPQSRFYIAVVVEREMVL  165

Query  520  LIGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
            ++GD   EA+AKT+A      Q LVL+REHV+G ++Y T++  GG
Sbjct  166  VVGDLTKEAFAKTKALKQERPQVLVLRREHVFGNRVYTTRARFGG  210



>gb|KJB55057.1| hypothetical protein B456_009G060700 [Gossypium raimondii]
Length=386

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 103/161 (64%), Gaps = 7/161 (4%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            YRT LGLF++TWSR  LG S HLH       + ++  S P    FS+L     FH  IKP
Sbjct  53   YRTNLGLFSLTWSRSFLGHSLHLHLHPASHYSPSSPLSLPASLSFSTLH----FHLHIKP  108

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
            F+F KK G KKL   SS  + N  VFWD SRAKF SG EP SGFYIA++V GE  LL+GD
Sbjct  109  FIFWKKHGHKKL---SSATVPNVQVFWDFSRAKFRSGSEPDSGFYIAIVVDGEMTLLVGD  165

Query  532  CQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
               EAYA+ RA+  G  Q+LVL+REHV G K+Y TK+  GG
Sbjct  166  SAKEAYARARAQRPGKSQSLVLRREHVLGNKVYNTKARFGG  206



>ref|XP_008377675.1| PREDICTED: uncharacterized protein LOC103440754 [Malus domestica]
Length=346

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 94/161 (58%), Gaps = 18/161 (11%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y T L LF++TWSR  LGRS HL+ L               D        +PSFH  IKP
Sbjct  47   YHTDLALFSLTWSRSFLGRSLHLNLLRHSF-----------DSPLPPSLSSPSFHLHIKP  95

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
            F+F KK GSKKL         N  ++W LSRA+FGSGPEP SGFYIAV+V  E  LL+GD
Sbjct  96   FLFWKKHGSKKLS-------PNILLYWXLSRARFGSGPEPQSGFYIAVVVDNEMTLLVGD  148

Query  532  CQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
               EAYAKTRA  +   Q  +LKREHV   K+Y TK+  GG
Sbjct  149  LTREAYAKTRANKSETSQIPILKREHVVAKKIYTTKARFGG  189



>ref|XP_009363946.1| PREDICTED: uncharacterized protein LOC103953867 [Pyrus x bretschneideri]
Length=343

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 96/161 (60%), Gaps = 18/161 (11%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y T   LF++TWSR  LGRS HL+ L               D        +PSFH  IKP
Sbjct  42   YHTDHALFSLTWSRSFLGRSLHLNLLRHSF-----------DSPLPPSLSSPSFHLHIKP  90

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
            F+F KK GSKKL         N  +FWDLS+A+FGSGPEP SGFYIAV+V  E  L++GD
Sbjct  91   FLFWKKHGSKKLS-------PNILLFWDLSKARFGSGPEPQSGFYIAVVVDNEMTLVVGD  143

Query  532  CQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
               EAYAKTRA+ +   Q  +LKREHV   K+YATK+  GG
Sbjct  144  LTREAYAKTRAQKSETPQIPILKREHVVAKKIYATKARFGG  184



>ref|XP_002515453.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46902.1| conserved hypothetical protein [Ricinus communis]
Length=336

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 85/127 (67%), Gaps = 12/127 (9%)
 Frame = +1

Query  310  SLSGAPS-----FHFRIKPFMFSKKQGSKKLQI-------SSSGGLKNANVFWDLSRAKF  453
            SLS  PS     FH  IKP++F KK GSKKLQI       +S+       +FWDLSRAKF
Sbjct  32   SLSHTPSLSTLSFHLDIKPYIFWKKHGSKKLQIINHQDYHTSTASTPAIQIFWDLSRAKF  91

Query  454  GSGPEPVSGFYIAVLVGGETVLLIGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYA  633
            GSGPEP SGFYIAV+V  E VLL+GD   +A+AKTRAR     Q LVL+REHVYG +++ 
Sbjct  92   GSGPEPQSGFYIAVVVEREIVLLVGDSTKQAFAKTRARKQERNQVLVLRREHVYGNRVFT  151

Query  634  TKSNVGG  654
            TK+  GG
Sbjct  152  TKARFGG  158



>ref|XP_008378697.1| PREDICTED: uncharacterized protein LOC103441769 [Malus domestica]
Length=344

 Score =   137 bits (345),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 92/161 (57%), Gaps = 18/161 (11%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y T   LF++TWSR  LGRS HL+ L               D        +P FH  IKP
Sbjct  43   YHTDHALFSLTWSRSFLGRSLHLNLLHHSF-----------DSPLPPSLSSPYFHLHIKP  91

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
            F+F KK GSKKL         N  +FWDLS+A+F SGPEP SGFYIAV+V  E  LL+GD
Sbjct  92   FLFWKKHGSKKLS-------PNILLFWDLSKARFSSGPEPQSGFYIAVVVDNEMTLLVGD  144

Query  532  CQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
               EAY+KTRAR +   Q  +LKREHV   K+Y T +  GG
Sbjct  145  LTREAYSKTRARKSETPQIPILKREHVIAKKIYTTMARFGG  185



>ref|XP_010048907.1| PREDICTED: uncharacterized protein LOC104437620 [Eucalyptus grandis]
 gb|KCW81330.1| hypothetical protein EUGRSUZ_C02717 [Eucalyptus grandis]
Length=382

 Score =   137 bits (346),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 101/162 (62%), Gaps = 5/162 (3%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y T LGLF++TWS+ L GRS HL       S+     SSP     S  S   SF   IKP
Sbjct  50   YHTHLGLFSLTWSKTLFGRSLHLSLHSHHGSSFLDYNSSP----LSPSSCTFSFQLHIKP  105

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
             +F KKQGSKKL    +    +  +FWDL+RAKFGSGPEP SGFYIAV+V GE  LL+GD
Sbjct  106  LVFWKKQGSKKLDADKTRTGASIRIFWDLARAKFGSGPEPESGFYIAVVVNGEMALLVGD  165

Query  532  CQXEAYAKTRARH-AGNGQALVLKREHVYGGKLYATKSNVGG  654
                AY KT+ R  A  GQAL L+REH++G ++YAT +  GG
Sbjct  166  AVKSAYGKTKVRKPAERGQALFLRREHLFGHRVYATSARFGG  207



>ref|XP_003603315.1| hypothetical protein MTR_3g106250 [Medicago truncatula]
 gb|AES73566.1| DUF868 family protein [Medicago truncatula]
Length=346

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 102/163 (63%), Gaps = 20/163 (12%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPS-FHFRIK  348
            Y++ +GL ++TWSR +LGRS H+                P D   ++ S + S FH  IK
Sbjct  42   YQSNVGLVSLTWSRSILGRSLHVQL-----------HHHPFDSPPTNPSSSSSSFHLHIK  90

Query  349  PFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIG  528
            PF+F KK G+KKL         N ++FW+LS+AKFGSGPEP SGFY AV+V  E  LL+G
Sbjct  91   PFIFWKKHGTKKLS-------SNTHLFWNLSKAKFGSGPEPDSGFYFAVVVDNEMTLLVG  143

Query  529  DCQXEAYAKTRAR-HAGNGQALVLKREHVYGGKLYATKSNVGG  654
            D   +AYAK++++ H  N Q LV+KREHVY  K+Y T++  GG
Sbjct  144  DSNKDAYAKSKSKEHKNNFQYLVMKREHVYANKIYNTRARFGG  186



>gb|ABK92441.1| unknown [Populus trichocarpa]
Length=207

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 104/165 (63%), Gaps = 8/165 (5%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHF-LLDDssaaaagessPRDFYFSSLSGAPSFHFRIK  348
            Y+T LGLF++TWS  LLG S HL    +DD+++  +  S       S++S    FH  IK
Sbjct  44   YQTDLGLFSLTWSSSLLGHSLHLRLHPIDDNASYCSPVSLSNPLSLSTIS----FHLNIK  99

Query  349  PFMFSKKQGSKKLQI---SSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVL  519
            PF+F K+ GSKKL +             +FWDLSRA+FGSGPEP S FYIAV+V  E VL
Sbjct  100  PFLFWKRHGSKKLHVINQEPDTPTPRIQIFWDLSRARFGSGPEPQSRFYIAVVVEREVVL  159

Query  520  LIGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
            ++GD   EA+AKT+A      Q LVL+REHV+G ++Y T++  GG
Sbjct  160  VVGDLTKEAFAKTKALKQERPQVLVLRREHVFGNRVYTTRARFGG  204



>ref|XP_004501367.1| PREDICTED: uncharacterized protein LOC101507611 [Cicer arietinum]
Length=347

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 99/161 (61%), Gaps = 18/161 (11%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y+T +GL ++TWSR +LGRS H+        +                + + SFH  IKP
Sbjct  44   YQTDIGLVSLTWSRSILGRSLHVQLHHHPFDSPP-----------PPPNPSSSFHLHIKP  92

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
            F+F KK G+KKL         N ++FW+LS+AKFGSGP+P SG+Y AV+V  E  LLIGD
Sbjct  93   FIFWKKHGTKKLS-------SNTHLFWNLSKAKFGSGPDPNSGYYFAVVVDKEMTLLIGD  145

Query  532  CQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
               +AYAK++A+   NGQ LVLKREHV+  K+Y T++  GG
Sbjct  146  SNKDAYAKSKAKEPKNGQFLVLKREHVFANKIYVTRARFGG  186



>ref|XP_003527779.1| PREDICTED: uncharacterized protein LOC100783731 [Glycine max]
Length=333

 Score =   132 bits (331),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 96/161 (60%), Gaps = 16/161 (10%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y T  G  ++TWSR ++GRS H+    + +   +    +P            SFH  I+P
Sbjct  38   YHTDTGPVSLTWSRSIVGRSLHIQLHQNQNPLDSPPYPNPTTL---------SFHHHIRP  88

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
            F+F KK GSKKL         +  +FW+LSRAKFG+ PEP+SGFY+A++V     LLIGD
Sbjct  89   FLFWKKHGSKKLA-------PDTFLFWNLSRAKFGAAPEPLSGFYVALVVHNHMTLLIGD  141

Query  532  CQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
               +A++K++ARH    Q L+LK+EHV+  +LY T++  GG
Sbjct  142  STKDAFSKSKARHPNTPQLLLLKKEHVFADRLYTTRATFGG  182



>ref|XP_002324318.2| hypothetical protein POPTR_0018s02290g [Populus trichocarpa]
 gb|EEF02883.2| hypothetical protein POPTR_0018s02290g [Populus trichocarpa]
Length=401

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 104/165 (63%), Gaps = 8/165 (5%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHF-LLDDssaaaagessPRDFYFSSLSGAPSFHFRIK  348
            Y+T LGLF++TWS  LLG S HL    +DD+++  +  S       S++S    FH  IK
Sbjct  44   YQTDLGLFSLTWSSSLLGHSLHLRLHPIDDNASYCSPVSLSNPLSLSTIS----FHLNIK  99

Query  349  PFMFSKKQGSKKLQI---SSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVL  519
            PF+F K+ GSKKL +             +FWDLSRA+FGSGPEP S FYIAV+V  E VL
Sbjct  100  PFLFWKRHGSKKLHVINQEPDTPTPRIQIFWDLSRARFGSGPEPQSRFYIAVVVEREVVL  159

Query  520  LIGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
            ++GD   EA+AKT+A      Q LVL+REHV+G ++Y T++  GG
Sbjct  160  VVGDLTKEAFAKTKALKQERPQVLVLRREHVFGNRVYTTRARFGG  204



>ref|XP_010665861.1| PREDICTED: uncharacterized protein LOC104883105 [Beta vulgaris 
subsp. vulgaris]
Length=384

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 96/162 (59%), Gaps = 23/162 (14%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y+T +G+F++TWSR L  RSFHLH                        S + SFH  +KP
Sbjct  71   YQTNIGIFSITWSRSLFSRSFHLHL---------------------HPSPSLSFHLTLKP  109

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
            F+F  K G KKL       L +  +FWD S AKFG GP P SGFYIAV+  G+  LL+GD
Sbjct  110  FLFWNKSGIKKLP-PPPHSLSSIYLFWDFSSAKFGPGPGPESGFYIAVVFEGQISLLVGD  168

Query  532  CQXEAYAKTR-ARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
             + EA+AKT+  + A   Q+LV++REHV+G + Y+T +++GG
Sbjct  169  LEKEAFAKTKVTKFAEKLQSLVIRREHVFGDRFYSTTTDLGG  210



>ref|XP_006579047.1| PREDICTED: uncharacterized protein LOC100775282 [Glycine max]
Length=299

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 96/157 (61%), Gaps = 11/157 (7%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y T  G  ++TWSR ++GRS H+    +   +      +P     ++LS    FH  I+P
Sbjct  36   YHTDTGPVSLTWSRSIVGRSLHIQLHQNPLDSPPYPNPNPNPSPSTTLS----FHLHIRP  91

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
            F+F KK GSKKL         N ++FW+LSRAKFG+ PEP+SGFY+A++V     LLIGD
Sbjct  92   FLFWKKHGSKKLA-------PNTHLFWNLSRAKFGATPEPLSGFYVALVVHNHMTLLIGD  144

Query  532  CQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKS  642
               +A++K++ARH    Q L+LK+E V+  +LY T++
Sbjct  145  AARDAFSKSKARHPNTPQLLLLKKERVFADRLYTTRA  181



>ref|XP_004291941.1| PREDICTED: uncharacterized protein LOC101293553 [Fragaria vesca 
subsp. vesca]
Length=352

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 95/166 (57%), Gaps = 24/166 (14%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLG-RSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIK  348
            Y T   +F++TWSR  LG RS HL+ L     +                S +PSFH  +K
Sbjct  47   YHTDFAIFSLTWSRSFLGGRSLHLNLLHHAFDSP------------PPPSSSPSFHLNLK  94

Query  349  PFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIG  528
            PF F K+ GSKKL         N  +FWD SRAKF SGPEP+S FY+AV+V G+  LL+G
Sbjct  95   PFFFWKRHGSKKLA-------PNVLIFWDFSRAKFSSGPEPLSAFYVAVVVDGDMTLLLG  147

Query  529  DCQXEAYAKTRARHAGNG----QALVLKREHVYGGKLYATKSNVGG  654
            D   EAYAKTRA  A +     Q LVLKREHV    +Y TK+ +GG
Sbjct  148  DLNKEAYAKTRANQAIDQSPQPQTLVLKREHVVAKNIYTTKAKLGG  193



>ref|XP_011039597.1| PREDICTED: uncharacterized protein LOC105136101 [Populus euphratica]
Length=402

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 101/165 (61%), Gaps = 8/165 (5%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLS-GAPSFHFRIK  348
            Y+T LGLF++TWS   LG S HLH    D + +         FY + LS    SFH  IK
Sbjct  45   YQTDLGLFSLTWSSCFLGHSLHLHLHPIDCNNSYCSPV----FYPNPLSLSTISFHLNIK  100

Query  349  PFMFSKKQGSKKLQI---SSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVL  519
            P +F K+ GSKK  +    ++       +FWDLSRAKFGSG EP SGFYIAV+V  E VL
Sbjct  101  PSLFWKRHGSKKFHVINQEANTPTPRIQIFWDLSRAKFGSGHEPQSGFYIAVVVEREMVL  160

Query  520  LIGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
            L+GD   EA+AKT+A      Q LVL+REHV+G ++Y T++  GG
Sbjct  161  LVGDLTKEAFAKTKALRKERAQVLVLRREHVFGNRVYTTRARFGG  205



>ref|XP_010245551.1| PREDICTED: uncharacterized protein LOC104589062 [Nelumbo nucifera]
Length=369

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 93/163 (57%), Gaps = 18/163 (11%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y T LG+FA+TW R+++GR   +    DD            D +       PS+   +KP
Sbjct  45   YYTNLGVFALTWCRNVIGRDLQIDIRFDDQED--------EDLF-------PSYRLHMKP  89

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKF-GSGPEPVSGFYIAVLVGGETVLLIG  528
            F F +K GSK+L ++     K   ++WDL+RAKF  S PEP SGFY+AV+V G   LL+G
Sbjct  90   FFFWRKYGSKRLHVNGPTK-KKVEIYWDLTRAKFVASSPEPQSGFYVAVVVDGVMTLLVG  148

Query  529  DCQXEAYAKTRARHAG-NGQALVLKREHVYGGKLYATKSNVGG  654
            D Q E Y +++ R      Q L+ +REHV+G K+Y T++  GG
Sbjct  149  DSQREVYGRSKTRKPNRRSQVLISRREHVFGNKVYTTRARFGG  191



>gb|KJB65893.1| hypothetical protein B456_010G117700 [Gossypium raimondii]
Length=357

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 94/163 (58%), Gaps = 14/163 (9%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y T +GLF++TWSR          FL             P        S A  FH  IK 
Sbjct  43   YDTNIGLFSLTWSRT---------FLGHSLHLHQHHHRLPSSPLSVLSSSALHFHLNIKS  93

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
            F F KK+G KKL   +S  + N  +FWDLSRAKFGSGPEP SGF++ V+V GE  LL+GD
Sbjct  94   FAFWKKKGCKKL---TSATVPNVKIFWDLSRAKFGSGPEPDSGFFVGVVVDGEMTLLVGD  150

Query  532  CQXEAYAKTRARHAGN--GQALVLKREHVYGGKLYATKSNVGG  654
               EAY +TRA++ G+   Q LVL++EHV G ++Y TK+  GG
Sbjct  151  ATKEAYTRTRAQNPGSRGSQTLVLRKEHVLGNRVYNTKARFGG  193



>ref|XP_010265675.1| PREDICTED: uncharacterized protein LOC104603360 [Nelumbo nucifera]
Length=376

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 93/163 (57%), Gaps = 18/163 (11%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y T LG+FA+TW R ++GR+  +    DD            D +       P+F   IKP
Sbjct  48   YYTNLGVFALTWCRYVIGRALQIDLRFDDQEE--------EDLF-------PTFRLHIKP  92

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKF-GSGPEPVSGFYIAVLVGGETVLLIG  528
            F F +K GSKKL +++    K   ++WDL+RAKF  S PEP SGFY+AV+V GET LL+G
Sbjct  93   FFFWRKYGSKKLHLNNPAK-KKVEIYWDLTRAKFISSSPEPQSGFYVAVVVDGETTLLVG  151

Query  529  DCQXEAY-AKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
            D Q  AY      R     Q L+ +REHV+G K+Y T++  GG
Sbjct  152  DLQRAAYDRTKTRRPKRRNQVLISRREHVFGNKVYTTRARFGG  194



>ref|XP_010033684.1| PREDICTED: uncharacterized protein LOC104422917 [Eucalyptus grandis]
 gb|KCW53394.1| hypothetical protein EUGRSUZ_J02625 [Eucalyptus grandis]
Length=382

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 100/162 (62%), Gaps = 5/162 (3%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y T LGLF++TWS+ L GRS HL       S+     SS      S  S   SF   IK 
Sbjct  50   YHTHLGLFSLTWSKTLFGRSLHLSLHSHHGSSFLDYNSS----PLSPSSSTFSFQLHIKS  105

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
             +F KKQGSKKL    +    +  +FWDL+RAKFGSGPEP SGFYIAV+V GE  LL+GD
Sbjct  106  LVFWKKQGSKKLDADKTRTGASIRIFWDLARAKFGSGPEPESGFYIAVVVNGEMALLVGD  165

Query  532  CQXEAYAKTRARH-AGNGQALVLKREHVYGGKLYATKSNVGG  654
                AY KT+AR  A  GQAL L+REH++G ++YAT +  GG
Sbjct  166  AVKSAYGKTKARKPAERGQALFLRREHLFGHRVYATSARFGG  207



>ref|XP_010541582.1| PREDICTED: uncharacterized protein LOC104815002 [Tarenaya hassleriana]
 ref|XP_010541584.1| PREDICTED: uncharacterized protein LOC104815002 [Tarenaya hassleriana]
Length=376

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 95/164 (58%), Gaps = 10/164 (6%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFS---SLSGAPSFHFR  342
            Y+T LG+F VTW+R   G S +L     D    ++  S       +   SLS A SF   
Sbjct  24   YKTNLGVFYVTWARTFFGHSVNLFLHSQDCYPHSSAASPLSLSASAADLSLSSAVSFRLH  83

Query  343  IKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLL  522
            + P  F +++GSK++        +   +FWDL+R K  SGPEP SGFYIAV+V G   LL
Sbjct  84   LNPLAFWRRRGSKRVS-------QKVQIFWDLTRVKLDSGPEPRSGFYIAVVVDGGMGLL  136

Query  523  IGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
            +GD   EAYA+TRA      QAL+L+REHV G +++ TK+ +GG
Sbjct  137  VGDAVKEAYARTRAGRPTIPQALILRREHVVGNRVFCTKARIGG  180



>ref|XP_008445586.1| PREDICTED: uncharacterized protein LOC103488566 [Cucumis melo]
Length=328

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 87/161 (54%), Gaps = 28/161 (17%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y+T    F++TWSR L  RS HL                       S     S+   +K 
Sbjct  40   YQTPTAAFSLTWSRTLFSRSLHL-----------------------SSDRHHSYFLHLKS  76

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
            F F KK GSK L      G  +  +FWD SRA+FGS PEP SGFY+AVLV  +  LL+GD
Sbjct  77   FAFWKKSGSKHLP-----GSPSLRLFWDFSRARFGSAPEPRSGFYLAVLVDNQMTLLVGD  131

Query  532  CQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
               EAYAKT+A    N Q+LVLKRE V   K+Y+TK+ +GG
Sbjct  132  LVKEAYAKTKALKPKNPQSLVLKREQVVAHKIYSTKAKIGG  172



>ref|XP_010519647.1| PREDICTED: uncharacterized protein LOC104799041 [Tarenaya hassleriana]
Length=389

 Score =   121 bits (304),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 95/163 (58%), Gaps = 9/163 (6%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDs--saaaagessPRDFYFSSLSGAPSFHFRI  345
            Y+T LG+F +TWSR   G S +L     D    ++A+  S            A SF   +
Sbjct  42   YQTDLGVFYITWSRSFFGHSLNLFLQTQDCYHHSSASPLSLSAAAAADLSPSAVSFRLHV  101

Query  346  KPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLI  525
             P  F +++GSK++        +   +FWDL+R KF SGPEP SGFYIAV+V GE  LL+
Sbjct  102  NPLAFWRRRGSKRVS-------QKVQIFWDLTRVKFDSGPEPRSGFYIAVVVDGEMGLLV  154

Query  526  GDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
            GD   EAYA+T+A      QALVL+REH++G ++  TK+ +GG
Sbjct  155  GDAVREAYARTKAGRPTIPQALVLRREHMFGNRVLCTKAKIGG  197



>ref|XP_007136970.1| hypothetical protein PHAVU_009G089200g [Phaseolus vulgaris]
 gb|ESW08964.1| hypothetical protein PHAVU_009G089200g [Phaseolus vulgaris]
Length=319

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/161 (39%), Positives = 90/161 (56%), Gaps = 26/161 (16%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y T  G  ++TWSR ++GRS H+                     F  +S    FH  I+P
Sbjct  38   YHTDTGPVSLTWSRSVVGRSLHIQLHRQS---------------FDPIS----FHLHIRP  78

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
            F+F KK G KK          +  +FW+ ++AKFGS PEPVSGFY+A++V     LL+GD
Sbjct  79   FVFWKKHGVKKFA-------PDTVLFWNFAKAKFGSNPEPVSGFYVALVVNNHMSLLLGD  131

Query  532  CQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
               +AY+K+RA H    Q L+LK+EHV+  ++Y+T++  GG
Sbjct  132  AARDAYSKSRAYHPTTPQLLLLKKEHVFADRVYSTRATFGG  172



>emb|CDP18790.1| unnamed protein product [Coffea canephora]
Length=377

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 97/182 (53%), Gaps = 35/182 (19%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLG-RSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIK  348
            Y+T  GLF +TWS    G RS H++ LLD+              +  S   +PSFH +  
Sbjct  38   YQTQQGLFGLTWSIGPFGTRSLHIYLLLDN--------------HHLSFPPSPSFHLQFN  83

Query  349  P-FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLI  525
            P F F KK+GSK L    +     A VFWDLSRAKFGS P+P SG+Y+A+L+GGE  LL+
Sbjct  84   PRFTFWKKRGSKTLVGLPNTSSTTARVFWDLSRAKFGSRPDPASGYYVAILIGGEVTLLV  143

Query  526  GD-----CQ-----------XEAYAKTRARHAGNGQALVLKREHVYGGK---LYATKSNV  648
            G+     CQ               AK  A      Q +VL+REHVYG K    Y T++N+
Sbjct  144  GEELLPLCQLPRSIASGGGGARPTAKETAAAEIRNQVMVLRREHVYGNKKRLYYTTRANI  203

Query  649  GG  654
            GG
Sbjct  204  GG  205



>ref|XP_004138846.1| PREDICTED: uncharacterized protein LOC101205493 [Cucumis sativus]
Length=300

 Score =   117 bits (294),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 87/161 (54%), Gaps = 28/161 (17%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y+T    F++TWSR L  R+ HL                      S  S +   H  +  
Sbjct  12   YQTPTAAFSLTWSRTLFSRTLHLT---------------------SDRSHSCCLH--LNS  48

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
            F F KK GSK L      G  +  +FWD SRA+FGS PEP SGFYIA+LV  +  LL+GD
Sbjct  49   FAFWKKSGSKHLP-----GSPSLRLFWDFSRARFGSAPEPRSGFYIALLVDNQMTLLVGD  103

Query  532  CQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
               EAYAKT+A    N Q+LVLKRE V   K+Y+TK+ +GG
Sbjct  104  LVKEAYAKTKALKPKNPQSLVLKREQVVAHKIYSTKAKIGG  144



>gb|KGN62983.1| hypothetical protein Csa_2G382560 [Cucumis sativus]
Length=328

 Score =   118 bits (295),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 87/161 (54%), Gaps = 28/161 (17%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y+T    F++TWSR L  R+ HL                      S  S +   H  +  
Sbjct  40   YQTPTAAFSLTWSRTLFSRTLHLT---------------------SDRSHSCCLH--LNS  76

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
            F F KK GSK L      G  +  +FWD SRA+FGS PEP SGFYIA+LV  +  LL+GD
Sbjct  77   FAFWKKSGSKHLP-----GSPSLRLFWDFSRARFGSAPEPRSGFYIALLVDNQMTLLVGD  131

Query  532  CQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
               EAYAKT+A    N Q+LVLKRE V   K+Y+TK+ +GG
Sbjct  132  LVKEAYAKTKALKPKNPQSLVLKREQVVAHKIYSTKAKIGG  172



>ref|XP_004160786.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101230499 
[Cucumis sativus]
Length=300

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 86/161 (53%), Gaps = 28/161 (17%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y+T    F++TWSR L  R+ HL                      S  S +   H  +  
Sbjct  12   YQTPTAAFSLTWSRTLFSRTLHLT---------------------SDRSHSCCLH--LNS  48

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
            F F K  GSK L      G  +  +FWD SRA+FGS PEP SGFYIA+LV  +  LL+GD
Sbjct  49   FAFWKNXGSKHLP-----GSPSLRLFWDFSRARFGSAPEPRSGFYIALLVDNQMTLLVGD  103

Query  532  CQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
               EAYAKT+A    N Q+LVLKRE V   K+Y+TK+ +GG
Sbjct  104  LVKEAYAKTKALKPKNPQSLVLKREQVVAHKIYSTKAKIGG  144



>ref|XP_010910592.1| PREDICTED: uncharacterized protein LOC105036529 [Elaeis guineensis]
Length=290

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 93/162 (57%), Gaps = 28/162 (17%)
 Frame = +1

Query  172  YRTGLG----LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHF  339
            Y+T LG    L  VTWS++L+G+   +   +DDS+               SL        
Sbjct  37   YQTQLGGRACLITVTWSKNLMGQGLSIG--IDDSAN-------------QSLC-----KV  76

