BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF041B21

Length=654
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006347553.1|  PREDICTED: aluminum-activated malate transpo...    114   8e-26   Solanum tuberosum [potatoes]
ref|XP_004235305.1|  PREDICTED: aluminum-activated malate transpo...    112   5e-25   
ref|XP_009619311.1|  PREDICTED: aluminum-activated malate transpo...    107   3e-23   Nicotiana tomentosiformis
ref|XP_009795348.1|  PREDICTED: aluminum-activated malate transpo...    106   6e-23   Nicotiana sylvestris
gb|EYU45360.1|  hypothetical protein MIMGU_mgv1a003565mg                104   3e-22   Erythranthe guttata [common monkey flower]
ref|XP_006347472.1|  PREDICTED: aluminum-activated malate transpo...    101   3e-21   Solanum tuberosum [potatoes]
ref|XP_011075828.1|  PREDICTED: aluminum-activated malate transpo...    101   4e-21   Sesamum indicum [beniseed]
ref|XP_009628763.1|  PREDICTED: aluminum-activated malate transpo...  97.1    1e-19   Nicotiana tomentosiformis
ref|XP_009803276.1|  PREDICTED: aluminum-activated malate transpo...  96.7    2e-19   Nicotiana sylvestris
ref|XP_004135406.1|  PREDICTED: aluminum-activated malate transpo...  94.0    1e-18   Cucumis sativus [cucumbers]
ref|XP_004242127.1|  PREDICTED: aluminum-activated malate transpo...  94.0    2e-18   Solanum lycopersicum
gb|EYU19727.1|  hypothetical protein MIMGU_mgv1a003372mg              93.2    3e-18   Erythranthe guttata [common monkey flower]
gb|KDO38904.1|  hypothetical protein CISIN_1g048543mg                 89.7    6e-18   Citrus sinensis [apfelsine]
ref|XP_008446577.1|  PREDICTED: aluminum-activated malate transpo...  90.9    2e-17   Cucumis melo [Oriental melon]
ref|XP_004297128.1|  PREDICTED: aluminum-activated malate transpo...  90.5    2e-17   Fragaria vesca subsp. vesca
ref|XP_006484436.1|  PREDICTED: aluminum-activated malate transpo...  89.7    4e-17   Citrus sinensis [apfelsine]
ref|XP_006437702.1|  hypothetical protein CICLE_v10031089mg           89.7    4e-17   Citrus clementina [clementine]
ref|XP_008350864.1|  PREDICTED: LOW QUALITY PROTEIN: aluminum-act...  89.4    5e-17   
ref|XP_004512938.1|  PREDICTED: aluminum-activated malate transpo...  89.0    8e-17   Cicer arietinum [garbanzo]
ref|XP_007046271.1|  Aluminum activated malate transporter family...  88.2    1e-16   
ref|XP_006341623.1|  PREDICTED: aluminum-activated malate transpo...  88.2    2e-16   Solanum tuberosum [potatoes]
ref|XP_011021871.1|  PREDICTED: aluminum-activated malate transpo...  87.8    2e-16   Populus euphratica
ref|XP_010102835.1|  Aluminum-activated malate transporter 4          88.2    2e-16   Morus notabilis
gb|KHG13463.1|  Aluminum-activated malate transporter 6 -like pro...  85.5    4e-16   Gossypium arboreum [tree cotton]
gb|KJB50732.1|  hypothetical protein B456_008G184400                  86.7    4e-16   Gossypium raimondii
ref|XP_007222460.1|  hypothetical protein PRUPE_ppa003480mg           86.7    5e-16   Prunus persica
gb|KJB50731.1|  hypothetical protein B456_008G184400                  86.7    5e-16   Gossypium raimondii
gb|KJB50733.1|  hypothetical protein B456_008G184400                  86.7    5e-16   Gossypium raimondii
ref|XP_009616234.1|  PREDICTED: aluminum-activated malate transpo...  86.7    5e-16   
ref|XP_008243200.1|  PREDICTED: aluminum-activated malate transpo...  86.7    5e-16   Prunus mume [ume]
emb|CAN68659.1|  hypothetical protein VITISV_002161                   86.3    7e-16   Vitis vinifera
ref|XP_002278978.1|  PREDICTED: aluminum-activated malate transpo...  85.9    8e-16   Vitis vinifera
ref|XP_002312386.2|  hypothetical protein POPTR_0008s11740g           85.9    9e-16   Populus trichocarpa [western balsam poplar]
ref|XP_009360165.1|  PREDICTED: aluminum-activated malate transpo...  80.9    1e-15   Pyrus x bretschneideri [bai li]
emb|CBI27043.3|  unnamed protein product                              85.9    1e-15   Vitis vinifera
ref|XP_006374353.1|  hypothetical protein POPTR_0015s06340g           84.7    2e-15   Populus trichocarpa [western balsam poplar]
ref|XP_010318605.1|  PREDICTED: aluminum-activated malate transpo...  84.7    3e-15   
ref|XP_007036504.1|  Aluminum-activated malate transporter 9          84.3    3e-15   
ref|XP_010932631.1|  PREDICTED: aluminum-activated malate transpo...  84.0    4e-15   Elaeis guineensis
ref|XP_010027833.1|  PREDICTED: aluminum-activated malate transpo...  84.0    4e-15   Eucalyptus grandis [rose gum]
ref|XP_009764790.1|  PREDICTED: aluminum-activated malate transpo...  84.0    5e-15   Nicotiana sylvestris
gb|KHG29903.1|  Aluminum-activated malate transporter 4 -like pro...  83.2    6e-15   Gossypium arboreum [tree cotton]
gb|EPS71908.1|  hypothetical protein M569_02848                       82.8    7e-15   Genlisea aurea
gb|KJB50413.1|  hypothetical protein B456_008G169600                  82.8    9e-15   Gossypium raimondii
ref|XP_006440948.1|  hypothetical protein CICLE_v10019485mg           82.4    1e-14   Citrus clementina [clementine]
ref|XP_010480664.1|  PREDICTED: aluminum-activated malate transpo...  81.6    2e-14   
gb|KDP29386.1|  hypothetical protein JCGZ_18307                       82.0    2e-14   Jatropha curcas
ref|XP_010102834.1|  Aluminum-activated malate transporter 4          82.0    2e-14   Morus notabilis
ref|XP_010460370.1|  PREDICTED: aluminum-activated malate transpo...  81.6    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_009360189.1|  PREDICTED: aluminum-activated malate transpo...  80.5    2e-14   Pyrus x bretschneideri [bai li]
gb|KHG02535.1|  Aluminum-activated malate transporter 9 -like pro...  81.6    3e-14   Gossypium arboreum [tree cotton]
ref|XP_006485776.1|  PREDICTED: aluminum-activated malate transpo...  81.6    3e-14   Citrus sinensis [apfelsine]
ref|XP_010499104.1|  PREDICTED: aluminum-activated malate transpo...  81.3    3e-14   Camelina sativa [gold-of-pleasure]
ref|XP_008812805.1|  PREDICTED: aluminum-activated malate transpo...  81.3    3e-14   
ref|XP_009356494.1|  PREDICTED: aluminum-activated malate transpo...  81.3    3e-14   
ref|XP_009356502.1|  PREDICTED: aluminum-activated malate transpo...  80.9    4e-14   
ref|XP_004298293.1|  PREDICTED: aluminum-activated malate transpo...  81.3    4e-14   Fragaria vesca subsp. vesca
emb|CBI15440.3|  unnamed protein product                              80.5    5e-14   Vitis vinifera
ref|XP_008367579.1|  PREDICTED: aluminum-activated malate transpo...  80.9    5e-14   
ref|XP_008374744.1|  PREDICTED: aluminum-activated malate transpo...  80.5    6e-14   Malus domestica [apple tree]
ref|XP_008361730.1|  PREDICTED: aluminum-activated malate transpo...  80.5    6e-14   
ref|XP_002275995.1|  PREDICTED: aluminum-activated malate transpo...  80.5    6e-14   Vitis vinifera
ref|XP_011084604.1|  PREDICTED: aluminum-activated malate transpo...  79.7    6e-14   
ref|XP_006307134.1|  hypothetical protein CARUB_v10008724mg           80.1    7e-14   Capsella rubella
ref|XP_011084603.1|  PREDICTED: aluminum-activated malate transpo...  79.7    8e-14   
ref|XP_002893421.1|  predicted protein                                80.1    8e-14   Arabidopsis lyrata subsp. lyrata
ref|XP_008361731.1|  PREDICTED: aluminum-activated malate transpo...  79.7    8e-14   
ref|XP_002278994.2|  PREDICTED: aluminum-activated malate transpo...  79.7    8e-14   
ref|XP_002529137.1|  conserved hypothetical protein                   80.1    8e-14   Ricinus communis
ref|XP_010477920.1|  PREDICTED: aluminum-activated malate transpo...  79.7    9e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010094774.1|  Aluminum-activated malate transporter 9          79.7    1e-13   Morus notabilis
ref|XP_008240281.1|  PREDICTED: aluminum-activated malate transpo...  79.7    1e-13   
ref|XP_010681586.1|  PREDICTED: aluminum-activated malate transpo...  79.7    1e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011084602.1|  PREDICTED: aluminum-activated malate transpo...  79.7    1e-13   Sesamum indicum [beniseed]
ref|XP_008812807.1|  PREDICTED: LOW QUALITY PROTEIN: aluminum-act...  79.0    1e-13   
gb|KHN20718.1|  Aluminum-activated malate transporter 9               79.3    1e-13   Glycine soja [wild soybean]
ref|XP_003530009.2|  PREDICTED: aluminum-activated malate transpo...  79.3    1e-13   Glycine max [soybeans]
ref|XP_006583403.1|  PREDICTED: aluminum-activated malate transpo...  79.0    2e-13   
emb|CDX84992.1|  BnaC05g20630D                                        79.0    2e-13   
ref|XP_009410081.1|  PREDICTED: aluminum-activated malate transpo...  79.0    2e-13   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU40877.1|  hypothetical protein MIMGU_mgv1a0220201mg             73.6    2e-13   Erythranthe guttata [common monkey flower]
emb|CDY42102.1|  BnaA09g28580D                                        78.2    3e-13   Brassica napus [oilseed rape]
ref|XP_007160366.1|  hypothetical protein PHAVU_002G315500g           78.2    3e-13   Phaseolus vulgaris [French bean]
gb|KJB37235.1|  hypothetical protein B456_006G195100                  78.2    3e-13   Gossypium raimondii
ref|XP_010487770.1|  PREDICTED: aluminum-activated malate transpo...  78.2    4e-13   Camelina sativa [gold-of-pleasure]
emb|CDY18521.1|  BnaA01g26740D                                        78.2    4e-13   Brassica napus [oilseed rape]
ref|XP_003555230.1|  PREDICTED: aluminum-activated malate transpo...  77.4    5e-13   
ref|XP_002314876.2|  hypothetical protein POPTR_0010s13750g           77.4    6e-13   
ref|XP_002883132.1|  hypothetical protein ARALYDRAFT_898211           77.4    6e-13   Arabidopsis lyrata subsp. lyrata
ref|XP_004170574.1|  PREDICTED: LOW QUALITY PROTEIN: aluminum-act...  77.4    6e-13   
ref|XP_004138239.1|  PREDICTED: aluminum-activated malate transpo...  77.4    6e-13   Cucumis sativus [cucumbers]
ref|XP_011012696.1|  PREDICTED: aluminum-activated malate transpo...  77.4    7e-13   Populus euphratica
ref|XP_006406604.1|  hypothetical protein EUTSA_v10020343mg           77.4    7e-13   Eutrema salsugineum [saltwater cress]
ref|XP_009112721.1|  PREDICTED: aluminum-activated malate transpo...  77.0    7e-13   Brassica rapa
ref|NP_188473.1|  aluminum-activated malate transporter 9             77.0    8e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003517985.1|  PREDICTED: aluminum-activated malate transpo...  77.0    8e-13   Glycine max [soybeans]
ref|XP_010265178.1|  PREDICTED: aluminum-activated malate transpo...  77.0    8e-13   Nelumbo nucifera [Indian lotus]
ref|XP_009347009.1|  PREDICTED: aluminum-activated malate transpo...  77.0    9e-13   Pyrus x bretschneideri [bai li]
gb|KFK44528.1|  hypothetical protein AALP_AA1G268500                  76.6    9e-13   Arabis alpina [alpine rockcress]
ref|XP_003533369.2|  PREDICTED: aluminum-activated malate transpo...  76.6    1e-12   Glycine max [soybeans]
ref|XP_003525258.2|  PREDICTED: aluminum-activated malate transpo...  76.6    1e-12   
gb|KHN21560.1|  Aluminum-activated malate transporter 9               76.6    1e-12   Glycine soja [wild soybean]
ref|XP_010419692.1|  PREDICTED: aluminum-activated malate transpo...  76.6    1e-12   
ref|XP_006297257.1|  hypothetical protein CARUB_v10013270mg           76.6    1e-12   Capsella rubella
ref|XP_008453386.1|  PREDICTED: aluminum-activated malate transpo...  76.6    1e-12   Cucumis melo [Oriental melon]
ref|XP_007142895.1|  hypothetical protein PHAVU_007G025900g           76.3    1e-12   Phaseolus vulgaris [French bean]
ref|XP_003630843.1|  hypothetical protein MTR_8g104130                76.3    2e-12   
ref|XP_011008233.1|  PREDICTED: aluminum-activated malate transpo...  75.9    2e-12   Populus euphratica
ref|XP_010487771.1|  PREDICTED: aluminum-activated malate transpo...  76.3    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_006584854.1|  PREDICTED: aluminum-activated malate transpo...  75.5    2e-12   Glycine max [soybeans]
ref|XP_003532498.1|  PREDICTED: aluminum-activated malate transpo...  75.5    2e-12   Glycine max [soybeans]
ref|XP_003630841.1|  hypothetical protein MTR_8g104110                75.5    3e-12   Medicago truncatula
emb|CDY26161.1|  BnaA06g12560D                                        75.5    3e-12   Brassica napus [oilseed rape]
ref|XP_004300533.1|  PREDICTED: aluminum-activated malate transpo...  75.5    3e-12   Fragaria vesca subsp. vesca
ref|XP_009149285.1|  PREDICTED: putative aluminum-activated malat...  75.5    3e-12   Brassica rapa
ref|XP_009381461.1|  PREDICTED: aluminum-activated malate transpo...  75.1    3e-12   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU40875.1|  hypothetical protein MIMGU_mgv1a003508mg              75.1    3e-12   Erythranthe guttata [common monkey flower]
gb|AAW81734.1|  Putative expressed protein                            75.1    3e-12   Brassica oleracea
ref|XP_010498230.1|  PREDICTED: putative aluminum-activated malat...  75.1    3e-12   Camelina sativa [gold-of-pleasure]
emb|CDY19211.1|  BnaC05g14120D                                        75.1    4e-12   Brassica napus [oilseed rape]
gb|KEH27049.1|  aluminum activated malate transporter family protein  75.1    4e-12   Medicago truncatula
ref|XP_006362575.1|  PREDICTED: aluminum-activated malate transpo...  73.6    4e-12   
ref|XP_010477020.1|  PREDICTED: putative aluminum-activated malat...  74.7    5e-12   Camelina sativa [gold-of-pleasure]
ref|XP_009115329.1|  PREDICTED: aluminum-activated malate transpo...  74.7    5e-12   
gb|KFK39175.1|  hypothetical protein AALP_AA3G210100                  74.7    5e-12   Arabis alpina [alpine rockcress]
ref|XP_010459458.1|  PREDICTED: putative aluminum-activated malat...  74.7    5e-12   Camelina sativa [gold-of-pleasure]
ref|NP_173919.1|  Aluminum activated malate transporter family pr...  74.3    6e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007152778.1|  hypothetical protein PHAVU_004G158900g           74.3    6e-12   Phaseolus vulgaris [French bean]
ref|XP_009617358.1|  PREDICTED: aluminum-activated malate transpo...  73.9    7e-12   Nicotiana tomentosiformis
ref|XP_004298292.1|  PREDICTED: aluminum-activated malate transpo...  73.9    8e-12   Fragaria vesca subsp. vesca
ref|XP_006838424.1|  hypothetical protein AMTR_s00002p00112740        73.9    8e-12   Amborella trichopoda
emb|CDY24400.1|  BnaCnng04670D                                        73.9    8e-12   Brassica napus [oilseed rape]
ref|XP_010465944.1|  PREDICTED: aluminum-activated malate transpo...  73.9    9e-12   Camelina sativa [gold-of-pleasure]
gb|KFK44001.1|  hypothetical protein AALP_AA1G202000                  73.6    1e-11   Arabis alpina [alpine rockcress]
ref|XP_006415877.1|  hypothetical protein EUTSA_v10007220mg           73.6    1e-11   Eutrema salsugineum [saltwater cress]
gb|KHN21559.1|  Aluminum-activated malate transporter 9               73.6    1e-11   Glycine soja [wild soybean]
ref|XP_004238944.1|  PREDICTED: aluminum-activated malate transpo...  73.6    1e-11   Solanum lycopersicum
ref|XP_010677979.1|  PREDICTED: aluminum-activated malate transpo...  73.6    1e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003524381.1|  PREDICTED: aluminum-activated malate transpo...  73.6    1e-11   Glycine max [soybeans]
ref|XP_010534735.1|  PREDICTED: aluminum-activated malate transpo...  70.9    1e-11   Tarenaya hassleriana [spider flower]
emb|CDX95521.1|  BnaC01g34130D                                        73.9    1e-11   
ref|XP_008243202.1|  PREDICTED: aluminum-activated malate transpo...  73.2    2e-11   Prunus mume [ume]
ref|XP_007046270.1|  Aluminum-activated malate transporter 9          73.2    2e-11   Theobroma cacao [chocolate]
ref|XP_003630842.1|  Aluminum activated malate transporter            73.2    2e-11   
gb|EYU28992.1|  hypothetical protein MIMGU_mgv1a017875mg              71.2    2e-11   Erythranthe guttata [common monkey flower]
ref|XP_006589701.1|  PREDICTED: aluminum-activated malate transpo...  72.4    2e-11   
ref|XP_003536690.1|  PREDICTED: aluminum-activated malate transpo...  72.8    2e-11   Glycine max [soybeans]
gb|KHN05579.1|  Aluminum-activated malate transporter 4               72.8    2e-11   Glycine soja [wild soybean]
ref|XP_010551282.1|  PREDICTED: aluminum-activated malate transpo...  72.8    2e-11   Tarenaya hassleriana [spider flower]
ref|XP_009761788.1|  PREDICTED: aluminum-activated malate transpo...  72.4    2e-11   Nicotiana sylvestris
ref|XP_006297373.1|  hypothetical protein CARUB_v10013392mg           72.4    3e-11   
ref|XP_009109882.1|  PREDICTED: aluminum-activated malate transpo...  72.4    3e-11   Brassica rapa
ref|XP_003530492.1|  PREDICTED: aluminum-activated malate transpo...  72.4    3e-11   Glycine max [soybeans]
ref|XP_007222486.1|  hypothetical protein PRUPE_ppa004106mg           71.6    4e-11   
ref|XP_010459460.1|  PREDICTED: putative aluminum-activated malat...  71.6    5e-11   
gb|AET05318.2|  aluminum activated malate transporter family protein  71.6    5e-11   Medicago truncatula
ref|XP_011077123.1|  PREDICTED: aluminum-activated malate transpo...  71.6    5e-11   Sesamum indicum [beniseed]
ref|XP_008360056.1|  PREDICTED: aluminum-activated malate transpo...  71.2    6e-11   
gb|KDP20105.1|  hypothetical protein JCGZ_05874                       71.2    6e-11   Jatropha curcas
ref|XP_006416605.1|  hypothetical protein EUTSA_v10007198mg           71.2    6e-11   Eutrema salsugineum [saltwater cress]
ref|XP_010031884.1|  PREDICTED: aluminum-activated malate transpo...  71.2    7e-11   Eucalyptus grandis [rose gum]
gb|KJB50730.1|  hypothetical protein B456_008G184300                  70.9    7e-11   Gossypium raimondii
ref|XP_010527530.1|  PREDICTED: aluminum-activated malate transpo...  70.9    7e-11   Tarenaya hassleriana [spider flower]
ref|XP_002890274.1|  predicted protein                                70.9    7e-11   
ref|XP_010097443.1|  Aluminum-activated malate transporter 9          70.9    8e-11   
ref|XP_010551149.1|  PREDICTED: aluminum-activated malate transpo...  70.9    9e-11   Tarenaya hassleriana [spider flower]
ref|XP_010102832.1|  Aluminum-activated malate transporter 9          70.9    9e-11   
ref|NP_173278.1|  putative aluminum-activated malate transporter 3    70.5    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004497108.1|  PREDICTED: aluminum-activated malate transpo...  70.5    1e-10   Cicer arietinum [garbanzo]
ref|XP_007160367.1|  hypothetical protein PHAVU_002G315600g           70.1    2e-10   Phaseolus vulgaris [French bean]
gb|KJB52978.1|  hypothetical protein B456_008G286300                  69.7    2e-10   Gossypium raimondii
gb|KJB52977.1|  hypothetical protein B456_008G286300                  69.3    2e-10   Gossypium raimondii
gb|KHG23241.1|  Aluminum-activated malate transporter 9 -like pro...  69.7    2e-10   Gossypium arboreum [tree cotton]
gb|KJB52976.1|  hypothetical protein B456_008G286300                  69.3    2e-10   Gossypium raimondii
emb|CDY36105.1|  BnaA08g19430D                                        69.3    2e-10   Brassica napus [oilseed rape]
ref|XP_011078420.1|  PREDICTED: aluminum-activated malate transpo...  69.3    3e-10   Sesamum indicum [beniseed]
ref|XP_010467518.1|  PREDICTED: aluminum-activated malate transpo...  68.9    3e-10   
ref|XP_010489374.1|  PREDICTED: aluminum-activated malate transpo...  68.9    3e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010514996.1|  PREDICTED: aluminum-activated malate transpo...  68.9    3e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010320773.1|  PREDICTED: aluminum-activated malate transpo...  68.6    5e-10   
gb|KFK40123.1|  hypothetical protein AALP_AA3G333300                  68.6    5e-10   Arabis alpina [alpine rockcress]
gb|KDP29387.1|  hypothetical protein JCGZ_18308                       68.2    5e-10   Jatropha curcas
gb|KHN32029.1|  Aluminum-activated malate transporter 9               68.2    6e-10   Glycine soja [wild soybean]
emb|CDO98443.1|  unnamed protein product                              68.2    7e-10   Coffea canephora [robusta coffee]
ref|XP_010537442.1|  PREDICTED: putative aluminum-activated malat...  67.8    9e-10   
ref|XP_008339686.1|  PREDICTED: aluminum-activated malate transpo...  67.4    9e-10   
ref|XP_006362576.1|  PREDICTED: aluminum-activated malate transpo...  67.0    1e-09   Solanum tuberosum [potatoes]
ref|XP_002529136.1|  conserved hypothetical protein                   66.2    3e-09   
gb|KEH44248.1|  aluminum activated malate transporter family protein  65.1    6e-09   Medicago truncatula
ref|XP_003520033.1|  PREDICTED: aluminum-activated malate transpo...  64.7    8e-09   
gb|ACU18485.1|  unknown                                               60.8    9e-09   Glycine max [soybeans]
gb|EEC80367.1|  hypothetical protein OsI_22476                        64.3    1e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_007157596.1|  hypothetical protein PHAVU_002G082600g           64.3    1e-08   Phaseolus vulgaris [French bean]
ref|XP_006656868.1|  PREDICTED: aluminum-activated malate transpo...  63.9    2e-08   
ref|XP_002454337.1|  hypothetical protein SORBIDRAFT_04g029000        63.5    2e-08   Sorghum bicolor [broomcorn]
ref|XP_010273911.1|  PREDICTED: aluminum-activated malate transpo...  62.4    5e-08   Nelumbo nucifera [Indian lotus]
ref|XP_007157597.1|  hypothetical protein PHAVU_002G082700g           62.0    6e-08   Phaseolus vulgaris [French bean]
ref|XP_010651907.1|  PREDICTED: aluminum-activated malate transpo...  61.2    1e-07   
ref|XP_002262763.1|  PREDICTED: aluminum-activated malate transpo...  61.2    1e-07   Vitis vinifera
dbj|BAD53534.1|  aluminum-activated malate transporter-like           58.2    1e-07   Oryza sativa Japonica Group [Japonica rice]
emb|CAN81826.1|  hypothetical protein VITISV_020247                   60.8    1e-07   Vitis vinifera
ref|NP_001057354.1|  Os06g0268800                                     60.5    1e-07   
gb|EAZ36579.1|  hypothetical protein OsJ_20920                        60.8    2e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004965201.1|  PREDICTED: aluminum-activated malate transpo...  60.8    2e-07   Setaria italica