Query  340  RIKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVL  519
             IKP++FSK++GSK L+  +S      ++FWDLS AKFGSGPEP+ GFY+AV+   E VL
Sbjct  77   DIKPWLFSKRKGSKSLEAENS----KVDIFWDLSAAKFGSGPEPLEGFYVAVIFDLEMVL  132

Query  520  LIGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
            L+GD   EAY KT A    +    + KREH+YG K+Y TK+ 
Sbjct  133  LLGDLTKEAYRKTSASPLPSSAVFIAKREHIYGKKIYCTKAQ  174



>ref|XP_008220875.1| PREDICTED: uncharacterized protein LOC103320911 [Prunus mume]
Length=342

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 85/161 (53%), Gaps = 24/161 (15%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y T L LF++TWSR  LGRS HL+ L     +              S +  PSFH  IKP
Sbjct  47   YHTDLALFSLTWSRSFLGRSLHLNLLHHSFDSPLPPS--------LSSASPPSFHLHIKP  98

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
            F+F KK GSK+L         N  +FW         G +P S FYIAV+V  E  LL+GD
Sbjct  99   FIFWKKHGSKRLS-------PNTRIFW---------GTDPQSVFYIAVVVDDEMTLLVGD  142

Query  532  CQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
               EAYAKTRA  A   Q  +LKREHV   K+Y TK+  GG
Sbjct  143  LTREAYAKTRAHKAQTPQIPILKREHVVAKKIYTTKARFGG  183



>ref|XP_008802684.1| PREDICTED: uncharacterized protein LOC103716457 [Phoenix dactylifera]
Length=289

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 92/162 (57%), Gaps = 28/162 (17%)
 Frame = +1

Query  172  YRTGLG----LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHF  339
            Y+T L     L  VTWS++L+G+   +   +DDS+               SL        
Sbjct  36   YQTQLCGRSCLITVTWSKNLMGQGLSIG--IDDSAN-------------QSLC-----KV  75

Query  340  RIKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVL  519
             IKP++FSK++GSK L+  +S      ++FWDLS AKFGSGPEP+ GFY+AV+   E VL
Sbjct  76   EIKPWLFSKRKGSKSLEAENS----KVDIFWDLSAAKFGSGPEPLEGFYVAVVFDLEMVL  131

Query  520  LIGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
            L+GD   EAY KT A    +    + KREH+YG K+Y TK+ 
Sbjct  132  LLGDLSKEAYRKTGASPPPSSAVFIAKREHIYGKKIYCTKAQ  173



>ref|XP_002872306.1| hypothetical protein ARALYDRAFT_489643 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48565.1| hypothetical protein ARALYDRAFT_489643 [Arabidopsis lyrata subsp. 
lyrata]
Length=288

 Score =   112 bits (279),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 91/153 (59%), Gaps = 24/153 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTW+++L+G+S  +   +DDS   +                     F IKP++F+K+
Sbjct  45   LITVTWTKNLMGQSVTVG--VDDSCNQSLC------------------KFEIKPWLFTKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  S     N +VFWDLS AKFGSGPE + GFY+ V+V  E VLL+GD + EA+
Sbjct  85   KGSKSLEAYSC----NIDVFWDLSSAKFGSGPEALGGFYVGVVVDKEMVLLLGDMKKEAF  140

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSNV  648
             KT A  +  G   + K+EHV+G +++ATK+ +
Sbjct  141  KKTNASPSSLGAVFIAKKEHVFGKRVFATKAQL  173



>ref|XP_010277409.1| PREDICTED: uncharacterized protein LOC104611862 [Nelumbo nucifera]
 ref|XP_010277418.1| PREDICTED: uncharacterized protein LOC104611862 [Nelumbo nucifera]
Length=298

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 86/152 (57%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            +  VTWS++L+G+   +   +DDS+                          IKP++FSK+
Sbjct  44   MITVTWSKNLMGQGLSVG--IDDSTNQCLC------------------KVDIKPWLFSKR  83

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  SS      +++WDLS AKFGSGPEP+ GFY+AV+   E VLL+GD   EAY
Sbjct  84   KGSKSLEADSS----KVDIYWDLSSAKFGSGPEPLEGFYLAVVFDREMVLLLGDLSKEAY  139

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             KT A    +    V KREH++G +LY TK+ 
Sbjct  140  KKTNAAPVPSNAIFVAKREHIFGKRLYGTKAQ  171



>ref|XP_006395009.1| hypothetical protein EUTSA_v10004720mg [Eutrema salsugineum]
 gb|ESQ32295.1| hypothetical protein EUTSA_v10004720mg [Eutrema salsugineum]
Length=288

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 90/153 (59%), Gaps = 24/153 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTW+++L+G+S  +   +DDS   +                       IKP++F+K+
Sbjct  45   LITVTWTKNLMGQSVTIG--VDDSCNQSLC------------------KVEIKPWLFTKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  S     N +VFWDLS AKFGSGPE + GFY+ V+V  E VLL+GD + EA+
Sbjct  85   KGSKSLEAYSC----NIDVFWDLSSAKFGSGPEALGGFYVGVVVDKEMVLLLGDMKKEAF  140

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSNV  648
             KT A  +  G   + K+EHV+G +++ATK+ +
Sbjct  141  KKTNASPSSLGAVFIAKKEHVFGKRVFATKAQL  173



>ref|XP_003521743.1| PREDICTED: uncharacterized protein LOC100791607 [Glycine max]
 gb|KHN31447.1| hypothetical protein glysoja_035554 [Glycine soja]
Length=297

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 87/151 (58%), Gaps = 24/151 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTWS++L+G+   +   +DDS                  S        IKP+ FSK+
Sbjct  45   LITVTWSKNLMGQGLGVG--IDDS------------------SSQSLCKVDIKPWGFSKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +G K L++ S       +V+WDLS AKFGSGPEP+ GFY+  +V G+ VLL+GD + EA+
Sbjct  85   RGCKSLEVHSC----KVDVYWDLSSAKFGSGPEPLGGFYVGAVVDGQMVLLLGDLRKEAF  140

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKS  642
             KT A    +  ALV K+EHV+G KLY TK+
Sbjct  141  KKTNANPLPHNAALVAKKEHVFGKKLYGTKA  171



>ref|NP_198167.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL90906.1| AT5g28150/T24G3_80 [Arabidopsis thaliana]
 gb|AAN18148.1| At5g28150/T24G3_80 [Arabidopsis thaliana]
 gb|AED93776.1| uncharacterized protein AT5G28150 [Arabidopsis thaliana]
Length=289

 Score =   109 bits (273),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 91/153 (59%), Gaps = 24/153 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTW+++L+G+S  +   +DDS                SL         IKP++F+K+
Sbjct  46   LITVTWTKNLMGQSVTVG--VDDSCN-------------QSLC-----KVEIKPWLFTKR  85

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  S     N +VFWDLS AKFGSGPE + GFY+ V+V  E VLL+GD + EA+
Sbjct  86   KGSKSLEAYSC----NIDVFWDLSSAKFGSGPEALGGFYVGVVVDKEMVLLLGDMKKEAF  141

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSNV  648
             KT A  +  G   + K+EHV+G +++ATK+ +
Sbjct  142  KKTNASPSSLGAVFIAKKEHVFGKRVFATKAQL  174



>ref|XP_010674843.1| PREDICTED: uncharacterized protein LOC104890923 [Beta vulgaris 
subsp. vulgaris]
Length=299

 Score =   109 bits (273),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 89/157 (57%), Gaps = 24/157 (15%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            +R    L  VTWS+ L+G+   +   +DDS                  S        IKP
Sbjct  39   FRGRSCLITVTWSKSLMGQGLSVG--IDDS------------------SNQCLCKVDIKP  78

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
            ++FSK++GSK L + SS    N +++WDLS AKFGSGPEP+ GFY+A++   + +LL+GD
Sbjct  79   WLFSKRKGSKSLDVESS----NIDLYWDLSSAKFGSGPEPLEGFYLAIVCDKQMILLLGD  134

Query  532  CQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKS  642
             + EA+ KT A    +    + KREHVYG K++ +K+
Sbjct  135  MRKEAFKKTNATPVSSNAVFIAKREHVYGKKVFYSKA  171



>ref|XP_006399599.1| hypothetical protein EUTSA_v10015286mg [Eutrema salsugineum]
 gb|ESQ41052.1| hypothetical protein EUTSA_v10015286mg [Eutrema salsugineum]
Length=387

 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 93/162 (57%), Gaps = 9/162 (6%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y+T  G+F +TWSR  LG    L+  L                   SLS A SFH  +  
Sbjct  43   YQTDHGVFYLTWSRTFLG-GHSLNLFLHSQDYYNHSSPLSFSSADLSLSSAVSFHLNLNT  101

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
              F +K+GS+ +         N  VFWDL+RAKF SG EP SGFYIAV+V GE  LL+GD
Sbjct  102  LAFWRKRGSRFVT-------PNIQVFWDLTRAKFDSGSEPRSGFYIAVVVDGEMGLLVGD  154

Query  532  CQXEAYAKTR-ARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
               EAYA+ + A+   N QAL+L++EHV+G ++++TK+  GG
Sbjct  155  SVKEAYARAKEAKPPTNPQALLLRKEHVFGARVFSTKARFGG  196



>ref|XP_009402136.1| PREDICTED: uncharacterized protein LOC103986002 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009402137.1| PREDICTED: uncharacterized protein LOC103986002 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009402138.1| PREDICTED: uncharacterized protein LOC103986002 [Musa acuminata 
subsp. malaccensis]
Length=290

 Score =   109 bits (272),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 86/152 (57%), Gaps = 23/152 (15%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            +  VTWS++L+G+   +   +DD                   +  P     IKP++FSK+
Sbjct  45   VINVTWSKNLMGQGLSVG--IDDLG-----------------NQCPPCRVEIKPWLFSKR  85

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GS+ L +  S      ++FWDLS AKFG GPEP+ GFY+A++   + VLL+G+   EAY
Sbjct  86   KGSRTLDMEGS----KIDIFWDLSAAKFGPGPEPLEGFYVALVFDHQMVLLLGNLIKEAY  141

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             +T AR   +   LV K EH+YG KLY+TK+ 
Sbjct  142  QRTNARPPPSSAVLVAKTEHIYGKKLYSTKAQ  173



>ref|XP_004981359.1| PREDICTED: uncharacterized protein LOC101774579 [Setaria italica]
Length=291

 Score =   109 bits (272),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 86/152 (57%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            + +VTWS+ L+G+   +   +DD                  LSG       IKP++FSKK
Sbjct  48   VISVTWSKSLMGQGLSIG--VDD------------------LSGHCLCKADIKPWLFSKK  87

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L +          +FWDLS AKFG+GPEPV GFY+AV+   E VLL+GD + +AY
Sbjct  88   KGSKCLDVEDG----KIEIFWDLSSAKFGAGPEPVEGFYVAVVFDLELVLLLGDMKKDAY  143

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             KT A  +    A V +REH+YG K+Y+ K+ 
Sbjct  144  RKTGANRSMLNAAFVARREHIYGKKIYSAKAQ  175



>ref|XP_006288375.1| hypothetical protein CARUB_v10001626mg [Capsella rubella]
 gb|EOA21273.1| hypothetical protein CARUB_v10001626mg [Capsella rubella]
Length=289

 Score =   109 bits (272),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 89/155 (57%), Gaps = 24/155 (15%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTW+++L+G+S  +   +DDS   +                       IKP +F+K+
Sbjct  45   LITVTWTKNLMGQSVTVG--VDDSCNQSLC------------------KVEIKPSLFTKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  S     N +VFWDLS AKFGSGPE + GFY+ V+V  E VLL+GD + EA+
Sbjct  85   KGSKSLEAYSC----NIDVFWDLSSAKFGSGPEALEGFYVGVVVDKEMVLLLGDMKKEAF  140

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
             KT A  +  G   + K+EHV+G +++ATK+ +  
Sbjct  141  KKTNASPSSLGAVFIAKKEHVFGKRVFATKAQLSA  175



>ref|XP_010649892.1| PREDICTED: uncharacterized protein LOC100246068 [Vitis vinifera]
Length=300

 Score =   109 bits (272),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 85/151 (56%), Gaps = 24/151 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  +TWS++L+G+   +   +DD                          F IKP++F+K+
Sbjct  46   LIIITWSKNLVGQCLSVE--IDDWMNQCLC------------------KFDIKPWLFAKR  85

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK  +I+S       + +WDLS AKFGSGPEP+ GFY+AV+  GE VLL+GD + EA+
Sbjct  86   KGSKSFEINSI----QVDTYWDLSLAKFGSGPEPLEGFYLAVVFNGEMVLLLGDMRKEAF  141

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKS  642
             KT A         V K+EH++G KLY TK+
Sbjct  142  KKTNATPGFYNAIFVSKKEHIFGKKLYGTKA  172



>ref|XP_010923391.1| PREDICTED: uncharacterized protein LOC105046501 [Elaeis guineensis]
 ref|XP_010923392.1| PREDICTED: uncharacterized protein LOC105046501 [Elaeis guineensis]
 ref|XP_010923393.1| PREDICTED: uncharacterized protein LOC105046501 [Elaeis guineensis]
Length=288

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 88/162 (54%), Gaps = 28/162 (17%)
 Frame = +1

Query  172  YRTGLG----LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHF  339
            YRT L     +  VTWS++L+ +   +   +DDS                  +       
Sbjct  35   YRTQLCRRSCVITVTWSKNLMSQGLSIG--IDDS------------------ANRSVCKV  74

Query  340  RIKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVL  519
             IKP++FSK++GSK L+  +S      ++FWDLS AKFGSGPEP+ GFY+AV+   E VL
Sbjct  75   DIKPWLFSKRKGSKSLEAENS----KVDIFWDLSAAKFGSGPEPLEGFYVAVVFDLEMVL  130

Query  520  LIGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
            L+GD   EAY KT A    +    + +REH+YG  +Y TK+ 
Sbjct  131  LLGDLTKEAYRKTSASPPPSNAVFIARREHIYGKNVYCTKAQ  172



>emb|CDP21506.1| unnamed protein product [Coffea canephora]
Length=302

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 88/151 (58%), Gaps = 24/151 (16%)
 Frame = +1

Query  193  FAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKKQ  372
              VTWS++L+G+   +   +DD+                  +        IKP++FSKK+
Sbjct  49   ITVTWSKNLMGQGLSVG--IDDN------------------TNQSLCKVDIKPWLFSKKK  88

Query  373  GSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAYA  552
            GSK L+ SSS      +V+WDLS AKFGSGPEP+ GFY+ ++   + +LL+GD + EA  
Sbjct  89   GSKSLEASSS----KLDVYWDLSSAKFGSGPEPLEGFYLGIVCERQIILLLGDMRKEALK  144

Query  553  KTRARHAGNGQALVLKREHVYGGKLYATKSN  645
            KT A  A +G  L+ KREH++G K++ TK+ 
Sbjct  145  KTGATPASSGSVLIAKREHIFGRKMFGTKAQ  175



>gb|ACU18448.1| unknown [Glycine max]
Length=297

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 86/150 (57%), Gaps = 24/150 (16%)
 Frame = +1

Query  193  FAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKKQ  372
              VTWS++L+G+   L   +DDS                  S        IKP+ FSK++
Sbjct  46   ITVTWSKNLMGQG--LGVGIDDS------------------SSQSLCKVDIKPWGFSKRR  85

Query  373  GSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAYA  552
            G K L++ S       +V+WDLS AKFGSGPEP+ GFY+  +V G+ VLL+GD + EA+ 
Sbjct  86   GCKSLEVHSC----KVDVYWDLSSAKFGSGPEPLGGFYVGAVVDGQMVLLLGDLRKEAFK  141

Query  553  KTRARHAGNGQALVLKREHVYGGKLYATKS  642
            KT A    +  ALV K+EHV+G KLY TK+
Sbjct  142  KTNANPLPHNAALVAKKEHVFGKKLYGTKA  171



>ref|XP_009407751.1| PREDICTED: uncharacterized protein LOC103990370 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009407752.1| PREDICTED: uncharacterized protein LOC103990370 [Musa acuminata 
subsp. malaccensis]
Length=287

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 84/152 (55%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            +  VTWS++L+G+   +                  DF    L         IKP++FSK+
Sbjct  44   VINVTWSKNLMGQGLTVGI---------------DDFANQCLC-----KLEIKPWLFSKR  83

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L++ +S       V WDLS AKFG GPEP+ GFYIAV+   E VLL+GD   EAY
Sbjct  84   KGSKILEVENS----KIAVSWDLSAAKFGPGPEPIEGFYIAVVFHLEMVLLLGDLTKEAY  139

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             KT A  + +    + KREH+YG K+Y+TK+ 
Sbjct  140  RKTNASPSPSNAVFIAKREHIYGKKVYSTKAQ  171



>ref|XP_007224916.1| hypothetical protein PRUPE_ppa021934mg [Prunus persica]
 gb|EMJ26115.1| hypothetical protein PRUPE_ppa021934mg [Prunus persica]
Length=431

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 82/161 (51%), Gaps = 35/161 (22%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y T L LF++TWSR  LGRS HL+ L     +              S +  PSFH  IKP
Sbjct  147  YHTDLALFSLTWSRSFLGRSLHLNLLHHSFDSPLPPS--------LSSASPPSFHLHIKP  198

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
            F+F KK GSK+L         N  +FWDLSRA+FGSGPEP S                  
Sbjct  199  FIFWKKHGSKRLS-------PNTRIFWDLSRARFGSGPEPQS------------------  233

Query  532  CQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
               EAYAKTRA  A   Q  +LKREHV   K+Y TK+  GG
Sbjct  234  --VEAYAKTRAHKAQTPQIPILKREHVVAKKIYTTKARFGG  272



>gb|AFW67285.1| hypothetical protein ZEAMMB73_929047 [Zea mays]
Length=291

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 86/152 (57%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            + ++TWSR L+G+   +   +DD                  LSG       IKP++FSKK
Sbjct  48   VISLTWSRSLMGQGLSVG--VDD------------------LSGHCLCKADIKPWLFSKK  87

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L +         ++FWDLS AKFG+GPEPV GFY+AV+   E VLL+GD + +AY
Sbjct  88   KGSKSLDVEDG----KIDIFWDLSGAKFGAGPEPVEGFYVAVVFDLELVLLLGDMKKDAY  143

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             KT A  +    A V +REH+YG K Y+ K+ 
Sbjct  144  RKTGANRSMLNAAFVARREHIYGKKTYSAKAQ  175



>emb|CDX97072.1| BnaC09g45530D [Brassica napus]
Length=387

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 92/162 (57%), Gaps = 9/162 (6%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y+T  G+F +TWSR  LG    L+  L                   SLS A SFH  +  
Sbjct  41   YQTDHGVFYLTWSRTFLG-GHSLNLFLHSQDYYNRSSPLSFSSADLSLSSAVSFHLNLNT  99

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
              F +++GS+ +            VFWDL+RAKF SG EP SGFYIAV+V GE  LL+GD
Sbjct  100  LAFWRRRGSRSVS-------PKIQVFWDLTRAKFDSGSEPRSGFYIAVVVDGEMGLLVGD  152

Query  532  CQXEAYAKTR-ARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
               EAYA+ + A+   N QAL+L++EHV+G ++++TK+  GG
Sbjct  153  SVKEAYARVKSAKPPTNPQALLLRKEHVFGARVFSTKARFGG  194



>gb|KFK25379.1| hypothetical protein AALP_AA8G105700 [Arabis alpina]
Length=377

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 96/165 (58%), Gaps = 15/165 (9%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLG-RSFHLHFLLDDssaaaagessPRDFYFS--SLSGAPSFHFR  342
            Y+T  G+F +TWSR  LG  S +L     D    ++    P  F  +  SLS A +FH  
Sbjct  34   YQTDHGVFYLTWSRTFLGGHSLNLFLHSQDYYNHSS----PLSFSSTDLSLSSAVTFHLN  89

Query  343  IKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLL  522
            +    F +K+GS+ +            V+WDL++AKF SG EP SGFYIAV+V GE  LL
Sbjct  90   LNTLAFWRKRGSRSVS-------SKIQVYWDLTKAKFESGSEPRSGFYIAVVVDGEMGLL  142

Query  523  IGDCQXEAYAKTRA-RHAGNGQALVLKREHVYGGKLYATKSNVGG  654
            +GD   EAY + ++ +   N QAL+L++EHV+G +++ TK+  GG
Sbjct  143  VGDSIKEAYTRVKSVKPPMNRQALLLRKEHVFGARVFTTKARFGG  187



>emb|CAN68226.1| hypothetical protein VITISV_040533 [Vitis vinifera]
Length=300

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 85/151 (56%), Gaps = 24/151 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  +TWS++L+G+   +   +DD                          F IKP++F+K+
Sbjct  46   LIIITWSKNLVGQCLSVE--IDDWMNQCLC------------------KFDIKPWLFAKR  85

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK  +I+S       + +WDLS AKFGSGPEP+ GFY+AV+  G+ VLL+GD + EA+
Sbjct  86   KGSKSFEINSI----QVDTYWDLSLAKFGSGPEPLEGFYLAVVFNGDMVLLLGDMRKEAF  141

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKS  642
             KT A         V K+EH++G KLY TK+
Sbjct  142  KKTNATPGFYNAIFVSKKEHIFGKKLYGTKA  172



>ref|XP_010546610.1| PREDICTED: uncharacterized protein LOC104818644 [Tarenaya hassleriana]
Length=286

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 88/155 (57%), Gaps = 24/155 (15%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTW+++L+G+   +   +DDS   +                       IKP++F+K+
Sbjct  45   LITVTWTKNLIGQGLTVG--IDDSCNQSLC------------------KVEIKPWLFTKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  S       +VFWDLS AKFGSGPEP++GFY+ V+V  E +LL+GD   EA+
Sbjct  85   KGSKSLEAYSC----KVDVFWDLSSAKFGSGPEPLAGFYVGVVVDKEMILLLGDMNKEAF  140

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
             KT A  + +    V K+EHV+G +++A K+   G
Sbjct  141  KKTNATPSSSSALFVAKKEHVFGKRVFAAKAQFSG  175



>ref|XP_010455167.1| PREDICTED: uncharacterized protein LOC104736806 [Camelina sativa]
Length=288

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 87/153 (57%), Gaps = 24/153 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTW+++L+G+S  +   +DDS   +                       IKP +F+K+
Sbjct  45   LITVTWTKNLMGQSVTVG--VDDSCNQSLC------------------KVEIKPSLFTKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  S     N +VFWDLS AKFGSGPE + GFY+ V+V  E VLL+GD   EA 
Sbjct  85   KGSKSLEAYSC----NIDVFWDLSSAKFGSGPEALGGFYVCVVVDKEMVLLLGDMNKEAL  140

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSNV  648
             KT A  +  G   + K+EHV+G +++ATK+ +
Sbjct  141  KKTNASPSSLGAVFIAKKEHVFGKRVFATKAQL  173



>ref|XP_010453134.1| PREDICTED: uncharacterized protein LOC104735112 [Camelina sativa]
Length=396

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 92/162 (57%), Gaps = 9/162 (6%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y+T  G+F +TWSR  LG    ++  L                   SLS A SFH  +  
Sbjct  40   YQTDHGVFYLTWSRTFLG-GHSVNLFLHSQDYYNHSSPLSFSSADLSLSSAVSFHLNLNT  98

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
              F KK+GS+ +            VFWDL++AKF SG EP SGFYIAV+V GE  LL+GD
Sbjct  99   LAFWKKRGSRFVS-------PKIQVFWDLTKAKFDSGSEPRSGFYIAVVVDGEMGLLVGD  151

Query  532  CQXEAYAKTR-ARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
               EAYA+T+ A+   N QAL+L++EHV+G +++ TK+  GG
Sbjct  152  SVKEAYARTKSAKPPTNPQALLLRKEHVFGARVFTTKARFGG  193



>ref|XP_004302026.1| PREDICTED: uncharacterized protein LOC101296394 [Fragaria vesca 
subsp. vesca]
Length=303

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 88/156 (56%), Gaps = 24/156 (15%)
 Frame = +1

Query  175  RTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPF  354
            R    L  VTWSR+L+G+   +   +DDS                  S        IKP+
Sbjct  44   RNRSCLITVTWSRNLMGQGLSIG--IDDS------------------SNQCLCKVDIKPW  83

Query  355  MFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDC  534
            +FSK++GSK L+  SS      +++WD S AKFGSGPEPV G+Y+ ++V  + +LL+GD 
Sbjct  84   LFSKRRGSKSLEAYSS----KIDIYWDFSSAKFGSGPEPVDGYYVGIVVDRQMILLLGDM  139

Query  535  QXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKS  642
            + EA+ KT A  A +    + +REH++G K++ TK+
Sbjct  140  KKEAFKKTSASPASSNAGCIARREHIFGKKVFTTKA  175



>ref|XP_008804337.1| PREDICTED: uncharacterized protein LOC103717650 [Phoenix dactylifera]
Length=288

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 89/162 (55%), Gaps = 28/162 (17%)
 Frame = +1

Query  172  YRTGLG----LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHF  339
            YRT L     +  VTWS++L+ +   +   +DDS+  +                      
Sbjct  35   YRTQLCSRSCVITVTWSKNLMSQGLTIG--IDDSANRSLC------------------KV  74

Query  340  RIKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVL  519
             IKP++FSK++GSK L+  +S      +VFWDLS A+FGSGPEP+ GFY+AV+   E VL
Sbjct  75   DIKPWLFSKRKGSKSLEAENS----KVDVFWDLSAARFGSGPEPLEGFYVAVVFDLEMVL  130

Query  520  LIGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
            L+GD   EAY KT A    +    + +REH+YG  +Y TK+ 
Sbjct  131  LLGDLTKEAYRKTSATPPPSNALFIARREHIYGKNVYCTKAQ  172



>emb|CDX69793.1| BnaA10g21420D [Brassica napus]
Length=376

 Score =   107 bits (268),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 92/162 (57%), Gaps = 9/162 (6%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y+T  G+F +TWSR  LG    L+  L                   SLS A SFH  +  
Sbjct  42   YQTDHGVFYLTWSRTFLG-GHSLNLFLHSQDYYNRSSPLSFSSADLSLSSAVSFHLNLNT  100

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
              F +++GS+ +            VFWDL+RAKF SG EP SGFYIAV+V GE  LL+GD
Sbjct  101  LAFWRRRGSRSVS-------PKIQVFWDLTRAKFDSGSEPRSGFYIAVVVDGEMGLLVGD  153

Query  532  CQXEAYAKTR-ARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
               EAY++ + A+   N QAL+L++EHV+G ++++TK+  GG
Sbjct  154  SVKEAYSRVKSAKPPTNPQALLLRKEHVFGARVFSTKARFGG  195



>ref|XP_002466252.1| hypothetical protein SORBIDRAFT_01g004400 [Sorghum bicolor]
 gb|EER93250.1| hypothetical protein SORBIDRAFT_01g004400 [Sorghum bicolor]
Length=291

 Score =   107 bits (266),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 87/152 (57%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            + ++TWS+ L+G+   +   +DD                  LSG       IKP++FSKK
Sbjct  48   VISLTWSKSLMGQGLSIG--VDD------------------LSGHCLCKADIKPWLFSKK  87

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L +         ++FWDLS AKFG+GPEPV GFY+AV+   E VLL+GD + +AY
Sbjct  88   KGSKSLDVEDG----KIDIFWDLSGAKFGAGPEPVEGFYVAVVFDLELVLLLGDMKKDAY  143

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             KT A  +    A V ++EH+YG K+Y+ K+ 
Sbjct  144  RKTGANRSMLNAAFVARKEHIYGKKIYSAKAQ  175



>ref|XP_010494083.1| PREDICTED: uncharacterized protein LOC104771271 [Camelina sativa]
Length=288

 Score =   106 bits (265),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 88/153 (58%), Gaps = 24/153 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTW+++L+G+S  +   +DDS   +                       IKP +F+K+
Sbjct  45   LITVTWTKNLMGQSVTVG--VDDSCNQSLC------------------KVEIKPSLFTKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  S     N +VFWDL+ AKFGSGPE + GFY+ V+V  E VLL+GD + EA 
Sbjct  85   KGSKSLEAYSC----NIDVFWDLASAKFGSGPEALGGFYVCVVVDKEMVLLLGDMKKEAL  140

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSNV  648
             KT A  +  G   + K+EHV+G +++ATK+ +
Sbjct  141  KKTNASPSSLGAVFIAKKEHVFGKRVFATKAQL  173



>ref|XP_003554710.1| PREDICTED: uncharacterized protein LOC100806479 [Glycine max]
Length=297

 Score =   106 bits (265),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 86/151 (57%), Gaps = 24/151 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTWS++L+G+   L   +DDS                  S        IKP+ FSK+
Sbjct  45   LITVTWSKNLMGQG--LGVGIDDS------------------SSQSLCKVDIKPWGFSKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +G K L++ S       +V+WDLS AKFGSGPEP+ GFY+  +V G+ VLL+GD + EA+
Sbjct  85   RGCKSLEVHSC----KVDVYWDLSSAKFGSGPEPLGGFYVGAVVDGQMVLLLGDLRKEAF  140

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKS  642
             KT A    +   LV K+EHV+G KL+ TK+
Sbjct  141  KKTNANPLPHNAVLVAKKEHVFGKKLHGTKA  171



>ref|XP_009122005.1| PREDICTED: uncharacterized protein LOC103846761 [Brassica rapa]
Length=441

 Score =   107 bits (268),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 92/162 (57%), Gaps = 9/162 (6%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y+T  G+F +TWSR  LG    L+  L                   SLS A SFH  +  
Sbjct  95   YQTDHGVFYLTWSRTFLG-GHSLNLFLHSQDYYNRSSPLSFSSADLSLSSAVSFHLNLNT  153

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
              F +++GS+ +            VFWDL+RAKF SG EP SGFYIAV+V GE  LL+GD
Sbjct  154  LAFWRRRGSRSVS-------PKIQVFWDLTRAKFDSGSEPRSGFYIAVVVDGEMGLLVGD  206

Query  532  CQXEAYAKTR-ARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
               EAY++ + A+   N QAL+L++EHV+G ++++TK+  GG
Sbjct  207  SVKEAYSRVKSAKPPTNPQALLLRKEHVFGARVFSTKARFGG  248



>ref|NP_001051637.1| Os03g0806700 [Oryza sativa Japonica Group]
 gb|AAP21412.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF99447.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF13551.1| Os03g0806700 [Oryza sativa Japonica Group]
 dbj|BAG88202.1| unnamed protein product [Oryza sativa Japonica Group]
Length=291

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 84/152 (55%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            + +VTWS+ L+G+   +   +DD                  LS        IKP++FSKK
Sbjct  48   VISVTWSKSLMGQGLSIG--VDD------------------LSNQCLCKADIKPWLFSKK  87

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK+L +          +FWDLS AKFG+GPEP+ GFY+AV+   E +LL+GD + +AY
Sbjct  88   KGSKRLDVEDG----KIEIFWDLSGAKFGAGPEPMEGFYVAVVFDLELILLLGDMKKDAY  143

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             KT A       A V +REH+YG K+Y  K+ 
Sbjct  144  RKTGANRPMLNAAFVARREHIYGKKIYTAKAQ  175



>ref|XP_002873490.1| hypothetical protein ARALYDRAFT_909057 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49749.1| hypothetical protein ARALYDRAFT_909057 [Arabidopsis lyrata subsp. 
lyrata]
Length=388

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 91/162 (56%), Gaps = 9/162 (6%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y+T  G+F +TWSR  LG    ++  L                   SLS A SFH  +  
Sbjct  39   YQTDHGVFYLTWSRTFLG-GHSVNLFLHSQDYYNHSSPLSFSSADLSLSSAVSFHLNLNT  97

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
              F KK+GS+ +            VFWDLS+AKF SG EP SGFYIAV+V GE  LL+GD
Sbjct  98   LAFWKKRGSRFVS-------PKIQVFWDLSKAKFDSGSEPRSGFYIAVVVDGEMGLLVGD  150

Query  532  CQXEAYAKTR-ARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
               EAYA+ + A+   N QAL+L++EHV+G +++ TK+  GG
Sbjct  151  SVKEAYARAKSAKPPTNPQALLLRKEHVFGARVFTTKARFGG  192



>ref|NP_196661.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB96855.1| putative protein [Arabidopsis thaliana]
 gb|AAL15307.1| AT5g11000/T30N20_270 [Arabidopsis thaliana]
 gb|AAM51579.1| AT5g11000/T30N20_270 [Arabidopsis thaliana]
 gb|AAM63680.1| unknown [Arabidopsis thaliana]
 gb|AED91619.1| uncharacterized protein AT5G11000 [Arabidopsis thaliana]
Length=389

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 91/162 (56%), Gaps = 9/162 (6%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y+T  G+F +TWSR  LG    ++  L                   SLS A SFH  +  
Sbjct  39   YQTDHGVFYLTWSRTFLG-GHSVNLFLHSQDYYNHSSPLSFSSADLSLSSAVSFHLNLNT  97

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
              F KK+GS+ +            VFWDLS+AKF SG EP SGFYIAV+V GE  LL+GD
Sbjct  98   LAFWKKRGSRFVS-------PKIQVFWDLSKAKFDSGSEPRSGFYIAVVVDGEMGLLVGD  150

Query  532  CQXEAYAKTR-ARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
               EAYA+ + A+   N QAL+L++EHV+G +++ TK+  GG
Sbjct  151  SVKEAYARAKSAKPPTNPQALLLRKEHVFGARVFTTKARFGG  192



>emb|CBI26241.3| unnamed protein product [Vitis vinifera]
Length=261

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 70/102 (69%), Gaps = 4/102 (4%)
 Frame = +1

Query  337  FRIKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETV  516
            F IKP++F+K++GSK  +I+S       + +WDLS AKFGSGPEP+ GFY+AV+  GE V
Sbjct  36   FDIKPWLFAKRKGSKSFEINSI----QVDTYWDLSLAKFGSGPEPLEGFYLAVVFNGEMV  91

Query  517  LLIGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKS  642
            LL+GD + EA+ KT A         V K+EH++G KLY TK+
Sbjct  92   LLLGDMRKEAFKKTNATPGFYNAIFVSKKEHIFGKKLYGTKA  133



>ref|XP_003564146.1| PREDICTED: uncharacterized protein LOC100837549 [Brachypodium 
distachyon]
Length=291

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 82/152 (54%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            + +VTWS+ L+G+   +                        LSG       IKP++FSKK
Sbjct  48   VISVTWSKSLMGQGLSIGV--------------------DGLSGQSLCKAEIKPWLFSKK  87

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L + S        +FWDLS AKF +GPEP+ GFY+AV+   E VLL+GD + +AY
Sbjct  88   KGSKSLDVDSG----KIEIFWDLSGAKFSTGPEPLEGFYVAVVFDLELVLLLGDMKKDAY  143

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             KT      +  A V +REH+YG K+Y+ K+ 
Sbjct  144  RKTGMNRPMSNAAFVARREHIYGKKIYSAKAQ  175



>ref|XP_003626413.1| hypothetical protein MTR_7g114790 [Medicago truncatula]
 gb|AES82631.1| plant/T24G3-80 protein [Medicago truncatula]
Length=306

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 72/103 (70%), Gaps = 7/103 (7%)
 Frame = +1

Query  343  IKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLL  522
            +KP++FSKK+G K L+  S+      +VFWDLS AKFGSGPEP+ GFY+ V+V  + VLL
Sbjct  75   VKPWVFSKKKGCKSLEAFSA----KIDVFWDLSSAKFGSGPEPLGGFYVGVVVDRQMVLL  130

Query  523  IGDCQXEAYAKTRA---RHAGNGQALVLKREHVYGGKLYATKS  642
            +GD + EA+ KT A     + N   LV K+EHV+G KLYATK+
Sbjct  131  LGDLRKEAFKKTNAVPLPCSSNAAVLVAKKEHVFGKKLYATKA  173



>ref|XP_009408456.1| PREDICTED: uncharacterized protein LOC103990890 [Musa acuminata 
subsp. malaccensis]
Length=286

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 84/152 (55%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            + AVTWS+ L+G+   L   +DD                    G       IKP++FSK+
Sbjct  45   VVAVTWSKTLMGQG--LTVGIDDG------------------DGQCLCKVDIKPWLFSKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L++ SS      ++ WDLS AKFG GPEP+ G+Y+AV+   + VLL+GD   EAY
Sbjct  85   KGSKSLEVESS----KVDIVWDLSAAKFGPGPEPLQGYYVAVVFDLQMVLLLGDLAKEAY  140

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             KT A  + +  A V KREH+ G  LY TK+ 
Sbjct  141  RKTAAVPSTSNMAFVAKREHISGKNLYCTKAQ  172



>ref|XP_006289029.1| hypothetical protein CARUB_v10002414mg [Capsella rubella]
 gb|EOA21927.1| hypothetical protein CARUB_v10002414mg [Capsella rubella]
Length=390

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 92/162 (57%), Gaps = 9/162 (6%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y+T  G+F +TWSR  LG    ++  L                   SLS A SFH  +  
Sbjct  40   YQTDHGVFYLTWSRTFLG-GHSVNLFLHSQDYYNHSSPLSFSSADLSLSSAVSFHLNLNT  98

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
              F KK+GS+ +            VFWDL++AKF SG EP SGFYIAV+V GE  LL+GD
Sbjct  99   LAFWKKRGSRFVS-------PKIQVFWDLTKAKFDSGSEPRSGFYIAVVVDGEMGLLVGD  151

Query  532  CQXEAYAKTR-ARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
               EAYA+ + A+ + N QAL+L++EHV+G +++ TK+  GG
Sbjct  152  SVKEAYARAKSAKPSTNPQALLLRKEHVFGARVFTTKARFGG  193



>ref|XP_006444048.1| hypothetical protein CICLE_v10021341mg [Citrus clementina]
 ref|XP_006479703.1| PREDICTED: uncharacterized protein LOC102609980 [Citrus sinensis]
 gb|ESR57288.1| hypothetical protein CICLE_v10021341mg [Citrus clementina]
 gb|KDO68699.1| hypothetical protein CISIN_1g022154mg [Citrus sinensis]
 gb|KDO68700.1| hypothetical protein CISIN_1g022154mg [Citrus sinensis]
 gb|KDO68701.1| hypothetical protein CISIN_1g022154mg [Citrus sinensis]
Length=302

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 85/153 (56%), Gaps = 24/153 (16%)
 Frame = +1

Query  184  LGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFS  363
            L L  VTW+++L+G+   L   +DDS                  +        IKP++FS
Sbjct  46   LVLINVTWTKNLMGQG--LCVAVDDS------------------TNQCLCKVEIKPWLFS  85

Query  364  KKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXE  543
            K++GSK L++ SS      +++WDLS A+FGSGPEPV G+Y+AV    E VLL+GD + E
Sbjct  86   KRKGSKNLEVDSS----RVDIYWDLSGARFGSGPEPVEGYYLAVAYNQEMVLLLGDLKKE  141

Query  544  AYAKTRARHAGNGQALVLKREHVYGGKLYATKS  642
            AY K  A    +    + KREH++G K Y  K+
Sbjct  142  AYRKINAAPINSNPIFIAKREHIFGKKFYGAKA  174



>ref|XP_002880661.1| hypothetical protein ARALYDRAFT_481378 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56920.1| hypothetical protein ARALYDRAFT_481378 [Arabidopsis lyrata subsp. 
lyrata]
Length=354

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 91/161 (57%), Gaps = 18/161 (11%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y T +G+F ++WS+  L RS HLHF    S  +        D Y  S+  A  F   IKP
Sbjct  54   YLTNVGVFFLSWSQSFLRRSLHLHFY---SCNSTNCYLHSPDCYRHSIPFA--FRLEIKP  108

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
              F +KQGSKK  IS    ++   V WDL+ A+FGSGP+P SGFY+AV V GE  LLIG 
Sbjct  109  LTFWRKQGSKK--ISRKPDIR---VVWDLTHARFGSGPDPESGFYVAVFVSGEVGLLIG-  162

Query  532  CQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
               E   K R R     Q LV K+E+++G ++Y+TK  + G
Sbjct  163  ---EGNLKQRPRR----QILVSKKENLFGNRVYSTKIKIQG  196



>ref|XP_010419653.1| PREDICTED: uncharacterized protein LOC104705366 [Camelina sativa]
Length=395

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 91/162 (56%), Gaps = 9/162 (6%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y+T  G+F +TWSR  LG    ++  L                   SLS A SFH  +  
Sbjct  41   YQTDHGVFYLTWSRTFLG-GHSVNLFLHSQDYYNHSSPLSFSSADLSLSSAVSFHLNLNT  99

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
              F KK+GS+ +            VFWDL++AKF SG EP SGFYIAV+V GE  LL+GD
Sbjct  100  LAFWKKRGSRFVS-------PKIQVFWDLTKAKFDSGSEPRSGFYIAVVVDGEMGLLVGD  152

Query  532  CQXEAYAKTR-ARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
               EAYA+ + A+   N QAL+L++EHV+G +++ TK+  GG
Sbjct  153  SVKEAYARAKSAKPPTNPQALLLRKEHVFGARVFTTKARFGG  194



>ref|XP_009151242.1| PREDICTED: uncharacterized protein LOC103874571 [Brassica rapa]
 ref|XP_009151243.1| PREDICTED: uncharacterized protein LOC103874571 [Brassica rapa]
 emb|CDX86191.1| BnaA06g29080D [Brassica napus]
Length=293

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 89/154 (58%), Gaps = 24/154 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTW++ L+G+S  +   +DD                 S +        IKP++F+K+
Sbjct  45   LITVTWAKSLMGQSVTVG--VDD-----------------SCNNQSLCKVEIKPWLFTKR  85

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  S       +VFWDLS AKFGSGPE + GFY++V+V  E VLL+GD + EA+
Sbjct  86   KGSKSLEAYSC----KIDVFWDLSSAKFGSGPEALGGFYVSVVVDKEMVLLLGDMRKEAF  141

Query  550  AKTRARHAGN-GQALVLKREHVYGGKLYATKSNV  648
             KT A  + + G   V K+EHV+G + +ATK+ +
Sbjct  142  KKTNASPSSSLGAVFVAKKEHVFGKRAFATKAEL  175



>ref|XP_004955779.1| PREDICTED: uncharacterized protein LOC101785301 [Setaria italica]
Length=313

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 69/101 (68%), Gaps = 2/101 (2%)
 Frame = +1

Query  343  IKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLL  522
            +KP++FSK++GSK L ++  G     +VFWDLS A+FG+ PEPV GFY+AV+  GETVLL
Sbjct  98   VKPWLFSKRKGSKTLDVA--GAAAKVDVFWDLSGARFGAAPEPVEGFYVAVVCDGETVLL  155

Query  523  IGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
            +GD + EAY KT A        LV ++EHV   K+++ K+ 
Sbjct  156  LGDMRKEAYRKTAADRPAVDALLVARKEHVVSKKVFSAKAQ  196



>ref|XP_006650760.1| PREDICTED: uncharacterized protein LOC102720690 [Oryza brachyantha]
Length=291

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 84/152 (55%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            + +VTWS+ L+G+   +   +DD                  LS        IKP++FSKK
Sbjct  48   VISVTWSKSLMGQGLSIG--VDD------------------LSNQCLCKADIKPWLFSKK  87

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK+L +          +FWDLS AKFG+GPEP+ GFY+AV+   E VLL+GD + +A+
Sbjct  88   KGSKRLDVEDG----KIEIFWDLSGAKFGAGPEPLEGFYVAVVFDLELVLLLGDMRKDAF  143

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             KT A       A V +REH+YG K+Y  K+ 
Sbjct  144  RKTGANRPMLNAAFVARREHIYGKKIYTAKAQ  175



>emb|CDY00013.1| BnaC09g02880D [Brassica napus]
Length=295

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 89/153 (58%), Gaps = 24/153 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTW++ L+G+S  +   +DDS                SL         IKP++F+K+
Sbjct  45   LITVTWAKTLMGQSVTVG--VDDSCN-------------QSLC-----KVEIKPWLFTKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L++ S     + +V WDL+ AKFGSGPE + GFY+ V+V  E VLL+GD + EA+
Sbjct  85   KGSKSLEVYSC----SIDVVWDLASAKFGSGPEALGGFYVGVVVDKEMVLLLGDMKKEAF  140

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSNV  648
             KT A  +  G   V K+EHV+G + +ATK+ +
Sbjct  141  KKTNASPSSRGAVFVAKKEHVFGKREFATKAQL  173



>ref|NP_566240.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAG51405.1|AC009465_5 unknown protein; 64727-65596 [Arabidopsis thaliana]
 gb|AAL27500.1|AF439828_1 AT3g04860/T9J14_19 [Arabidopsis thaliana]
 gb|AAM78072.1| AT3g04860/T9J14_19 [Arabidopsis thaliana]
 gb|AEE74147.1| uncharacterized protein AT3G04860 [Arabidopsis thaliana]
Length=289

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 89/156 (57%), Gaps = 25/156 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTW+++L+G+   +   +DDS   +                       IKP++F+K+
Sbjct  46   LITVTWTKNLMGQCVTVG--VDDSCNRSLC------------------KVEIKPWLFTKR  85

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  +     N +VFWDLS AKFGS PEP+ GFY+ V+V  E VLL+GD + EA+
Sbjct  86   KGSKTLEAYAC----NIDVFWDLSSAKFGSSPEPLGGFYVGVVVDKEMVLLLGDMKKEAF  141

Query  550  AKTRARHAGN-GQALVLKREHVYGGKLYATKSNVGG  654
             KT A  + + G   + K+EHV+G + +ATK+   G
Sbjct  142  KKTNAAPSSSLGAVFIAKKEHVFGKRTFATKAQFSG  177



>ref|XP_006382769.1| hypothetical protein POPTR_0005s05250g [Populus trichocarpa]
 gb|ERP60566.1| hypothetical protein POPTR_0005s05250g [Populus trichocarpa]
Length=299

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 86/151 (57%), Gaps = 24/151 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  +TWS++L+G+   +   +DDS+                          IKP++FSK+
Sbjct  45   LITITWSKNLMGQGLSVG--IDDSANQCLC------------------KVDIKPWLFSKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  S       +++WDLS AKFGSGPEP  GFY+AV+V  + VL++GD + EA+
Sbjct  85   KGSKSLEAYSC----KIDIYWDLSSAKFGSGPEPFEGFYVAVVVDRQMVLILGDMRKEAF  140

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKS  642
             KT A    +    V KREHV+G K++ TK+
Sbjct  141  KKTGATPIPSNAVFVAKREHVFGKKVFCTKA  171



>gb|AAM65821.1| unknown [Arabidopsis thaliana]
Length=289

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 89/156 (57%), Gaps = 25/156 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTW+++L+G+   +   +DDS   +                       IKP++F+K+
Sbjct  46   LITVTWTKNLMGQCVTVG--VDDSCNRSLC------------------KVEIKPWLFTKR  85

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  +     N +VFWDLS AKFGS PEP+ GFY+ V+V  E VLL+GD + EA+
Sbjct  86   KGSKTLKAYAC----NIDVFWDLSSAKFGSSPEPLGGFYVGVVVDKEMVLLLGDIKKEAF  141

Query  550  AKTRARHAGN-GQALVLKREHVYGGKLYATKSNVGG  654
             KT A  + + G   + K+EHV+G + +ATK+   G
Sbjct  142  KKTNAAPSSSLGAVFIAKKEHVFGKRTFATKAQFSG  177



>ref|XP_007147151.1| hypothetical protein PHAVU_006G100000g [Phaseolus vulgaris]
 gb|ESW19145.1| hypothetical protein PHAVU_006G100000g [Phaseolus vulgaris]
Length=297

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 85/151 (56%), Gaps = 24/151 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTWS++L+G+   L   +DDS                  S        IKP+ FSK+
Sbjct  45   LITVTWSKNLMGQG--LGVAIDDS------------------SSQSLCKVDIKPWGFSKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +G K L++ S       +V+WDLS AKFGS PEP+ GFY+  +V G+ +LL+GD + EA+
Sbjct  85   RGCKSLEVHSC----KVDVYWDLSSAKFGSSPEPLGGFYVGAVVDGQMILLLGDLKKEAF  140

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKS  642
             KT A    +   L+ K+EHV+G KLY TK+
Sbjct  141  KKTNASPLPHNGFLIAKKEHVFGKKLYGTKA  171



>ref|XP_011032437.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032438.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032439.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032440.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032441.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032442.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032443.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032444.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032446.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032447.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032448.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032449.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032450.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032452.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032453.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032454.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032455.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032456.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032457.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032458.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032459.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032460.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032461.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
Length=299

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 86/151 (57%), Gaps = 24/151 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  +TWS++L+G+   L   +DDS+                          IKP++FSK+
Sbjct  45   LITITWSKNLMGQG--LSVGIDDSANQCLC------------------KVDIKPWLFSKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  S       +++WDLS AKFGSGPEP  GFY+AV+V  + VL++GD + EA+
Sbjct  85   KGSKCLEAYSC----KIDIYWDLSSAKFGSGPEPFEGFYVAVVVDRQMVLILGDMRKEAF  140

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKS  642
             KT A    +    V KREHV+G K++ TK+
Sbjct  141  KKTGATPVPSNAVFVAKREHVFGKKVFCTKA  171



>gb|KHN43207.1| hypothetical protein glysoja_001790 [Glycine soja]
Length=243

 Score =   103 bits (257),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 69/100 (69%), Gaps = 4/100 (4%)
 Frame = +1

Query  343  IKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLL  522
            IKP+ FSK++G K L++ S       +V+WDLS AKFGSGPEP+ GFY+  +V G+ VLL
Sbjct  22   IKPWGFSKRRGCKSLEVHSC----KVDVYWDLSSAKFGSGPEPLGGFYVGAVVDGQMVLL  77

Query  523  IGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKS  642
            +GD + EA+ KT A    +   LV K+EHV+G KL+ TK+
Sbjct  78   LGDLRKEAFKKTNANPLPHNAVLVAKKEHVFGKKLHGTKA  117



>ref|XP_009111920.1| PREDICTED: uncharacterized protein LOC103837313 [Brassica rapa]
 ref|XP_009111921.1| PREDICTED: uncharacterized protein LOC103837313 [Brassica rapa]
Length=294

 Score =   104 bits (259),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 89/153 (58%), Gaps = 24/153 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTW++ L+G+S  +   +DDS                SL         IKP++F+K+
Sbjct  45   LITVTWAKTLMGQSVTVG--VDDSCN-------------QSLC-----KVEIKPWLFTKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L++ S     + +V WDL+ AKFGSGPE + GFY+ V+V  E VLL+GD + EA+
Sbjct  85   KGSKSLEVYSC----SIDVVWDLASAKFGSGPEALGGFYVGVVVDKEMVLLLGDMKKEAF  140

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSNV  648
             KT A  +  G   + K+EHV+G + +ATK+ +
Sbjct  141  KKTNASPSSRGAVFIAKKEHVFGKREFATKAQL  173



>ref|XP_010090262.1| hypothetical protein L484_006168 [Morus notabilis]
 gb|EXB39200.1| hypothetical protein L484_006168 [Morus notabilis]
Length=299

 Score =   104 bits (259),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 57/152 (38%), Positives = 87/152 (57%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  +TWS+ L+G+   +   +DDS                  S        IKP++FSK+
Sbjct  45   LITITWSKSLMGQGLTVG--IDDS------------------SNQCLCKVDIKPWLFSKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  SS      +++WDLS AKFGSGPEP+ G+Y+AV+V  + VLL+GD + EA+
Sbjct  85   RGSKSLEAYSS----KIDIYWDLSSAKFGSGPEPLEGYYVAVVVDRQMVLLLGDLRKEAF  140

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             KT A    +    V K+EH++G +++ TK+ 
Sbjct  141  KKTGANPVASDAVFVAKKEHIFGKRVFTTKAQ  172



>emb|CDY52485.1| BnaC07g49460D [Brassica napus]
Length=293

 Score =   104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 89/154 (58%), Gaps = 24/154 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTW++ L+G+S  +   +DD                 S +        IKP++F+K+
Sbjct  45   LITVTWAKSLMGQSVTVG--VDD-----------------SCNNQSLCKVEIKPWLFTKR  85

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  S       +VFWDLS AKFGSGPE + GFY++V+V  E VLL+GD + EA+
Sbjct  86   KGSKSLEAYSC----KIDVFWDLSSAKFGSGPEALGGFYVSVVVDKEMVLLLGDMRKEAF  141

Query  550  AKTRARHAGN-GQALVLKREHVYGGKLYATKSNV  648
             KT A  + + G   + K+EHV+G + +ATK+ +
Sbjct  142  KKTNASPSSSLGAVFIAKKEHVFGKRSFATKAQL  175



>ref|XP_004494682.1| PREDICTED: uncharacterized protein LOC101496846 [Cicer arietinum]
Length=302

 Score =   104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 70/103 (68%), Gaps = 7/103 (7%)
 Frame = +1

Query  343  IKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLL  522
            IKP++FSKK+G K L+  S+      +VFWDLS AKFGSGPEP+ GFY+ V+V  + VLL
Sbjct  73   IKPWVFSKKKGCKSLEAFSA----KIDVFWDLSSAKFGSGPEPLEGFYVGVVVDRQMVLL  128

Query  523  IGDCQXEAYAKTRA---RHAGNGQALVLKREHVYGGKLYATKS  642
            +GD + EA+ KT A       N   LV K+EHV+G KLY TK+
Sbjct  129  LGDLRKEAFKKTNAVPLPSNSNAAVLVAKKEHVFGKKLYGTKA  171



>ref|XP_010421680.1| PREDICTED: uncharacterized protein LOC104707100 [Camelina sativa]
Length=288

 Score =   103 bits (258),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 88/153 (58%), Gaps = 24/153 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTW+++L+G+S  +   +DD          P +     +         IK  +F+K+
Sbjct  45   LITVTWTKNLMGQSVTVG--VDD----------PCNQSLCKV--------EIKQSLFTKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  S     N +VFWDLS AKFGSGPE + GFY+ V+V  E VLL+GD + EA 
Sbjct  85   KGSKSLEAYSC----NIDVFWDLSSAKFGSGPEALGGFYVCVVVDKEMVLLLGDMKKEAL  140

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSNV  648
             KT A  +  G   + K+EHV+G +++ATK+ +
Sbjct  141  KKTNASPSSLGAVFIAKKEHVFGKRVFATKAQL  173



>dbj|BAJ95878.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=292

 Score =   103 bits (258),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 87/162 (54%), Gaps = 28/162 (17%)
 Frame = +1

Query  172  YRTGLG----LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHF  339
            Y+T L     + +VTWS+ L+G+   +                        LSG      
Sbjct  38   YQTQLAARPCVVSVTWSKSLMGQGLSVAV--------------------DGLSGQSLCKA  77

Query  340  RIKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVL  519
             IKP++FSKK+GSK L +   GG    ++FWDLS A+FG+GPEP+ GFY+A++   E  L
Sbjct  78   DIKPWLFSKKKGSKSLDVD--GG--KVDIFWDLSAARFGAGPEPLEGFYVALVFDLELAL  133

Query  520  LIGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
            L+GD   +AY KT A       A V ++EH+YG K+Y+ K+ 
Sbjct  134  LLGDMNKDAYRKTGANRPALNAAFVARKEHIYGKKIYSAKAQ  175



>ref|XP_010256015.1| PREDICTED: uncharacterized protein LOC104596517 [Nelumbo nucifera]
Length=298