ref|XP_006441921.1|  hypothetical protein CICLE_v10023819mg           60.5    2e-07   
ref|XP_002529135.1|  conserved hypothetical protein                   60.5    2e-07   Ricinus communis
ref|XP_006409304.1|  hypothetical protein EUTSA_v10022649mg           60.1    3e-07   
ref|XP_010088642.1|  Aluminum-activated malate transporter 2          60.1    3e-07   
dbj|BAK01253.1|  predicted protein                                    59.7    4e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003563969.1|  PREDICTED: aluminum-activated malate transpo...  59.7    4e-07   Brachypodium distachyon [annual false brome]
ref|NP_179338.1|  aluminum-activated malate transporter 6             59.3    4e-07   Arabidopsis thaliana [mouse-ear cress]
gb|KHN27182.1|  Aluminum-activated malate transporter 4               58.9    6e-07   Glycine soja [wild soybean]
ref|XP_006649014.1|  PREDICTED: aluminum-activated malate transpo...  58.9    6e-07   
ref|XP_006838425.1|  hypothetical protein AMTR_s00002p00115520        58.5    9e-07   Amborella trichopoda
ref|XP_002532651.1|  conserved hypothetical protein                   58.2    1e-06   Ricinus communis
emb|CDY24338.1|  BnaA07g02630D                                        57.8    1e-06   Brassica napus [oilseed rape]
ref|XP_010236888.1|  PREDICTED: aluminum-activated malate transpo...  57.4    2e-06   Brachypodium distachyon [annual false brome]
ref|XP_010088643.1|  Aluminum-activated malate transporter 2          57.4    2e-06   Morus notabilis
gb|KEH44433.1|  aluminum activated malate transporter family protein  57.0    3e-06   Medicago truncatula
ref|XP_004154705.1|  PREDICTED: LOW QUALITY PROTEIN: aluminum-act...  57.0    3e-06   
gb|KHN23120.1|  Aluminum-activated malate transporter 12              57.0    3e-06   Glycine soja [wild soybean]
gb|KFK41279.1|  hypothetical protein AALP_AA2G109500                  57.0    3e-06   Arabis alpina [alpine rockcress]
ref|XP_010419084.1|  PREDICTED: aluminum-activated malate transpo...  57.0    3e-06   
ref|XP_009121112.1|  PREDICTED: aluminum-activated malate transpo...  56.6    3e-06   Brassica rapa
ref|XP_004139139.1|  PREDICTED: aluminum-activated malate transpo...  56.6    3e-06   Cucumis sativus [cucumbers]
ref|XP_003535771.2|  PREDICTED: aluminum-activated malate transpo...  57.0    3e-06   Glycine max [soybeans]
ref|XP_010474207.1|  PREDICTED: aluminum-activated malate transpo...  56.6    4e-06   Camelina sativa [gold-of-pleasure]
gb|EAZ24499.1|  hypothetical protein OsJ_08260                        56.6    4e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010415488.1|  PREDICTED: aluminum-activated malate transpo...  56.6    4e-06   Camelina sativa [gold-of-pleasure]
ref|XP_002887192.1|  F24J5.16                                         56.6    4e-06   
dbj|BAD15928.1|  putative aluminum-activated malate transporter       56.6    4e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007015684.1|  Aluminum activated malate transporter family...  55.8    6e-06   
ref|XP_002886114.1|  hypothetical protein ARALYDRAFT_319696           55.8    6e-06   Arabidopsis lyrata subsp. lyrata
gb|AAD49983.1|AC008075_16  F24J5.16                                   55.8    7e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010511869.1|  PREDICTED: aluminum-activated malate transpo...  55.8    7e-06   Camelina sativa [gold-of-pleasure]
ref|XP_008450295.1|  PREDICTED: aluminum-activated malate transpo...  55.8    7e-06   Cucumis melo [Oriental melon]
ref|NP_564935.1|  Aluminum activated malate transporter family pr...  55.8    7e-06   Arabidopsis thaliana [mouse-ear cress]
gb|KFK28482.1|  hypothetical protein AALP_AA7G001700                  55.8    7e-06   Arabis alpina [alpine rockcress]
gb|KFK28481.1|  hypothetical protein AALP_AA7G001700                  55.8    7e-06   Arabis alpina [alpine rockcress]
ref|XP_008376196.1|  PREDICTED: aluminum-activated malate transpo...  55.5    8e-06   
ref|XP_008450296.1|  PREDICTED: aluminum-activated malate transpo...  55.5    8e-06   Cucumis melo [Oriental melon]
ref|XP_003555194.1|  PREDICTED: aluminum-activated malate transpo...  55.5    9e-06   Glycine max [soybeans]
emb|CDP04954.1|  unnamed protein product                              55.5    1e-05   Coffea canephora [robusta coffee]
ref|XP_009342772.1|  PREDICTED: aluminum-activated malate transpo...  54.7    1e-05   Pyrus x bretschneideri [bai li]
dbj|BAJ87572.1|  predicted protein                                    55.1    1e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010474208.1|  PREDICTED: aluminum-activated malate transpo...  55.1    1e-05   
gb|KJB24154.1|  hypothetical protein B456_004G130400                  55.1    1e-05   Gossypium raimondii
ref|XP_010511868.1|  PREDICTED: aluminum-activated malate transpo...  55.1    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_008238285.1|  PREDICTED: aluminum-activated malate transpo...  54.7    2e-05   
ref|XP_011003846.1|  PREDICTED: aluminum-activated malate transpo...  54.3    2e-05   Populus euphratica
ref|XP_004293112.1|  PREDICTED: aluminum-activated malate transpo...  54.3    2e-05   Fragaria vesca subsp. vesca
ref|XP_008361562.1|  PREDICTED: aluminum-activated malate transpo...  54.3    2e-05   Malus domestica [apple tree]
ref|XP_004306386.1|  PREDICTED: aluminum-activated malate transpo...  54.3    2e-05   Fragaria vesca subsp. vesca
ref|XP_006302111.1|  hypothetical protein CARUB_v10020109mg           54.3    2e-05   Capsella rubella
ref|XP_011003845.1|  PREDICTED: aluminum-activated malate transpo...  54.3    2e-05   Populus euphratica
ref|XP_011003844.1|  PREDICTED: aluminum-activated malate transpo...  54.3    2e-05   Populus euphratica
gb|ABW33503.1|  aluminum activated malate transporter                 50.8    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008230202.1|  PREDICTED: aluminum-activated malate transpo...  53.9    3e-05   Prunus mume [ume]
gb|KDP46600.1|  hypothetical protein JCGZ_04534                       53.9    3e-05   Jatropha curcas
ref|XP_008646203.1|  PREDICTED: aluminum-activated malate transpo...  53.9    3e-05   Zea mays [maize]
ref|XP_008344380.1|  PREDICTED: aluminum-activated malate transpo...  53.9    3e-05   
ref|XP_002870075.1|  hypothetical protein ARALYDRAFT_493074           53.9    3e-05   Arabidopsis lyrata subsp. lyrata
gb|KFK38536.1|  hypothetical protein AALP_AA3G126700                  53.9    3e-05   Arabis alpina [alpine rockcress]
ref|XP_009373893.1|  PREDICTED: aluminum-activated malate transpo...  53.9    3e-05   Pyrus x bretschneideri [bai li]
ref|XP_002438218.1|  hypothetical protein SORBIDRAFT_10g009730        53.9    4e-05   Sorghum bicolor [broomcorn]
ref|XP_002314250.2|  hypothetical protein POPTR_0009s02300g           53.5    4e-05   
gb|KHG28575.1|  Aluminum-activated malate transporter 12 -like pr...  53.5    4e-05   Gossypium arboreum [tree cotton]
gb|KJB18933.1|  hypothetical protein B456_003G075900                  53.5    4e-05   Gossypium raimondii
ref|XP_004298279.1|  PREDICTED: aluminum-activated malate transpo...  53.5    4e-05   Fragaria vesca subsp. vesca
ref|XP_007015679.1|  Aluminum activated malate transporter family...  53.5    4e-05   
ref|NP_193531.1|  aluminum-activated, malate transporter 12           53.5    5e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002274847.2|  PREDICTED: aluminum-activated malate transpo...  53.1    5e-05   Vitis vinifera
ref|XP_009629476.1|  PREDICTED: aluminum-activated malate transpo...  53.1    5e-05   Nicotiana tomentosiformis
emb|CAN72306.1|  hypothetical protein VITISV_044063                   53.1    5e-05   Vitis vinifera
emb|CDY01507.1|  BnaC07g34970D                                        53.1    5e-05   
ref|XP_006414167.1|  hypothetical protein EUTSA_v10024816mg           53.1    5e-05   Eutrema salsugineum [saltwater cress]
emb|CDX90432.1|  BnaA03g43490D                                        53.1    5e-05   
gb|KGN66580.1|  hypothetical protein Csa_1G630840                     52.4    6e-05   Cucumis sativus [cucumbers]
ref|XP_009136887.1|  PREDICTED: aluminum-activated malate transpo...  53.1    6e-05   Brassica rapa
ref|XP_004139137.1|  PREDICTED: aluminum-activated malate transpo...  52.8    6e-05   
gb|KDO58242.1|  hypothetical protein CISIN_1g036990mg                 52.8    7e-05   
gb|ABD32785.1|  Protein of unknown function UPF0005; Rho GTPase a...  52.8    7e-05   
gb|KCW50918.1|  hypothetical protein EUGRSUZ_J00567                   52.8    7e-05   
ref|XP_010034243.1|  PREDICTED: aluminum-activated malate transpo...  52.8    7e-05   
ref|XP_010055344.1|  PREDICTED: aluminum-activated malate transpo...  52.8    7e-05   
ref|XP_006283440.1|  hypothetical protein CARUB_v10004488mg           52.8    7e-05   
ref|NP_001183913.1|  hypothetical protein                             52.8    7e-05   
ref|XP_004495501.1|  PREDICTED: aluminum-activated malate transpo...  52.8    8e-05   
ref|XP_009760052.1|  PREDICTED: aluminum-activated malate transpo...  52.8    8e-05   
ref|XP_008374093.1|  PREDICTED: aluminum-activated malate transpo...  52.8    8e-05   
ref|XP_004301694.2|  PREDICTED: LOW QUALITY PROTEIN: aluminum-act...  52.8    8e-05   
ref|XP_010439919.1|  PREDICTED: aluminum-activated malate transpo...  52.8    8e-05   
ref|XP_010449535.1|  PREDICTED: aluminum-activated malate transpo...  52.8    8e-05   
ref|XP_007205300.1|  hypothetical protein PRUPE_ppa006760mg           52.4    8e-05   
ref|XP_007039541.1|  Aluminum-activated malate transporter 12         52.8    8e-05   
ref|XP_011042181.1|  PREDICTED: aluminum-activated malate transpo...  52.4    9e-05   
ref|XP_009628093.1|  PREDICTED: aluminum-activated malate transpo...  52.4    9e-05   
ref|XP_009358731.1|  PREDICTED: aluminum-activated malate transpo...  52.4    9e-05   
ref|XP_008351124.1|  PREDICTED: aluminum-activated malate transpo...  52.4    9e-05   
ref|XP_006481848.1|  PREDICTED: aluminum-activated malate transpo...  52.4    9e-05   
ref|XP_011003849.1|  PREDICTED: aluminum-activated malate transpo...  52.4    1e-04   
emb|CDX97484.1|  BnaC08g13490D                                        50.1    1e-04   
ref|XP_009337710.1|  PREDICTED: aluminum-activated malate transpo...  52.4    1e-04   
ref|NP_001289915.1|  aluminum-activated malate transporter 1-like     52.0    1e-04   
ref|XP_009377066.1|  PREDICTED: aluminum-activated malate transpo...  52.4    1e-04   
ref|XP_009804534.1|  PREDICTED: aluminum-activated malate transpo...  52.0    1e-04   
ref|XP_008373555.1|  PREDICTED: aluminum-activated malate transpo...  52.0    1e-04   
gb|EYU36026.1|  hypothetical protein MIMGU_mgv1a006083mg              52.0    1e-04   
gb|AAF22891.1|AC006932_8  T27G7.12                                    52.0    1e-04   
ref|XP_010275268.1|  PREDICTED: aluminum-activated malate transpo...  52.0    1e-04   
ref|XP_010434594.1|  PREDICTED: aluminum-activated malate transpo...  52.0    1e-04   
ref|NP_172320.1|  aluminum-activated malate transporter 2             52.0    1e-04   
ref|XP_008442919.1|  PREDICTED: aluminum-activated malate transpo...  52.0    2e-04   
ref|XP_002889694.1|  hypothetical protein ARALYDRAFT_334132           52.0    2e-04   
ref|XP_007219805.1|  hypothetical protein PRUPE_ppa026486mg           51.6    2e-04   
ref|XP_002298270.2|  hypothetical protein POPTR_0001s22490g           51.6    2e-04   
ref|XP_009371491.1|  PREDICTED: aluminum-activated malate transpo...  51.6    2e-04   
gb|KJB35446.1|  hypothetical protein B456_006G115300                  51.6    2e-04   
ref|XP_004308292.1|  PREDICTED: aluminum-activated malate transpo...  51.6    2e-04   
ref|XP_006417690.1|  hypothetical protein EUTSA_v10009830mg           51.6    2e-04   
ref|XP_011465834.1|  PREDICTED: aluminum-activated malate transpo...  49.7    2e-04   
ref|XP_006344005.1|  PREDICTED: aluminum-activated malate transpo...  51.6    2e-04   
gb|KEH42890.1|  aluminum activated malate transporter family protein  51.6    2e-04   
gb|KJB51665.1|  hypothetical protein B456_008G227700                  51.6    2e-04   
gb|KDO41689.1|  hypothetical protein CISIN_1g040886mg                 51.6    2e-04   
gb|KEH38993.1|  aluminum activated malate transporter family protein  51.6    2e-04   
ref|XP_006424110.1|  hypothetical protein CICLE_v10030132mg           51.6    2e-04   
ref|XP_009148099.1|  PREDICTED: aluminum-activated malate transpo...  51.6    2e-04   
ref|XP_006424111.1|  hypothetical protein CICLE_v10028411mg           51.6    2e-04   
ref|XP_009398472.1|  PREDICTED: aluminum-activated malate transpo...  51.6    2e-04   
ref|XP_006424112.1|  hypothetical protein CICLE_v10029898mg           51.2    2e-04   
gb|ACU21022.1|  unknown                                               51.6    2e-04   
ref|XP_002889693.1|  Al-activated malate transporter 1                51.2    2e-04   
emb|CDX93562.1|  BnaA06g04860D                                        51.2    2e-04   
ref|XP_002309252.2|  hypothetical protein POPTR_0006s21960g           51.2    2e-04   
ref|XP_009334385.1|  PREDICTED: aluminum-activated malate transpo...  51.2    2e-04   
ref|XP_006854629.1|  hypothetical protein AMTR_s00030p00178130        51.2    2e-04   
ref|XP_002527763.1|  conserved hypothetical protein                   51.2    2e-04   
gb|KDO76671.1|  hypothetical protein CISIN_1g011750mg                 51.2    2e-04   
ref|XP_002264499.1|  PREDICTED: aluminum-activated malate transpo...  51.2    2e-04   
gb|KDO58243.1|  hypothetical protein CISIN_1g046681mg                 51.2    2e-04   
emb|CDX95060.1|  BnaC05g06110D                                        51.2    2e-04   
emb|CDP06850.1|  unnamed protein product                              51.2    2e-04   
ref|XP_006481847.1|  PREDICTED: aluminum-activated malate transpo...  51.2    2e-04   
gb|KHG16054.1|  Aluminum-activated malate transporter 7               51.2    2e-04   
ref|XP_003608627.1|  hypothetical protein MTR_4g098570                51.2    2e-04   
ref|XP_006424113.1|  hypothetical protein CICLE_v10030101mg           51.2    2e-04   
ref|XP_003556423.1|  PREDICTED: aluminum-activated malate transpo...  51.2    2e-04   
ref|XP_008659565.1|  PREDICTED: aluminum-activated malate transpo...  51.2    2e-04   
ref|XP_004310262.2|  PREDICTED: aluminum-activated malate transpo...  51.2    2e-04   
gb|KFK43164.1|  hypothetical protein AALP_AA1G088100                  51.2    3e-04   
gb|KHN05000.1|  Aluminum-activated malate transporter 10              51.2    3e-04   
ref|XP_010559291.1|  PREDICTED: aluminum-activated malate transpo...  51.2    3e-04   
gb|KCW71811.1|  hypothetical protein EUGRSUZ_E00296                   51.2    3e-04   
gb|ADB28918.1|  unknown                                               48.1    3e-04   
ref|XP_007161574.1|  hypothetical protein PHAVU_001G081000g           51.2    3e-04   
gb|KGN59213.1|  hypothetical protein Csa_3G782120                     50.8    3e-04   
ref|XP_010247137.1|  PREDICTED: aluminum-activated malate transpo...  51.2    3e-04   
ref|XP_010269981.1|  PREDICTED: aluminum-activated malate transpo...  51.2    3e-04   
ref|XP_008390303.1|  PREDICTED: aluminum-activated malate transpo...  51.2    3e-04   
gb|KHN14754.1|  Aluminum-activated malate transporter 10              51.2    3e-04   
ref|XP_010247129.1|  PREDICTED: aluminum-activated malate transpo...  51.2    3e-04   
ref|XP_006439261.1|  hypothetical protein CICLE_v10024452mg           51.2    3e-04   
ref|XP_006481849.1|  PREDICTED: aluminum-activated malate transpo...  50.8    3e-04   
gb|KHG16053.1|  Aluminum-activated malate transporter 2               50.8    3e-04   
gb|EYU18115.1|  hypothetical protein MIMGU_mgv1a021852mg              50.8    3e-04   
gb|ABF22742.1|  aluminum activated malate transporter                 51.2    3e-04   
gb|KJB25340.1|  hypothetical protein B456_004G186500                  51.2    3e-04   
ref|XP_006407423.1|  hypothetical protein EUTSA_v10022400mg           50.8    3e-04   
gb|ABF22746.1|  aluminum activated malate transporter                 50.8    3e-04   
gb|ABF22744.1|  aluminum activated malate transporter                 50.8    3e-04   
ref|XP_002322786.2|  hypothetical protein POPTR_0016s07080g           50.8    3e-04   
ref|NP_172319.1|  aluminum-activated malate transporter 1             50.8    3e-04   
gb|ABF22743.1|  aluminum activated malate transporter                 50.8    3e-04   
ref|XP_004953423.1|  PREDICTED: aluminum-activated malate transpo...  50.8    3e-04   
emb|CDX97489.1|  BnaC08g13540D                                        50.8    3e-04   
ref|XP_010104343.1|  Aluminum-activated malate transporter 12         50.8    3e-04   
ref|XP_011021454.1|  PREDICTED: aluminum-activated malate transpo...  50.8    4e-04   
ref|XP_010263008.1|  PREDICTED: aluminum-activated malate transpo...  50.8    4e-04   
gb|KDP25238.1|  hypothetical protein JCGZ_20394                       50.8    4e-04   
ref|XP_002298269.1|  hypothetical protein POPTR_0001s22470g           50.4    4e-04   
gb|KDP35821.1|  hypothetical protein JCGZ_10630                       50.4    4e-04   
ref|XP_006481850.1|  PREDICTED: aluminum-activated malate transpo...  50.4    4e-04   
ref|XP_007162971.1|  hypothetical protein PHAVU_001G195700g           50.4    4e-04   
ref|XP_002279322.1|  PREDICTED: aluminum-activated malate transpo...  50.4    4e-04   
ref|XP_008341114.1|  PREDICTED: aluminum-activated malate transpo...  50.4    4e-04   
ref|XP_010521628.1|  PREDICTED: aluminum-activated malate transpo...  50.4    4e-04   
ref|XP_008810443.1|  PREDICTED: aluminum-activated malate transpo...  50.4    5e-04   
gb|ABF22745.1|  aluminum activated malate transporter                 50.4    5e-04   
ref|XP_010458081.1|  PREDICTED: aluminum-activated malate transpo...  50.4    5e-04   
emb|CAN82473.1|  hypothetical protein VITISV_030202                   50.4    5e-04   
ref|XP_003516635.1|  PREDICTED: aluminum-activated malate transpo...  50.4    5e-04   
ref|XP_011046418.1|  PREDICTED: aluminum-activated malate transpo...  50.4    5e-04   
ref|XP_006303723.1|  hypothetical protein CARUB_v10011859mg           50.4    5e-04   
ref|XP_010488865.1|  PREDICTED: aluminum-activated malate transpo...  50.4    5e-04   
ref|XP_009359572.1|  PREDICTED: aluminum-activated malate transpo...  50.4    5e-04   
ref|XP_009146692.1|  PREDICTED: aluminum-activated malate transpo...  50.4    5e-04   
ref|XP_004136712.1|  PREDICTED: aluminum-activated malate transpo...  50.4    5e-04   
ref|XP_010475643.1|  PREDICTED: aluminum-activated malate transpo...  50.4    5e-04   
gb|KEH42891.1|  aluminum activated malate transporter family protein  50.4    5e-04   
gb|KJB35447.1|  hypothetical protein B456_006G115400                  50.4    5e-04   
gb|EPS68168.1|  hypothetical protein M569_06608                       50.1    5e-04   
ref|XP_004246086.1|  PREDICTED: aluminum-activated malate transpo...  50.1    5e-04   
ref|XP_009110894.1|  PREDICTED: aluminum-activated malate transpo...  50.1    5e-04   
ref|XP_003538776.1|  PREDICTED: aluminum-activated malate transpo...  50.4    5e-04   
ref|XP_010488872.1|  PREDICTED: aluminum-activated malate transpo...  50.1    5e-04   
ref|XP_002513712.1|  conserved hypothetical protein                   50.1    6e-04   
emb|CDY31146.1|  BnaA08g26960D                                        50.1    6e-04   
ref|XP_009776252.1|  PREDICTED: aluminum-activated malate transpo...  50.1    6e-04   
ref|XP_002303680.2|  hypothetical protein POPTR_0003s14490g           50.1    6e-04   
ref|XP_003550945.1|  PREDICTED: aluminum-activated malate transpo...  50.1    6e-04   
ref|XP_003570082.1|  PREDICTED: aluminum-activated malate transpo...  50.1    6e-04   
ref|XP_002448354.1|  hypothetical protein SORBIDRAFT_06g025640        50.1    6e-04   
ref|XP_009612746.1|  PREDICTED: aluminum-activated malate transpo...  50.1    6e-04   
ref|XP_007209894.1|  hypothetical protein PRUPE_ppa004066mg           50.1    6e-04   
ref|XP_010475642.1|  PREDICTED: aluminum-activated malate transpo...  50.1    6e-04   
emb|CDP21018.1|  unnamed protein product                              50.1    7e-04   
ref|XP_004953814.1|  PREDICTED: aluminum-activated malate transpo...  50.1    7e-04   
gb|KEH44440.1|  aluminum activated malate transporter                 50.1    7e-04   
ref|XP_004293111.1|  PREDICTED: aluminum-activated malate transpo...  49.7    8e-04   
ref|XP_008786376.1|  PREDICTED: aluminum-activated malate transpo...  49.7    8e-04   
ref|XP_007015680.1|  Aluminum activated malate transporter family...  49.7    8e-04   
ref|XP_011022437.1|  PREDICTED: aluminum-activated malate transpo...  49.7    8e-04   
ref|XP_010441566.1|  PREDICTED: aluminum-activated malate transpo...  49.7    8e-04   
gb|EYU32272.1|  hypothetical protein MIMGU_mgv1a024574mg              49.7    8e-04   
gb|ABD32783.1|  Protein of unknown function UPF0005                   49.7    8e-04   
ref|XP_002519839.1|  conserved hypothetical protein                   49.7    9e-04   
ref|XP_010055342.1|  PREDICTED: aluminum-activated malate transpo...  49.7    9e-04   
gb|KCW71810.1|  hypothetical protein EUGRSUZ_E00295                   49.7    0.001   
ref|XP_010053089.1|  PREDICTED: aluminum-activated malate transpo...  49.7    0.001   
ref|XP_010685437.1|  PREDICTED: aluminum-activated malate transpo...  49.7    0.001   
ref|XP_008239213.1|  PREDICTED: aluminum-activated malate transpo...  49.7    0.001   
gb|EYU36032.1|  hypothetical protein MIMGU_mgv1a006531mg              49.3    0.001   
gb|KCW77334.1|  hypothetical protein EUGRSUZ_D01695                   49.7    0.001   
ref|XP_010481435.1|  PREDICTED: aluminum-activated malate transpo...  49.7    0.001   
gb|KHN01683.1|  Aluminum-activated malate transporter 12              49.3    0.001   
ref|XP_010458079.1|  PREDICTED: aluminum-activated malate transpo...  49.3    0.001   



>ref|XP_006347553.1| PREDICTED: aluminum-activated malate transporter 4-like [Solanum 
tuberosum]
Length=571

 Score =   114 bits (286),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 91/127 (72%), Gaps = 2/127 (2%)
 Frame = -1

Query  423  MAAGNAYSESLRRSFMGASREGLL--SRGGCSSELEWGIPSQSTNRGFLHGFRDRVSAFF  250
            MAAGNAY  SL++SF   S+E LL   +G     +  G  S + N  FL   R RVS + 
Sbjct  1    MAAGNAYLGSLKQSFHETSKERLLLLRKGYSDLSVGGGGSSFTGNETFLERIRYRVSEYC  60

Query  249  GDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVV  70
             +VK+ + KA +MGR DPRKIIF+AK+G AL+LVS+L+FFKEP+ YIGS S+WAILTVVV
Sbjct  61   NNVKQAASKAVKMGRSDPRKIIFSAKVGFALALVSILIFFKEPIPYIGSHSIWAILTVVV  120

Query  69   VFEFSIG  49
            VFEFSIG
Sbjct  121  VFEFSIG  127



>ref|XP_004235305.1| PREDICTED: aluminum-activated malate transporter 4-like [Solanum 
lycopersicum]
Length=571

 Score =   112 bits (280),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 89/125 (71%), Gaps = 1/125 (1%)
 Frame = -1

Query  420  AAGNAYSESLRRSFMGASREGLLSRGGCSSELEWGIPSQST-NRGFLHGFRDRVSAFFGD  244
            AAGNAY  SL++SF   S+E LL      S+L  G     T N  FL   R RVS +  +
Sbjct  3    AAGNAYLGSLKQSFHETSKERLLLLRKGYSDLSVGGGGGFTGNENFLERIRYRVSEYCNN  62

Query  243  VKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVF  64
            VK+ + KA +MGR DPRKIIF+AK+G AL+LVS+L+FFKEP+ YIGS S+WAILTVVVVF
Sbjct  63   VKQAASKAVKMGRSDPRKIIFSAKVGFALALVSILIFFKEPIPYIGSHSIWAILTVVVVF  122

Query  63   EFSIG  49
            EFSIG
Sbjct  123  EFSIG  127



>ref|XP_009619311.1| PREDICTED: aluminum-activated malate transporter 4-like [Nicotiana 
tomentosiformis]
Length=557

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 86/125 (69%), Gaps = 11/125 (9%)
 Frame = -1

Query  423  MAAGNAYSESLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGD  244
            MA  N    SL ++F   S+  LL  G      E+G+  ++       G R+R++ F  +
Sbjct  1    MAEANVDIRSLSQNFNETSKARLLYNGS-----EYGLDVEN------EGLRNRINEFCSN  49

Query  243  VKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVF  64
            VK+   KA EMGRKDPRK+IFAAKMG ALSLVS+L+FFKEPLSYIG+ S+WAILTVVVVF
Sbjct  50   VKQGLFKAIEMGRKDPRKVIFAAKMGSALSLVSVLIFFKEPLSYIGTYSIWAILTVVVVF  109

Query  63   EFSIG  49
            EFSIG
Sbjct  110  EFSIG  114



>ref|XP_009795348.1| PREDICTED: aluminum-activated malate transporter 4-like [Nicotiana 
sylvestris]
Length=566

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 84/119 (71%), Gaps = 7/119 (6%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEWGIPSQ--STNRGFLHGFRDRVSAFFGDVKETSIK  223
            SL ++F   S+  LL  G      E+G+ +     N GF     +R++ F  +VK+ S K
Sbjct  11   SLSQNFNETSKARLLHNGS-----EYGLDASFYIENEGFWRRLSNRINEFCSNVKQGSFK  65

Query  222  AYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
            A EMGRKDPRK+IFAAKMG ALSLVS+L+FFKEPLSYIG+ S+WAILTVVVVFEFSIG 
Sbjct  66   AIEMGRKDPRKVIFAAKMGSALSLVSVLIFFKEPLSYIGTYSIWAILTVVVVFEFSIGA  124



>gb|EYU45360.1| hypothetical protein MIMGU_mgv1a003565mg [Erythranthe guttata]
Length=577