 Score =   103 bits (258),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 84/152 (55%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTWS++L+G+   +   +DDS+                          IKP++FSK+
Sbjct  44   LITVTWSKNLMGQGLSVG--IDDSTNQCLC------------------KVDIKPWLFSKR  83

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +G K L+  SS      +++WDLS AKFGS PEP+ GFY+AV+   E VLL+GD   EAY
Sbjct  84   KGFKSLEADSS----KVDIYWDLSSAKFGSSPEPLEGFYLAVVFDREMVLLLGDLSKEAY  139

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             KT A    +    + KREH++G ++Y TK+ 
Sbjct  140  KKTSAAPVPSSAIFIAKREHIFGKRVYGTKAQ  171



>ref|XP_009125261.1| PREDICTED: uncharacterized protein LOC103850289 [Brassica rapa]
Length=343

 Score =   104 bits (259),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 69/169 (41%), Positives = 91/169 (54%), Gaps = 32/169 (19%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFS--------SLSGAP  327
            Y+T  G+F +TWSR  LG    L+  L             +D+Y S        SLS   
Sbjct  22   YQTDHGVFYLTWSRTFLG-GHSLNLFL-----------HSQDYYNSHSSPLSFPSLSSLA  69

Query  328  SFHFRIKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGG  507
            SFH  +    F +K+GSK +         N  V WDL+RAKF SG EP SGFY+AV+V G
Sbjct  70   SFHLSLNTLTFWRKRGSKFIS-------SNIQVLWDLTRAKFESGSEPRSGFYVAVIVDG  122

Query  508  ETVLLIGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
            E  LL+GDC        R +   N QALV+++EHV+GG ++ATK+  GG
Sbjct  123  EVGLLVGDC-----GDARVKSPANRQALVMRKEHVFGGSVFATKARFGG  166



>ref|XP_004230118.1| PREDICTED: uncharacterized protein LOC101268432 [Solanum lycopersicum]
Length=299

 Score =   103 bits (257),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 56/152 (37%), Positives = 87/152 (57%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTWS++L+G+   +   +DD+                  +        IKP++FSKK
Sbjct  45   LLNVTWSKNLMGQGLTIG--IDDN------------------TNQCLCKVDIKPWLFSKK  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  S    +  ++ WDLS AKFGSGPEP+ GFY+ V+   + +LL+GD + EA 
Sbjct  85   KGSKTLEAYS----RKIDICWDLSSAKFGSGPEPLEGFYVCVVSERQMILLLGDMKKEAI  140

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             KT A  A +G   + K+EH++G K+++TK+ 
Sbjct  141  KKTSATPAASGAVFIAKKEHMFGKKVFSTKAQ  172



>ref|XP_006347793.1| PREDICTED: uncharacterized protein LOC102597851 [Solanum tuberosum]
Length=299

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/152 (38%), Positives = 86/152 (57%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTWS++L+G+   +   +DD+                  +        IKP++FSKK
Sbjct  45   LLNVTWSKNLMGQGLTIG--IDDN------------------TNQCLCKVDIKPWLFSKK  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  S    +  +V WDLS AKFGSGPEP+ GFY+ V+   + +LL+GD + EA 
Sbjct  85   KGSKTLEAYS----RKIDVCWDLSSAKFGSGPEPLEGFYVCVVSERQMILLLGDMKKEAI  140

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             KT A  A  G   + K+EH++G K+++TK+ 
Sbjct  141  KKTSATPAACGAVFIAKKEHMFGKKVFSTKAQ  172



>ref|XP_009364535.1| PREDICTED: uncharacterized protein LOC103954432 [Pyrus x bretschneideri]
 ref|XP_009364536.1| PREDICTED: uncharacterized protein LOC103954432 [Pyrus x bretschneideri]
 ref|XP_009364537.1| PREDICTED: uncharacterized protein LOC103954432 [Pyrus x bretschneideri]
 ref|XP_009364538.1| PREDICTED: uncharacterized protein LOC103954432 [Pyrus x bretschneideri]
 ref|XP_009364540.1| PREDICTED: uncharacterized protein LOC103954432 [Pyrus x bretschneideri]
Length=299

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 86/152 (57%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTWSR+L+G+   +   +DDS                  S        IKP++FSK+
Sbjct  45   LITVTWSRNLMGQGLSVG--IDDS------------------SNQCLCKVDIKPWLFSKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  SS      +++WDLS AKFGSGPEP+ G+Y+ V+V  + +LL+GD + EA+
Sbjct  85   RGSKSLEAYSS----QIDIYWDLSSAKFGSGPEPLEGYYVGVVVDRQMLLLLGDMRKEAF  140

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             KT A    +    V KREH++G + + TK+ 
Sbjct  141  KKTSANPVPSSAVCVAKREHIFGKRGFTTKAQ  172



>ref|XP_006433029.1| hypothetical protein CICLE_v10001999mg [Citrus clementina]
 ref|XP_006471721.1| PREDICTED: uncharacterized protein LOC102630218 isoform X1 [Citrus 
sinensis]
 ref|XP_006471722.1| PREDICTED: uncharacterized protein LOC102630218 isoform X2 [Citrus 
sinensis]
 gb|ESR46269.1| hypothetical protein CICLE_v10001999mg [Citrus clementina]
 gb|KDO41101.1| hypothetical protein CISIN_1g022287mg [Citrus sinensis]
Length=299

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/151 (38%), Positives = 87/151 (58%), Gaps = 24/151 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  +TWS++L+G+   +   +DD+                  S        IKP++FSK+
Sbjct  45   LITITWSKNLMGQGLSVG--IDDA------------------SNQCLCKVDIKPWLFSKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  S       +++WDLS AKFGSGPEP+ GFY++V+V  + VLL+GD + EA+
Sbjct  85   KGSKSLEAYSCI----IDIYWDLSSAKFGSGPEPLEGFYVSVVVDRQMVLLLGDMRKEAF  140

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKS  642
             KT A    +    V KREH++G K++ TK+
Sbjct  141  KKTNATPVPSNAVFVAKREHLFGKKVFFTKA  171



>gb|EEE60141.1| hypothetical protein OsJ_13031 [Oryza sativa Japonica Group]
Length=269

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 72/121 (60%), Gaps = 9/121 (7%)
 Frame = +1

Query  298  FYFSSLSGAPSF-----HFRIKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSG  462
             Y +  SG P          IKP++FSKK+GSK+L +          +FWDLS AKFG+G
Sbjct  37   LYQAQFSGRPCVISCLCKADIKPWLFSKKKGSKRLDVEDG----KIEIFWDLSGAKFGAG  92

Query  463  PEPVSGFYIAVLVGGETVLLIGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKS  642
            PEP+ GFY+AV+   E +LL+GD + +AY KT A       A V +REH+YG K+Y  K+
Sbjct  93   PEPMEGFYVAVVFDLELILLLGDMKKDAYRKTGANRPMLNAAFVARREHIYGKKIYTAKA  152

Query  643  N  645
             
Sbjct  153  Q  153



>gb|AFW67286.1| hypothetical protein ZEAMMB73_929047 [Zea mays]
Length=214

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 81/143 (57%), Gaps = 24/143 (17%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            + ++TWSR L+G+   +   +DD                  LSG       IKP++FSKK
Sbjct  48   VISLTWSRSLMGQGLSVG--VDD------------------LSGHCLCKADIKPWLFSKK  87

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L +         ++FWDLS AKFG+GPEPV GFY+AV+   E VLL+GD + +AY
Sbjct  88   KGSKSLDVEDG----KIDIFWDLSGAKFGAGPEPVEGFYVAVVFDLELVLLLGDMKKDAY  143

Query  550  AKTRARHAGNGQALVLKREHVYG  618
             KT A  +    A V +REH+YG
Sbjct  144  RKTGANRSMLNAAFVARREHIYG  166



>ref|XP_010491790.1| PREDICTED: uncharacterized protein LOC104769314 [Camelina sativa]
Length=392

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 90/162 (56%), Gaps = 9/162 (6%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y+T  G+F +TWSR  LG    ++  L                   SLS A SFH  +  
Sbjct  40   YQTDHGVFYLTWSRTFLG-GHSVNLFLHSQDYYNHSSPLSFSSADLSLSSAVSFHLNLNT  98

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
              F KK+GS+ +            VFWDL++AKF SG EP  GFYIAV+V GE  LL+GD
Sbjct  99   LAFWKKRGSRFVS-------PKIQVFWDLTKAKFDSGSEPRYGFYIAVVVDGEMGLLVGD  151

Query  532  CQXEAYAKTR-ARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
               EAYA+ + A+   N QAL+L++EHV+G +++ TK+  GG
Sbjct  152  SVKEAYARAKSAKPPTNPQALLLRKEHVFGARVFTTKARFGG  193



>ref|XP_006838233.1| hypothetical protein AMTR_s00103p00021650 [Amborella trichopoda]
 gb|ERN00802.1| hypothetical protein AMTR_s00103p00021650 [Amborella trichopoda]
Length=301

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 89/162 (55%), Gaps = 28/162 (17%)
 Frame = +1

Query  172  YRTGLG----LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHF  339
            YR+ L     +  VTWS++L+G+   L   +DDS+                         
Sbjct  34   YRSQLCGRSCVITVTWSKNLMGQG--LSVGIDDSTNQGLC------------------KV  73

Query  340  RIKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVL  519
             +KP++FSK++GSK L   ++      ++FWDLS AKFGSGPEP+ GFY+AV+   + VL
Sbjct  74   DLKPWLFSKRKGSKTLDAETN----KIDIFWDLSSAKFGSGPEPIEGFYLAVVFDLQMVL  129

Query  520  LIGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
            L+GD   +AY KT AR        V KREH++G ++Y TK+ 
Sbjct  130  LLGDLSKDAYRKTNARPPSFNPVFVAKREHIFGKRVYFTKAQ  171



>ref|XP_010090415.1| hypothetical protein L484_025081 [Morus notabilis]
 gb|EXB39385.1| hypothetical protein L484_025081 [Morus notabilis]
Length=305

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 87/159 (55%), Gaps = 27/159 (17%)
 Frame = +1

Query  175  RTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPF  354
            R  L L  VTW+++L+G+   +   +DDS+                          IKP+
Sbjct  41   RGRLCLITVTWTKNLMGQGLSIG--IDDSAHQCLC------------------KVDIKPW  80

Query  355  MFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDC  534
            +FSK++G K L++ SS      +++WDL+ AKFG+GPEP+ GFY+AV+  GE +LL+GD 
Sbjct  81   LFSKRKGCKNLEVDSS----KIDMYWDLTNAKFGAGPEPLEGFYLAVIFNGEMILLLGDL  136

Query  535  QXEAYAKTR---ARHAGNGQALVLKREHVYGGKLYATKS  642
            + EAY K      R   +    V KREH++G K Y  K+
Sbjct  137  KREAYKKIDNDAERVRCSNSIFVAKREHIFGKKFYVAKA  175



>ref|XP_002977922.1| hypothetical protein SELMODRAFT_107811 [Selaginella moellendorffii]
 gb|EFJ21260.1| hypothetical protein SELMODRAFT_107811 [Selaginella moellendorffii]
Length=294

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 84/158 (53%), Gaps = 32/158 (20%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFR----IKPFM  357
            L  VTW ++L+G+   ++  +DD                      P+ H+     +KP+ 
Sbjct  44   LITVTWCKNLMGQGLSVN--VDD----------------------PACHYTCKVDMKPWF  79

Query  358  FSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQ  537
            F KKQGSK +++      +   VFWDLS AK+  GPEP  GFY+A++  GE  LL+GD  
Sbjct  80   FWKKQGSKAMEVDG----QKVEVFWDLSSAKYLCGPEPQDGFYLAIVSDGEVALLLGDMV  135

Query  538  XEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVG  651
             EAY KT+AR       L+ +REHV+G + Y TK+  G
Sbjct  136  REAYKKTQARPPTIEAMLLSRREHVFGKRYYTTKAQFG  173



>ref|XP_002986948.1| hypothetical protein SELMODRAFT_158336 [Selaginella moellendorffii]
 gb|EFJ12030.1| hypothetical protein SELMODRAFT_158336 [Selaginella moellendorffii]
Length=297

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 84/158 (53%), Gaps = 32/158 (20%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFR----IKPFM  357
            L  VTW ++L+G+   ++  +DD                      P+ H+     +KP+ 
Sbjct  47   LITVTWCKNLMGQGLSVN--VDD----------------------PACHYTCKVDMKPWF  82

Query  358  FSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQ  537
            F KKQGSK +++      +   VFWDLS AK+  GPEP  GFY+A++  GE  LL+GD  
Sbjct  83   FWKKQGSKAMEVDG----QKVEVFWDLSSAKYLCGPEPQDGFYLAIVSDGEVALLLGDMV  138

Query  538  XEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVG  651
             EAY KT+AR       L+ +REHV+G + Y TK+  G
Sbjct  139  REAYKKTQARPPTIEAMLLSRREHVFGKRYYTTKAQFG  176



>ref|XP_010417285.1| PREDICTED: uncharacterized protein LOC104703050 [Camelina sativa]
Length=373

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 90/161 (56%), Gaps = 18/161 (11%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y T +G+F +TWS+  L RS HLHF    S  +        D Y  S+    +F   +KP
Sbjct  73   YHTNVGVFFLTWSQAFLRRSLHLHFY---SCHSVNCYLHSPDCYRHSVPF--TFRLEVKP  127

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
              F +K GSKK  IS    ++   + WDL+ A+FG GP+P SGFY+AV+V GE  LL+GD
Sbjct  128  LTFWRKHGSKK--ISRKPDIR---IVWDLTHARFGLGPDPESGFYVAVIVSGEVGLLVGD  182

Query  532  CQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
                   K R R     Q LV KRE+++G ++Y+TK  + G
Sbjct  183  ----GNVKERPRR----QVLVSKRENLFGNRVYSTKIKIQG  215



>ref|XP_006408140.1| hypothetical protein EUTSA_v10021255mg [Eutrema salsugineum]
 ref|XP_006408141.1| hypothetical protein EUTSA_v10021255mg [Eutrema salsugineum]
 gb|ESQ49593.1| hypothetical protein EUTSA_v10021255mg [Eutrema salsugineum]
 gb|ESQ49594.1| hypothetical protein EUTSA_v10021255mg [Eutrema salsugineum]
Length=288

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 88/156 (56%), Gaps = 25/156 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTW+++L+G+   +   +DDS   +                       IKP++F+K+
Sbjct  45   LITVTWTKNLMGQCVTVG--VDDSCNRSLC------------------KVEIKPWLFTKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  S     N +VFWDLS AKFGS PEP+ GFY+ V+V  E  LL+GD + EA+
Sbjct  85   KGSKNLEAYSC----NIDVFWDLSSAKFGSSPEPLGGFYVGVVVDKEMALLLGDMKKEAF  140

Query  550  AKTRARHAGN-GQALVLKREHVYGGKLYATKSNVGG  654
             KT A  + + G   + K+EHV+G + +ATK+   G
Sbjct  141  RKTNAAPSSSLGAVFIGKKEHVFGKRTFATKAQFSG  176



>ref|XP_008345708.1| PREDICTED: uncharacterized protein LOC103408652 [Malus domestica]
 ref|XP_008345709.1| PREDICTED: uncharacterized protein LOC103408652 [Malus domestica]
Length=299

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 86/152 (57%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTWSR+L+G+   +   +DDS                  S        IKP++FSK+
Sbjct  45   LITVTWSRNLMGQGLSVG--IDDS------------------SSQCLCKVDIKPWLFSKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  SS      +++WDLS AKFGSGPEP+ G+Y+ V+V  + +LL+GD + EA+
Sbjct  85   RGSKSLEAYSS----KIDIYWDLSSAKFGSGPEPLEGYYVGVVVDRQMLLLLGDMRKEAF  140

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             KT      +    V KREH++G + +ATK+ 
Sbjct  141  KKTSVTPVPSSAVCVAKREHIFGKRGFATKAQ  172



>ref|XP_009805050.1| PREDICTED: uncharacterized protein LOC104250176 [Nicotiana sylvestris]
Length=297

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/152 (37%), Positives = 87/152 (57%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTWS++L+G+   L   +DD+                  +        IKP++FSKK
Sbjct  43   LLNVTWSKNLMGQG--LTVGIDDN------------------TNQCLCKVDIKPWLFSKK  82

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  S    +  +V+WDL+ AKFGSGPEP+ GFY+ V+   + +LL+GD + EA 
Sbjct  83   KGSKTLEAYS----RKIDVYWDLTSAKFGSGPEPLEGFYVCVVSERQMILLLGDMRKEAT  138

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             KT A  + +G   + K+EH++G K++ TK+ 
Sbjct  139  KKTSATPSASGAVFIAKKEHIFGKKVFGTKAQ  170



>gb|ACU20214.1| unknown [Glycine max]
Length=300

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 84/155 (54%), Gaps = 27/155 (17%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  V+W++ L+G+   +   +DD                  L         IKP++FSK+
Sbjct  45   LITVSWTKTLIGQGLSVE--IDD------------------LGKHCLCKVEIKPWLFSKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L++ S       ++FWDLS AKFGSGPEP+ GFY+AV+   ETVLL+GD + EA 
Sbjct  85   KGSKNLEVQSG----KVDIFWDLSSAKFGSGPEPMEGFYLAVVFNKETVLLLGDLKKEAC  140

Query  550  AKTRARHAG---NGQALVLKREHVYGGKLYATKSN  645
             K  +  A    +G   + KREH++G K Y  K+ 
Sbjct  141  KKIESDCACFSHSGAIFIAKREHIFGKKFYGAKAQ  175



>ref|XP_003536564.1| PREDICTED: uncharacterized protein LOC100796685 [Glycine max]
Length=300

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 84/155 (54%), Gaps = 27/155 (17%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  V+W++ L+G+   +   +DD                  L         IKP++FSK+
Sbjct  45   LITVSWTKTLIGQGLSVE--IDD------------------LGKHCLCKVEIKPWLFSKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L++ S       ++FWDLS AKFGSGPEP+ GFY+AV+   ETVLL+GD + EA 
Sbjct  85   KGSKNLEVQSG----KVDIFWDLSSAKFGSGPEPMEGFYLAVVFNKETVLLLGDLKKEAC  140

Query  550  AKTRARHAG---NGQALVLKREHVYGGKLYATKSN  645
             K  +  A    +G   + KREH++G K Y  K+ 
Sbjct  141  KKIESDCACFSHSGAIFIAKREHIFGKKFYGAKAQ  175



>emb|CDY59819.1| BnaA09g51660D [Brassica napus]
Length=444

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 89/153 (58%), Gaps = 24/153 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTW++ L+G+S  +   +DDS                SL         IKP++F+K+
Sbjct  194  LITVTWAKTLMGQSVTVG--VDDSCN-------------QSLCKV-----EIKPWLFTKR  233

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L++ S     + +V WDL+ AKFGSGPE + GFY+ V+V  E VLL+GD + EA+
Sbjct  234  KGSKSLEVYSC----SIDVIWDLASAKFGSGPEALGGFYVGVVVDKEMVLLLGDMKKEAF  289

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSNV  648
             KT A  +  G   + K+EHV+G + +ATK+ +
Sbjct  290  KKTNASPSSRGAVFIAKKEHVFGKREFATKAQL  322



>ref|XP_011071576.1| PREDICTED: uncharacterized protein LOC105156990 [Sesamum indicum]
Length=302

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 87/162 (54%), Gaps = 28/162 (17%)
 Frame = +1

Query  172  YRTGL----GLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHF  339
            YR  L     L ++ WS+ L+G+   +   +DD+                  S    F  
Sbjct  37   YRCKLFDKSCLISIVWSKSLMGQCLSVE--IDDA------------------SHQCIFKV  76

Query  340  RIKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVL  519
             +KP +FSK++GSK L+++S        VFWDLS AKFGSGPEP+ G+YI V+   E VL
Sbjct  77   DVKPSLFSKRKGSKCLEVNSG----RIEVFWDLSMAKFGSGPEPLEGYYIGVVCKREMVL  132

Query  520  LIGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
            LIGD   EA+ KT A  + +    V KREH+ G +++ TK+ 
Sbjct  133  LIGDLTKEAFKKTGAIASLSSAVFVSKREHICGKRVFGTKAQ  174



>gb|KJB45005.1| hypothetical protein B456_007G284600 [Gossypium raimondii]
 gb|KJB45006.1| hypothetical protein B456_007G284600 [Gossypium raimondii]
 gb|KJB45007.1| hypothetical protein B456_007G284600 [Gossypium raimondii]
 gb|KJB45008.1| hypothetical protein B456_007G284600 [Gossypium raimondii]
Length=303

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 84/152 (55%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTW+++L+G+   +   +DDS+                          IKP++FSK+
Sbjct  47   LITVTWTKNLMGQGLSVG--IDDSANQCLC------------------KVDIKPWLFSKR  86

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  S       +V+WDLS AKFGSGPEP  GFY+ V+   + VLL+GD   EA 
Sbjct  87   KGSKSLEAYSC----KIDVYWDLSSAKFGSGPEPFEGFYVGVVANKQMVLLLGDMSKEAC  142

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             KT A H     +LV K+EHV+G +++ TK+ 
Sbjct  143  KKTGATHIPCNASLVAKKEHVFGKRVFGTKAQ  174



>emb|CDY50761.1| BnaAnng10680D [Brassica napus]
Length=287

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 87/157 (55%), Gaps = 28/157 (18%)
 Frame = +1

Query  175  RTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPF  354
            R    L  VTW++ L+G+   +   +DDS               +SL         IKP+
Sbjct  40   RGKTCLITVTWTKSLMGQCVTIG--VDDSCN-------------TSLC-----KVEIKPW  79

Query  355  MFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDC  534
            +F+K++GSK L         N +VFWDLS AKFGS PEP+ GFY+ V+V  E  LL+GD 
Sbjct  80   LFTKRKGSKNL-------CNNISVFWDLSSAKFGSSPEPLGGFYVCVVVDKEMTLLLGDM  132

Query  535  QXEAYAKTRARHAGN-GQALVLKREHVYGGKLYATKS  642
            + EA+ KT A  + + G  ++ KREHV+G + + TK+
Sbjct  133  RKEAFKKTNAAPSSSLGAVIIAKREHVFGKRTFETKA  169



>ref|XP_007030623.1| Uncharacterized protein TCM_026394 [Theobroma cacao]
 gb|EOY11125.1| Uncharacterized protein TCM_026394 [Theobroma cacao]
Length=300

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 85/152 (56%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTWS++L+G+   +   +DDS+                          IKP++FSK+
Sbjct  45   LITVTWSKNLMGQGLSVG--IDDSANQCLC------------------KVDIKPWLFSKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  S       +++WDLS AKFGSGPEP+ GFY+ V+   + VLL+GD + EAY
Sbjct  85   KGSKSLEAYSC----KIDIYWDLSSAKFGSGPEPLEGFYVGVVADKQMVLLLGDMRKEAY  140

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             KT A    +    V K+EHV+G K++ TK+ 
Sbjct  141  KKTGATPVPSTAVYVAKKEHVFGKKVFGTKAQ  172



>gb|KDP23639.1| hypothetical protein JCGZ_23472 [Jatropha curcas]
Length=299

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 86/151 (57%), Gaps = 24/151 (16%)
 Frame = +1

Query  193  FAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKKQ  372
              +TWS++L+G+   +   +DDS+                          IKP++FSK++
Sbjct  46   ITITWSKNLMGQGLSVG--MDDSANQCLC------------------KVDIKPWLFSKRK  85

Query  373  GSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAYA  552
            GSK L+  S       +++WDLS AKFGSGPEP+ GFY+ ++V  + VLL+GD + EA+ 
Sbjct  86   GSKSLEAYSC----KIDIYWDLSAAKFGSGPEPLEGFYVGIVVDRQMVLLLGDLRKEAFK  141

Query  553  KTRARHAGNGQALVLKREHVYGGKLYATKSN  645
            KT A    +    V KREHV+G K+++T++ 
Sbjct  142  KTSATPIPSNAVFVAKREHVFGKKVFSTRAQ  172



>ref|XP_010419519.1| PREDICTED: uncharacterized protein LOC104705248 [Camelina sativa]
Length=291

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 91/164 (55%), Gaps = 31/164 (19%)
 Frame = +1

Query  172  YRTGLG----LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHF  339
            YR  +G    L  V+W+++L+G+   +   +DDS   +                      
Sbjct  36   YRCRIGGRTCLITVSWTKNLMGQCLTVG--VDDSCNRSLC------------------KV  75

Query  340  RIKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVL  519
             IKP++F+K++GSK L+  S     N +VFWDLS AKFGS PEP+ GFY+ V+V  E  L
Sbjct  76   EIKPWLFTKRKGSKNLEAYSC----NIDVFWDLSSAKFGSSPEPLGGFYVGVVVDKEMAL  131

Query  520  LIGDCQXEAYAKTRARHAGN---GQALVLKREHVYGGKLYATKS  642
            L+GD + EA+ KT A  + +   G   + K+EHV+G + +ATK+
Sbjct  132  LLGDMRKEAFKKTNAAPSSSSSLGAVFIAKKEHVFGKRTFATKA  175



>ref|XP_008388659.1| PREDICTED: uncharacterized protein LOC103451015 [Malus domestica]
 ref|XP_008388660.1| PREDICTED: uncharacterized protein LOC103451015 [Malus domestica]
 ref|XP_008388661.1| PREDICTED: uncharacterized protein LOC103451015 [Malus domestica]
Length=299

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 86/152 (57%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTWSR+L+G+   +   +DDS                  S        IKP++FSK+
Sbjct  45   LITVTWSRNLMGQGLSVG--IDDS------------------SNQCLCKVDIKPWLFSKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  SS      +++WDLS AKFGSGPEP+ G+Y+ V+V  + +LL+GD + EA+
Sbjct  85   RGSKSLEAYSS----KIDIYWDLSLAKFGSGPEPLEGYYVGVVVDRQMLLLLGDMRKEAF  140

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             KT A    +    V KREH++G + + TK+ 
Sbjct  141  KKTSASPVPSSAVCVAKREHIFGKRGFTTKAQ  172



>ref|XP_002512236.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49688.1| conserved hypothetical protein [Ricinus communis]
Length=299

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/152 (37%), Positives = 86/152 (57%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  +TWS++L+G+   +   +DDS+                          IKP++FSK+
Sbjct  45   LITITWSKNLMGQGLSVG--MDDSANQCLC------------------KVDIKPWLFSKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  S       +++WDLS AKFGSGPEP+  FY+ V+V  + VLL+GD + EA+
Sbjct  85   KGSKSLEAYSC----KIDIYWDLSSAKFGSGPEPLEAFYVGVVVDRQMVLLLGDMRKEAF  140

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             KT A    +    V KREHV+G ++++TK+ 
Sbjct  141  KKTSAAPISSTAVFVSKREHVFGKRVFSTKAQ  172



>ref|XP_009588422.1| PREDICTED: uncharacterized protein LOC104085995 [Nicotiana tomentosiformis]
Length=297

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/152 (37%), Positives = 87/152 (57%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTWS++L+G+   L   +DD+                  +        IKP++FSKK
Sbjct  43   LLNVTWSKNLMGQG--LTVGIDDN------------------TNQCLCKVDIKPWLFSKK  82

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  S    +  +V+WDL+ AKFGSGPEP+ GFY+ V+   + +LL+GD + EA 
Sbjct  83   KGSKTLEAYS----RKIDVYWDLTSAKFGSGPEPLEGFYVCVVSERQMILLLGDMRKEAT  138

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             KT A  + +G   + K+EH++G K++ TK+ 
Sbjct  139  KKTGATPSASGAVFIAKKEHIFGKKVFGTKAQ  170



>ref|XP_010429513.1| PREDICTED: uncharacterized protein LOC104713983 isoform X2 [Camelina 
sativa]
Length=353