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 87/121 (72%), Gaps = 5/121 (4%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNRGFLHG-FR---DRVSAFFGDVKETS  229
            SLR+SF+   RE LLSR   +S++ +   S   + G LH  FR   DR+S ++ +V   +
Sbjct  7    SLRQSFVERGRERLLSRK-YNSDVGFNDSSYIVHEGCLHWLFRVTVDRISRWWNNVTGIA  65

Query  228  IKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIG  49
              AYEMGR DPRK++FAAKMG ALSLVS+L+FFKEPLSYI   S+WAILTVVVVFEFSIG
Sbjct  66   FSAYEMGRSDPRKVVFAAKMGAALSLVSVLIFFKEPLSYISQYSIWAILTVVVVFEFSIG  125

Query  48   T  46
             
Sbjct  126  A  126



>ref|XP_006347472.1| PREDICTED: aluminum-activated malate transporter 4-like [Solanum 
tuberosum]
Length=562

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 84/118 (71%), Gaps = 7/118 (6%)
 Frame = -1

Query  393  LRRSFMGASREGLLSRGGCSSELEWGI-PSQSTNR-GFLHGFRDRVSAFFGDVKETSIKA  220
            L ++F   S+E L+ +       E+G+ PS    R GF     +R+     +VK  SIKA
Sbjct  5    LSQNFNETSKERLIPKYS-----EYGLDPSFYVEREGFWRRLCNRIKKSCSNVKHGSIKA  59

Query  219  YEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
             +MGRKDPRK+IFAAKMGLALSLVS+++FFKEPLSYIG+ S+WAILTVVVVFEFSIG 
Sbjct  60   IDMGRKDPRKVIFAAKMGLALSLVSVIIFFKEPLSYIGTYSIWAILTVVVVFEFSIGA  117



>ref|XP_011075828.1| PREDICTED: aluminum-activated malate transporter 4-like [Sesamum 
indicum]
Length=582

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 87/121 (72%), Gaps = 6/121 (5%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNRGFLHGF----RDRVSAFFGDVKETS  229
            SLR+SF   S+E LLSR   +S++ +   S     G  H F     + +S ++ DVK T+
Sbjct  7    SLRQSFADRSKERLLSRK-YNSDVGFD-DSFFVYEGCWHRFFRIIGESLSGWWNDVKGTA  64

Query  228  IKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIG  49
            + AYEMGR DPRK++FAAKMG ALSLVS+L+FFKEPLSYIG  S+WAILTVVVVFEFSIG
Sbjct  65   VSAYEMGRSDPRKVVFAAKMGAALSLVSVLIFFKEPLSYIGKYSIWAILTVVVVFEFSIG  124

Query  48   T  46
             
Sbjct  125  A  125



>ref|XP_009628763.1| PREDICTED: aluminum-activated malate transporter 4-like [Nicotiana 
tomentosiformis]
Length=558

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 86/121 (71%), Gaps = 1/121 (1%)
 Frame = -1

Query  408  AYSESLRRSFMGASREGLL-SRGGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKET  232
            AY  SL++SF+  ++E LL  R G S     G  S + N  FL   R R++ F  DVK+ 
Sbjct  2    AYLGSLKQSFVETNKERLLLPRKGYSELGVGGGASFTGNENFLERLRYRLTEFCNDVKKV  61

Query  231  SIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSI  52
            + KA +MGR DPRKIIF+AK+G AL+LVS+L+FFKEPL YIG  S+WAILTVVVVFEFSI
Sbjct  62   AAKAVKMGRSDPRKIIFSAKVGFALALVSILIFFKEPLPYIGKHSIWAILTVVVVFEFSI  121

Query  51   G  49
            G
Sbjct  122  G  122



>ref|XP_009803276.1| PREDICTED: aluminum-activated malate transporter 5-like [Nicotiana 
sylvestris]
Length=558

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 86/121 (71%), Gaps = 1/121 (1%)
 Frame = -1

Query  408  AYSESLRRSFMGASREG-LLSRGGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKET  232
            AY  SL++SF+  ++E  LL R G S     G  S + N  FL   R R++ F  DVK+ 
Sbjct  2    AYLGSLKQSFVETNKERILLPRKGYSELGVGGGASFTGNENFLERLRYRLTEFCNDVKKA  61

Query  231  SIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSI  52
            + KA +MGR DPRKIIF+AK+G AL+LVS+L+FFKEPL YIG  S+WAILTVVVVFEFSI
Sbjct  62   AAKAVKMGRSDPRKIIFSAKVGFALALVSILIFFKEPLPYIGKHSIWAILTVVVVFEFSI  121

Query  51   G  49
            G
Sbjct  122  G  122



>ref|XP_004135406.1| PREDICTED: aluminum-activated malate transporter 4-like [Cucumis 
sativus]
 ref|XP_004159319.1| PREDICTED: aluminum-activated malate transporter 4-like [Cucumis 
sativus]
 gb|KGN52065.1| hypothetical protein Csa_5G608530 [Cucumis sativus]
Length=571

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 82/121 (68%), Gaps = 8/121 (7%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEWGIPSQ--STNRGFLHGFR---DRVSAFFGDVKET  232
            S+R+SF+  +RE LLSR G S   ++G+ S   S +      FR   D V+  +   + T
Sbjct  7    SIRQSFLDQNREKLLSRKGYS---DFGLNSYDGSGDNVKCRCFRTLSDAVTNLWKGCQNT  63

Query  231  SIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSI  52
            S+K YEMGR DPRK  FA KMGL+L+L SL++FF++PL  +G  S+WAILTVVVVFEFS+
Sbjct  64   SVKLYEMGRSDPRKFFFAVKMGLSLALASLVIFFRQPLKEVGQYSIWAILTVVVVFEFSV  123

Query  51   G  49
            G
Sbjct  124  G  124



>ref|XP_004242127.1| PREDICTED: aluminum-activated malate transporter 4-like [Solanum 
lycopersicum]
Length=559

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 81/118 (69%), Gaps = 7/118 (6%)
 Frame = -1

Query  393  LRRSFMGASREGLLSRGGCSSELEWGI-PSQSTN-RGFLHGFRDRVSAFFGDVKETSIKA  220
            L ++F   S+E L+ +       E+G+ PS      GF     +R+     +VK+  IKA
Sbjct  5    LSQNFNETSKERLIPKYS-----EYGLDPSFYVEPEGFWRRLCNRIKKSGSNVKQGYIKA  59

Query  219  YEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
             +MGRKDPRK+IFA KMGL LSLVS+++FFKEPLSYIG+ S+WAILTVVVVFEFSIG 
Sbjct  60   IDMGRKDPRKVIFAVKMGLTLSLVSVVIFFKEPLSYIGTYSIWAILTVVVVFEFSIGA  117



>gb|EYU19727.1| hypothetical protein MIMGU_mgv1a003372mg [Erythranthe guttata]
Length=589

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  270  DRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVW  91
            D+ S ++G++K T+I AYEMGR DPRK++FAAKMG ALSLVS+L+FFKEP +YI   S+W
Sbjct  56   DKFSNWWGNIKATAISAYEMGRSDPRKVVFAAKMGSALSLVSVLIFFKEPSTYITKHSIW  115

Query  90   AILTVVVVFEFSIG  49
            AILTVVVVFEFSIG
Sbjct  116  AILTVVVVFEFSIG  129



>gb|KDO38904.1| hypothetical protein CISIN_1g048543mg, partial [Citrus sinensis]
Length=282

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 82/124 (66%), Gaps = 12/124 (10%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTN--------RGFLHGFRDRVSAFFGDV  241
            S R SF   S+E LLSR G S   ++G+ S   +        R F     D V  F+ ++
Sbjct  7    SFRHSFAERSKERLLSRKGYS---DFGLNSTDDDGSEDGIKCRCF-RWISDGVINFWTNL  62

Query  240  KETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFE  61
            +   I+ Y+MGRKDPRK +FAAKMGL+L+LVSL+VFFKEPLS +   S+WAILTVVVVFE
Sbjct  63   QNIFIQFYDMGRKDPRKAVFAAKMGLSLALVSLVVFFKEPLSNVSQYSIWAILTVVVVFE  122

Query  60   FSIG  49
            FS+G
Sbjct  123  FSVG  126



>ref|XP_008446577.1| PREDICTED: aluminum-activated malate transporter 4 [Cucumis melo]
Length=572

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 79/120 (66%), Gaps = 4/120 (3%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNRGFLHGFR---DRVSAFFGDVKETSI  226
            S+R+SF+  +RE LLSR G  S+L       + +      FR   D V+  +    +T++
Sbjct  7    SIRQSFLDQNREKLLSRKG-YSDLGLNSYDGAGDNVKCRCFRTVSDVVTNLWKGFHDTTV  65

Query  225  KAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
            K YEMGR DPRK  FA KMGL+L+L SL++FF++PL  +G  S+WAILTVVVVFEFS+G 
Sbjct  66   KLYEMGRSDPRKFFFAVKMGLSLALASLVIFFRQPLKEVGQYSIWAILTVVVVFEFSVGA  125



>ref|XP_004297128.1| PREDICTED: aluminum-activated malate transporter 4 [Fragaria 
vesca subsp. vesca]
 ref|XP_011462925.1| PREDICTED: aluminum-activated malate transporter 4 [Fragaria 
vesca subsp. vesca]
 ref|XP_011462926.1| PREDICTED: aluminum-activated malate transporter 4 [Fragaria 
vesca subsp. vesca]
Length=583

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 77/122 (63%), Gaps = 8/122 (7%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNR-----GFLHGFRDRVSAFFGDVKET  232
            S R SF   S+E LLSR G S   ++G+ S          G+     D +  F   V+E 
Sbjct  7    SFRHSFAERSKERLLSRKGYS---DFGLNSSECGEDRVKCGWFGRMSDGLVNFCNSVQEV  63

Query  231  SIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSI  52
            S+K Y+MGR DPRK  FAAKMGL+L++VSLL+FFKEPL      S+WAILTVVVVFEFSI
Sbjct  64   SVKLYQMGRSDPRKAYFAAKMGLSLAIVSLLIFFKEPLKDASQYSIWAILTVVVVFEFSI  123

Query  51   GT  46
            G 
Sbjct  124  GA  125



>ref|XP_006484436.1| PREDICTED: aluminum-activated malate transporter 4-like [Citrus 
sinensis]
Length=572

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 84/124 (68%), Gaps = 10/124 (8%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEWGIPS---QSTNRGF-LHGFR---DRVSAFFGDVK  238
            S R SF   S+E LLSR G S   ++G+ S    ++  G     FR   D V  F+ +++
Sbjct  7    SFRHSFAERSKERLLSRKGYS---DFGLNSTDDDASEDGIKCRCFRWISDGVINFWTNLQ  63

Query  237  ETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEF  58
               I+ Y+MGRKDPRK +FAAKMGL+L+LVSL+VFFKEPLS +   S+WAILTVVVVFEF
Sbjct  64   NIFIQFYDMGRKDPRKAVFAAKMGLSLALVSLVVFFKEPLSNVSQYSIWAILTVVVVFEF  123

Query  57   SIGT  46
            S+G 
Sbjct  124  SVGA  127



>ref|XP_006437702.1| hypothetical protein CICLE_v10031089mg [Citrus clementina]
 gb|ESR50942.1| hypothetical protein CICLE_v10031089mg [Citrus clementina]
Length=572

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 84/124 (68%), Gaps = 10/124 (8%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEWGIPS---QSTNRGF-LHGFR---DRVSAFFGDVK  238
            S R SF   S+E LLSR G S   ++G+ S    ++  G     FR   D V  F+ +++
Sbjct  7    SFRHSFAERSKERLLSRKGYS---DFGLNSTDDDASEDGIKCRCFRWISDGVINFWTNLQ  63

Query  237  ETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEF  58
               I+ Y+MGRKDPRK +FAAKMGL+L+LVSL+VFFKEPLS +   S+WAILTVVVVFEF
Sbjct  64   NIFIQFYDMGRKDPRKAVFAAKMGLSLALVSLVVFFKEPLSNVSQYSIWAILTVVVVFEF  123

Query  57   SIGT  46
            S+G 
Sbjct  124  SVGA  127



>ref|XP_008350864.1| PREDICTED: LOW QUALITY PROTEIN: aluminum-activated malate transporter 
4-like [Malus domestica]
Length=568

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 77/122 (63%), Gaps = 8/122 (7%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEWGIPS-----QSTNRGFLHGFRDRVSAFFGDVKET  232
            S   SF   S+E LLSR G S   ++G  S     +    G    F D  + F+ + ++T
Sbjct  7    SFHHSFAERSKERLLSRKGYS---DFGFNSSEAGDEHVKCGCFRRFSDGFNNFYNNFQDT  63

Query  231  SIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSI  52
             IK Y+MGR DPRK IFA KMG++L+LVSLL+FFKEPL      S+WAILTVVVVFEFS+
Sbjct  64   FIKLYQMGRSDPRKAIFATKMGMSLALVSLLIFFKEPLKNASQYSIWAILTVVVVFEFSV  123

Query  51   GT  46
            G 
Sbjct  124  GA  125



>ref|XP_004512938.1| PREDICTED: aluminum-activated malate transporter 9-like [Cicer 
arietinum]
Length=597

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = -1

Query  336  SSELEWGIPSQSTNRGF-LHGFRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLA  160
            S E  + +P  S  R     GF D +   + +VK  ++ A+EMGR DPRKIIF+AKMG+A
Sbjct  45   SDEDYFAVPGNSKRRCCSFRGFSDGIVELWKNVKRVTVSAWEMGRSDPRKIIFSAKMGVA  104

Query  159  lslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
            L L+SLL+F K+P   +G  SVWAILTVVVVFEFSIG 
Sbjct  105  LILISLLIFLKQPFQDVGRYSVWAILTVVVVFEFSIGA  142



>ref|XP_007046271.1| Aluminum activated malate transporter family protein isoform 
1 [Theobroma cacao]
 gb|EOY02103.1| Aluminum activated malate transporter family protein isoform 
1 [Theobroma cacao]
Length=568

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 81/122 (66%), Gaps = 8/122 (7%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEWGIPSQ--STNRGFLHGFR---DRVSAFFGDVKET  232
            S  RS    S+E LLSR G S   E+G+ S   S +      FR   D ++ F+  ++E+
Sbjct  5    SFLRSSTDESKERLLSRKGYS---EFGLNSSDGSEDGVKCRCFRSCSDSINKFWDGLQES  61

Query  231  SIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSI  52
            S+K YEMG+ DPRK+ FAAKMG +L++VSLL+FFKEPL      S+WAILTVVVVFEFS+
Sbjct  62   SVKLYEMGQSDPRKVFFAAKMGFSLAMVSLLIFFKEPLRNASQYSIWAILTVVVVFEFSV  121

Query  51   GT  46
            G 
Sbjct  122  GA  123



>ref|XP_006341623.1| PREDICTED: aluminum-activated malate transporter 9-like [Solanum 
tuberosum]
Length=604

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 82/126 (65%), Gaps = 10/126 (8%)
 Frame = -1

Query  402  SESLRRSFMGAS-REGLLS--RGGCSSELEWGIPS----QSTNRGFLHGFRDRVSAFFGD  244
            S S R+SF     +E LLS   G   +EL  G P     Q T+ G    FR++ S  + D
Sbjct  5    SNSFRKSFEDRRVKERLLSLCNGVDYTELP-GFPHSLDYQETS-GCCSSFREKFSELWKD  62

Query  243  VKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEP-LSYIGSKSVWAILTVVVV  67
             K  S+KA EMGR DPRKIIF+AKMGLAL L+SL +FFKEP +  +G  SVWAILTVVVV
Sbjct  63   WKRVSVKAMEMGRTDPRKIIFSAKMGLALILMSLFIFFKEPAVKELGKYSVWAILTVVVV  122

Query  66   FEFSIG  49
            FEFSIG
Sbjct  123  FEFSIG  128



>ref|XP_011021871.1| PREDICTED: aluminum-activated malate transporter 4 [Populus euphratica]
 ref|XP_011021877.1| PREDICTED: aluminum-activated malate transporter 4 [Populus euphratica]
Length=555

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 78/123 (63%), Gaps = 10/123 (8%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSR------GGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKE  235
            SLR SF   S+E L+SR      G   SE +     ++  R       DR+ +F+  V+ 
Sbjct  7    SLRHSFEERSKERLISRKEYPDFGLNRSEND----EEAGKRRCFASLSDRIVSFWNGVRN  62

Query  234  TSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFS  55
            ++I+ YEMG+ DPRK  FA KMGL+L+LVSL++F KEPL  +   S+WAILTVVVVFEFS
Sbjct  63   SAIELYEMGQADPRKYFFAVKMGLSLALVSLVIFLKEPLKDVSQYSIWAILTVVVVFEFS  122

Query  54   IGT  46
            +G 
Sbjct  123  VGA  125



>ref|XP_010102835.1| Aluminum-activated malate transporter 4 [Morus notabilis]
 gb|EXB94195.1| Aluminum-activated malate transporter 4 [Morus notabilis]
Length=580

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 80/122 (66%), Gaps = 8/122 (7%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNRGFLH--GFR---DRVSAFFGDVKET  232
            SLR SF+  S+E LLSR G S   ++G+ S     G      FR   D ++  + ++   
Sbjct  7    SLRHSFVEKSKERLLSRKGYS---DFGLQSSDGRDGAAKFWCFRFMSDGITNLWNNLHNM  63

Query  231  SIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSI  52
             ++ YEMGR DPRK +FA KMGL+L+LVSL++FFKEPL  +   ++WAILTVVVVFEFS+
Sbjct  64   FVELYEMGRSDPRKFVFAIKMGLSLALVSLVIFFKEPLKNVSQYAIWAILTVVVVFEFSV  123

Query  51   GT  46
            G 
Sbjct  124  GA  125



>gb|KHG13463.1| Aluminum-activated malate transporter 6 -like protein [Gossypium 
arboreum]
Length=380

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 68/108 (63%), Gaps = 3/108 (3%)
 Frame = -1

Query  369  SREGLLSRGGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRKDPRK  190
            S+E LLS+ GCS     G   +   RG           F+   ++ S K Y+MGR DPRK
Sbjct  12   SKERLLSKKGCSG---LGAADEGAKRGCFRSCCGSTDNFWNGFQQVSAKLYKMGRSDPRK  68

Query  189  IIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
            + FA KMGL+L++VSLL+ FKEPL  +   SVWAILTVV+VFEFS+G 
Sbjct  69   VFFAMKMGLSLTVVSLLMLFKEPLRGVSQYSVWAILTVVLVFEFSVGA  116



>gb|KJB50732.1| hypothetical protein B456_008G184400 [Gossypium raimondii]
Length=538

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 75/121 (62%), Gaps = 10/121 (8%)
 Frame = -1

Query  387  RSFM--GASREGLLSRGGCSSELEWGIPSQ--STNRGFLHGFR---DRVSAFFGDVKETS  229
            RSF+    S+E LL R G S   E+G  S   S +R     FR   D +  F+  ++E  
Sbjct  4    RSFLRGTESKEKLLPRKGYS---EFGFNSSDVSEDRVKCSCFRSCCDSIDNFWSGLQELF  60

Query  228  IKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIG  49
            +K YEMGR DPRK+IFA KMG +L  +SLL+ FKEPL      S+WAILTVVVVFEFS+G
Sbjct  61   VKLYEMGRSDPRKVIFATKMGFSLMSISLLMLFKEPLKETSQYSIWAILTVVVVFEFSVG  120

Query  48   T  46
             
Sbjct  121  A  121



>ref|XP_007222460.1| hypothetical protein PRUPE_ppa003480mg [Prunus persica]
 gb|EMJ23659.1| hypothetical protein PRUPE_ppa003480mg [Prunus persica]
Length=571

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 76/122 (62%), Gaps = 8/122 (7%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNR-----GFLHGFRDRVSAFFGDVKET  232
            S R SF   S+E LLSR G S   ++G+ S  T       G      D  + F    ++T
Sbjct  7    SFRHSFAERSKERLLSRKGYS---DFGLNSSETGDDHVKCGCFRAVSDGFNNFCKSFQDT  63

Query  231  SIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSI  52
             IK Y+MG  DPRK +FAAKMG +LS+VSLL+FFKEPL  +   S+WAILTVVVVFEFS+
Sbjct  64   FIKLYQMGHSDPRKAVFAAKMGTSLSIVSLLIFFKEPLKDVSQYSIWAILTVVVVFEFSV  123

Query  51   GT  46
            G 
Sbjct  124  GA  125



>gb|KJB50731.1| hypothetical protein B456_008G184400 [Gossypium raimondii]
Length=562

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 73/119 (61%), Gaps = 6/119 (5%)
 Frame = -1

Query  387  RSFM--GASREGLLSRGGCSSELEWGIPSQSTNRGFLHGFR---DRVSAFFGDVKETSIK  223
            RSF+    S+E LL R G  SE  +     S +R     FR   D +  F+  ++E  +K
Sbjct  4    RSFLRGTESKEKLLPRKG-YSEFGFNSSDVSEDRVKCSCFRSCCDSIDNFWSGLQELFVK  62

Query  222  AYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
             YEMGR DPRK+IFA KMG +L  +SLL+ FKEPL      S+WAILTVVVVFEFS+G 
Sbjct  63   LYEMGRSDPRKVIFATKMGFSLMSISLLMLFKEPLKETSQYSIWAILTVVVVFEFSVGA  121



>gb|KJB50733.1| hypothetical protein B456_008G184400 [Gossypium raimondii]
Length=556

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 75/120 (63%), Gaps = 10/120 (8%)
 Frame = -1

Query  387  RSFM--GASREGLLSRGGCSSELEWGIPSQ--STNRGFLHGFR---DRVSAFFGDVKETS  229
            RSF+    S+E LL R G S   E+G  S   S +R     FR   D +  F+  ++E  
Sbjct  4    RSFLRGTESKEKLLPRKGYS---EFGFNSSDVSEDRVKCSCFRSCCDSIDNFWSGLQELF  60

Query  228  IKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIG  49
            +K YEMGR DPRK+IFA KMG +L  +SLL+ FKEPL      S+WAILTVVVVFEFS+G
Sbjct  61   VKLYEMGRSDPRKVIFATKMGFSLMSISLLMLFKEPLKETSQYSIWAILTVVVVFEFSVG  120



>ref|XP_009616234.1| PREDICTED: aluminum-activated malate transporter 9 [Nicotiana 
tomentosiformis]
Length=601

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 76/119 (64%), Gaps = 4/119 (3%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSR-GGCSSELEWGIPS--QSTNRGFLHGFRDRVSAFFGDVKETSI  226
            S R+SF    RE L S   G  +EL    P+     N G    FR++    + D    ++
Sbjct  7    SFRKSF-EEKRERLFSSCNGDYTELPGFNPTLDYPENPGCFSSFREKFRELWKDWSSVAV  65

Query  225  KAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIG  49
            KA EMGR DPRKI+F+AKMGLAL L+SLL+FFKEP+  +   SVWAILTVVVVFEFSIG
Sbjct  66   KAMEMGRSDPRKIVFSAKMGLALMLISLLIFFKEPVEELSRYSVWAILTVVVVFEFSIG  124



>ref|XP_008243200.1| PREDICTED: aluminum-activated malate transporter 4-like [Prunus 
mume]
Length=571

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 76/122 (62%), Gaps = 8/122 (7%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNR-----GFLHGFRDRVSAFFGDVKET  232
            S R SF   S+E LLSR G S   ++G+ S  T       G      D  + F    ++T
Sbjct  7    SFRHSFAERSKERLLSRKGYS---DFGLNSSETGDDHVKCGCFRAVSDGFNNFCKSFQDT  63

Query  231  SIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSI  52
             IK Y+MG  DPRK +FA KMG++LS+VSLL+FFKEPL  +   S+WAILTVVVVFEFS+
Sbjct  64   FIKLYQMGHSDPRKAVFAVKMGMSLSIVSLLIFFKEPLKDVSQYSIWAILTVVVVFEFSV  123

Query  51   GT  46
            G 
Sbjct  124  GA  125



>emb|CAN68659.1| hypothetical protein VITISV_002161 [Vitis vinifera]
Length=559

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 79/122 (65%), Gaps = 8/122 (7%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNRGFLHG--FRDRVSA---FFGDVKET  232
            S R SF+  S+E LLSR G S   E+G+ S       +    FR R  A   F+  +++T
Sbjct  7    SFRHSFVERSKERLLSRKGYS---EFGLNSSDGGDEPVKCLCFRWRTDAIINFWNGLQDT  63

Query  231  SIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSI  52
            + + +EM R DPRK+ FAAKMGL+L++VSL +F KEPL  +   S+WAILTVVVVFEFS+
Sbjct  64   ASRLFEMARSDPRKVYFAAKMGLSLAIVSLFIFLKEPLKDVSQYSIWAILTVVVVFEFSV  123

Query  51   GT  46
            G 
Sbjct  124  GA  125



>ref|XP_002278978.1| PREDICTED: aluminum-activated malate transporter 4 [Vitis vinifera]
Length=583

 Score = 85.9 bits (211),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 79/122 (65%), Gaps = 8/122 (7%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNRGFLHG--FRDRVSA---FFGDVKET  232
            S R SF+  S+E LLSR G S   E+G+ S       +    FR R  A   F+  +++T
Sbjct  7    SFRHSFVERSKERLLSRKGYS---EFGLNSSDGGDEPVKCLCFRWRTDAIINFWNGLQDT  63

Query  231  SIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSI  52
            + + +EM R DPRK+ FAAKMGL+L++VSL +F KEPL  +   S+WAILTVVVVFEFS+
Sbjct  64   ASRLFEMARSDPRKVYFAAKMGLSLAIVSLFIFLKEPLKDVSQYSIWAILTVVVVFEFSV  123

Query  51   GT  46
            G 
Sbjct  124  GA  125



>ref|XP_002312386.2| hypothetical protein POPTR_0008s11740g [Populus trichocarpa]
 gb|EEE89753.2| hypothetical protein POPTR_0008s11740g [Populus trichocarpa]
Length=556

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 77/121 (64%), Gaps = 5/121 (4%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCS----SELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKETS  229
            SLR SF   S+E L+SR        +  E  I      R F     DR+ +F+  V+ ++
Sbjct  7    SLRHSFEERSKERLISRKEYPDFGLNRSENDIEEAGKCRCF-GSLSDRIVSFWNGVRNSA  65

Query  228  IKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIG  49
            I+ Y+MG+ DPRK +FA KMGL+L+LVSL++F KEPL  +   S+WAILTVVVVFEFS+G
Sbjct  66   IELYKMGQADPRKYLFAVKMGLSLALVSLVIFLKEPLKDVSQYSIWAILTVVVVFEFSVG  125

Query  48   T  46
             
Sbjct  126  A  126



>ref|XP_009360165.1| PREDICTED: aluminum-activated malate transporter 9-like [Pyrus 
x bretschneideri]
Length=142

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 67/111 (60%), Gaps = 5/111 (5%)
 Frame = -1

Query  366  REGLLSRGGCSSEL-----EWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRK  202
            RE LLS     SEL     E   PS S          DR+  +   V+  S +A +MG+ 
Sbjct  16   RERLLSVQKGYSELGFVHIEEQEPSGSPRCCTFRSVSDRIVGWCRTVQHVSSRAVQMGQS  75

Query  201  DPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIG  49
            DPRKI+FA KMGLAL +VSLL+F KEP   +   SVWAILTVVVVFEFSIG
Sbjct  76   DPRKIVFAGKMGLALMIVSLLIFLKEPFKQLSRYSVWAILTVVVVFEFSIG  126



>emb|CBI27043.3| unnamed protein product [Vitis vinifera]
Length=1070

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 79/122 (65%), Gaps = 8/122 (7%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNRGFLHG--FRDRVSA---FFGDVKET  232
            S R SF+  S+E LLSR G S   E+G+ S       +    FR R  A   F+  +++T
Sbjct  494  SFRHSFVERSKERLLSRKGYS---EFGLNSSDGGDEPVKCLCFRWRTDAIINFWNGLQDT  550

Query  231  SIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSI  52
            + + +EM R DPRK+ FAAKMGL+L++VSL +F KEPL  +   S+WAILTVVVVFEFS+
Sbjct  551  ASRLFEMARSDPRKVYFAAKMGLSLAIVSLFIFLKEPLKDVSQYSIWAILTVVVVFEFSV  610

Query  51   GT  46
            G 
Sbjct  611  GA  612


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = -1

Query  213  MGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGTQNIL  34
            MGR DPRKIIFA KMGLALSLVSLL+F+KEP   +G  S+WAILTV+V+FEFSIG   I 
Sbjct  1    MGRSDPRKIIFAMKMGLALSLVSLLIFWKEPAD-VGQYSIWAILTVIVMFEFSIGATFIK  59

Query  33   NF  28
             F
Sbjct  60   GF  61



>ref|XP_006374353.1| hypothetical protein POPTR_0015s06340g [Populus trichocarpa]
 gb|ERP52150.1| hypothetical protein POPTR_0015s06340g [Populus trichocarpa]
Length=587

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 71/118 (60%), Gaps = 5/118 (4%)
 Frame = -1

Query  387  RSFMGASREGLLSRGGCSSEL-----EWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIK  223
            R  +   RE LLS   C SE+     +  +   + N        D++      V++ + +
Sbjct  9    RHSLAEKRERLLSTTKCYSEIVFPNIQEDLDEPTRNCCSYRFLSDKIVGLCKQVQDVAYR  68

Query  222  AYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIG  49
             Y+MG+ DPRKI+F+AKMGLAL L+SLL+F KEP+  +    VWAILTVVVVFEFSIG
Sbjct  69   GYQMGKSDPRKIVFSAKMGLALMLISLLIFLKEPIKELSQHFVWAILTVVVVFEFSIG  126



>ref|XP_010318605.1| PREDICTED: aluminum-activated malate transporter 9 [Solanum lycopersicum]
Length=609

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 63/83 (76%), Gaps = 1/83 (1%)
 Frame = -1

Query  291  GFLHGFRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEP-LS  115
            G    FR+R S  + D K  S+KA EMGR DPRKIIF+AKMGLAL L+SLL+FFKEP + 
Sbjct  49   GCCSSFRERFSELWKDWKRVSVKAMEMGRTDPRKIIFSAKMGLALILISLLIFFKEPAVK  108

Query  114  YIGSKSVWAILTVVVVFEFSIGT  46
             +G  SVWAILTVVVVFEFSIG 
Sbjct  109  ELGKYSVWAILTVVVVFEFSIGA  131



>ref|XP_007036504.1| Aluminum-activated malate transporter 9 [Theobroma cacao]
 gb|EOY21005.1| Aluminum-activated malate transporter 9 [Theobroma cacao]
Length=583

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = -1

Query  294  RGFLHGF-RDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPL  118
            R F + F  D+++ F+ DV++ + +A++MG+ DPRKIIF+AKMGLAL L+S L+F KEP 
Sbjct  41   RCFSYRFISDKITGFWKDVQDVAGEAWQMGKSDPRKIIFSAKMGLALMLISFLIFLKEPF  100

Query  117  SYIGSKSVWAILTVVVVFEFSIGT  46
              +   SVWAILTVVVVFEFSIG 
Sbjct  101  KELSQYSVWAILTVVVVFEFSIGA  124



>ref|XP_010932631.1| PREDICTED: aluminum-activated malate transporter 9-like [Elaeis 
guineensis]
 ref|XP_010932632.1| PREDICTED: aluminum-activated malate transporter 9-like [Elaeis 
guineensis]
Length=578

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 71/120 (59%), Gaps = 5/120 (4%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEWGIP---SQSTNRGFLHGFRDRVSAFFGDVKETSI  226
            S R +    S+E LLS   C  E EWG      +   RG L    D ++  +G   E  +
Sbjct  7    SCRSNSEKRSKERLLS--SCHEEGEWGFALDFDEEEERGCLRRIGDGIAGMWGKAWELVV  64

Query  225  KAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
            + +  GR DPRK+IF AK+GLAL+L S ++F KEP   +   SVWAILTVVVVFEFSIG+
Sbjct  65   RLWNFGRSDPRKVIFGAKVGLALTLTSFIIFLKEPSIDLTKNSVWAILTVVVVFEFSIGS  124



>ref|XP_010027833.1| PREDICTED: aluminum-activated malate transporter 4-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW54460.1| hypothetical protein EUGRSUZ_I00408 [Eucalyptus grandis]
Length=571

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 81/122 (66%), Gaps = 8/122 (7%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEWGIP-SQSTNRGF-LHGFR---DRVSAFFGDVKET  232
            S R SF+  S+E LLSR   S   ++G+  +  ++ G     FR   D V   +  +++ 
Sbjct  7    SFRHSFLERSKERLLSRKEYS---DFGMTDADGSDYGVKCRCFRSISDWVVNCWNGLQDV  63

Query  231  SIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSI  52
             +K YEMGR DPRK +FA KMGL+L+LVSL++FFKEPL+ +   S+WAILTVVVVFEFS+
Sbjct  64   VVKLYEMGRSDPRKFVFAVKMGLSLALVSLVIFFKEPLADVSQYSIWAILTVVVVFEFSV  123

Query  51   GT  46
            G 
Sbjct  124  GA  125



>ref|XP_009764790.1| PREDICTED: aluminum-activated malate transporter 9 [Nicotiana 
sylvestris]
Length=645

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -1

Query  297  NRGFLHGFRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPL  118
            N G    FR++    + D    ++KA EMGR DPRKI+F+AKMGLAL L+SLL+FFKEP+
Sbjct  87   NLGCFSYFREKFREVWKDWSSVAVKAMEMGRSDPRKIVFSAKMGLALMLISLLIFFKEPV  146

Query  117  SYIGSKSVWAILTVVVVFEFSIGT  46
              +   SVWAILTVVVVFEFSIG 
Sbjct  147  EELSRYSVWAILTVVVVFEFSIGA  170



>gb|KHG29903.1| Aluminum-activated malate transporter 4 -like protein [Gossypium 
arboreum]
Length=562

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 72/119 (61%), Gaps = 6/119 (5%)
 Frame = -1

Query  387  RSFM--GASREGLLSRGGCSSELEWGIPSQSTNRGFLHGFR---DRVSAFFGDVKETSIK  223
            RSF+    S+E LL R G  SE  +     S +R     FR   D +  F+  ++   +K
Sbjct  4    RSFLRGTESKERLLPRKG-YSEFGFNSSDVSEDRVKCRCFRSCCDSIDNFWSGLQGLFVK  62

Query  222  AYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
             YEMGR DPRK+IFA KMG +L  +SLL+ FKEPL      S+WAILTVVVVFEFS+G 
Sbjct  63   LYEMGRSDPRKVIFATKMGFSLMSISLLMLFKEPLKETSQYSIWAILTVVVVFEFSVGA  121



>gb|EPS71908.1| hypothetical protein M569_02848, partial [Genlisea aurea]
Length=494

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = -1

Query  276  FRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKS  97
             R+  SA++ +    +I +YEMGR DPRK++FAAK+GLALSLVSLL+FFKEP +YI    
Sbjct  5    LREGTSAWWKNASAIAITSYEMGRSDPRKVVFAAKVGLALSLVSLLIFFKEPSTYITKHY  64

Query  96   VWAILTVVVVFEFSIGT  46
            VWAIL+VVVVFEFSIG 
Sbjct  65   VWAILSVVVVFEFSIGA  81



>gb|KJB50413.1| hypothetical protein B456_008G169600 [Gossypium raimondii]
Length=540

 Score = 82.8 bits (203),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 67/108 (62%), Gaps = 3/108 (3%)
 Frame = -1

Query  369  SREGLLSRGGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRKDPRK  190
            S+E LLS+ GCS     G   +    G           F+   ++ S K Y+MGR DPRK
Sbjct  12   SKERLLSKKGCSG---LGGAEEGAKSGCFRSCCGSTDNFWNGFQQVSAKLYKMGRSDPRK  68