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 90/161 (56%), Gaps = 18/161 (11%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y T +G+F +TWS+  L RS HLHF   +S           D Y  S+    +F   +KP
Sbjct  53   YHTNVGVFFLTWSQAFLRRSLHLHFYSCNSVNCYLHSP---DCYRHSVPF--TFRLEVKP  107

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
              F +K GSKK  IS    ++   + WDL+ A+FG GP+P SGFY+AV+V GE  LL+GD
Sbjct  108  LTFWRKHGSKK--ISRKPDIR---IVWDLTHARFGLGPDPESGFYVAVIVSGEVGLLVGD  162

Query  532  CQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
                   K R R     Q LV K+E+++G ++Y+TK  + G
Sbjct  163  ----GNEKERPRR----QVLVSKKENLFGNRVYSTKIKIQG  195



>ref|XP_010429511.1| PREDICTED: uncharacterized protein LOC104713983 isoform X1 [Camelina 
sativa]
Length=353

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 90/161 (56%), Gaps = 18/161 (11%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y T +G+F +TWS+  L RS HLHF   +S           D Y  S+    +F   +KP
Sbjct  53   YHTNVGVFFLTWSQAFLRRSLHLHFYSCNSVNCYLHSP---DCYRHSVPF--TFRLEVKP  107

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
              F +K GSKK  IS    ++   + WDL+ A+FG GP+P SGFY+AV+V GE  LL+GD
Sbjct  108  LTFWRKHGSKK--ISRKPDIR---IVWDLTHARFGLGPDPESGFYVAVIVSGEVGLLVGD  162

Query  532  CQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
                   K R R     Q LV K+E+++G ++Y+TK  + G
Sbjct  163  ----GNEKERPRR----QVLVSKKENLFGNRVYSTKIKIQG  195



>ref|XP_011005698.1| PREDICTED: uncharacterized protein LOC105111908 [Populus euphratica]
 ref|XP_011005699.1| PREDICTED: uncharacterized protein LOC105111908 [Populus euphratica]
 ref|XP_011005700.1| PREDICTED: uncharacterized protein LOC105111908 [Populus euphratica]
Length=299

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 84/151 (56%), Gaps = 24/151 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  + WS++L+G+   L  ++DDS+                          IKP++FSK+
Sbjct  45   LITIIWSKNLMGQG--LSVVIDDSANHCLC------------------KVDIKPWLFSKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  S       +++WDLS AKFGSGPEP  GFY+AV+V  +  LL+GD + EA+
Sbjct  85   KGSKSLEAYSC----KIDIYWDLSSAKFGSGPEPSEGFYVAVVVDSQMALLLGDMRKEAF  140

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKS  642
             KT A    +    V KREHV+G K + TK+
Sbjct  141  KKTGATPIPSNAVFVAKREHVFGKKAFRTKA  171



>gb|ACN25495.1| unknown [Zea mays]
Length=236

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 68/102 (67%), Gaps = 5/102 (5%)
 Frame = +1

Query  343  IKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLL  522
            IKP++FSKK+GS+ L +          +FWDLS A+FG+GPEPV GFY+AV+   E  LL
Sbjct  23   IKPWLFSKKKGSRSLDVEDG----KVEIFWDLSGARFGAGPEPVEGFYVAVVFDLELALL  78

Query  523  IGDCQXEAYAKTRARHAG-NGQALVLKREHVYGGKLYATKSN  645
            +GD + +AY KT A  +  N  A V +REH+YG K+Y+ K+ 
Sbjct  79   LGDMKKDAYRKTGASQSTLNAAAFVARREHIYGKKIYSAKAQ  120



>ref|NP_001167908.1| hypothetical protein [Zea mays]
 gb|ACN25441.1| unknown [Zea mays]
 gb|ACN26475.1| unknown [Zea mays]
 tpg|DAA52032.1| TPA: hypothetical protein ZEAMMB73_540283 [Zea mays]
Length=294

 Score =   101 bits (252),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 86/153 (56%), Gaps = 24/153 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            + ++TWS+ L+G+   L   +DD S                 SG       IKP++FSKK
Sbjct  49   VISLTWSKSLMGQG--LSVGVDDLS-----------------SGHCLCKADIKPWLFSKK  89

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GS+ L +          +FWDLS A+FG+GPEPV GFY+AV+   E  LL+GD + +AY
Sbjct  90   KGSRSLDVEDG----KVEIFWDLSGARFGAGPEPVEGFYVAVVFDLELALLLGDMKKDAY  145

Query  550  AKTRARHAG-NGQALVLKREHVYGGKLYATKSN  645
             KT A  +  N  A V +REH+YG K+Y+ K+ 
Sbjct  146  RKTGASQSTLNAAAFVARREHIYGKKIYSAKAQ  178



>ref|XP_009124203.1| PREDICTED: uncharacterized protein LOC103849150 [Brassica rapa]
Length=286

 Score =   101 bits (251),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 87/158 (55%), Gaps = 29/158 (18%)
 Frame = +1

Query  175  RTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPF  354
            R    L  VTW++ L+G+   +   +DDS               +SL         IKP+
Sbjct  40   RGKTCLITVTWTKSLMGQCVTIG--VDDSCN-------------TSLC-----KVEIKPW  79

Query  355  MFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDC  534
            +F+K++GSK         L N +VFWDLS AKFGS PEP+ GFY+ V+V  E  LL+GD 
Sbjct  80   LFTKRKGSK--------NLSNISVFWDLSSAKFGSSPEPLGGFYVCVVVDKEMTLLLGDM  131

Query  535  QXEAYAKTRARHAGN-GQALVLKREHVYGGKLYATKSN  645
            + EA+ KT A  + + G  ++ KREHV+G + + TK+ 
Sbjct  132  RKEAFKKTNAAPSSSLGAVIMAKREHVFGKRTFETKAQ  169



>emb|CDY30020.1| BnaC01g39880D [Brassica napus]
Length=282

 Score =   101 bits (251),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 86/155 (55%), Gaps = 29/155 (19%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTW++ L+G+   +   +DDS   +                     F IKP++F+K+
Sbjct  45   LITVTWTKTLMGQCVTIG--VDDSCNRSLC------------------KFEIKPWLFTKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +G K L+          +++WDLS AKFGS PEP+ GFY++VLV  E VLL+GD + EA+
Sbjct  85   KGYKNLEA--------CDIYWDLSSAKFGSSPEPLCGFYVSVLVDTEMVLLLGDMKKEAF  136

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
             KT A  + +    + K+EHV+G + +ATK+   G
Sbjct  137  KKTNAASSLSA-VFIAKKEHVFGKRTFATKAQFSG  170



>ref|XP_002319062.1| hypothetical protein POPTR_0013s03440g [Populus trichocarpa]
 gb|EEE94985.1| hypothetical protein POPTR_0013s03440g [Populus trichocarpa]
Length=299

 Score =   101 bits (251),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 84/152 (55%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  +TWS++L+G+   +   +DDS+                          IKP++FSK+
Sbjct  45   LITITWSKNLMGQGLSVG--IDDSANHCLC------------------KVDIKPWLFSKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  S       +++WDLS AKFGSGPEP  GFY+AV+V  +  LL+GD + EA+
Sbjct  85   KGSKSLEAYSC----KIDIYWDLSSAKFGSGPEPSEGFYVAVVVDRQMALLLGDMRKEAF  140

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             KT A    +    V KREHV+G K + TK+ 
Sbjct  141  KKTGATPIPSNTVFVAKREHVFGKKAFRTKAQ  172



>ref|XP_006294490.1| hypothetical protein CARUB_v10023518mg [Capsella rubella]
 gb|EOA27388.1| hypothetical protein CARUB_v10023518mg [Capsella rubella]
Length=353

 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 91/161 (57%), Gaps = 18/161 (11%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y T +G+F +TWS+  L RS H+HF    S  +        D Y +S+    +F   +KP
Sbjct  52   YHTNVGVFFLTWSQAFLRRSLHIHFY---SCHSVNCYLHSPDCYRNSVPF--TFRLEVKP  106

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
              F +K GSKK  IS    ++   V WDL+ A+FGSGP+P SGFY+AV V G+  LL+G 
Sbjct  107  LTFWRKHGSKK--ISRKPDIR---VVWDLTHARFGSGPDPESGFYVAVFVSGQMGLLVG-  160

Query  532  CQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
               E   K R R     Q LV KRE+++G ++Y+TK  + G
Sbjct  161  ---EGDFKERPRR----QILVSKRENLFGNRVYSTKIKIQG  194



>ref|XP_002884475.1| hypothetical protein ARALYDRAFT_477757 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60734.1| hypothetical protein ARALYDRAFT_477757 [Arabidopsis lyrata subsp. 
lyrata]
Length=289

 Score =   100 bits (250),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 56/156 (36%), Positives = 89/156 (57%), Gaps = 25/156 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            +  VTW+++L+G+   +   +DDS   +                       IKP++F+K+
Sbjct  46   MITVTWTKNLMGQCVTVG--VDDSCNRSLC------------------KVEIKPWLFTKR  85

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  +     + +VFWDLS AKFGS PEP+ GFY+ ++V  E VLL+GD + EA+
Sbjct  86   KGSKSLEAYAC----SIDVFWDLSSAKFGSSPEPLGGFYVGIVVDKEMVLLLGDMKKEAF  141

Query  550  AKTRARHAGN-GQALVLKREHVYGGKLYATKSNVGG  654
             KT A  + + G   + K+EHV+G + +ATK+   G
Sbjct  142  KKTNAAPSSSLGALFIAKKEHVFGKRTFATKAQFSG  177



>ref|XP_008452874.1| PREDICTED: uncharacterized protein LOC103493769 [Cucumis melo]
Length=347

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 88/163 (54%), Gaps = 11/163 (7%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y T   LF+++WS+ L   S  LHF    +        +P  F  SS S + SF   I+P
Sbjct  33   YHTNFALFSLSWSQSLFSHSLLLHF--HQNLNPFDSPQNPSSFSSSSSSSSISFRLLIRP  90

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSG-PEPVSGFYIAVLVGGETVLLIG  528
             +  KK GS+KL  S        +VFWDL RA+F S  PEP SGF+IAV+V GE  LL+G
Sbjct  91   LIPWKKHGSEKLSDS-------IHVFWDLRRARFSSSSPEPCSGFFIAVVVDGEMTLLVG  143

Query  529  DCQXEAYAKTRARHAGNG-QALVLKREHVYGGKLYATKSNVGG  654
            D   EA  K RA       Q L+LKREHV   K+Y TK+   G
Sbjct  144  DMIKEASKKIRAAKPPQVLQTLILKREHVTAHKIYTTKAKFAG  186



>emb|CDY21108.1| BnaA01g33390D [Brassica napus]
Length=282

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 86/160 (54%), Gaps = 29/160 (18%)
 Frame = +1

Query  175  RTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPF  354
            R G  L  VTW++ L+G    +   +DDS   +                       IKP+
Sbjct  40   RGGTCLITVTWTKTLMGLCVTIG--VDDSCNRSLC------------------KLEIKPW  79

Query  355  MFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDC  534
            +F+K++G K L+          +V+WDLS AKFGS PEP+ GFY++VLV  E VLL+GD 
Sbjct  80   LFTKRKGYKNLEA--------CDVYWDLSSAKFGSSPEPLGGFYVSVLVDKEMVLLLGDM  131

Query  535  QXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
            + EA  KT+A  +  G   + K+EHV+G + +ATK+   G
Sbjct  132  KKEALKKTKA-ASSLGAVFIAKKEHVFGKRTFATKAQFSG  170



>ref|XP_009117076.1| PREDICTED: uncharacterized protein LOC103842203 [Brassica rapa]
Length=350

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 90/161 (56%), Gaps = 19/161 (12%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y T +G+F ++WS+  L RS HLHF      ++A       D Y  S S   +F   IKP
Sbjct  56   YHTNVGVFFLSWSQSFLRRSLHLHFY---HCSSANCYLHSPDCY--SHSVPFTFRLEIKP  110

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
              F +K GSKK  IS    ++   V WDL+ A+FGSGP+PVSGFY+AVLV G+  LL+GD
Sbjct  111  LTFWRKHGSKK--ISRKPDIR---VTWDLTHARFGSGPDPVSGFYVAVLVSGKVGLLVGD  165

Query  532  CQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
                       +H    Q LV + E+++G ++Y TK  + G
Sbjct  166  S---------LKHRPKRQILVSRGENLFGNRVYHTKIKIKG  197



>gb|KDP21447.1| hypothetical protein JCGZ_21918 [Jatropha curcas]
Length=299

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 82/157 (52%), Gaps = 24/157 (15%)
 Frame = +1

Query  175  RTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPF  354
            R    L  VTW+++L+G+   L   +DDS+                          IKP+
Sbjct  40   RGRFCLITVTWTKNLMGQG--LSVAIDDSANHCLC------------------KVDIKPW  79

Query  355  MFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDC  534
            +FSK++G K L++ S       +++WDLS AKFGSGPEP+ GFY+A+    + VLL+GD 
Sbjct  80   LFSKRKGCKNLEVDSC----KIDIYWDLSNAKFGSGPEPLEGFYLAIAFNQDMVLLLGDM  135

Query  535  QXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
            + EAY K       +    + KREH++G K Y  K+ 
Sbjct  136  KKEAYKKIDNASIHSAAIFIAKREHIFGKKFYGAKAQ  172



>gb|ACN33725.1| unknown [Zea mays]
Length=157

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 66/105 (63%), Gaps = 4/105 (4%)
 Frame = +1

Query  304  FSSLSGAPSFHFRIKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGF  483
               LSG       IKP++FSKK+GSK L +         ++FWDLS AKFG+GPEPV GF
Sbjct  9    VDDLSGHCLCKADIKPWLFSKKKGSKSLDVEDG----KIDIFWDLSGAKFGAGPEPVEGF  64

Query  484  YIAVLVGGETVLLIGDCQXEAYAKTRARHAGNGQALVLKREHVYG  618
            Y+AV+   E VLL+GD + +AY KT A  +    A V +REH+YG
Sbjct  65   YVAVVFDLELVLLLGDMKKDAYRKTGANRSMLNAAFVARREHIYG  109



>gb|KHN03804.1| hypothetical protein glysoja_011033 [Glycine soja]
Length=300

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/155 (37%), Positives = 83/155 (54%), Gaps = 27/155 (17%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  V+W++ L+G+   +   +DD                  L         IKP++FSK+
Sbjct  45   LITVSWTKTLIGQGLSVE--IDD------------------LGKHCLCKVEIKPWLFSKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L++ S       ++FWDLS AKFGSGPEP+ GFY+AV+   E VLL+GD + EA 
Sbjct  85   KGSKNLEVQSG----KVDIFWDLSSAKFGSGPEPMEGFYLAVVFNKEMVLLLGDLKKEAC  140

Query  550  AKTRARHAG---NGQALVLKREHVYGGKLYATKSN  645
             K  +  A    +G   + KREH++G K Y  K+ 
Sbjct  141  KKIESDCACFSHSGAIFIAKREHIFGKKFYGAKAQ  175



>emb|CDO99050.1| unnamed protein product [Coffea canephora]
Length=304

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 88/152 (58%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L ++ WS++L+G    +   +DD                  LS        +KP +FSK+
Sbjct  48   LISIIWSKNLMGHCLSVE--IDD------------------LSHHCLGKVDVKPSLFSKR  87

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+++S+      +++WDLS A+FGSGPEP+ G+Y+A++  GE VL+IGD + EA+
Sbjct  88   KGSKCLEVNST----KLDLYWDLSLARFGSGPEPLEGYYLALMCKGEMVLVIGDLRKEAF  143

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             KT A  A +    V KREH++G ++  TK+ 
Sbjct  144  KKTNAAPALSSPLFVSKREHLFGKRICGTKAQ  175



>ref|XP_002307590.1| hypothetical protein POPTR_0005s23240g [Populus trichocarpa]
 gb|EEE94586.1| hypothetical protein POPTR_0005s23240g [Populus trichocarpa]
Length=300

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 82/152 (54%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTW+++L+G+   +   +DDS                  +        IKP++FSK+
Sbjct  45   LITVTWTKNLMGQGVGVA--IDDS------------------TSQCLCKVDIKPWLFSKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +G K L+++S   +    ++WDLS AKFGSGPEP+ GFY+A+    E VLL+GD   EAY
Sbjct  85   KGYKNLEVASDKVI----IYWDLSNAKFGSGPEPLEGFYLAITFNQEMVLLLGDMAKEAY  140

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             K  +         + +REH++G K YA K+ 
Sbjct  141  KKIESAPVHTNAIFIARREHIFGKKFYAAKAQ  172



>ref|XP_007050577.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX94734.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=310

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 82/153 (54%), Gaps = 25/153 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTW++ L+G+   L   +DDS                  +        IKP++FSK+
Sbjct  55   LITVTWTKSLMGQG--LSVAIDDS------------------ANQCLCKVDIKPWLFSKR  94

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L++ S       ++ WDLS A+FGSGPEPV GFY+AV    E +LL+GD + EAY
Sbjct  95   KGSKNLEVDSG----KIDICWDLSNARFGSGPEPVEGFYLAVAFDQEMMLLLGDLKKEAY  150

Query  550  AKTRARHAGNGQAL-VLKREHVYGGKLYATKSN  645
             K       N  A+ + KREH++G K Y  K+ 
Sbjct  151  KKIDTSAPVNSDAIFIAKREHIFGKKFYGAKAQ  183



>ref|XP_010463974.1| PREDICTED: uncharacterized protein LOC104744596 [Camelina sativa]
Length=293

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 87/155 (56%), Gaps = 27/155 (17%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  ++W+++L+G+   +   +DDS   +                       IKP++F+K+
Sbjct  48   LITISWTKNLMGQCLTVG--VDDSCNRSLC------------------KVEIKPWLFTKR  87

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  S     N +VFWDLS AKFGS PEP+ GFY+ V+V  E  LL+GD + EA+
Sbjct  88   KGSKNLEAYSC----NIDVFWDLSSAKFGSSPEPLGGFYVGVVVDKEMALLLGDMRKEAF  143

Query  550  AKTRARHAGN---GQALVLKREHVYGGKLYATKSN  645
             KT A  + +   G   + K+EHV+G + +ATK+ 
Sbjct  144  KKTNAAPSSSSSLGAVFIAKKEHVFGKRTFATKAQ  178



>ref|XP_006298244.1| hypothetical protein CARUB_v10014305mg [Capsella rubella]
 gb|EOA31142.1| hypothetical protein CARUB_v10014305mg [Capsella rubella]
Length=289

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 87/154 (56%), Gaps = 26/154 (17%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  V+W+++L+G+   +   +DDS   +                       IKP++F+K+
Sbjct  45   LITVSWTKNLMGQCVTVG--VDDSCNRSLC------------------KVEIKPWLFTKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  S     N +VFWDLS AKFGS PEP+ GFY+ V+V  E  LL+GD + EA+
Sbjct  85   KGSKNLEAYSC----NIDVFWDLSSAKFGSSPEPLGGFYVGVVVDKEMALLLGDMRKEAF  140

Query  550  AKTRARHAGN--GQALVLKREHVYGGKLYATKSN  645
             KT A  + +  G   + K+EHV+G + +ATK+ 
Sbjct  141  KKTSAAPSSSSLGAVFIAKKEHVFGKRSFATKAQ  174



>ref|XP_003632331.1| PREDICTED: uncharacterized protein LOC100853449 [Vitis vinifera]
Length=300

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/157 (36%), Positives = 85/157 (54%), Gaps = 24/157 (15%)
 Frame = +1

Query  175  RTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPF  354
            R    L  +TW+++L+G+   +   +DDS                  S        IKP+
Sbjct  40   RGKWCLITITWTKNLMGQGLSVG--IDDS------------------SNQCLCKVDIKPW  79

Query  355  MFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDC  534
            +FSK++G K L++ SS      +++WDLS AKFGSGPEP+ GFY+AV+   E  LL+GD 
Sbjct  80   LFSKRKGCKNLEVDSS----KIDMYWDLSAAKFGSGPEPLEGFYLAVVFNQELALLLGDL  135

Query  535  QXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
            + EA  K  +    +   L+ KREH++G +LY  K+ 
Sbjct  136  KKEACKKINSPPVPSTAVLIAKREHLFGKRLYFAKAQ  172



>ref|XP_010041438.1| PREDICTED: uncharacterized protein LOC104430401 [Eucalyptus grandis]
 ref|XP_010041445.1| PREDICTED: uncharacterized protein LOC104430401 [Eucalyptus grandis]
 gb|KCW84880.1| hypothetical protein EUGRSUZ_B01700 [Eucalyptus grandis]
 gb|KCW84881.1| hypothetical protein EUGRSUZ_B01700 [Eucalyptus grandis]
Length=299

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 84/151 (56%), Gaps = 24/151 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  +TWS+ ++G+   +   +DDS                  S        IKP++FSK+
Sbjct  45   LITITWSKHMMGQGLSVG--IDDS------------------SNQCLCKVDIKPWLFSKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  S       +++WDLS AKFGSGPEP+ GFY+ V+V  + +LL+GD + EA 
Sbjct  85   KGSKSLEAYSC----KIDIYWDLSSAKFGSGPEPLEGFYVGVVVDRQMILLLGDLRKEAL  140

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKS  642
             KT A    +    + KREHV+G K++ TK+
Sbjct  141  KKTNAVPVPSNAYFLAKREHVFGKKMFVTKA  171



>gb|EMS52757.1| hypothetical protein TRIUR3_04572 [Triticum urartu]
Length=235

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 71/111 (64%), Gaps = 4/111 (4%)
 Frame = +1

Query  313  LSGAPSFHFRIKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIA  492
            LSG       IKP++FSKK+GSK L +   GG    ++FWDLS A+FG+GPEP+  FY+A
Sbjct  12   LSGQSLCKADIKPWLFSKKKGSKSLDVD--GG--KVDIFWDLSAARFGAGPEPLESFYVA  67

Query  493  VLVGGETVLLIGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
            ++   E  LL+GD + +AY KT A       A V ++EH+YG K+Y+ K+ 
Sbjct  68   LVSDLELALLLGDMKKDAYRKTGANRPALNAAFVARKEHIYGKKIYSAKAQ  118



>emb|CDX76763.1| BnaC08g33490D [Brassica napus]
Length=349

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 90/161 (56%), Gaps = 19/161 (12%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y T +G+F ++WS+  L RS HLHF      ++A       D Y  S S   +F   IKP
Sbjct  55   YHTNVGVFFLSWSQSFLRRSLHLHFY---HCSSANCYLHSPDCY--SRSAPFTFRLEIKP  109

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
              F +K GSKK  IS    ++   V WDL+ A+FGSGP+PVSGFY+AVLV G+  LL+GD
Sbjct  110  LTFWRKHGSKK--ISRKPDIR---VTWDLTHARFGSGPDPVSGFYVAVLVSGKVGLLVGD  164

Query  532  CQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
               +   +         Q LV + E+++G ++Y TK  + G
Sbjct  165  SLKQRPER---------QILVSRGENLFGNRVYHTKIKIKG  196



>ref|XP_011458574.1| PREDICTED: uncharacterized protein LOC101299437 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=292

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/156 (36%), Positives = 85/156 (54%), Gaps = 25/156 (16%)
 Frame = +1

Query  175  RTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPF  354
            R  L L  VTW+++L+G+   +   +DD++          +F    +         IKP+
Sbjct  21   RGRLCLITVTWTKNLMGQGLSVE--IDDAA----------NFCLCKVD--------IKPW  60

Query  355  MFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDC  534
            +FSK++G + L++ SS      ++FWDL+ AKFGSGPEP+  FY+AV+   E VL +GD 
Sbjct  61   LFSKRKGCRNLEVDSS----KIDIFWDLTNAKFGSGPEPLEKFYLAVMFNQEMVLHLGDL  116

Query  535  QXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKS  642
            + E        H  N    V KREH++G KLY  K+
Sbjct  117  KREVLGVKDPIHGSNA-VFVAKREHIFGKKLYGAKA  151



>ref|XP_004247361.1| PREDICTED: uncharacterized protein LOC101254730 [Solanum lycopersicum]
Length=303

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 86/152 (57%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  V W++ L+G+   +   +DD                  +S        +KP +FSK+
Sbjct  48   LITVVWTKSLMGQCLSVE--IDD------------------MSHQCLCKVDVKPSLFSKR  87

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GS+ L++++       +++WD S AKFGSGPEPV G+Y+AV+  G+ VL IGD + EA+
Sbjct  88   KGSRFLEVNAC----KIDIYWDFSLAKFGSGPEPVEGYYLAVVCKGQMVLCIGDLRKEAF  143

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             K+ A  + +    + KREH++G ++++TK+ 
Sbjct  144  KKSNATPSLSNAMFISKREHIFGKRVFSTKAQ  175



>ref|XP_004290606.1| PREDICTED: uncharacterized protein LOC101299437 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=315

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/156 (36%), Positives = 85/156 (54%), Gaps = 25/156 (16%)
 Frame = +1

Query  175  RTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPF  354
            R  L L  VTW+++L+G+   +   +DD++          +F    +         IKP+
Sbjct  44   RGRLCLITVTWTKNLMGQGLSVE--IDDAA----------NFCLCKVD--------IKPW  83

Query  355  MFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDC  534
            +FSK++G + L++ SS      ++FWDL+ AKFGSGPEP+  FY+AV+   E VL +GD 
Sbjct  84   LFSKRKGCRNLEVDSS----KIDIFWDLTNAKFGSGPEPLEKFYLAVMFNQEMVLHLGDL  139

Query  535  QXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKS  642
            + E        H  N    V KREH++G KLY  K+
Sbjct  140  KREVLGVKDPIHGSNA-VFVAKREHIFGKKLYGAKA  174



>emb|CAN61445.1| hypothetical protein VITISV_024138 [Vitis vinifera]
Length=416

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/157 (36%), Positives = 85/157 (54%), Gaps = 24/157 (15%)
 Frame = +1

Query  175  RTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPF  354
            R    L  +TW+++L+G+   +   +DDS                  S        IKP+
Sbjct  40   RGKWCLITITWTKNLMGQGLSVG--IDDS------------------SNQCLCKVDIKPW  79

Query  355  MFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDC  534
            +FSK++G K L++ SS      +++WDLS AKFGSGPEP+ GFY+AV+   E  LL+GD 
Sbjct  80   LFSKRKGCKNLEVDSS----KIDMYWDLSAAKFGSGPEPLEGFYLAVVFNQELALLLGDL  135

Query  535  QXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
            + EA  K  +    +   L+ KREH++G +LY  K+ 
Sbjct  136  KKEACKKINSPPVPSTAVLIAKREHLFGKRLYFAKAQ  172



>ref|XP_002277386.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659902.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659903.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659904.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659905.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659906.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659907.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659908.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659909.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659910.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659911.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659912.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659913.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
Length=305

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 85/151 (56%), Gaps = 24/151 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  V WS++L+G+   +   +DDS                  +        IKP++FSK+
Sbjct  45   LITVVWSKNLMGQGLSVG--IDDS------------------ANQSLCKVDIKPWLFSKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+ +SS      +++WD S AKFGSGPEP+ GFY+ V+   + VLL+GD + EA+
Sbjct  85   KGSKSLEANSS----KIDIYWDFSSAKFGSGPEPLEGFYVGVVFDRQMVLLLGDLRKEAF  140

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKS  642
             KT A    +    + KRE+++G K++ TK+
Sbjct  141  KKTNATPVPSNAVFIAKRENIFGKKVFRTKA  171



>emb|CAN64151.1| hypothetical protein VITISV_041021 [Vitis vinifera]
Length=305

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 85/151 (56%), Gaps = 24/151 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  V WS++L+G+   +   +DDS                  +        IKP++FSK+
Sbjct  45   LITVVWSKNLMGQGLSVG--IDDS------------------ANQSLCKVDIKPWLFSKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+ +SS      +++WD S AKFGSGPEP+ GFY+ V+   + VLL+GD + EA+
Sbjct  85   KGSKSLEANSS----KIDIYWDFSSAKFGSGPEPLEGFYVGVVFDRQMVLLLGDLRKEAF  140