Query  189  IIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
            + FA KMGL+L++VSLL+ FKEPL  +   SVWAILTVV+VFEFS+G 
Sbjct  69   VFFAMKMGLSLTVVSLLMLFKEPLRGVSQYSVWAILTVVLVFEFSVGA  116



>ref|XP_006440948.1| hypothetical protein CICLE_v10019485mg [Citrus clementina]
 gb|ESR54188.1| hypothetical protein CICLE_v10019485mg [Citrus clementina]
Length=574

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 75/118 (64%), Gaps = 9/118 (8%)
 Frame = -1

Query  378  MGASREGLLSRGGCSSELEWGIPSQSTNRGFLHGFR--------DRVSAFFGDVKETSIK  223
            +G+ RE LLS  G  S++  G+ +  ++       R        DRV++F   +++  + 
Sbjct  5    IGSLREKLLSTKG-HSDIGLGLKTTVSSESVEQPVRCWPYRFVCDRVTSFLKTLQDGFVG  63

Query  222  AYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIG  49
            A + G+ DPRKI+FAAKM LAL+L+SLL F KEP   +G  SVWAILTVVVVFEFSIG
Sbjct  64   AVQTGKNDPRKIVFAAKMALALTLISLLSFMKEPFPDLGRYSVWAILTVVVVFEFSIG  121



>ref|XP_010480664.1| PREDICTED: aluminum-activated malate transporter 4-like [Camelina 
sativa]
Length=454

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 72/120 (60%), Gaps = 9/120 (8%)
 Frame = -1

Query  369  SREGLLSRGGCSSELEWGIPSQST---NRGFLHGFR---DRVSAFFGDVKETSIKAYEMG  208
            +REGLLSR GCS   ++G    S     R     FR   D + A +  + + + K YEMG
Sbjct  5    NREGLLSRKGCS---DFGFNDSSIIDDRRSKFRCFRFCSDGIVASWMALYDIAAKLYEMG  61

Query  207  RKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGTQNILNF  28
            R D RK+ FA KMG+AL+L S +++ KEPL      +VWAILTVVVVFE+SIG   +  F
Sbjct  62   RSDRRKVYFAVKMGMALALCSFVIYLKEPLRDASKYAVWAILTVVVVFEYSIGATLVKGF  121



>gb|KDP29386.1| hypothetical protein JCGZ_18307 [Jatropha curcas]
Length=562

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 76/128 (59%), Gaps = 14/128 (11%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEWGIPSQS---------TNRGFLHGFRDRVSAFFGD  244
            SLR +F   S+E LLSR    S    G+ S             R FL  F D +   +G 
Sbjct  7    SLRHNFAETSKERLLSRNNIYSNF--GLNSSEGGDDQDGSFKCRCFL-SFSDWIINLWGR  63

Query  243  VKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSY--IGSKSVWAILTVVV  70
             K  +I+ Y MGR DPRK++F  KMGL+L+LVSL++FFKEPL    +   S+WAILTVVV
Sbjct  64   TKAAAIELYNMGRTDPRKVVFGIKMGLSLALVSLVIFFKEPLKIRNVNQYSIWAILTVVV  123

Query  69   VFEFSIGT  46
            VFEFS+G 
Sbjct  124  VFEFSVGA  131



>ref|XP_010102834.1| Aluminum-activated malate transporter 4 [Morus notabilis]
 gb|EXB94194.1| Aluminum-activated malate transporter 4 [Morus notabilis]
Length=583

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 77/126 (61%), Gaps = 7/126 (6%)
 Frame = -1

Query  402  SESLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNR-GFLHGFR------DRVSAFFGD  244
            S  L   F   S+E LL      S+    I   S +R G  + FR      D ++ F+ +
Sbjct  2    SAKLEPCFAKKSKERLLLPRKVFSDFSLPIAGSSDDRDGSANEFRCFRSMSDGIANFWNN  61

Query  243  VKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVF  64
            + +T ++ YEMGR DPRK+ FAAK+GLAL++VSL +FFKEPL  I   ++WA LTVV++F
Sbjct  62   LHKTLVQLYEMGRSDPRKVAFAAKVGLALAIVSLAIFFKEPLKDINQYAIWATLTVVLIF  121

Query  63   EFSIGT  46
            EFS+G 
Sbjct  122  EFSVGA  127



>ref|XP_010460370.1| PREDICTED: aluminum-activated malate transporter 4-like [Camelina 
sativa]
Length=566

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 72/120 (60%), Gaps = 9/120 (8%)
 Frame = -1

Query  369  SREGLLSRGGCSSELEWGIPSQST---NRGFLHGFR---DRVSAFFGDVKETSIKAYEMG  208
            +REGLLSR GCS   ++G    S     R     FR   D + A +  + + + K YEMG
Sbjct  5    TREGLLSRKGCS---DFGFNDSSIIDDRRSKFRCFRFCSDGIVASWMALYDIAAKLYEMG  61

Query  207  RKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGTQNILNF  28
            R D RK+ FA KMG+AL+L S +++ KEPL      +VWAILTVVVVFE+SIG   +  F
Sbjct  62   RSDRRKVYFAVKMGMALALCSFVIYLKEPLRDASKYAVWAILTVVVVFEYSIGATLVKGF  121



>ref|XP_009360189.1| PREDICTED: aluminum-activated malate transporter 9-like, partial 
[Pyrus x bretschneideri]
Length=364

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 67/112 (60%), Gaps = 5/112 (4%)
 Frame = -1

Query  366  REGLLSRGGCSSEL-----EWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRK  202
            RE LLS     SEL     E   PS S          DR+  +   V+  S +A +MG+ 
Sbjct  16   RERLLSVQKGYSELGFVHIEEQEPSGSPRCCTFRSVSDRIVGWCRTVQHVSSRAVQMGQS  75

Query  201  DPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
            DPRKI+FA KMGLAL +VSLL+F KEP   +   SVWAILTVVVVFEFSIG 
Sbjct  76   DPRKIVFAGKMGLALMIVSLLIFLKEPFKQLSRYSVWAILTVVVVFEFSIGA  127



>gb|KHG02535.1| Aluminum-activated malate transporter 9 -like protein [Gossypium 
arboreum]
Length=581

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = -1

Query  270  DRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVW  91
            D+V+ F   V++ ++KA++MG  DPRKI+F+AK+GLAL L+SLL+F KEP+  +   SVW
Sbjct  46   DKVTGFSKKVQDVALKAWQMGISDPRKIVFSAKVGLALMLISLLIFLKEPIKELSEHSVW  105

Query  90   AILTVVVVFEFSIGT  46
            AILTVVVVFEFSIG 
Sbjct  106  AILTVVVVFEFSIGA  120



>ref|XP_006485776.1| PREDICTED: aluminum-activated malate transporter 9-like [Citrus 
sinensis]
Length=574

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 75/118 (64%), Gaps = 9/118 (8%)
 Frame = -1

Query  378  MGASREGLLSRGGCSSELEWGIPSQSTNRGFLHGFR--------DRVSAFFGDVKETSIK  223
            +G+ RE LLS  G  S++  G+ +  ++       R        DRV++F   +++  + 
Sbjct  5    IGSLREKLLSTKG-HSDIGPGLKTTVSSESVEQPVRCWPYRFVCDRVTSFLKTLQDGFVG  63

Query  222  AYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIG  49
            A + G+ DPRKI+FAAKM LAL+L+SLL F KEP   +G  SVWAILTVVVVFEFSIG
Sbjct  64   AVQTGKNDPRKIVFAAKMALALTLISLLSFMKEPFPDLGRYSVWAILTVVVVFEFSIG  121



>ref|XP_010499104.1| PREDICTED: aluminum-activated malate transporter 4-like [Camelina 
sativa]
Length=566

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 72/120 (60%), Gaps = 9/120 (8%)
 Frame = -1

Query  369  SREGLLSRGGCSSELEWGIPSQST---NRGFLHGFR---DRVSAFFGDVKETSIKAYEMG  208
            +REGLLSR GCS   ++G    S     R     FR   D + A +  + + + K YEMG
Sbjct  5    NREGLLSRKGCS---DFGFNDSSIIDDRRSKFRCFRFCSDGIVASWMALYDIAAKLYEMG  61

Query  207  RKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGTQNILNF  28
            R D RK+ FA KMG+AL+L S +++ KEPL      +VWAILTVVVVFE+SIG   +  F
Sbjct  62   RSDRRKVYFAVKMGMALALCSFVIYLKEPLRDASKYAVWAILTVVVVFEYSIGATLVKGF  121



>ref|XP_008812805.1| PREDICTED: aluminum-activated malate transporter 5-like [Phoenix 
dactylifera]
Length=579

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 72/121 (60%), Gaps = 6/121 (5%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEWGI----PSQSTNRGFLHGFRDRVSAFFGDVKETS  229
            S R +    S+EGLLS      E EWG+      +   RG L      ++  +G  +E  
Sbjct  7    SFRYNSEQRSKEGLLS--SFLKEGEWGVGLDFDEEEEKRGCLRRLGAGIAGMWGKARELV  64

Query  228  IKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIG  49
             K ++ GR DPRK++F AKMGLAL+L S ++F KEP   +   SVWAILTVVV+FEFSIG
Sbjct  65   EKGWKFGRSDPRKVVFGAKMGLALTLTSFIIFLKEPSMDLTKHSVWAILTVVVIFEFSIG  124

Query  48   T  46
            +
Sbjct  125  S  125



>ref|XP_009356494.1| PREDICTED: aluminum-activated malate transporter 4 isoform X1 
[Pyrus x bretschneideri]
Length=568

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 73/121 (60%), Gaps = 6/121 (5%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCS----SELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKETS  229
            S R SF   S+E LLSR G S    +  E G   +    G      D  + F  + + T 
Sbjct  7    SFRHSFAERSKERLLSRKGYSDLGFNSSEAG--DEHVKCGCFRRISDGFNNFCNNFQGTF  64

Query  228  IKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIG  49
            IK Y+MG  DPRK IFA KMGL+L+LVSLL+FFK PL  +   S+WAILTVVVVFEFS+G
Sbjct  65   IKLYQMGHSDPRKAIFAIKMGLSLALVSLLIFFKVPLKDVSQYSIWAILTVVVVFEFSVG  124

Query  48   T  46
             
Sbjct  125  A  125



>ref|XP_009356502.1| PREDICTED: aluminum-activated malate transporter 4 isoform X2 
[Pyrus x bretschneideri]
Length=500

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 73/121 (60%), Gaps = 6/121 (5%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCS----SELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKETS  229
            S R SF   S+E LLSR G S    +  E G   +    G      D  + F  + + T 
Sbjct  7    SFRHSFAERSKERLLSRKGYSDLGFNSSEAG--DEHVKCGCFRRISDGFNNFCNNFQGTF  64

Query  228  IKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIG  49
            IK Y+MG  DPRK IFA KMGL+L+LVSLL+FFK PL  +   S+WAILTVVVVFEFS+G
Sbjct  65   IKLYQMGHSDPRKAIFAIKMGLSLALVSLLIFFKVPLKDVSQYSIWAILTVVVVFEFSVG  124

Query  48   T  46
             
Sbjct  125  A  125



>ref|XP_004298293.1| PREDICTED: aluminum-activated malate transporter 4-like [Fragaria 
vesca subsp. vesca]
Length=578

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 79/123 (64%), Gaps = 9/123 (7%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEWGIP-SQSTNRGFLH-GFRDRVSA----FFGDVKE  235
            S R SF   S+E LLSR G S   ++GI  SQ +    +  G+  R+S     F  +V +
Sbjct  7    SFRHSFAERSKERLLSRKGYS---DFGINNSQCSEEEIVKCGWFGRMSEGFVNFCNNVPQ  63

Query  234  TSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFS  55
             S+K Y+MG  DPRK  FA KMGL+L++VSLL+FFKEPL      S+WAILTVV+VFEFS
Sbjct  64   VSVKLYKMGSSDPRKAYFAGKMGLSLAIVSLLIFFKEPLKGASQYSIWAILTVVLVFEFS  123

Query  54   IGT  46
            IG 
Sbjct  124  IGA  126



>emb|CBI15440.3| unnamed protein product [Vitis vinifera]
Length=549

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 74/125 (59%), Gaps = 12/125 (10%)
 Frame = -1

Query  396  SLRRSFMGA-SREGLLSRGGCSS-------ELEWGIPSQSTNRGFLHGFRDRVSAFFGDV  241
            S R +F     R+ LLS  G S        E E   P   + R   H F +    ++   
Sbjct  7    SFRHTFAEKRERDRLLSCKGYSELGFVHLEENEEATPRWCSFRSIRHKFAN----WWKTT  62

Query  240  KETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFE  61
            K+ + K +EMG  DPRKI+F+AKMGLAL L++LL+F KEP+  +G  SVWAILTVVVVFE
Sbjct  63   KDVAAKGWEMGLSDPRKIVFSAKMGLALMLITLLIFLKEPVKDLGRYSVWAILTVVVVFE  122

Query  60   FSIGT  46
            FSIG 
Sbjct  123  FSIGA  127



>ref|XP_008367579.1| PREDICTED: aluminum-activated malate transporter 9-like [Malus 
domestica]
Length=597

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 67/112 (60%), Gaps = 5/112 (4%)
 Frame = -1

Query  366  REGLLSRGGCSSEL-----EWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRK  202
            RE LLS     SEL     E   PS S          DR+  +   V+  S +A +MG+ 
Sbjct  16   RERLLSVQKGYSELGFVHIEEQEPSGSARCCTFRSVSDRIVGWCRTVQHVSSRAVQMGQS  75

Query  201  DPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
            DPRKI+FA KMGLAL +VSLL+F KEP   +   SVWAILTVVVVFEFSIG 
Sbjct  76   DPRKIVFAGKMGLALMIVSLLIFLKEPFKQLSRYSVWAILTVVVVFEFSIGA  127



>ref|XP_008374744.1| PREDICTED: aluminum-activated malate transporter 9 [Malus domestica]
Length=602

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 70/116 (60%), Gaps = 9/116 (8%)
 Frame = -1

Query  366  REGLLS--RGGCSSEL-------EWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAYE  214
            RE LLS  +G   SEL       E    S ST         DR+  +   V+  S +A +
Sbjct  16   RERLLSVQKGYSYSELGGFPNIEEQDPSSGSTRCCTFRSVSDRIVGWCRTVQHVSKRAVK  75

Query  213  MGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
            MG+ DPRKIIFAAKMGLAL ++SLL+F KEP   +   SVWAILTVVVVFEFSIG 
Sbjct  76   MGQSDPRKIIFAAKMGLALMIISLLIFLKEPFKQLSRYSVWAILTVVVVFEFSIGA  131



>ref|XP_008361730.1| PREDICTED: aluminum-activated malate transporter 4-like isoform 
X1 [Malus domestica]
Length=568

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 71/121 (59%), Gaps = 6/121 (5%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCS----SELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKETS  229
            S R SF   S+E LLSR G S    +  E G   +    G      D    F  + + T 
Sbjct  7    SFRHSFAERSKERLLSRKGYSDLGFNSSEAG--DEXVKCGCFRRISDGFXNFCNNFQGTF  64

Query  228  IKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIG  49
            IK Y+MG  DPRK IFA KMGL L+LVSLL+FFK PL  +   S+WAILTVVVVFEFS+G
Sbjct  65   IKLYQMGHSDPRKAIFAIKMGLTLALVSLLIFFKVPLKDVSQYSIWAILTVVVVFEFSVG  124

Query  48   T  46
             
Sbjct  125  A  125



>ref|XP_002275995.1| PREDICTED: aluminum-activated malate transporter 9-like [Vitis 
vinifera]
Length=588

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 74/125 (59%), Gaps = 12/125 (10%)
 Frame = -1

Query  396  SLRRSFMGA-SREGLLSRGGCSS-------ELEWGIPSQSTNRGFLHGFRDRVSAFFGDV  241
            S R +F     R+ LLS  G S        E E   P   + R   H F +    ++   
Sbjct  7    SFRHTFAEKRERDRLLSCKGYSELGFVHLEENEEATPRWCSFRSIRHKFAN----WWKTT  62

Query  240  KETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFE  61
            K+ + K +EMG  DPRKI+F+AKMGLAL L++LL+F KEP+  +G  SVWAILTVVVVFE
Sbjct  63   KDVAAKGWEMGLSDPRKIVFSAKMGLALMLITLLIFLKEPVKDLGRYSVWAILTVVVVFE  122

Query  60   FSIGT  46
            FSIG 
Sbjct  123  FSIGA  127



>ref|XP_011084604.1| PREDICTED: aluminum-activated malate transporter 4-like isoform 
X3 [Sesamum indicum]
Length=445

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 79/126 (63%), Gaps = 8/126 (6%)
 Frame = -1

Query  408  AYSESLRRSFMGASREGLLSRGGCSSELEWGI-PSQSTNRG----FLHGFRDRVSAFFGD  244
            ++S SLR SF  +SR  L+     S E   G+  S   N G          +R   ++ D
Sbjct  3    SHSGSLRGSFAESSRVRLIPGKYYSDE---GLNDSYGKNHGCFRRMFQAIGERFLGWWRD  59

Query  243  VKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVF  64
            VK T++ A+EMGR DPRK+IFAAKMG ALSLVS+L+FF++  SY     +WAILTV+VVF
Sbjct  60   VKGTAVGAFEMGRSDPRKVIFAAKMGAALSLVSVLIFFRKSASYFTLNHIWAILTVIVVF  119

Query  63   EFSIGT  46
            EFSIG 
Sbjct  120  EFSIGA  125



>ref|XP_006307134.1| hypothetical protein CARUB_v10008724mg [Capsella rubella]
 gb|EOA40032.1| hypothetical protein CARUB_v10008724mg [Capsella rubella]
Length=565

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 71/120 (59%), Gaps = 9/120 (8%)
 Frame = -1

Query  369  SREGLLSRGGCSSELEWGIPSQST---NRGFLHGFR---DRVSAFFGDVKETSIKAYEMG  208
            +REGLL R GCS   ++G    S     R     FR   D ++A +    + + K YEMG
Sbjct  5    TREGLLPRKGCS---DFGFNDSSIIDDRRSKFRCFRFFSDGITASWMAFYDIAAKLYEMG  61

Query  207  RKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGTQNILNF  28
            R D RK+ FA KMG+AL+L S +++ KEPL      +VWAILTVVVVFE+SIG   +  F
Sbjct  62   RSDRRKVYFAVKMGMALALCSFVIYLKEPLRDASKYAVWAILTVVVVFEYSIGATLVKGF  121



>ref|XP_011084603.1| PREDICTED: aluminum-activated malate transporter 4-like isoform 
X2 [Sesamum indicum]
Length=451

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 79/126 (63%), Gaps = 8/126 (6%)
 Frame = -1

Query  408  AYSESLRRSFMGASREGLLSRGGCSSELEWGI-PSQSTNRG----FLHGFRDRVSAFFGD  244
            ++S SLR SF  +SR  L+     S E   G+  S   N G          +R   ++ D
Sbjct  3    SHSGSLRGSFAESSRVRLIPGKYYSDE---GLNDSYGKNHGCFRRMFQAIGERFLGWWRD  59

Query  243  VKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVF  64
            VK T++ A+EMGR DPRK+IFAAKMG ALSLVS+L+FF++  SY     +WAILTV+VVF
Sbjct  60   VKGTAVGAFEMGRSDPRKVIFAAKMGAALSLVSVLIFFRKSASYFTLNHIWAILTVIVVF  119

Query  63   EFSIGT  46
            EFSIG 
Sbjct  120  EFSIGA  125



>ref|XP_002893421.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69680.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=567

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 72/120 (60%), Gaps = 9/120 (8%)
 Frame = -1

Query  369  SREGLLSRGGCSSELEWGIPSQST---NRGFLHGFR---DRVSAFFGDVKETSIKAYEMG  208
            +RE LLSR GCS   ++G    S     R     FR   D ++A +  + + + K YEMG
Sbjct  5    TREALLSRKGCS---DFGFNDSSIIDDRRSKFRCFRFCSDGITASWKALYDIAAKLYEMG  61

Query  207  RKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGTQNILNF  28
            R D RK+ F+ KMG+AL+L S +++ KEPL      +VWAILTVVVVFE+SIG   +  F
Sbjct  62   RSDRRKVYFSVKMGMALALCSFVIYLKEPLRDASKYAVWAILTVVVVFEYSIGATLVKGF  121



>ref|XP_008361731.1| PREDICTED: aluminum-activated malate transporter 4-like isoform 
X2 [Malus domestica]
Length=500

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 71/121 (59%), Gaps = 6/121 (5%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCS----SELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKETS  229
            S R SF   S+E LLSR G S    +  E G   +    G      D    F  + + T 
Sbjct  7    SFRHSFAERSKERLLSRKGYSDLGFNSSEAG--DEXVKCGCFRRISDGFXNFCNNFQGTF  64

Query  228  IKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIG  49
            IK Y+MG  DPRK IFA KMGL L+LVSLL+FFK PL  +   S+WAILTVVVVFEFS+G
Sbjct  65   IKLYQMGHSDPRKAIFAIKMGLTLALVSLLIFFKVPLKDVSQYSIWAILTVVVVFEFSVG  124

Query  48   T  46
             
Sbjct  125  A  125



>ref|XP_002278994.2| PREDICTED: aluminum-activated malate transporter 9 [Vitis vinifera]
 ref|XP_010647826.1| PREDICTED: aluminum-activated malate transporter 9 [Vitis vinifera]
Length=535

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 62/80 (78%), Gaps = 1/80 (1%)
 Frame = -1

Query  267  RVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWA  88
            ++  F+  V++ S KA+EMGR DPRKIIFA KMGLALSLVSLL+F+KEP   +G  S+WA
Sbjct  46   KLKNFWNSVQDVSWKAWEMGRSDPRKIIFAMKMGLALSLVSLLIFWKEPAD-VGQYSIWA  104

Query  87   ILTVVVVFEFSIGTQNILNF  28
            ILTV+V+FEFSIG   I  F
Sbjct  105  ILTVIVMFEFSIGATFIKGF  124



>ref|XP_002529137.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33250.1| conserved hypothetical protein [Ricinus communis]
Length=574

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 76/126 (60%), Gaps = 6/126 (5%)
 Frame = -1

Query  408  AYSESLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNRGFL--HGFR---DRVSAFFGD  244
            A + S R SF   S+E LLSR G  S+ +          G +    FR   D+++     
Sbjct  3    AKTGSFRHSFAERSKERLLSRKG-YSDFDLNSSYGGGEGGVIKCRCFRLLCDQINNSRNA  61

Query  243  VKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVF  64
            + +  ++ Y MGR DPRK+ FA KMGL+L+LVSL++F KEPL  +   S+WAILTVVVVF
Sbjct  62   IHDAVVELYNMGRTDPRKVFFAVKMGLSLALVSLVIFLKEPLKNVNQYSIWAILTVVVVF  121

Query  63   EFSIGT  46
            EFS+G 
Sbjct  122  EFSVGA  127



>ref|XP_010477920.1| PREDICTED: aluminum-activated malate transporter 4 [Camelina 
sativa]
Length=566

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 71/120 (59%), Gaps = 9/120 (8%)
 Frame = -1

Query  369  SREGLLSRGGCSSELEWGIPSQST---NRGFLHGFR---DRVSAFFGDVKETSIKAYEMG  208
            +RE LLSR GCS   ++G    S     R     FR   D + A +  + + + K YEMG
Sbjct  5    TREALLSRKGCS---DFGFNDSSIIDDRRSKFRCFRFCSDGIVASWMALYDIAAKLYEMG  61

Query  207  RKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGTQNILNF  28
            R D RK+ FA KMG+AL+L S +++ KEPL      +VWAILTVVVVFE+SIG   +  F
Sbjct  62   RSDRRKVYFAVKMGMALALCSFVIYLKEPLRDASKYAVWAILTVVVVFEYSIGATLVKGF  121



>ref|XP_010094774.1| Aluminum-activated malate transporter 9 [Morus notabilis]
 gb|EXB56939.1| Aluminum-activated malate transporter 9 [Morus notabilis]
Length=608

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 76/133 (57%), Gaps = 18/133 (14%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNR-------------GFLHGFRDRVSA  256
            S R +F+   RE LLS     SEL   +P++S                GFL  FR     
Sbjct  7    SFRYNFV-EKRERLLSMNKGYSELAGFLPTESDEENQLASSPSRCCGCGFL-SFRSVSDG  64

Query  255  FFG---DVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAI  85
             F      +E   KA+EMGR DPRKI+F+AKMGLAL L+SLL++ +EP   +   SVWAI
Sbjct  65   LFRRYRTAQEVLHKAWEMGRSDPRKIVFSAKMGLALMLISLLIYLREPFKDLSRYSVWAI  124

Query  84   LTVVVVFEFSIGT  46
            LTVVVVFEFSIG 
Sbjct  125  LTVVVVFEFSIGA  137



>ref|XP_008240281.1| PREDICTED: aluminum-activated malate transporter 9 [Prunus mume]
Length=596

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 67/112 (60%), Gaps = 5/112 (4%)
 Frame = -1

Query  366  REGLLSRGGCSSEL-----EWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRK  202
            RE LLS     SEL     E   P  S          DR+ ++   V+  S +A  MG+ 
Sbjct  16   RERLLSTQKDYSELGFVHIEEQEPYGSPRCCTFRSVSDRIMSWCRTVQNVSNRAIRMGQS  75

Query  201  DPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
            DPRKI+FAAKMGLAL ++SLL+F KEP   +   SVWAILTVVVVFEFSIG 
Sbjct  76   DPRKIVFAAKMGLALMIISLLIFLKEPFKQLSRYSVWAILTVVVVFEFSIGA  127



>ref|XP_010681586.1| PREDICTED: aluminum-activated malate transporter 4 [Beta vulgaris 
subsp. vulgaris]
Length=593

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 78/134 (58%), Gaps = 17/134 (13%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCS----------SELEWGIPS----QSTNRGFLHGFR---D  268
            SLR+SF+  S+E  LSR G S          +EL  G+       + NR  +  +R   D
Sbjct  7    SLRQSFIERSKEKFLSRKGYSELGFSASDGETELNDGVKCGCFGSTCNRAKVGCYRWICD  66

Query  267  RVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWA  88
             +   F   ++  +  YEMGR DPRK+ F+AKMGL LSLVSLL+FF  PL  I   ++WA
Sbjct  67   GILGLFNGFRDFGVNLYEMGRSDPRKVFFSAKMGLCLSLVSLLIFFTGPLKDISQYAIWA  126

Query  87   ILTVVVVFEFSIGT  46
            ILTVVV FE+S+G 
Sbjct  127  ILTVVVCFEYSVGA  140



>ref|XP_011084602.1| PREDICTED: aluminum-activated malate transporter 4-like isoform 
X1 [Sesamum indicum]
Length=569

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 79/126 (63%), Gaps = 8/126 (6%)
 Frame = -1

Query  408  AYSESLRRSFMGASREGLLSRGGCSSELEWGI-PSQSTNRG----FLHGFRDRVSAFFGD  244
            ++S SLR SF  +SR  L+     S E   G+  S   N G          +R   ++ D
Sbjct  3    SHSGSLRGSFAESSRVRLIPGKYYSDE---GLNDSYGKNHGCFRRMFQAIGERFLGWWRD  59

Query  243  VKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVF  64
            VK T++ A+EMGR DPRK+IFAAKMG ALSLVS+L+FF++  SY     +WAILTV+VVF
Sbjct  60   VKGTAVGAFEMGRSDPRKVIFAAKMGAALSLVSVLIFFRKSASYFTLNHIWAILTVIVVF  119

Query  63   EFSIGT  46
            EFSIG 
Sbjct  120  EFSIGA  125



>ref|XP_008812807.1| PREDICTED: LOW QUALITY PROTEIN: aluminum-activated malate transporter 
9-like [Phoenix dactylifera]
Length=422

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 74/127 (58%), Gaps = 11/127 (9%)
 Frame = -1

Query  414  GNAYSESLRRSFMGASREGLLSRGGCSSELEWGI----PSQSTNRGFLHGFRDRVSAFFG  247
            G+ +  S RRS     +EGLLS      E EWG+      +   RG L    D ++  +G
Sbjct  6    GSFWYSSERRS-----KEGLLS--SFLKEGEWGLGLDFDEEEEERGCLRRLGDGIAGLWG  58

Query  246  DVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVV  67
              +E   K ++ GR DPRK+IFAAKM LAL+L   ++F KE    +   +VWAILTVVVV
Sbjct  59   KARELVDKGWKFGRSDPRKVIFAAKMRLALTLTLFIIFLKEASMDLTKHAVWAILTVVVV  118

Query  66   FEFSIGT  46
            FEFS+G+
Sbjct  119  FEFSVGS  125



>gb|KHN20718.1| Aluminum-activated malate transporter 9 [Glycine soja]
Length=596

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 76/128 (59%), Gaps = 12/128 (9%)
 Frame = -1

Query  396  SLRRSFMGASREGLLS-RGGCSSELEWGIP-------SQSTNRGFLHGFR---DRVSAFF  250
            S R SF    +E LLS +GG  S++  GI         QS  R     +R   D +   +
Sbjct  13   SFRHSF-AEKKERLLSMKGGGYSQIGIGIALPESDEEDQSPTRRSCCSYRAVSDGIVGAW  71

Query  249  GDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVV  70
               K    +A+EMGR DPRKIIF+AKMGLAL L+SLL+F K+P   I   SVWAILTVVV
Sbjct  72   KTAKHVVARAWEMGRSDPRKIIFSAKMGLALILLSLLIFLKQPFEDISKHSVWAILTVVV  131

Query  69   VFEFSIGT  46
            VFEFSIG 
Sbjct  132  VFEFSIGA  139



>ref|XP_003530009.2| PREDICTED: aluminum-activated malate transporter 9-like isoform 
X1 [Glycine max]
Length=596

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 76/128 (59%), Gaps = 12/128 (9%)
 Frame = -1

Query  396  SLRRSFMGASREGLLS-RGGCSSELEWGIP-------SQSTNRGFLHGFR---DRVSAFF  250
            S R SF    +E LLS +GG  S++  GI         QS  R     +R   D +   +
Sbjct  13   SFRHSF-AEKKERLLSMKGGGYSQIGIGIALPESDEEDQSPTRRSCCSYRAVSDGIVGAW  71

Query  249  GDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVV  70
               K    +A+EMGR DPRKIIF+AKMGLAL L+SLL+F K+P   I   SVWAILTVVV
Sbjct  72   KTAKHVVARAWEMGRSDPRKIIFSAKMGLALILLSLLIFLKQPFEDISKHSVWAILTVVV  131

Query  69   VFEFSIGT  46
            VFEFSIG 
Sbjct  132  VFEFSIGA  139



>ref|XP_006583403.1| PREDICTED: aluminum-activated malate transporter 9-like isoform 
X2 [Glycine max]
Length=563

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 76/128 (59%), Gaps = 12/128 (9%)
 Frame = -1

Query  396  SLRRSFMGASREGLLS-RGGCSSELEWGIP-------SQSTNRGFLHGFR---DRVSAFF  250
            S R SF    +E LLS +GG  S++  GI         QS  R     +R   D +   +
Sbjct  13   SFRHSF-AEKKERLLSMKGGGYSQIGIGIALPESDEEDQSPTRRSCCSYRAVSDGIVGAW  71

Query  249  GDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVV  70
               K    +A+EMGR DPRKIIF+AKMGLAL L+SLL+F K+P   I   SVWAILTVVV
Sbjct  72   KTAKHVVARAWEMGRSDPRKIIFSAKMGLALILLSLLIFLKQPFEDISKHSVWAILTVVV  131

Query  69   VFEFSIGT  46
            VFEFSIG 
Sbjct  132  VFEFSIGA  139



>emb|CDX84992.1| BnaC05g20630D [Brassica napus]
Length=546

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 65/118 (55%), Gaps = 18/118 (15%)
 Frame = -1

Query  381  FMGASREGLLSRGGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRK  202
            F   +RE LLSR GCS                  GF D  S    D + +  + YEMGR 
Sbjct  2    FGDHTRESLLSRKGCSD----------------FGFND--SGIISDDRRSKWRLYEMGRS  43

Query  201  DPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGTQNILNF  28
            D RK+ FA KMG+AL+L S +++ KEPL      +VWAILTVVVVFE+SIG   +  F
Sbjct  44   DRRKVYFAVKMGVALALCSFVIYLKEPLHDASKYAVWAILTVVVVFEYSIGATLVKGF  101



>ref|XP_009410081.1| PREDICTED: aluminum-activated malate transporter 4-like [Musa 
acuminata subsp. malaccensis]
Length=579

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 75/117 (64%), Gaps = 5/117 (4%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNRG-FLHGFRDRVSAFFGDVKETSIKA  220
            S   +F   S+E LLS    S+ L       ST +G       DR++A +  ++  +++ 
Sbjct  7    SFHYNFEQRSKERLLS----STLLPHLYDDPSTRQGGCFRRLADRIAAAWAFIRWLAVEG  62

Query  219  YEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIG  49
            +E GR DPRK++FAAKMGLAL+L+SLL+F +EP   +   SVWAILTVVVVFEFSIG
Sbjct  63   WEFGRSDPRKVVFAAKMGLALTLISLLIFLREPFRDLTKYSVWAILTVVVVFEFSIG  119



>gb|EYU40877.1| hypothetical protein MIMGU_mgv1a0220201mg, partial [Erythranthe 
guttata]
Length=100

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = -1

Query  285  LHGFRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIG  106
               FRD+++  + +  + S KA EMG+KDPRKII+A K G AL+ VSL +F+K+PL  + 
Sbjct  23   FQSFRDKITQLWSNSCDFSKKALEMGKKDPRKIIYAIKSGFALAFVSLFIFWKKPLPDVS  82

Query  105  SKSVWAILTVVVVFEFSI  52
              S+WAILTV+V+FEFSI
Sbjct  83   QFSIWAILTVIVMFEFSI  100



>emb|CDY42102.1| BnaA09g28580D [Brassica napus]
Length=546

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 65/118 (55%), Gaps = 18/118 (15%)
 Frame = -1

Query  381  FMGASREGLLSRGGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRK  202
            F   +R+ LLSR GCS                  GF D  S    D + +  + YEMGR 
Sbjct  2    FGDQTRDALLSRKGCSD----------------FGFND--SGIISDDRRSKWRLYEMGRS  43

Query  201  DPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGTQNILNF  28
            D RK+ FA KMG+AL+L S +++ KEPL      +VWAILTVVVVFE+SIG   +  F
Sbjct  44   DRRKVYFAVKMGVALALCSFVIYLKEPLHDASKYAVWAILTVVVVFEYSIGATLVKGF  101



>ref|XP_007160366.1| hypothetical protein PHAVU_002G315500g [Phaseolus vulgaris]
 gb|ESW32360.1| hypothetical protein PHAVU_002G315500g [Phaseolus vulgaris]
Length=576

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = -1

Query  252  FGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVV  73
            +  VK+ ++KA++MGR DPRK+IF+ KMGLAL+L+S L++ KEP   +   SVWAILTVV
Sbjct  53   WNTVKQVAVKAWDMGRSDPRKVIFSVKMGLALTLISFLIYLKEPFKELIRYSVWAILTVV  112

Query  72   VVFEFSIG  49
            VVFEFSIG
Sbjct  113  VVFEFSIG  120



>gb|KJB37235.1| hypothetical protein B456_006G195100 [Gossypium raimondii]
Length=582

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = -1

Query  270  DRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVW  91
            D+V+ F   V++ + KA +MG  DPRKI+F+AK+GLAL L+SLL+F KEP+  +   SVW
Sbjct  47   DKVTGFSKKVQDVARKACQMGISDPRKIVFSAKVGLALMLISLLIFLKEPIKELSEHSVW  106

Query  90   AILTVVVVFEFSIGT  46
            AILTVVVVFEFSIG 
Sbjct  107  AILTVVVVFEFSIGA  121



>ref|XP_010487770.1| PREDICTED: aluminum-activated malate transporter 9-like isoform 
X1 [Camelina sativa]
Length=599