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKS  642
             KT A    +    + KRE+++G K++ TK+
Sbjct  141  KKTNATPVPSNAVFIAKRENIFGKKVFRTKA  171



>ref|XP_007050578.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 ref|XP_007050579.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOX94735.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOX94736.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=246

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 66/102 (65%), Gaps = 5/102 (5%)
 Frame = +1

Query  343  IKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLL  522
            IKP++FSK++GSK L++ S       ++ WDLS A+FGSGPEPV GFY+AV    E +LL
Sbjct  22   IKPWLFSKRKGSKNLEVDSG----KIDICWDLSNARFGSGPEPVEGFYLAVAFDQEMMLL  77

Query  523  IGDCQXEAYAKTRARHAGNGQAL-VLKREHVYGGKLYATKSN  645
            +GD + EAY K       N  A+ + KREH++G K Y  K+ 
Sbjct  78   LGDLKKEAYKKIDTSAPVNSDAIFIAKREHIFGKKFYGAKAQ  119



>ref|XP_011092005.1| PREDICTED: uncharacterized protein LOC105172319 [Sesamum indicum]
Length=290

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 70/101 (69%), Gaps = 4/101 (4%)
 Frame = +1

Query  343  IKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLL  522
            IKP++FSKK+GSK L+  SS      +++WDLS AKFGSGPEP+ GFY+ ++   + +LL
Sbjct  76   IKPWLFSKKKGSKSLEADSS----KIDIYWDLSLAKFGSGPEPLEGFYVGIVFQKQMILL  131

Query  523  IGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
            +GD + EA+ K  +  A +G   + KREH++G  +++TK+ 
Sbjct  132  LGDMRKEAFKKAGSVLAQSGAVFISKREHIFGKNIFSTKAQ  172



>emb|CBI34200.3| unnamed protein product [Vitis vinifera]
Length=249

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 69/100 (69%), Gaps = 4/100 (4%)
 Frame = +1

Query  343  IKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLL  522
            IKP++FSK++GSK L+ +SS      +++WD S AKFGSGPEP+ GFY+ V+   + VLL
Sbjct  40   IKPWLFSKRKGSKSLEANSS----KIDIYWDFSSAKFGSGPEPLEGFYVGVVFDRQMVLL  95

Query  523  IGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKS  642
            +GD + EA+ KT A    +    + KRE+++G K++ TK+
Sbjct  96   LGDLRKEAFKKTNATPVPSNAVFIAKRENIFGKKVFRTKA  135



>ref|XP_010485871.1| PREDICTED: uncharacterized protein LOC104764117 [Camelina sativa]
Length=293

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 86/154 (56%), Gaps = 27/154 (18%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  V+W+++L+G+   +   +DDS   +                       IKP++F+K 
Sbjct  48   LITVSWTKNLMGQCLTVG--VDDSCNRSLC------------------KVEIKPWLFTKW  87

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  S     N +VFWDLS AKFGS PEP+ GFY+ V+V  E  LL+GD + EA+
Sbjct  88   KGSKNLEAYSC----NIDVFWDLSSAKFGSSPEPLGGFYVGVVVDKEMALLLGDMRKEAF  143

Query  550  AKTRARHAGN---GQALVLKREHVYGGKLYATKS  642
             KT A  + +   G   + K+EHV+G + +ATK+
Sbjct  144  KKTNAAPSSSSSLGAVFIAKKEHVFGKRTFATKA  177



>ref|XP_008218232.1| PREDICTED: uncharacterized protein LOC103318613 [Prunus mume]
 ref|XP_008218233.1| PREDICTED: uncharacterized protein LOC103318613 [Prunus mume]
 ref|XP_008218234.1| PREDICTED: uncharacterized protein LOC103318613 [Prunus mume]
 ref|XP_008218235.1| PREDICTED: uncharacterized protein LOC103318613 [Prunus mume]
Length=299

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/152 (38%), Positives = 85/152 (56%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTWS++L+G+   +   +DDS                  S        IKP++FSK+
Sbjct  45   LITVTWSKNLMGQGLSVG--IDDS------------------SNQCLCKVDIKPWLFSKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +G K L+  SS      +++WDLS AKFGSGPEP+ G+Y+ V+V  + +LL+GD + EA+
Sbjct  85   RGFKSLEAYSS----KIDIYWDLSSAKFGSGPEPLGGYYVGVVVDRQMLLLLGDMRKEAF  140

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             KT A    +    V KREHV+G + + TK+ 
Sbjct  141  KKTSASPVPSNAVCVAKREHVFGKRGFTTKAQ  172



>ref|XP_007207341.1| hypothetical protein PRUPE_ppa009272mg [Prunus persica]
 gb|EMJ08540.1| hypothetical protein PRUPE_ppa009272mg [Prunus persica]
Length=299

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/152 (38%), Positives = 85/152 (56%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTWS++L+G+   +   +DDS                  S        IKP++FSK+
Sbjct  45   LITVTWSKNLMGQGLSVG--IDDS------------------SNQCLCKVDIKPWLFSKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +G K L+  SS      +++WDLS AKFGSGPEP+ G+Y+ V+V  + +LL+GD + EA+
Sbjct  85   RGFKSLEAYSS----KIDIYWDLSSAKFGSGPEPLGGYYVGVVVDRQMLLLLGDMRKEAF  140

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             KT A    +    V KREHV+G + + TK+ 
Sbjct  141  KKTSASPVPSNAVCVAKREHVFGKRGFTTKAQ  172



>ref|XP_006405118.1| hypothetical protein EUTSA_v10000227mg [Eutrema salsugineum]
 gb|ESQ46571.1| hypothetical protein EUTSA_v10000227mg [Eutrema salsugineum]
Length=343

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 62/161 (39%), Positives = 89/161 (55%), Gaps = 18/161 (11%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y T +G+F ++WS+  L RS HLH+      +A        D Y  S+    +F   IKP
Sbjct  53   YHTNIGVFFLSWSQSFLRRSLHLHYY--SCHSANCYLHHSPDCYRHSVPF--TFRLEIKP  108

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
              F +K GSKK  IS    ++   V WDL++A+FGSGP+P SGFY+AV+V  E  LL+GD
Sbjct  109  LTFWRKHGSKK--ISRKPDIR---VVWDLTKARFGSGPDPESGFYVAVVVSNEVGLLVGD  163

Query  532  CQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
                   K R +     Q LV +RE+++G ++Y T   + G
Sbjct  164  S-----LKQRPKR----QILVSRRENLFGNRVYCTNIKIKG  195



>ref|XP_007144641.1| hypothetical protein PHAVU_007G172700g [Phaseolus vulgaris]
 gb|ESW16635.1| hypothetical protein PHAVU_007G172700g [Phaseolus vulgaris]
Length=300

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 69/104 (66%), Gaps = 6/104 (6%)
 Frame = +1

Query  340  RIKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVL  519
             IKP++FSK++GSK L++ S       ++FWDLS AKFGSGPEP+ GFY+AV++  E VL
Sbjct  75   EIKPWLFSKRKGSKNLEVQSG----KIDIFWDLSCAKFGSGPEPLEGFYLAVVLNKELVL  130

Query  520  LIGDCQXEAYAKTRARHAGN--GQALVLKREHVYGGKLYATKSN  645
            L+GD + EA  K  +  A +  G   + KREH++G K Y  K+ 
Sbjct  131  LLGDLKKEACKKIDSDCAFSHCGTVFIAKREHIFGKKFYGAKAQ  174



>ref|XP_009124977.1| PREDICTED: uncharacterized protein LOC103850026 [Brassica rapa]
Length=282

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 84/160 (53%), Gaps = 29/160 (18%)
 Frame = +1

Query  175  RTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPF  354
            R G  L  VTW++ L+G    +   +DDS   +                       IKP+
Sbjct  40   RGGTCLITVTWTKTLMGLCVTIG--VDDSCNRSLC------------------KLEIKPW  79

Query  355  MFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDC  534
            +F+K++G K L+          +V+WDLS AKFGS PEP+ GFY+ VLV  E VLL+GD 
Sbjct  80   LFTKRKGYKNLEA--------CDVYWDLSSAKFGSSPEPLGGFYVGVLVDKEMVLLLGDM  131

Query  535  QXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
            + EA+ KT    +  G   + K+EHV+G + +ATK+   G
Sbjct  132  KKEAFKKTNT-ASSLGAVFIAKKEHVFGKRTFATKARFSG  170



>ref|XP_009792059.1| PREDICTED: uncharacterized protein LOC104239187 [Nicotiana sylvestris]
Length=302

 Score = 98.2 bits (243),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 85/152 (56%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  + W++ L+G+   +   +DD                  +S        +KP +FSK+
Sbjct  48   LITIVWTKGLMGQCLSVE--IDD------------------MSHQCLCKVDVKPSLFSKR  87

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GS+ L+++S       ++ WD S AKFGSGPEP+ G+Y+A++  G+ VL+IGD + EA+
Sbjct  88   KGSRSLEVNSC----KIDLHWDFSLAKFGSGPEPIEGYYLAIVCKGQMVLVIGDLRKEAF  143

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             KT A  + +    + KREH++G +++ TK+ 
Sbjct  144  KKTNATPSFSNAMFISKREHIFGKRVFGTKAQ  175



>ref|XP_007144817.1| hypothetical protein PHAVU_007G186400g [Phaseolus vulgaris]
 gb|AGV54810.1| hypothetical protein [Phaseolus vulgaris]
 gb|ESW16811.1| hypothetical protein PHAVU_007G186400g [Phaseolus vulgaris]
Length=299

 Score = 98.2 bits (243),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 56/156 (36%), Positives = 85/156 (54%), Gaps = 24/156 (15%)
 Frame = +1

Query  175  RTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPF  354
            R    L  +TWS+ L+G+   +   +DDS                  S        IKP+
Sbjct  40   RGKCCLITITWSKSLMGQGLSVG--IDDS------------------SNQCLCKVDIKPW  79

Query  355  MFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDC  534
            +FSK++GSK L+  S       +V+WDLS A+FG GPEP+ GFY+ V+V  + VLL+GD 
Sbjct  80   VFSKRRGSKSLEAYSC----KIDVYWDLSSARFGVGPEPLEGFYVGVVVDRQMVLLLGDL  135

Query  535  QXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKS  642
            + EA+ K+ A    +   +V K+EHV+G K++  K+
Sbjct  136  RKEAFKKSSAIPLPSNAVIVAKKEHVFGKKMFGNKA  171



>ref|XP_008455804.1| PREDICTED: uncharacterized protein LOC103495897 [Cucumis melo]
Length=299

 Score = 98.2 bits (243),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 87/152 (57%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L +VTWS++L+G+   +   +DDS                  S        IKP++FSK+
Sbjct  45   LISVTWSKNLMGQGLSVG--IDDS------------------SNQCLCKVDIKPWLFSKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  +       +++WDLS AKFGSGPEP+ G+Y+ ++V  + VLL+GD + EA+
Sbjct  85   RGSKSLEAYAC----KIDIYWDLSSAKFGSGPEPLEGYYVGIVVDKQMVLLLGDLRKEAF  140

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             K+ +    +    + K+EH++G K++ +K+ 
Sbjct  141  KKSNSSPVPSSAVFISKKEHIFGKKVFCSKAQ  172



>ref|XP_004139223.1| PREDICTED: uncharacterized protein LOC101220430 [Cucumis sativus]
 ref|XP_004156452.1| PREDICTED: uncharacterized LOC101220430 [Cucumis sativus]
Length=299

 Score = 98.2 bits (243),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 87/152 (57%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L +VTWS++L+G+   +   +DDS                  S        IKP++FSK+
Sbjct  45   LISVTWSKNLMGQGLSVG--IDDS------------------SNQCLCKVDIKPWLFSKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  +       +++WDLS AKFGSGPEP+ G+Y+ ++V  + VLL+GD + EA+
Sbjct  85   RGSKSLEAYAC----KIDIYWDLSSAKFGSGPEPLEGYYVGIVVDKQMVLLLGDLRREAF  140

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             K+ +    +    + K+EH++G K++ +K+ 
Sbjct  141  KKSNSSPVPSSAVFISKKEHIFGKKVFCSKAQ  172



>emb|CDY72112.1| BnaC05g52260D [Brassica napus]
Length=282

 Score = 97.8 bits (242),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 56/152 (37%), Positives = 82/152 (54%), Gaps = 32/152 (21%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTW++ L+G+   +   +DDS                           IKP++F+K+
Sbjct  45   LITVTWTKSLMGQCVTVG--VDDSRLC---------------------KVEIKPWLFTKR  81

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L         N +V WDLS AKFGSGPEP+ GFY+ V+   E  LL+GD + EA+
Sbjct  82   KGSKNLC--------NISVLWDLSSAKFGSGPEPLGGFYVCVVADKEMTLLLGDMRREAF  133

Query  550  AKTRARHAGN-GQALVLKREHVYGGKLYATKS  642
             KT A  + + G  ++ KREHV+G + + TK+
Sbjct  134  KKTNAAPSSSLGAVIIAKREHVFGKRTFETKA  165



>ref|XP_006360806.1| PREDICTED: uncharacterized protein LOC102583145 [Solanum tuberosum]
Length=303

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 84/152 (55%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  V W++ L+G+   +   +DD                  +S        +KP +FSK+
Sbjct  48   LITVVWTKSLMGQCLSVE--IDD------------------MSHQCLCKVDVKPSLFSKR  87

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GS+ L++++       ++ WD S AKFGSGPEPV G+Y+AV+  G+ VL IGD + EA+
Sbjct  88   KGSRSLEVNAC----KIDIHWDFSLAKFGSGPEPVEGYYLAVVCKGQMVLAIGDLRKEAF  143

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             K+ A  + +    + KREH++G +++ TK+ 
Sbjct  144  KKSNATPSLSNAIFISKREHIFGKRVFGTKAQ  175



>ref|XP_003518919.1| PREDICTED: uncharacterized protein LOC100793503 [Glycine max]
 gb|KHN18875.1| hypothetical protein glysoja_028244 [Glycine soja]
Length=301

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 67/104 (64%), Gaps = 6/104 (6%)
 Frame = +1

Query  340  RIKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVL  519
             IKP++FSK++GSK L++ S       ++FWDLS AKFGSGPEP+ GFY+AV+   E VL
Sbjct  75   EIKPWLFSKRKGSKNLEVQSG----KVDIFWDLSCAKFGSGPEPLEGFYLAVVFNKEMVL  130

Query  520  LIGDCQXEAYAKTRARHAGN--GQALVLKREHVYGGKLYATKSN  645
            L+GD + EA  K  +  A +  G   + KREH+ G K Y  K+ 
Sbjct  131  LLGDLKKEACKKIESDCAFSHCGAVCIAKREHIIGKKFYGAKAQ  174



>ref|XP_002300838.1| hypothetical protein POPTR_0002s05250g [Populus trichocarpa]
 gb|EEE80111.1| hypothetical protein POPTR_0002s05250g [Populus trichocarpa]
Length=299

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 82/152 (54%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTW+++L+G+   +   +DDS                  +        IKP++FSK+
Sbjct  45   LITVTWTKNLMGQGVGVA--IDDS------------------NSQCLCKVDIKPWLFSKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +G K L++ S   + N    WDLS AKFGSGPEP+ GFY+A+    E VLL+GD + EAY
Sbjct  85   KGYKNLEVDSDKVIIN----WDLSNAKFGSGPEPLEGFYLAITFNLEMVLLLGDMKKEAY  140

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             K  +    +    + +REH++G K Y+ K+ 
Sbjct  141  KKIESSPVHSKAIFIARREHIFGKKFYSAKAQ  172



>emb|CBI28703.3| unnamed protein product [Vitis vinifera]
Length=273

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 67/101 (66%), Gaps = 4/101 (4%)
 Frame = +1

Query  343  IKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLL  522
            IKP++FSK++G K L++ SS      +++WDLS AKFGSGPEP+ GFY+AV+   E  LL
Sbjct  49   IKPWLFSKRKGCKNLEVDSS----KIDMYWDLSAAKFGSGPEPLEGFYLAVVFNQELALL  104

Query  523  IGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
            +GD + EA  K  +    +   L+ KREH++G +LY  K+ 
Sbjct  105  LGDLKKEACKKINSPPVPSTAVLIAKREHLFGKRLYFAKAQ  145



>ref|XP_002520723.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41685.1| conserved hypothetical protein [Ricinus communis]
Length=299

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 80/155 (52%), Gaps = 24/155 (15%)
 Frame = +1

Query  175  RTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPF  354
            R    L  VTW+++L+G+   +   +DDS                  +        IKP+
Sbjct  40   RGRFCLITVTWTKNLMGQGVSVA--IDDS------------------TNQCLCKVDIKPW  79

Query  355  MFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDC  534
            +FSK++G K L++ S+      ++ WDLS AKFGSGPEP  GFY+AV    E VLL+GD 
Sbjct  80   LFSKRKGCKNLEVDST----KIDIHWDLSNAKFGSGPEPFEGFYLAVAFNQEMVLLLGDL  135

Query  535  QXEAYAKTRARHAGNGQALVLKREHVYGGKLYATK  639
            + EAY K       +    + K+EH++G K Y  K
Sbjct  136  KKEAYKKIEDAPLHSNAIFIAKKEHIFGKKFYGAK  170



>ref|XP_011090719.1| PREDICTED: uncharacterized protein LOC105171343 isoform X2 [Sesamum 
indicum]
Length=296

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/152 (37%), Positives = 84/152 (55%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L ++ WS++L+G+   +   +DD+                  S        +K  +FSK+
Sbjct  47   LISIVWSKNLMGQCLSVE--IDDA------------------SHQCICKVDVKSSLFSKR  86

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GS+ L ++SS       VFWDLS AKFGSGPEP+ G+Y+AV+  GE  LL+GD + EA 
Sbjct  87   KGSRPLLVNSS----KIEVFWDLSVAKFGSGPEPLGGYYVAVVFKGEMFLLVGDLRKEAL  142

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             KT A  +     L+ KREH+ G ++Y TK+ 
Sbjct  143  KKTGAVASICSAVLISKREHISGKRVYGTKAQ  174



>gb|KGN60826.1| hypothetical protein Csa_2G011590 [Cucumis sativus]
Length=335

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 87/152 (57%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L +VTWS++L+G+   +   +DDS                  S        IKP++FSK+
Sbjct  81   LISVTWSKNLMGQGLSVG--IDDS------------------SNQCLCKVDIKPWLFSKR  120

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+  +       +++WDLS AKFGSGPEP+ G+Y+ ++V  + VLL+GD + EA+
Sbjct  121  RGSKSLEAYAC----KIDIYWDLSSAKFGSGPEPLEGYYVGIVVDKQMVLLLGDLRREAF  176

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             K+ +    +    + K+EH++G K++ +K+ 
Sbjct  177  KKSNSSPVPSSAVFISKKEHIFGKKVFCSKAQ  208



>gb|KJB22971.1| hypothetical protein B456_004G079100 [Gossypium raimondii]
Length=307

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 81/153 (53%), Gaps = 25/153 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTW+++L+G+   L  ++DD                  L+        IKP++FSK+
Sbjct  52   LITVTWTKNLMGQG--LSVVIDD------------------LANNCLCKVDIKPWLFSKR  91

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L++ S       ++ WDLS A+FG GPEPV G+Y+AV    E VLL+GD + EA 
Sbjct  92   KGSKNLEVDSG----KIDICWDLSNARFGVGPEPVEGYYLAVAFEQEMVLLLGDLKKEAI  147

Query  550  AKT-RARHAGNGQALVLKREHVYGGKLYATKSN  645
             K   + H  +    + KREH+ G K Y  K+ 
Sbjct  148  KKIDTSAHLNSNAVFIAKREHIVGKKFYGAKAQ  180



>ref|XP_010550936.1| PREDICTED: uncharacterized protein LOC104821683 [Tarenaya hassleriana]
Length=290

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 86/164 (52%), Gaps = 28/164 (17%)
 Frame = +1

Query  175  RTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPF  354
            R    L  VTW+++L+G+   +   +DDS                           IKP+
Sbjct  40   RGSTCLITVTWTKNLMGQGLTVG--VDDSCNQTLC------------------KVEIKPW  79

Query  355  MFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDC  534
            +F+K++GSK L+  S    +  +VFWDLS AKFGSG EP+ GFY+ V V  ETVLL+GD 
Sbjct  80   LFTKRKGSKSLEAYS----RKVDVFWDLSAAKFGSGSEPLGGFYVGVAVDKETVLLLGDM  135

Query  535  QXEAYAKTR----ARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
              EA  K +       +    +L+ K+EHV+G + +ATK+   G
Sbjct  136  NKEASKKMKMNPTVTPSSPNASLIAKKEHVFGKRAFATKAPFSG  179



>ref|XP_011090718.1| PREDICTED: uncharacterized protein LOC105171343 isoform X1 [Sesamum 
indicum]
Length=320

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/152 (37%), Positives = 84/152 (55%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L ++ WS++L+G+   +   +DD+                  S        +K  +FSK+
Sbjct  47   LISIVWSKNLMGQCLSVE--IDDA------------------SHQCICKVDVKSSLFSKR  86

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GS+ L ++SS       VFWDLS AKFGSGPEP+ G+Y+AV+  GE  LL+GD + EA 
Sbjct  87   KGSRPLLVNSS----KIEVFWDLSVAKFGSGPEPLGGYYVAVVFKGEMFLLVGDLRKEAL  142

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             KT A  +     L+ KREH+ G ++Y TK+ 
Sbjct  143  KKTGAVASICSAVLISKREHISGKRVYGTKAQ  174



>gb|KJB46029.1| hypothetical protein B456_007G344900 [Gossypium raimondii]
Length=318

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 80/152 (53%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTW++ L+G+   +   +DDS                  +        IKP++FSK+
Sbjct  63   LITVTWNKSLMGQGLSVG--IDDS------------------TNQCLCKVDIKPWLFSKR  102

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+          ++FWDLS AKF SGPEP  GFY+ V+   + VLL+GD + EAY
Sbjct  103  KGSKSLEAYCC----KLDIFWDLSTAKFSSGPEPSEGFYVCVVANKQMVLLLGDMKKEAY  158

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             KT A         V K+EHV+G +++ TK+ 
Sbjct  159  KKTNASPVPLDALFVAKKEHVFGRRVFGTKAQ  190



>gb|EYU30508.1| hypothetical protein MIMGU_mgv1a010362mg [Erythranthe guttata]
Length=314

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/158 (35%), Positives = 84/158 (53%), Gaps = 21/158 (13%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            + T      VTW ++L+G++  +    DD                 + +        IKP
Sbjct  50   FHTKPCWITVTWIKNLMGQTLTVGIDDDD----------------GNNTNQSLCKMDIKP  93

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
            ++FSKK+GSK L+  S       +V+WDLS AKFGSGPEP+ GFY+ ++   E VL++GD
Sbjct  94   WLFSKKKGSKVLEADSF----RIDVYWDLSSAKFGSGPEPIEGFYVGIVFEKEMVLVLGD  149

Query  532  CQXEAYAKTRARHA-GNGQALVLKREHVYGGKLYATKS  642
             + EA  +T    +      LV KREH++G K++ TK+
Sbjct  150  LRKEALKRTNCTPSLSRSVVLVSKREHIFGKKVFTTKA  187



>ref|XP_011026156.1| PREDICTED: uncharacterized protein LOC105126841 [Populus euphratica]
Length=299

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 83/152 (55%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTW+++L+G+   +   +DDS++                         IKP++FSK+
Sbjct  45   LITVTWTKNLMGQGVGVA--IDDSNSQCLC------------------KVDIKPWLFSKR  84

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +G K L++ S   + N    WD+S AKFGSGPEP+ GFY+A+    E VLL+GD + EAY
Sbjct  85   KGYKNLEVDSDKVIIN----WDMSNAKFGSGPEPLEGFYLAITFNLEMVLLLGDMKKEAY  140

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             K  +    +    + +REH++G K Y+ K+ 
Sbjct  141  KKIESPPVHSKAIFIARREHIFGKKFYSAKAQ  172



>ref|XP_011032694.1| PREDICTED: uncharacterized protein LOC105131425 [Populus euphratica]
Length=285

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 81/152 (53%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTW+++L+G+   +   +DDS                  +        IKP++FSK+
Sbjct  43   LITVTWTKNLMGQGVGVA--IDDS------------------TSQCLCKVDIKPWLFSKR  82

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +G + L+++S   +    ++WDLS AKFGSGPEP+ GFY+A+    E VLL+GD   EAY
Sbjct  83   KGYRNLEVASDKVI----IYWDLSNAKFGSGPEPLEGFYLAITFNQEMVLLLGDMAKEAY  138

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             K  +         + +REH++G K Y  K+ 
Sbjct  139  KKIESDPVHINAIFIARREHIFGKKFYGAKAQ  170



>ref|XP_009601952.1| PREDICTED: uncharacterized protein LOC104097132 [Nicotiana tomentosiformis]
Length=302

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/152 (32%), Positives = 84/152 (55%), Gaps = 24/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  + W++ L+G+   +   +DD                  +S        +KP +FSK+
Sbjct  48   LITIVWTKSLMGQCLSVE--IDD------------------MSHQCLCKVDVKPSLFSKR  87

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GS+ L+++S       ++ WD S  KFGSGPEP+ G+Y+A++  G+ VL+IGD + EA+
Sbjct  88   KGSRSLEVNSC----KIDLHWDFSLGKFGSGPEPIEGYYLALVCKGQMVLVIGDLRKEAF  143

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             KT A  + +    + KREH++G +++ TK+ 
Sbjct  144  KKTNATPSFSNAMFISKREHIFGKRVFGTKAQ  175



>gb|ADG39148.1| AT5G28150-like protein [Capsella grandiflora]
Length=155

 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 64/96 (67%), Gaps = 4/96 (4%)
 Frame = +1

Query  367  KQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEA  546
            ++GSK L+  S     N +VFWDLS AKFGSGPE + GFY+ V+V  E VLL+GD + EA
Sbjct  1    RKGSKSLEAYSC----NIDVFWDLSSAKFGSGPEALEGFYVGVVVDKEMVLLLGDMKKEA  56

Query  547  YAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
            + KT A  +  G   + K+EHV+G +++ATK+ +  
Sbjct  57   FKKTNASPSSLGAVFIAKKEHVFGKRVFATKAQLSA  92



>ref|XP_010089947.1| hypothetical protein L484_014458 [Morus notabilis]
 gb|EXB38643.1| hypothetical protein L484_014458 [Morus notabilis]
Length=360

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 90/165 (55%), Gaps = 18/165 (11%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y T   LF++TWSR  L RS HL  L    ++      S      SS S +PS H +IKP
Sbjct  47   YHTDAALFSLTWSRSFLCRSLHLSLLHHSFNSPLPLSLS------SSSSPSPSLHLQIKP  100

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
            F+F  K GSKKL         N  VFWDLS AKFGSGPEP SGF+IAV+V GE +LL+GD
Sbjct  101  FVFWNKHGSKKL-------CPNIIVFWDLSGAKFGSGPEPQSGFFIAVVVDGELILLVGD  153

Query  532  CQXEAYAKTRARHAGNGQALVLKREH-----VYGGKLYATKSNVG  651
               EA+AKT+++ +G      L           GGK    + N G
Sbjct  154  LAKEAHAKTKSQPSGKNHDRALSTSSRRGSTRLGGKTREIQINCG  198



>gb|ADG39151.1| AT5G28150-like protein [Capsella grandiflora]
Length=155

 Score = 93.2 bits (230),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 64/96 (67%), Gaps = 4/96 (4%)
 Frame = +1

Query  367  KQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEA  546
            ++GSK L+  S     N +VFWDLS AKFGSGPE + GFY+ V+V  E VLL+GD + EA
Sbjct  1    RKGSKSLEAYSC----NIDVFWDLSSAKFGSGPEALEGFYVGVVVDKEMVLLLGDMKKEA  56

Query  547  YAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
            + KT A  +  G   + K+EHV+G +++ATK+ +  
Sbjct  57   FKKTNASPSSLGAVFIAKKEHVFGKRVFATKAQLSA  92



>gb|ADG39149.1| AT5G28150-like protein [Capsella grandiflora]
 gb|ADG39152.1| AT5G28150-like protein [Capsella grandiflora]
Length=155

 Score = 93.2 bits (230),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 64/96 (67%), Gaps = 4/96 (4%)
 Frame = +1

Query  367  KQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEA  546
            ++GSK L+  S     N +VFWDLS AKFGSGPE + GFY+ V+V  E VLL+GD + EA
Sbjct  1    RKGSKSLEAYSC----NIDVFWDLSSAKFGSGPEALEGFYVGVVVDKEMVLLLGDMKKEA  56

Query  547  YAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
            + KT A  +  G   + K+EHV+G +++ATK+ +  
Sbjct  57   FKKTNASPSSLGAVFIAKKEHVFGKRVFATKAQLSA  92



>gb|AEN83173.1| AT5G28150-like protein, partial [Capsella rubella]
 gb|AEN83174.1| AT5G28150-like protein, partial [Capsella rubella]
 gb|AEN83175.1| AT5G28150-like protein, partial [Capsella rubella]
 gb|AEN83176.1| AT5G28150-like protein, partial [Capsella rubella]
 gb|AEN83177.1| AT5G28150-like protein, partial [Capsella rubella]
 gb|AEN83178.1| AT5G28150-like protein, partial [Capsella rubella]
 gb|AEN83179.1| AT5G28150-like protein, partial [Capsella rubella]
 gb|AEN83180.1| AT5G28150-like protein, partial [Capsella rubella]
Length=156

 Score = 93.2 bits (230),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 64/96 (67%), Gaps = 4/96 (4%)
 Frame = +1

Query  367  KQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEA  546
            ++GSK L+  S     N +VFWDLS AKFGSGPE + GFY+ V+V  E VLL+GD + EA
Sbjct  1    RKGSKSLEAYSC----NIDVFWDLSSAKFGSGPEALEGFYVGVVVDKEMVLLLGDMKKEA  56

Query  547  YAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
            + KT A  +  G   + K+EHV+G +++ATK+ +  
Sbjct  57   FKKTNASPSSLGAVFIAKKEHVFGKRVFATKAQLSA  92



>gb|KHN10674.1| hypothetical protein glysoja_019105 [Glycine soja]
Length=304

 Score = 95.5 bits (236),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 84/165 (51%), Gaps = 31/165 (19%)
 Frame = +1

Query  172  YRTGLG----LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHF  339
            Y+  LG    L  V+W+++L+G+   +                        L        
Sbjct  35   YQCKLGGRSCLITVSWTKNLMGQGLSVGI--------------------DELGNHCLCKV  74

Query  340  RIKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVL  519
             IKP++FSK++GSK L++ S+      ++ WDLS AKFGSGPEP+ GFY+ V+   E VL
Sbjct  75   DIKPWLFSKRKGSKNLEVESN----KIDILWDLSCAKFGSGPEPLEGFYLVVVFNQEMVL  130

Query  520  LIGDCQXEAYAKTRARHAGNGQA---LVLKREHVYGGKLYATKSN  645
            L+GD + EA  K  + +A    +    + KREH++G K Y  K+ 
Sbjct  131  LLGDLKKEACKKIDSDYACADHSEAVFIAKREHIFGKKFYGAKAQ  175



>gb|EMT25403.1| hypothetical protein F775_31443 [Aegilops tauschii]
Length=292

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 87/162 (54%), Gaps = 28/162 (17%)
 Frame = +1

Query  172  YRTGLG----LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHF  339
            Y+T L     + +VTWS+ L+G+   +                       +LSG      
Sbjct  38   YQTQLAGRPCVVSVTWSKSLMGQGLSVAV--------------------DALSGQSLCKA  77

Query  340  RIKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVL  519
             IKP++FSKK+GSK L    +      ++FWDLS A+FG+GPEP+ GFY+A+L   E  L
Sbjct  78   DIKPWLFSKKKGSKTLDADGA----KVDIFWDLSAARFGAGPEPLEGFYVALLFDLELAL  133

Query  520  LIGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
            L+GD + +AY KT A       A V ++EH+YG K+Y+ K+ 
Sbjct  134  LLGDMKKDAYRKTGANRPALNAAFVARKEHIYGKKIYSAKAQ  175



>emb|CDY51100.1| BnaCnng20030D [Brassica napus]
Length=340

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 86/161 (53%), Gaps = 13/161 (8%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y+T  G+F +TWSR  LG    L+  L          S       SSLS   SF   +  
Sbjct  18   YQTDHGVFHLTWSRTFLG-GHSLNLFLHSQDYYNNHSSPLSFSSLSSLSSLASFRLTLNT  76

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
              F +K+GSK   ISS     N  V WDL+RAKF SG EP SGFY+AV+V GE  LL+GD
Sbjct  77   LTFWRKRGSK--LISS-----NIQVLWDLTRAKFESGSEPRSGFYVAVIVDGEVGLLVGD  129

Query  532  CQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
                     R +     QALV+++EHV+GG ++ TK+  GG
Sbjct  130  S-----GDARVKSPAKPQALVMRKEHVFGGSVFTTKARFGG  165



>ref|XP_003521248.2| PREDICTED: uncharacterized protein LOC100799355 [Glycine max]
Length=313

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 84/165 (51%), Gaps = 31/165 (19%)
 Frame = +1

Query  172  YRTGLG----LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHF  339
            Y+  LG    L  V+W+++L+G+   +                        L        
Sbjct  35   YQCKLGGRSCLITVSWTKNLMGQGLSVGI--------------------DELGNHCLCKV  74

Query  340  RIKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVL  519
             IKP++FSK++GSK L++ S+      ++ WDLS AKFGSGPEP+ GFY+ V+   E VL
Sbjct  75   DIKPWLFSKRKGSKNLEVESN----KIDILWDLSCAKFGSGPEPLEGFYLVVVFNQEMVL  130

Query  520  LIGDCQXEAYAKTRARHAGNGQA---LVLKREHVYGGKLYATKSN  645
            L+GD + EA  K  + +A    +    + KREH++G K Y  K+ 
Sbjct  131  LLGDLKKEACKKIDSDYACADHSEAVFIAKREHIFGKKFYGAKAQ  175



>ref|XP_001772274.1| predicted protein [Physcomitrella patens]
 gb|EDQ62927.1| predicted protein [Physcomitrella patens]
Length=284

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 79/151 (52%), Gaps = 26/151 (17%)
 Frame = +1

Query  193  FAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKKQ  372
             ++TW ++L+G+   ++  +D                             +KP+MF KKQ
Sbjct  46   LSITWCKNLIGQGLSVNVDVDQHMC----------------------KVDMKPWMFWKKQ  83

Query  373  GSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAYA  552
            G K  ++    G+K   VFWDLS AK+  GP P   F++AV+  GE VLL+GD   EAY 
Sbjct  84   GLKSFEVD---GIK-VEVFWDLSSAKYICGPVPSDSFFVAVVSDGEVVLLLGDMYSEAYK  139

Query  553  KTRARHAGNGQALVLKREHVYGGKLYATKSN  645
            KT+AR A     LV + EHV+G K ++TK+ 
Sbjct  140  KTKARPASIEAILVSRSEHVFGKKYHSTKAQ  170



>gb|AFK40643.1| unknown [Medicago truncatula]
Length=303

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 24/150 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  +TWS+ L+G+ F +   +DD+                  S        IKP++FSK+
Sbjct  47   LITITWSKSLMGQGFSVG--IDDA------------------SNQCLCKVDIKPWVFSKR  86

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +G K L+  S       +V+WDLS A+FG GPEP+ GF++ V+V  + VLL+GD + EA+
Sbjct  87   KGCKSLEAYSC----KIDVYWDLSSARFGVGPEPLEGFFVGVVVAKQMVLLLGDLRKEAF  142

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATK  639
             K+ A         V K+EHV+G K +  K
Sbjct  143  KKSNAVPLPLNAVFVAKKEHVFGKKFFGNK  172



>gb|KHN33661.1| hypothetical protein glysoja_013667 [Glycine soja]
Length=247

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 69/103 (67%), Gaps = 6/103 (6%)
 Frame = +1

Query  343  IKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLL  522
            IKP++FSK++GSK L++ S+      ++ WDLS AKFGSGPEP+ GFY+ V+   E VLL
Sbjct  22   IKPWLFSKRKGSKNLEVESN----KIDILWDLSCAKFGSGPEPLEGFYLVVVFNQEMVLL  77

Query  523  IGDCQXEAYAKTRARHA-GNGQAL-VLKREHVYGGKLYATKSN  645
            +GD   EA  K  + +A  + +A+ + KREH++G K Y  K+ 
Sbjct  78   LGDLTKEACKKIDSDYACAHSEAVFIAKREHIFGKKFYGAKAQ  120



>ref|XP_006604441.1| PREDICTED: uncharacterized protein LOC100786850 [Glycine max]
 gb|KHN02571.1| hypothetical protein glysoja_002595 [Glycine soja]
Length=301

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 86/164 (52%), Gaps = 30/164 (18%)
 Frame = +1

Query  172  YRTGLG----LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHF  339
            Y+  LG    L  V+W+++L+G+   +                        L        
Sbjct  35   YQCKLGGRSCLITVSWTKNLMGQGLSVGI--------------------DELGNHCLCKV  74

Query  340  RIKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVL  519
             IKP++FSK++GSK L++ S+      ++ WDLS AKFGSGPEP+ GFY+ V+   E VL
Sbjct  75   DIKPWLFSKRKGSKNLEVESN----KIDILWDLSCAKFGSGPEPLEGFYLVVVFNQEMVL  130

Query  520  LIGDCQXEAYAKTRARHA-GNGQAL-VLKREHVYGGKLYATKSN  645
            L+GD   EA  K  + +A  + +A+ + KREH++G K Y  K+ 
Sbjct  131  LLGDLTKEACKKIDSDYACAHSEAVFIAKREHIFGKKFYGAKAQ  174



>gb|ADG39147.1| AT5G28150-like protein [Capsella grandiflora]
Length=155

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 63/96 (66%), Gaps = 4/96 (4%)
 Frame = +1

Query  367  KQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEA  546
            ++GSK L+  S     N +VFWDLS AKFGSGPE + GFY+ V+V  E VLL+GD + EA
Sbjct  1    RKGSKSLEAYSC----NIDVFWDLSSAKFGSGPEALEGFYVGVVVDKEMVLLLGDMKKEA  56

Query  547  YAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
            + KT A  +  G   + K+EHV+G  ++ATK+ +  
Sbjct  57   FKKTNASPSSLGAVFIAKKEHVFGKXVFATKAQLSA  92



>gb|ADG39153.1| AT5G28150-like protein [Neslia paniculata]
Length=155

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 63/96 (66%), Gaps = 4/96 (4%)
 Frame = +1

Query  367  KQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEA  546
            ++GSK L+  S     N +VFWDLS AKFGSGPE + GFY+ V+V  E VLL+GD   EA
Sbjct  1    RKGSKSLEAYSC----NIDVFWDLSSAKFGSGPEALGGFYVGVVVDKEMVLLLGDMNKEA  56

Query  547  YAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
            + KT A  +  G   + K+EHV+G +++ATK+ +  
Sbjct  57   FKKTNASPSSLGAVFIAKKEHVFGKRVFATKAQLSA  92



>gb|ADG39150.1| AT5G28150-like protein [Capsella grandiflora]
Length=155

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 63/96 (66%), Gaps = 4/96 (4%)
 Frame = +1

Query  367  KQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEA  546
            ++GSK L+  S     N +VFWDLS AKFGSGPE + GFY+ V+V  E VLL+GD + EA
Sbjct  1    RKGSKSLEAYSC----NIDVFWDLSSAKFGSGPEALEGFYVGVVVDKEMVLLLGDMKKEA  56

Query  547  YAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
            + KT A  +  G   + K+EHV+G  ++ATK+ +  
Sbjct  57   FKKTNASPSSLGAVFIAKKEHVFGKXVFATKAQLSA  92



>gb|AES61262.2| plant/T24G3-80 protein [Medicago truncatula]
Length=303

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 24/150 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  +TWS+ L+G+ F +   +DD+                  S        IKP++FSK+
Sbjct  47   LITITWSKSLMGQGFSVG--IDDA------------------SNQCLCKVDIKPWVFSKR  86

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +G K L+  S       +V+WDLS A+FG GPEP+ GF++ V+V  + VLL+GD + EA+
Sbjct  87   KGCKSLEAYSC----KIDVYWDLSSARFGVGPEPLEGFFVGVVVDKQMVLLLGDLRKEAF  142

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATK  639
             K+ A         V K+EHV+G K +  K
Sbjct  143  KKSNAVPLPLNAVFVAKKEHVFGKKFFGNK  172



>ref|XP_009370813.1| PREDICTED: uncharacterized protein LOC103960122 [Pyrus x bretschneideri]
Length=317

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 87/162 (54%), Gaps = 30/162 (19%)
 Frame = +1

Query  175  RTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPF  354
            ++ L L  VTW+++L+G+S  +   +DD                  ++G       IKP+
Sbjct  47   KSRLCLITVTWTKNLMGQSLAIE--IDD------------------VAGHCLCRVEIKPW  86

Query  355  MFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDC  534
            +FSK++G K L++ S+      ++FWDL+ AKFGSGPEP+  FY+A++   E VL +GD 
Sbjct  87   IFSKRKGLKNLEVDST----KIDIFWDLTNAKFGSGPEPLEKFYLALMFDQEMVLFLGDL  142

Query  535  QXEAYAKTRARHAGNGQ-----ALVLKREHVYGGKLYATKSN  645
            + E + K+R       +       V KREH++G K Y  K+ 
Sbjct  143  RREDF-KSRDESNSKFKSKSKAEFVAKREHIFGKKFYGAKAQ  183



>ref|XP_003556459.1| PREDICTED: uncharacterized protein LOC100802422 isoform 1 [Glycine 
max]
 gb|KHN04941.1| hypothetical protein glysoja_013848 [Glycine soja]
Length=300

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 82/156 (53%), Gaps = 23/156 (15%)
 Frame = +1

Query  175  RTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPF  354
            R    L  +TWS+ L+G+   +   +DD                 S S        IKP+
Sbjct  40   RGKCCLITITWSKSLMGQGLSVG--IDD-----------------SSSNQCLCKVDIKPW  80

Query  355  MFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDC  534
            +FSK++G K L+  S       +V+WDLS A+ G GPEP+ GFY+ V+V  + VLL+GD 
Sbjct  81   VFSKRRGYKSLEAYSC----KIDVYWDLSNARLGVGPEPLEGFYVGVVVDRQMVLLLGDL  136

Query  535  QXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKS  642
            + EA+ K+ A    +    V K+EHV+G K++  K+
Sbjct  137  RKEAFKKSSAIPLPSNAVFVAKKEHVFGKKMFGNKA  172



>ref|XP_009417441.1| PREDICTED: uncharacterized protein LOC103997840 [Musa acuminata 
subsp. malaccensis]
Length=380

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 87/172 (51%), Gaps = 27/172 (16%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y T LG+ A+TWSR +LG S      L                            FRI+P
Sbjct  31   YETHLGVAALTWSRTVLGLSLRTELRLS----------------ADEEDEEEPVRFRIRP  74

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKF--GSGPEPVSGFYIAVLVGGETVLLI  525
            ++  K++G+K+  +    G +  +  WDL+RA F  G GPEP +GF++AV V GE +L+ 
Sbjct  75   WLLWKRRGTKRFHLKDDRGHRCVDFAWDLTRASFPPGGGPEPAAGFFVAVSVDGEMLLVA  134

Query  526  GDCQXEAYAKTRARHAG----NGQALVLKREHVY-----GGKLYATKSNVGG  654
            GD   EA+ K++AR       +  ALV ++EHV      G + Y T++ VGG
Sbjct  135  GDLAEEAFKKSKARLPQAPLLSRPALVSRQEHVVLVDQGGRRSYLTRARVGG  186



>emb|CDX85733.1| BnaA02g00800D [Brassica napus]
Length=343

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 93/162 (57%), Gaps = 18/162 (11%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLG-RSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIK  348
            Y+T  G+F +TWSR  LG  S +L     D   + +   S      SSLS   SFH  + 
Sbjct  22   YQTDHGVFYLTWSRTFLGGHSLNLFLHSQDYYNSHSSPLSF-----SSLSSLASFHLTLN  76

Query  349  PFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIG  528
               F +K+GSK   ISS     N  V WDL+RAKF SG EP SGFY+AV+V GE  LL+G
Sbjct  77   TLTFWRKRGSK--FISS-----NIQVLWDLTRAKFESGSEPRSGFYVAVIVDGEVGLLVG  129

Query  529  DCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
            D        TR +   N QALV+++EHV+GG ++ATK+  GG
Sbjct  130  DS-----GDTRVKSPANRQALVMRKEHVFGGSVFATKARFGG  166



>gb|ACU19762.1| unknown [Glycine max]
Length=257

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 81/150 (54%), Gaps = 23/150 (15%)
 Frame = +1

Query  193  FAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKKQ  372
              +TW++ L+G+   +   +DD S                 S        IKP++FSK++
Sbjct  46   ITITWTKSLMGQGLSVG--IDDYS-----------------SNQCLCKVDIKPWVFSKRR  86

Query  373  GSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAYA  552
            G K L+  S       +V+WDLS A+FG GPEP+ GFY+ V+V  + VLL+GD + EA+ 
Sbjct  87   GCKSLEAYSC----KIDVYWDLSNARFGVGPEPLEGFYVGVVVDRQMVLLLGDLRKEAFK  142

Query  553  KTRARHAGNGQALVLKREHVYGGKLYATKS  642
            K+ A    +    V K+EHV+G K++  K+
Sbjct  143  KSSAIPLPSNAVFVAKKEHVFGKKMFGNKA  172



>ref|XP_003591011.1| hypothetical protein MTR_1g081260 [Medicago truncatula]
Length=336

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 24/150 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  +TWS+ L+G+ F +   +DD+                  S        IKP++FSK+
Sbjct  47   LITITWSKSLMGQGFSVG--IDDA------------------SNQCLCKVDIKPWVFSKR  86

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +G K L+  S       +V+WDLS A+FG GPEP+ GF++ V+V  + VLL+GD + EA+
Sbjct  87   KGCKSLEAYSC----KIDVYWDLSSARFGVGPEPLEGFFVGVVVDKQMVLLLGDLRKEAF  142

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATK  639
             K+ A         V K+EHV+G K +  K
Sbjct  143  KKSNAVPLPLNAVFVAKKEHVFGKKFFGNK  172



>ref|XP_007162443.1| hypothetical protein PHAVU_001G152600g [Phaseolus vulgaris]
 gb|ESW34437.1| hypothetical protein PHAVU_001G152600g [Phaseolus vulgaris]
Length=301

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 70/103 (68%), Gaps = 6/103 (6%)
 Frame = +1

Query  343  IKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLL  522
            IKP++FSK++GSK L++ S+      ++ WDLS AKFGSGPEP+ GFY+ V+   E VLL
Sbjct  76   IKPWLFSKRKGSKNLEVESN----KIDILWDLSCAKFGSGPEPLEGFYLLVVFNQEMVLL  131

Query  523  IGDCQXEAYAKTRARHA-GNGQAL-VLKREHVYGGKLYATKSN  645
            +GD + EA  K  + +A  + +A+ + KREHV+G K Y  ++ 
Sbjct  132  LGDLKKEACKKIDSDYACAHSEAVFIAKREHVFGKKFYGARAQ  174



>gb|EPS66867.1| hypothetical protein M569_07907 [Genlisea aurea]
Length=313

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 83/152 (55%), Gaps = 23/152 (15%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  +TWS+ L+G+   +   ++D+S   +                  F   +KP +F ++
Sbjct  48   LITITWSKSLMGQCLSVE--IEDASHHHSI-----------------FRVDVKPSLFYRR  88

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L+ +S    +   V WDLS AKFGSGPEP  G+YIAV+  GE +LL+GD + EA+
Sbjct  89   KGSKSLETNS----RRIQVSWDLSLAKFGSGPEPSEGYYIAVVSKGEMILLVGDLRREAF  144

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             KT A    +    + KREHV G  +Y T++ 
Sbjct  145  KKTGAVALLSSAPFISKREHVSGKGVYHTRAQ  176



>ref|XP_009379950.1| PREDICTED: uncharacterized protein LOC103968448 [Musa acuminata 
subsp. malaccensis]
Length=318

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 83/162 (51%), Gaps = 14/162 (9%)
 Frame = +1

Query  172  YRTGLG----LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHF  339
            YRT +     L  VTW RD+L R   L   +DD  + +  ES         +     F  
Sbjct  39   YRTKIAGHCRLITVTWCRDVLVRG--LSVSVDDEGSGSGTESCGGGGGSQLVC----FKV  92

Query  340  RIKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVL  519
             ++P+ F +K GS++ Q+      K  +V WDL  AKF   PEP SGFY+AV    E VL
Sbjct  93   EMRPWHFWRKHGSRRFQVEG----KAVDVLWDLRSAKFSGEPEPQSGFYVAVASDHEVVL  148

Query  520  LIGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
            L+GD + EAY KT  R A     LV ++EHV+G   + T++ 
Sbjct  149  LLGDNKKEAYRKTWCRPATIDATLVSRKEHVFGRTRFVTRAR  190



>ref|XP_009385461.1| PREDICTED: uncharacterized protein LOC103972819 [Musa acuminata 
subsp. malaccensis]
Length=305

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 66/105 (63%), Gaps = 4/105 (4%)
 Frame = +1

Query  328  SFHFRIKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGG  507
            S   +I P+   +KQGS + QI    G +   VFWDL  AKF + PEP S +Y+AV+  G
Sbjct  97   SCKVQISPWQPWRKQGSNRFQI----GGETVEVFWDLHSAKFCNEPEPQSDYYVAVVSEG  152

Query  508  ETVLLIGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKS  642
            E VLL+GD + EAY +T +R +     LV ++EHV+G K +ATKS
Sbjct  153  EVVLLLGDLRKEAYRRTSSRPSLTEAVLVARKEHVFGKKRFATKS  197



>ref|XP_007199427.1| hypothetical protein PRUPE_ppa026525mg [Prunus persica]
 gb|EMJ00626.1| hypothetical protein PRUPE_ppa026525mg [Prunus persica]
Length=302

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 80/153 (52%), Gaps = 25/153 (16%)
 Frame = +1

Query  184  LGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFS  363
            L    VTW+++L+G+   +   +DD+                  +        IKP++FS
Sbjct  46   LCFITVTWTKNLMGQGLSIE--IDDA------------------ANQCICKVDIKPWLFS  85

Query  364  KKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXE  543
            K++G + L++ +S      +++WDL+ AKFGSGPEP+  FY+AV+   E VL +GD + E
Sbjct  86   KRKGCRNLEVDTS----KIDIYWDLTNAKFGSGPEPLEKFYLAVMFNQEMVLFLGDLKRE  141

Query  544  AYAKTRARHAGNGQALVLKREHVYGGKLYATKS  642
            A+ K            + KREH++G K Y  K+
Sbjct  142  AFNKDPVGSISRA-TFIAKREHIFGKKFYGAKA  173



>gb|EYU41493.1| hypothetical protein MIMGU_mgv1a027106mg [Erythranthe guttata]
Length=293

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 82/151 (54%), Gaps = 24/151 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  ++WS++L+G+   +   +DDS                  S        +KP +FSK+
Sbjct  48   LITLSWSKNLIGQCLSVE--IDDS------------------SHHCICKIDVKPSLFSKR  87

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK  Q+ S+       VFWDLS AKFGS  EP+ G+YIA++  GE +LL+GD + EA 
Sbjct  88   KGSKFSQVDST----EIEVFWDLSSAKFGSRSEPLEGYYIAIVSSGEMLLLVGDLKKEAL  143

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKS  642
             KT A  +     L+ KREH+   ++Y TK+
Sbjct  144  KKTGAIASPLNAVLISKREHISAKRVYQTKT  174



>ref|XP_003536115.1| PREDICTED: uncharacterized protein LOC100778089 [Glycine max]
 gb|KHN16187.1| hypothetical protein glysoja_012163 [Glycine soja]
Length=301

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 81/151 (54%), Gaps = 23/151 (15%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
               +TW++ L+G+   +   +DD S                 S        IKP++FSK+
Sbjct  45   FITITWTKSLMGQGLSVG--IDDYS-----------------SNQCLCKVDIKPWVFSKR  85

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +G K L+  S       +V+WDLS A+FG GPEP+ GFY+ V+V  + VLL+GD + EA+
Sbjct  86   RGCKSLEAYSC----KIDVYWDLSNARFGVGPEPLEGFYVGVVVDRQMVLLLGDLRKEAF  141

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKS  642
             K+ A    +    V K+EHV+G K++  K+
Sbjct  142  KKSSAIPLPSNAVFVAKKEHVFGKKMFGNKA  172



>ref|XP_010929447.1| PREDICTED: uncharacterized protein LOC105050916 [Elaeis guineensis]
Length=299

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 63/100 (63%), Gaps = 4/100 (4%)
 Frame = +1

Query  343  IKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLL  522
            +KP+ F  K+G K  +I      K  +++WDL   KF +GPEP  G+Y+A+    E VLL
Sbjct  77   LKPWPFWSKKGFKSFEIDG----KRVDIYWDLRSVKFSNGPEPSGGYYVALACDEEVVLL  132

Query  523  IGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKS  642
            +GDC+ EAY +T+ R A    ALV KRE+V+G K + T++
Sbjct  133  LGDCKKEAYKRTKCRPALESAALVSKRENVFGKKCFTTRA  172



>ref|XP_008235299.1| PREDICTED: uncharacterized protein LOC103334137 isoform X1 [Prunus 
mume]
Length=303

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 80/153 (52%), Gaps = 25/153 (16%)
 Frame = +1

Query  184  LGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFS  363
            L    VTW+++L+G+   +   +DD+                  +        IKP++FS
Sbjct  47   LCFITVTWTKNLMGQGLSIE--IDDA------------------ANQCICKVDIKPWLFS  86

Query  364  KKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXE  543
            K++G + L++ ++      +++WDL+ AKFGSGPEP+  FY+AV+   E VL +GD + E
Sbjct  87   KRKGCRNLEVDTN----KIDIYWDLTNAKFGSGPEPLEKFYLAVMFNQEMVLFLGDLKRE  142

Query  544  AYAKTRARHAGNGQALVLKREHVYGGKLYATKS  642
            A+ K            + KREH++G K Y  K+
Sbjct  143  AFNKDPVGSISRA-TFIAKREHIFGKKFYGAKT  174



>ref|NP_850061.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAD23671.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAS49111.1| At2g25200 [Arabidopsis thaliana]
 dbj|BAD43081.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC07670.1| uncharacterized protein AT2G25200 [Arabidopsis thaliana]
Length=354

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 86/161 (53%), Gaps = 18/161 (11%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y T +G+F ++WSR  L RS HLHF   +S+          D Y  S+  A  F   IKP
Sbjct  54   YHTNVGVFFLSWSRSFLRRSLHLHFYSCNSTNCYLHSL---DCYRHSIPFA--FRLEIKP  108

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
              F +K GSKKL         +  V WDL+ AKFGSGP+P SGFY+AV V GE  LL   
Sbjct  109  LTFWRKNGSKKL-----SRKPDIRVVWDLTHAKFGSGPDPESGFYVAVFVSGEVGLL---  160

Query  532  CQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
                   K R R     Q LV K+E+++G ++Y+TK  + G
Sbjct  161  -VGGGNLKQRPRR----QILVSKKENLFGNRVYSTKIMIQG  196



>gb|KEH23778.1| plant/T24G3-80 protein [Medicago truncatula]
Length=307

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/156 (33%), Positives = 83/156 (53%), Gaps = 29/156 (19%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  V+W+++L+G+   +                        L  +      IKP++FSK+
Sbjct  47   LITVSWTKNLMGQGLSVGI--------------------DELGNSCLCKVDIKPWLFSKR  86

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +G K L++ SS  +    + WDLS AKFGSGPEP+ G+Y+ V+   + VLL+GD + EA 
Sbjct  87   KGCKNLEVESSKVV----ILWDLSYAKFGSGPEPLEGYYLVVMFNKKMVLLLGDLKKEAC  142

Query  550  AKTRARH--AGNGQA---LVLKREHVYGGKLYATKS  642
             K  + +  +GN  +    + KREH++G K Y+ K+
Sbjct  143  KKIDSDNNVSGNNNSDAIFIAKREHIFGKKFYSAKA  178



>gb|KJB42124.1| hypothetical protein B456_007G137800 [Gossypium raimondii]
Length=306

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 80/154 (52%), Gaps = 26/154 (17%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  VTW+++++G+   L   +DDS                  +        +KP++FSK+
Sbjct  49   LITVTWTKNMMGQG--LGVAIDDS------------------ANQCLCKVDMKPWLFSKR  88

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK + + S       ++ WDLS A+FGSGPEPV GFY+AV +  E VLL+GD + EA 
Sbjct  89   KGSKTIDVDSG----KIDICWDLSNARFGSGPEPVEGFYLAVALDQEMVLLLGDLKKEAS  144

Query  550  AKTRARHA--GNGQALVLKREHVYGGKLYATKSN  645
             K         +    + KREH++G K Y  K+ 
Sbjct  145  KKINISSTPLSSDAVFIAKREHIFGKKFYGAKAQ  178



>gb|AFK42653.1| unknown [Medicago truncatula]
Length=262

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 69/105 (66%), Gaps = 9/105 (9%)
 Frame = +1

Query  343  IKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLL  522
            IKP++FSK++G K L++ SS  +    + WDLS AKFGSGPEP+ G+Y+ V+   + VLL
Sbjct  33   IKPWLFSKRKGCKNLEVESSKVV----ILWDLSYAKFGSGPEPLEGYYLVVMFNKKMVLL  88

Query  523  IGDCQXEAYAKTRARH--AGNGQA---LVLKREHVYGGKLYATKS  642
            +GD + EA  K  + +  +GN  +    + KREH++G K Y+ K+
Sbjct  89   LGDLKKEACKKIDSDNNVSGNNNSDAIFIAKREHIFGKKFYSAKA  133



>ref|XP_010912954.1| PREDICTED: uncharacterized protein LOC105038765 [Elaeis guineensis]
Length=310

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 78/151 (52%), Gaps = 12/151 (8%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            LF VTW +D+L     +  + D ++          +   +S     S    ++P+ F +K
Sbjct  48   LFTVTWCKDVLVHELSISVVEDSNNVG--------ETNINSSGKQQSCKVELRPWYFWRK  99

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            QG K+  +      K  +VFWDL  AKF   PEP S +Y+A + G E VLL+GD   EAY
Sbjct  100  QGWKRFHVEG----KPVDVFWDLKSAKFSGEPEPRSNYYVAAVSGDEVVLLLGDLNKEAY  155

Query  550  AKTRARHAGNGQALVLKREHVYGGKLYATKS  642
             +T  R A     LV ++E+V+G K + T++
Sbjct  156  RRTGCRPATLDATLVSRKENVFGKKRFVTRA  186



>ref|XP_008806297.1| PREDICTED: uncharacterized protein LOC103719024 [Phoenix dactylifera]
Length=391

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 93/170 (55%), Gaps = 16/170 (9%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y T LGL A++WSR +LG S     L  D   A  G ++  +        +P   FRI+P
Sbjct  32   YETHLGLAALSWSRTVLGLS-----LRADLRCAGGGAAAATEDENDEDEESP--RFRIRP  84

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGS--GPEPVSGFYIAVLVGGETVLLI  525
            +MF K++GSK   +      +     WDL+RA+F +  GPEP +G+++AV+VGGE +L+ 
Sbjct  85   WMFWKRRGSKLFHLKDQQQHRTVEFSWDLTRARFPACGGPEPSAGYFVAVVVGGEMLLVA  144

Query  526  GDCQXEAYAKTRARHAGN--GQALVLKREHVY-----GGKLYATKSNVGG  654
            GD   +AY KT+     +     L+ +REHV      GG+ Y T++  GG
Sbjct  145  GDLVDKAYRKTKVARGKSPWNSILISRREHVALGESGGGRSYKTRARFGG  194



>ref|XP_010552768.1| PREDICTED: uncharacterized protein LOC104823045 [Tarenaya hassleriana]
Length=298

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 85/157 (54%), Gaps = 26/157 (17%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            + +++W R+L+G+   L   +DDS                           IKP++F+++
Sbjct  47   MISISWFRNLMGQG--LSVAIDDSKNQCIC------------------KVDIKPWIFARR  86

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK L++ SS       VFWDLSRA+F  GP+P  GFY+AV++  E +LL+GD + EAY
Sbjct  87   KGSKGLEVGSS----EIGVFWDLSRARFACGPDPTEGFYLAVVLDHELLLLLGDMKKEAY  142

Query  550  AKTRARHAGN--GQALVLKREHVYGGKLYATKSNVGG  654
             K     AG       V K+EHV+G KLY T++   G
Sbjct  143  KKIGISTAGGSCNAVFVAKKEHVFGKKLYTTRAQFHG  179



>gb|ABR17303.1| unknown [Picea sitchensis]
Length=270

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/156 (33%), Positives = 82/156 (53%), Gaps = 33/156 (21%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFH----FRIKPFM  357
            L  VTW ++L+G+   ++  +DD                      PS+       +K ++
Sbjct  20   LITVTWCKNLMGQGLSVN--VDD----------------------PSYQCLCRVDMKSWL  55

Query  358  FSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQ  537
            F KK+GSK+ ++    G    +VFWDLS A++GS PEP+ G+++AV+   E  LL+GD  
Sbjct  56   FWKKKGSKRFEL----GTTKVDVFWDLSSARYGSAPEPLEGYFVAVVSNEEVALLLGDMC  111

Query  538  XEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
             EA+ KT A+       L+ ++EHV+G   Y TK+ 
Sbjct  112  KEAFKKTHAKPPAE-TVLISRKEHVFGKNCYTTKAQ  146



>ref|XP_009333930.1| PREDICTED: uncharacterized protein LOC103926780 [Pyrus x bretschneideri]
Length=342

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 64/106 (60%), Gaps = 4/106 (4%)
 Frame = +1

Query  328  SFHFRIKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGG  507
            SF   +KP+ F +KQGSK+  +      K   +FWDL  AKF  G EP S +Y+AVL   
Sbjct  79   SFKVELKPWYFWRKQGSKRFVVDG----KAVEIFWDLKAAKFNGGTEPKSEYYVAVLCEK  134

Query  508  ETVLLIGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
            E VLL+GD + +AY KT  R A     LV K+EH++G K ++TK+ 
Sbjct  135  EVVLLLGDLKKDAYRKTGFRPALTDPTLVSKKEHIFGKKKFSTKAK  180



>emb|CBI21089.3| unnamed protein product [Vitis vinifera]
Length=291

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 76/161 (47%), Gaps = 45/161 (28%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y T LG+F +TWSR+  GRS HL         +AA   SP           P+FH  IKP
Sbjct  49   YHTDLGIFTLTWSRNFFGRSLHLQL-----HPSAAANLSPLSLSNPLSLSTPAFHLHIKP  103

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGD  531
            F+F KK GSKKL +                                        +LL+GD
Sbjct  104  FVFWKKYGSKKLHM----------------------------------------ILLVGD  123

Query  532  CQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSNVGG  654
             + EAY KTRA+ A   Q LVL+REHV+G K+Y T+++ GG
Sbjct  124  SEKEAYNKTRAKKAERTQVLVLRREHVFGNKVYTTRASFGG  164



>ref|XP_008380651.1| PREDICTED: uncharacterized protein LOC103443554 [Malus domestica]
Length=365

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 83/162 (51%), Gaps = 21/162 (13%)
 Frame = +1

Query  172  YRTGLG----LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHF  339
            YRT +     L  +TW ++LL     LH L       +     P D   +      SF  
Sbjct  36   YRTKIADQSRLITITWCKNLL-----LHGL-------SVTMEGP-DGDQTQQHTQHSFKV  82

Query  340  RIKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVL  519
             +KP+ F +KQGSK+  +      K   +FWDL  AKF  G EP S +Y+AVL   E VL
Sbjct  83   ELKPWYFWRKQGSKRFVVDG----KAVEIFWDLKAAKFNGGTEPKSEYYVAVLCDKEVVL  138

Query  520  LIGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
            L+GD + +AY KT  R A     LV K+EH++G K ++TK+ 
Sbjct  139  LLGDLKKDAYRKTGFRPALTDPTLVSKKEHIFGKKKFSTKAK  180



>gb|KJB42120.1| hypothetical protein B456_007G137800 [Gossypium raimondii]
 gb|KJB42121.1| hypothetical protein B456_007G137800 [Gossypium raimondii]
 gb|KJB42122.1| hypothetical protein B456_007G137800 [Gossypium raimondii]
 gb|KJB42123.1| hypothetical protein B456_007G137800 [Gossypium raimondii]
Length=249

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 63/103 (61%), Gaps = 6/103 (6%)
 Frame = +1

Query  343  IKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLL  522
            +KP++FSK++GSK + + S       ++ WDLS A+FGSGPEPV GFY+AV +  E VLL
Sbjct  23   MKPWLFSKRKGSKTIDVDSG----KIDICWDLSNARFGSGPEPVEGFYLAVALDQEMVLL  78

Query  523  IGDCQXEAYAKTRARHA--GNGQALVLKREHVYGGKLYATKSN  645
            +GD + EA  K         +    + KREH++G K Y  K+ 
Sbjct  79   LGDLKKEASKKINISSTPLSSDAVFIAKREHIFGKKFYGAKAQ  121



>gb|KGN55450.1| hypothetical protein Csa_4G652140 [Cucumis sativus]
Length=351

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 63/106 (59%), Gaps = 9/106 (8%)
 Frame = +1

Query  343  IKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSG-PEPVSGFYIAVLVGGETVL  519
            I+P +  KK GS+KL  S        +VFWDL RA+F S  PEP SGF+IAV+V GE  L
Sbjct  91   IRPLIPWKKHGSEKLSDS-------IHVFWDLRRARFSSSSPEPCSGFFIAVVVDGEMTL  143

Query  520  LIGDCQXEAYAKTRARHAGNG-QALVLKREHVYGGKLYATKSNVGG  654
            L+GD   EA  K RA       Q L+LKREHV   K+Y TK+   G
Sbjct  144  LVGDMVKEASKKIRAAKPPQVLQTLILKREHVTAHKVYTTKAKFAG  189



>ref|XP_008793736.1| PREDICTED: uncharacterized protein LOC103709963 [Phoenix dactylifera]
 ref|XP_008804211.1| PREDICTED: uncharacterized protein LOC103717555 [Phoenix dactylifera]
Length=315

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 82/163 (50%), Gaps = 19/163 (12%)
 Frame = +1

Query  172  YRTGLG----LFAVTWSRDLL--GRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSF  333
            YRT +     L  VTW +D+L  G S  +    D         ++ +           S 
Sbjct  38   YRTKIAGHCRLITVTWCKDVLVHGLSVSVEERSDSVDETNININTNQHM---------SC  88

Query  334  HFRIKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGET  513
               ++P+ F +K GSK+  +      K  +VFWDL  AKF   PEP S +Y+AV+   E 
Sbjct  89   KVELRPWYFWRKHGSKRFHVEG----KPVDVFWDLKSAKFSGEPEPQSNYYVAVVSDEEV  144

Query  514  VLLIGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKS  642
            VLL+GD   EAY +T +R A     LV ++EHV+G + +ATK+
Sbjct  145  VLLLGDLNTEAYRRTGSRPATIDATLVSRKEHVFGRRRFATKA  187



>ref|XP_008235300.1| PREDICTED: uncharacterized protein LOC103334137 isoform X2 [Prunus 
mume]
Length=245

 Score = 89.0 bits (219),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 63/100 (63%), Gaps = 5/100 (5%)
 Frame = +1

Query  343  IKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLL  522
            IKP++FSK++G + L++ ++      +++WDL+ AKFGSGPEP+  FY+AV+   E VL 
Sbjct  22   IKPWLFSKRKGCRNLEVDTN----KIDIYWDLTNAKFGSGPEPLEKFYLAVMFNQEMVLF  77

Query  523  IGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKS  642
            +GD + EA+ K            + KREH++G K Y  K+
Sbjct  78   LGDLKREAFNKDPVGSISRA-TFIAKREHIFGKKFYGAKT  116



>gb|EYU45648.1| hypothetical protein MIMGU_mgv1a010996mg [Erythranthe guttata]
Length=295

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 84/152 (55%), Gaps = 25/152 (16%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  + WS++L+G+   +   +DDS                  S    F   +KP +FSK+
Sbjct  47   LITILWSKNLMGQCLSIE--IDDS------------------SHRLIFKVDVKPSLFSKR  86

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +GSK  + +S+       +FWDLS A FGSG EP+  +YI V+  GE VLLIGD + EA+
Sbjct  87   KGSKYFEANSA----KIEIFWDLSSANFGSGSEPLDSYYICVVCKGEMVLLIGDLREEAF  142

Query  550  AKTRARHAGNGQ-ALVLKREHVYGGKLYATKS  642
             KT A  + + + + V K EH++G +++ TK+
Sbjct  143  KKTGAIGSVSSETSFVSKIEHLFGKRVFNTKA  174



>emb|CDP13671.1| unnamed protein product [Coffea canephora]
Length=307

 Score = 89.4 bits (220),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 82/151 (54%), Gaps = 22/151 (15%)
 Frame = +1

Query  199  VTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKKQGS  378
            V+WS+ L+G S  LH L+++                 S     +    +K + F  K+G 
Sbjct  52   VSWSKSLMGHS--LHILVEN----------------PSEENHSTCKIDLKTWQFWGKKGL  93

Query  379  KKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAYAKT  558
            K  ++    G +  +VFWDL  AKF S PEPVS +Y+A++   E VLL+GD + EAY +T
Sbjct  94   KSFKV----GERRVDVFWDLRTAKFSSSPEPVSDYYVALVSEKELVLLLGDQKTEAYKRT  149

Query  559  RARHAGNGQALVLKREHVYGGKLYATKSNVG  651
            R++ +    ALV K+E V+  + + T++ +G
Sbjct  150  RSKPSPMDAALVHKKESVFAKRCFCTRTMLG  180



>ref|NP_001143196.1| uncharacterized protein LOC100275698 [Zea mays]
 gb|ACG29652.1| hypothetical protein [Zea mays]
Length=284

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 82/156 (53%), Gaps = 24/156 (15%)
 Frame = +1

Query  175  RTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPF  354
            R    +  VTWS+  +G++F +                  D+    L  A      +KP+
Sbjct  36   RDKRCVVTVTWSKVAMGQAFAIAI---------------HDYSNRCLCKA-----EVKPW  75

Query  355  MFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDC  534
            +FSK++GSK +++ S     N  + WDLS AKF +GPEP+ GF++A+L G E VL++G+ 
Sbjct  76   LFSKRKGSKVMELDSG----NVEIIWDLSAAKFAAGPEPLEGFHVALLYGLEVVLVLGNL  131

Query  535  QXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKS  642
              E   +  +  +     ++ ++EH+Y  K+Y+ K+
Sbjct  132  SKEEDHRVLSDASHCDAVMIARKEHIYAKKMYSAKA  167



>ref|XP_008651185.1| PREDICTED: uncharacterized protein LOC100275698 isoform X1 [Zea 
mays]
 gb|ACF82722.1| unknown [Zea mays]
 gb|ACN25273.1| unknown [Zea mays]
 tpg|DAA63241.1| TPA: hypothetical protein ZEAMMB73_389417 [Zea mays]
 tpg|DAA63242.1| TPA: hypothetical protein ZEAMMB73_389417 [Zea mays]
Length=284

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 82/156 (53%), Gaps = 24/156 (15%)
 Frame = +1

Query  175  RTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPF  354
            R    +  VTWS+  +G++F +                  D+    L  A      +KP+
Sbjct  36   RDKPCVVTVTWSKVAMGQAFAIAI---------------HDYSNRCLCKA-----EVKPW  75

Query  355  MFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDC  534
            +FSK++GSK +++ S     N  + WDLS AKF +GPEP+ GF++A+L G E VL++G+ 
Sbjct  76   LFSKRKGSKVMELDSG----NVEIIWDLSAAKFAAGPEPLEGFHVALLYGLEVVLVLGNL  131

Query  535  QXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKS  642
              E   +  +  +     ++ ++EH+Y  K+Y+ K+
Sbjct  132  SKEEDHRVLSDASHCDAVMIARKEHIYAKKMYSAKA  167



>ref|XP_011079867.1| PREDICTED: uncharacterized protein LOC105163276 [Sesamum indicum]
Length=303

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 66/103 (64%), Gaps = 6/103 (6%)
 Frame = +1

Query  343  IKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLL  522
            +KP++FSK++G K L + S+      +V WDLS AKFGSGPEP+ GFY+AV +  E  LL
Sbjct  77   VKPWLFSKRKGFKNLALDST----TVDVHWDLSSAKFGSGPEPLEGFYLAVSLNQELCLL  132

Query  523  IGDCQXEAYAKTRARHAGNGQ--ALVLKREHVYGGKLYATKSN  645
            +GD + EA  +  +      Q    V KREH++G +LY++K+ 
Sbjct  133  LGDLEHEACKRVDSISIPVVQRATFVAKREHIFGKRLYSSKAQ  175



>ref|XP_004493685.1| PREDICTED: uncharacterized protein LOC101510231 [Cicer arietinum]
Length=305

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 79/154 (51%), Gaps = 26/154 (17%)
 Frame = +1

Query  190  LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKPFMFSKK  369
            L  V+W+++L+G+   +                        L         IKP++FSK+
Sbjct  47   LITVSWTKNLMGQGLSIGI--------------------DELGNHCICKVDIKPWLFSKR  86

Query  370  QGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLIGDCQXEAY  549
            +G K L++ SS  +    + WDLS AKFGSGPEP+ G+Y+ VL   + VLL+GD + EA 
Sbjct  87   KGCKNLEVESSKIV----ILWDLSYAKFGSGPEPLEGYYLVVLFNKKMVLLLGDLKKEAC  142

Query  550  AKT-RARHAGNGQAL-VLKREHVYGGKLYATKSN  645
             K  R   +    A+ + KREH++G + Y  K+ 
Sbjct  143  KKIDRDSVSVKSDAIFIAKREHIFGKRFYCVKAQ  176



>gb|AFK39419.1| unknown [Lotus japonicus]
Length=322

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 64/102 (63%), Gaps = 3/102 (3%)
 Frame = +1

Query  340  RIKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVL  519
             +KP+ F +KQGSK+  I    G K  +VFWDL  AKF    EP+S +Y+AV+   E VL
Sbjct  83   ELKPWYFWRKQGSKRFIID---GTKAVDVFWDLKGAKFNGETEPISEYYVAVVCDEEVVL  139

Query  520  LIGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
            L+GD + EAY +T  R A     LV K+EH++G K ++T++ 
Sbjct  140  LLGDLKKEAYRRTGCRPALIDPILVSKKEHIFGKKRFSTRAK  181



>emb|CDP03641.1| unnamed protein product [Coffea canephora]
Length=278

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 61/100 (61%), Gaps = 4/100 (4%)
 Frame = +1

Query  343  IKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLL  522
            IKP++F+ ++G +  +  S+      +++WD S AKFG GPEP+ GFY+AV    E VLL
Sbjct  56   IKPWLFTPRKGFRSSEADSTA----IDIYWDFSSAKFGFGPEPLEGFYLAVAFNQELVLL  111

Query  523  IGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKS  642
            +GD Q E Y K       +    + KREH++G ++Y TK+
Sbjct  112  LGDLQKEVYKKIGTSPVASNTVFIAKREHIFGKRVYTTKA  151



>ref|NP_001060057.1| Os07g0572300 [Oryza sativa Japonica Group]
 dbj|BAC84673.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF21971.1| Os07g0572300 [Oryza sativa Japonica Group]
 gb|EAZ40371.1| hypothetical protein OsJ_24817 [Oryza sativa Japonica Group]
 dbj|BAG93762.1| unnamed protein product [Oryza sativa Japonica Group]
Length=284

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 67/101 (66%), Gaps = 4/101 (4%)
 Frame = +1

Query  340  RIKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVL  519
             IKP++FSK++GSK +++   G L   ++ WDLS AKF +GPEPV GFY+A++   E VL
Sbjct  71   EIKPWLFSKRKGSKAMEVDG-GAL---DIVWDLSSAKFAAGPEPVEGFYVALVCDLEAVL  126

Query  520  LIGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKS  642
            ++GD + +   +  +    +   ++ ++EHVYG K+Y+ K+
Sbjct  127  VLGDMRKDGDHRVSSDVLASNAVMIARKEHVYGKKVYSAKA  167



>ref|XP_010929912.1| PREDICTED: uncharacterized protein LOC105051269 [Elaeis guineensis]
Length=314

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 86/161 (53%), Gaps = 16/161 (10%)
 Frame = +1

Query  172  YRTGLG----LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHF  339
            YRT +     L  VTW +D+L     +H L   S + A    +  +   ++ +   S   
Sbjct  38   YRTKIAGHCRLITVTWCKDVL-----VHGL---SVSVAERSDNADETNTNTNTNQHSCKV  89

Query  340  RIKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVL  519
             ++P+ F +K GSK+  +      K  +VFWDL  AKF   P+P S +Y+AV+   E VL
Sbjct  90   ELRPWYFWRKHGSKRFHVEG----KPVDVFWDLKNAKFSGEPQPQSNYYVAVVSDEEVVL  145

Query  520  LIGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKS  642
            L+GD   EAY +T +R A     LV ++EHV+G K +AT++
Sbjct  146  LLGDLNMEAYRRTGSRPATIDATLVSRKEHVFGKKRFATRA  186



>ref|XP_008669644.1| PREDICTED: uncharacterized protein LOC103646740 [Zea mays]
Length=152

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 60/101 (59%), Gaps = 4/101 (4%)
 Frame = +1

Query  343  IKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLL  522
            IK ++FSKK+ S+ L +  S       VFWDL+ A+F   PEPV GFY+ V+   E  LL
Sbjct  14   IKLWLFSKKKWSRSLDVEDS----KVKVFWDLADARFSVEPEPVEGFYVVVVFYLELALL  69

Query  523  IGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKSN  645
            + D + +AY KTRA         + +REH+YG K+++ K+ 
Sbjct  70   LDDMKKDAYRKTRASQLTMNAPFMARREHIYGKKIHSAKAQ  110



>ref|XP_008811744.1| PREDICTED: uncharacterized protein LOC103722827 [Phoenix dactylifera]
Length=315

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 77/161 (48%), Gaps = 17/161 (11%)
 Frame = +1

Query  172  YRTGLG----LFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHF  339
            YRT +     L  VTW RD+      +  + D  +       S         S   S   
Sbjct  38   YRTMIAGHCRLITVTWCRDVRVHGLSISVVEDSDNVDETNMIS---------SKRHSCKV  88

Query  340  RIKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVL  519
             ++P+ F +K G K+  +      K  +VFWDL  AKF   PEP S +Y+AV+   E VL
Sbjct  89   ELRPWCFWRKHGWKRFHVEG----KPVDVFWDLKSAKFSGEPEPRSDYYVAVVSDDEVVL  144

Query  520  LIGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKS  642
            L+GD   EAY +T +R A     LV ++EHV+G K +  +S
Sbjct  145  LLGDLNKEAYRRTGSRPAAIDATLVSRKEHVFGKKRFVARS  185



>ref|XP_004495197.1| PREDICTED: uncharacterized protein LOC101503605 [Cicer arietinum]
Length=289

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 63/105 (60%), Gaps = 9/105 (9%)
 Frame = +1

Query  340  RIKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVL  519
             IKP++FSK++GSK L++          +FWD S AKFGSGPEP+ GFY+AV+   E VL
Sbjct  74   EIKPWLFSKRKGSKNLEVQ----FGKVEIFWDFSFAKFGSGPEPLEGFYLAVVFNHEMVL  129

Query  520  LIGDCQXEAYAKTRAR-----HAGNGQALVLKREHVYGGKLYATK  639
            L+GD + EA  K   +      + +    + K+EH++G   Y TK
Sbjct  130  LLGDLKNEACKKIHNKSNFVVDSHSSAVFIGKKEHIFGKMFYGTK  174



>ref|XP_010228241.1| PREDICTED: uncharacterized protein LOC100838117 [Brachypodium 
distachyon]
Length=299

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 63/101 (62%), Gaps = 5/101 (5%)
 Frame = +1

Query  346  KPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVLLI  525
            KP++FSKK+GSK L    + G     +FWDLS AKFG GPEP+ GFY+AV+   E VLL+
Sbjct  84   KPWLFSKKKGSKSL----AAGDGKIGIFWDLSGAKFGPGPEPLEGFYVAVMFNREMVLLL  139

Query  526  GDCQXEAYAKT-RARHAGNGQALVLKREHVYGGKLYATKSN  645
            GD + +AY K   A         + ++EH++G KLY  K+ 
Sbjct  140  GDMKKDAYRKMGGAVRPALSTLFLARKEHIHGKKLYCAKAQ  180



>gb|EAZ04414.1| hypothetical protein OsI_26558 [Oryza sativa Indica Group]
Length=284

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 67/101 (66%), Gaps = 4/101 (4%)
 Frame = +1

Query  340  RIKPFMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKFGSGPEPVSGFYIAVLVGGETVL  519
             IKP++FSK++GSK +++   G L   ++ WDLS AKF +GPEPV GFY+A++   E VL
Sbjct  71   EIKPWLFSKRKGSKAMEVDG-GAL---DIVWDLSSAKFAAGPEPVEGFYVALVCDLEAVL  126

Query  520  LIGDCQXEAYAKTRARHAGNGQALVLKREHVYGGKLYATKS  642
            ++GD + +   +  +    +   ++ ++EHVYG K+Y+ K+
Sbjct  127  VLGDMRKDGDHRVSSDVLASNAVMISRKEHVYGKKVYSAKA  167



>ref|XP_008808239.1| PREDICTED: uncharacterized protein LOC103720353 [Phoenix dactylifera]
Length=437

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 89/170 (52%), Gaps = 16/170 (9%)
 Frame = +1

Query  172  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  351
            Y T LGL A++WSR + G    L    D   A     + P +          +F F ++P
Sbjct  78   YETRLGLAALSWSRTVFG----LSLRADLRFAGGGSAAVPEEENDDDEE---TFRFHLRP  130

Query  352  FMFSKKQGSKKLQISSSGGLKNANVFWDLSRAKF--GSGPEPVSGFYIAVLVGGETVLLI  525
            ++F K++GSK+  +      +     WDL+RA+F  G GPEP SG+++AV V GE +L+ 
Sbjct  131  WLFWKRRGSKRFHLKDYSPHRTVEFSWDLTRARFPAGGGPEPSSGYFVAVAVDGEMLLVA  190

Query  526  GDCQXEAYAKTRARHAGN--GQALVLKREHVY-----GGKLYATKSNVGG  654
            GD   EAY K++A    +     L+ +REHV      GG+ Y T++  GG
Sbjct  191  GDLVDEAYRKSKAAKGNSLRNPILISRREHVVLRDSGGGRSYKTRALFGG  240



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1014965446875