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -1

Query  270  DRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVW  91
            DR+S  F  VK+ + KA++MG  DPRKI+F+AK+GLAL +V+LL+FF+EP   +   SVW
Sbjct  64   DRISGVFDGVKDVARKAWDMGVSDPRKIVFSAKIGLALMIVALLIFFQEPNPDLSRYSVW  123

Query  90   AILTVVVVFEFSIG  49
            AILTVVVVFEF+IG
Sbjct  124  AILTVVVVFEFTIG  137



>emb|CDY18521.1| BnaA01g26740D [Brassica napus]
Length=665

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 76/125 (61%), Gaps = 14/125 (11%)
 Frame = -1

Query  384  SFMGASREGLLSRGGCSSELEWG-IPSQSTNRGFLHG------------FRDRVSAFFGD  244
            SF    RE LLS  G S +L +G I S     G  HG               ++S  + D
Sbjct  94   SFRNGKRERLLSNNGFS-DLRFGDIESNDLLEGDSHGRTRLCCCCSCGNISGKISGVYED  152

Query  243  VKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVF  64
             K+ + KA+ MG  DPRKI+F+AK+GLAL++V++L+F++EP   +   SVWAILTVVVVF
Sbjct  153  AKDVARKAWAMGVSDPRKIVFSAKIGLALTIVAVLIFYQEPNPDLSRYSVWAILTVVVVF  212

Query  63   EFSIG  49
            EF+IG
Sbjct  213  EFTIG  217



>ref|XP_003555230.1| PREDICTED: aluminum-activated malate transporter 4-like isoform 
X1 [Glycine max]
 ref|XP_006605893.1| PREDICTED: aluminum-activated malate transporter 4-like isoform 
X2 [Glycine max]
 gb|KHN11433.1| Aluminum-activated malate transporter 4 [Glycine soja]
Length=553

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 72/118 (61%), Gaps = 3/118 (3%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEW-GIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKA  220
            S R SF+  S+E LLS+      + + G    S  R FL    DRV +F    ++ + K 
Sbjct  7    SFRHSFLEKSKERLLSKKEYQDFVGFNGDHDASPKRSFLDALSDRVVSFHNWSRDFASKL  66

Query  219  YEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
            YEMGR D RK++FA K GL+L++VSL+++ +E        SVWAILTVVVVFEFSIG 
Sbjct  67   YEMGRSDRRKVLFAVKAGLSLAIVSLVIYIEE--EQFSKYSVWAILTVVVVFEFSIGA  122



>ref|XP_002314876.2| hypothetical protein POPTR_0010s13750g [Populus trichocarpa]
 gb|EEF01047.2| hypothetical protein POPTR_0010s13750g [Populus trichocarpa]
Length=513

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 78/121 (64%), Gaps = 5/121 (4%)
 Frame = -1

Query  390  RRSFMGASREGLLSRGGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEM  211
            R +++ +S+E     G  S ++E     Q+    +L+   +++S    D +E +++A+EM
Sbjct  5    RHNYVESSKEWQPLLGSLSGDVE-----QAGKCKYLNLLSEKISKSLNDFQEFAVRAWEM  59

Query  210  GRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGTQNILN  31
            GR DP+K+IFA KMGLALS+VSLL+F+K     I   S+WAILTV+V+FE+SIG   I  
Sbjct  60   GRSDPKKVIFAIKMGLALSIVSLLIFWKGSNEDISQYSIWAILTVIVMFEYSIGATFIKG  119

Query  30   F  28
            F
Sbjct  120  F  120



>ref|XP_002883132.1| hypothetical protein ARALYDRAFT_898211 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59391.1| hypothetical protein ARALYDRAFT_898211 [Arabidopsis lyrata subsp. 
lyrata]
Length=597

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = -1

Query  270  DRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVW  91
            D++S  + D K+ + KA++MG  DPRKI+F+AK+GLAL++V+LL+F++EP   +   SVW
Sbjct  60   DKISGVYQDAKDVARKAWDMGVSDPRKIVFSAKIGLALTIVALLIFYQEPNPDLSRYSVW  119

Query  90   AILTVVVVFEFSIGT  46
            AILTVVVVFEF+IG 
Sbjct  120  AILTVVVVFEFTIGA  134



>ref|XP_004170574.1| PREDICTED: LOW QUALITY PROTEIN: aluminum-activated malate transporter 
9-like [Cucumis sativus]
Length=579

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 73/117 (62%), Gaps = 2/117 (2%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEW-GIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKA  220
            S + SF    RE LLS      +L +  I +   N         R S  +  V++   KA
Sbjct  7    SFKHSF-AERRERLLSTAKEFPDLGFNAIQTIHENPSCCSSVSHRFSYIWNSVQDVLYKA  65

Query  219  YEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIG  49
            ++MG  DPRKI+F+AKMGLAL+L+SLL+FFK+P+  +   SVWAILTVVVVFEFSIG
Sbjct  66   WQMGVSDPRKIVFSAKMGLALTLISLLIFFKQPVEELSRYSVWAILTVVVVFEFSIG  122



>ref|XP_004138239.1| PREDICTED: aluminum-activated malate transporter 9-like [Cucumis 
sativus]
 gb|KGN63811.1| hypothetical protein Csa_1G022500 [Cucumis sativus]
Length=579

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 73/117 (62%), Gaps = 2/117 (2%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEW-GIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKA  220
            S + SF    RE LLS      +L +  I +   N         R S  +  V++   KA
Sbjct  7    SFKHSF-AERRERLLSTAKEFPDLGFNAIQTIHENPSCCSSVSHRFSYIWNSVQDVLYKA  65

Query  219  YEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIG  49
            ++MG  DPRKI+F+AKMGLAL+L+SLL+FFK+P+  +   SVWAILTVVVVFEFSIG
Sbjct  66   WQMGVSDPRKIVFSAKMGLALTLISLLIFFKQPVEELSRYSVWAILTVVVVFEFSIG  122



>ref|XP_011012696.1| PREDICTED: aluminum-activated malate transporter 9 [Populus euphratica]
Length=587

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 69/119 (58%), Gaps = 5/119 (4%)
 Frame = -1

Query  387  RSFMGASREGLLSRGGCSSEL-----EWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIK  223
            R  +   RE LLS     SE+     +  +   + N        D++      V++ + +
Sbjct  9    RHSLAEKRERLLSTTKGYSEIVFPNIQEDLNEPTRNCCSYRLLSDKIVGLCKQVQDVAYR  68

Query  222  AYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
             Y+MG+ DPRKI+F+AKMG AL L+SLL+F KEP+  +    VWAILTVVVVFEFSIG 
Sbjct  69   GYQMGKSDPRKIVFSAKMGFALILISLLIFLKEPIKELSQHFVWAILTVVVVFEFSIGA  127



>ref|XP_006406604.1| hypothetical protein EUTSA_v10020343mg [Eutrema salsugineum]
 dbj|BAJ34033.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48057.1| hypothetical protein EUTSA_v10020343mg [Eutrema salsugineum]
Length=597

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 74/118 (63%), Gaps = 11/118 (9%)
 Frame = -1

Query  366  REGLLSRGGCS----SELEWGIPSQSTNRGFLH-------GFRDRVSAFFGDVKETSIKA  220
            RE LLS  G S    +++E     +S N G             +++S  + D K+   KA
Sbjct  16   REKLLSNNGFSDFRFTDIESNDLLESENYGRTRFCCCSCGNLSEKISGMYQDAKDVGRKA  75

Query  219  YEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
            +EMG  DPRKI+F+AK+GLAL++V++L+FF+EP   +   SVWAILTVVVVFEF+IG 
Sbjct  76   WEMGVSDPRKIVFSAKIGLALTIVAVLIFFQEPNPDLSRYSVWAILTVVVVFEFTIGA  133



>ref|XP_009112721.1| PREDICTED: aluminum-activated malate transporter 9 [Brassica 
rapa]
Length=592

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 75/125 (60%), Gaps = 14/125 (11%)
 Frame = -1

Query  384  SFMGASREGLLSRGGCSSELEWG-IPSQSTNRGFLHG------------FRDRVSAFFGD  244
            SF    RE LLS  G  S+L +G I S     G  HG               ++S  + D
Sbjct  7    SFRNGKRERLLSNNG-FSDLRFGDIESNDLLEGDSHGRTRLCCCCSCGNISGKISGVYED  65

Query  243  VKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVF  64
             K+   KA+ MG  DPRKI+F+AK+GLAL++V++L+F++EP   +   SVWAILTVVVVF
Sbjct  66   AKDVGRKAWAMGVSDPRKIVFSAKIGLALTIVAVLIFYQEPNPDLSRYSVWAILTVVVVF  125

Query  63   EFSIG  49
            EF+IG
Sbjct  126  EFTIG  130



>ref|NP_188473.1| aluminum-activated malate transporter 9 [Arabidopsis thaliana]
 sp|Q9LS46.1|ALMT9_ARATH RecName: Full=Aluminum-activated malate transporter 9; Short=AtALMT9 
[Arabidopsis thaliana]
 dbj|BAB01110.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM20514.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15577.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76098.1| aluminum-activated malate transporter 9 [Arabidopsis thaliana]
Length=598

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = -1

Query  270  DRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVW  91
            +++S  + D K+ + KA+EMG  DPRKI+F+AK+GLAL++V+LL+F++EP   +   SVW
Sbjct  61   EKISGVYDDAKDVARKAWEMGVSDPRKIVFSAKIGLALTIVALLIFYQEPNPDLSRYSVW  120

Query  90   AILTVVVVFEFSIGT  46
            AILTVVVVFEF+IG 
Sbjct  121  AILTVVVVFEFTIGA  135



>ref|XP_003517985.1| PREDICTED: aluminum-activated malate transporter 4-like [Glycine 
max]
Length=554

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 74/126 (59%), Gaps = 4/126 (3%)
 Frame = -1

Query  423  MAAGNAYSESLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGD  244
            MAA  A S SLR+ F   S+E LLSR   S     G  + S +    H   DRV+ F   
Sbjct  1    MAA--ARSVSLRQIFAERSKERLLSRKDFSDLRLNGTTATSASVATPHALSDRVAQFGEG  58

Query  243  VKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVF  64
            V     +  EM R DPRK++FAAK GL+L+LVSL ++ KE    +   S+WAILTVVVVF
Sbjct  59   VGRFFRELREMARSDPRKVVFAAKAGLSLALVSLFIYIKE--EQLSKYSIWAILTVVVVF  116

Query  63   EFSIGT  46
            EFS+G 
Sbjct  117  EFSVGA  122



>ref|XP_010265178.1| PREDICTED: aluminum-activated malate transporter 9 [Nelumbo nucifera]
Length=584

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 77/125 (62%), Gaps = 13/125 (10%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNRGF--LHGFRDRVSAF------FGDV  241
            S +  F   SRE LLS  G  SEL + I     N G     G+R   S        +  +
Sbjct  7    SFKSVFAEKSRERLLSNKGGYSELGFCI-----NDGVDETKGWRWCCSPIEVIVNSWTTL  61

Query  240  KETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFE  61
             +++IK +E GR DPRK IFAAK GLAL L++LL+F++EP   +G+ SVWAI+TVVVVFE
Sbjct  62   SQSAIKLWEFGRSDPRKAIFAAKGGLALVLITLLIFYREPFKDLGTYSVWAIMTVVVVFE  121

Query  60   FSIGT  46
            FS+G+
Sbjct  122  FSVGS  126



>ref|XP_009347009.1| PREDICTED: aluminum-activated malate transporter 9 [Pyrus x bretschneideri]
Length=602

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 69/116 (59%), Gaps = 9/116 (8%)
 Frame = -1

Query  366  REGLLS--RGGCSSEL------EWGIPSQSTNRGF-LHGFRDRVSAFFGDVKETSIKAYE  214
            RE LLS  +G   SEL      E   PS  + R        DR+  +   V+    +A  
Sbjct  16   RERLLSVQKGYSYSELGGFPNIEEQEPSSGSTRCCTFRSVSDRIVGWCRTVQHVWKRAVR  75

Query  213  MGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
            MG+ DPRKIIFAAKMGLAL ++SLL+F KEP   +   SVWAILTVVVVFEFSIG 
Sbjct  76   MGQSDPRKIIFAAKMGLALMIISLLIFLKEPFKQLSRYSVWAILTVVVVFEFSIGA  131



>gb|KFK44528.1| hypothetical protein AALP_AA1G268500 [Arabis alpina]
Length=568

 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 71/124 (57%), Gaps = 10/124 (8%)
 Frame = -1

Query  378  MGASREGLLSRGGCSSELEWGIPSQST----NRGFLHGFR---DRVSAFFGDVKETSIKA  220
            +  +RE LLSR  CS   ++G    S      R     FR   D + A +  + + + K 
Sbjct  5    LDQTREALLSRKACS---DFGFNDSSIIVDDRRSKFRCFRFCSDGIVATWKALYDIAAKL  61

Query  219  YEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGTQN  40
            YEMGR D RK+ F+ KMG+AL+L S +++ KEPL      +VWAILTVVVVFE+SIG   
Sbjct  62   YEMGRSDRRKVYFSVKMGMALALCSFVIYLKEPLRDASKYAVWAILTVVVVFEYSIGATL  121

Query  39   ILNF  28
            +  F
Sbjct  122  VKGF  125



>ref|XP_003533369.2| PREDICTED: aluminum-activated malate transporter 9-like [Glycine 
max]
Length=598

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 76/131 (58%), Gaps = 17/131 (13%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSR----GGCSSELEWGIP-------SQSTNRGFLHGFR---DRVS  259
            S R SF    +E LLS     GG  S++  GIP         S  R     +R   D + 
Sbjct  14   SFRHSF-AERKERLLSMKGGIGGGYSQI--GIPLPESDEEDHSPTRRRCCSYRAVSDGIV  70

Query  258  AFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILT  79
              +   K  + +A+EMGR DPRKIIF+AKMGLAL L+SLL+F K+P   I   SVWAILT
Sbjct  71   GAWKSAKRVAARAWEMGRSDPRKIIFSAKMGLALILLSLLIFLKQPFEDIAKHSVWAILT  130

Query  78   VVVVFEFSIGT  46
            VVVVFEFSIG 
Sbjct  131  VVVVFEFSIGA  141



>ref|XP_003525258.2| PREDICTED: aluminum-activated malate transporter 9 [Glycine max]
Length=622

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = -1

Query  273  RDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSV  94
             D   +++   K  + KA EMGR DPRKIIF+AK+GLAL+++SLL+F KEP + + S  V
Sbjct  83   EDEEQSWWNTFKRVAGKALEMGRSDPRKIIFSAKLGLALTILSLLIFLKEPFADLSSYCV  142

Query  93   WAILTVVVVFEFSIG  49
            WAILTVVVVFEF+IG
Sbjct  143  WAILTVVVVFEFNIG  157



>gb|KHN21560.1| Aluminum-activated malate transporter 9 [Glycine soja]
Length=584

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = -1

Query  273  RDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSV  94
             D   +++   K  + KA EMGR DPRKIIF+AK+GLAL+++SLL+F KEP + + S  V
Sbjct  45   EDEEQSWWNTFKRVAGKALEMGRSDPRKIIFSAKLGLALTILSLLIFLKEPFADLSSYCV  104

Query  93   WAILTVVVVFEFSIG  49
            WAILTVVVVFEF+IG
Sbjct  105  WAILTVVVVFEFNIG  119



>ref|XP_010419692.1| PREDICTED: aluminum-activated malate transporter 9-like [Camelina 
sativa]
Length=590

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -1

Query  270  DRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVW  91
            +R+S  F  VK+ + KA++MG  DPRKI+F+AK+GLAL +V+LL+FF+EP   +   SVW
Sbjct  64   ERISGVFESVKDVAKKAWDMGVSDPRKIVFSAKIGLALMIVALLIFFQEPNPDLSRYSVW  123

Query  90   AILTVVVVFEFSIG  49
            AILTVVVVFEF+IG
Sbjct  124  AILTVVVVFEFTIG  137



>ref|XP_006297257.1| hypothetical protein CARUB_v10013270mg [Capsella rubella]
 gb|EOA30155.1| hypothetical protein CARUB_v10013270mg [Capsella rubella]
Length=602

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = -1

Query  270  DRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVW  91
            +++S  F +VK+ + KA++MG  DPRKI+F+AK+GLAL +V+LL+FF+EP   +   SVW
Sbjct  64   EKISGVFNEVKDVARKAWDMGVSDPRKIVFSAKIGLALMIVALLIFFQEPNPDLSRYSVW  123

Query  90   AILTVVVVFEFSIGT  46
            AILTVVVVFEF+IG 
Sbjct  124  AILTVVVVFEFTIGA  138



>ref|XP_008453386.1| PREDICTED: aluminum-activated malate transporter 9 [Cucumis melo]
Length=579

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 73/118 (62%), Gaps = 2/118 (2%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEW-GIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKA  220
            S + SF    RE LLS      +L +  I +   N         R S  +  V++   KA
Sbjct  7    SFKHSF-AERRERLLSTAKEFPDLGFSAIQTIHENPSCCSSVFHRFSYIWNSVQDVLYKA  65

Query  219  YEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
            ++MG  DPRKI+F+AKMGLAL+L+SLL+FFK+P+  +   SVWAILTVVVVFEFSIG 
Sbjct  66   WQMGVSDPRKIVFSAKMGLALTLISLLIFFKQPVEELSRYSVWAILTVVVVFEFSIGA  123



>ref|XP_007142895.1| hypothetical protein PHAVU_007G025900g, partial [Phaseolus vulgaris]
 gb|ESW14889.1| hypothetical protein PHAVU_007G025900g, partial [Phaseolus vulgaris]
Length=641

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 70/117 (60%), Gaps = 4/117 (3%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAY  217
            S R SF+  S+E LLS+       + G  +  + R FL    DRV       K+ + K Y
Sbjct  96   SFRHSFLEKSKERLLSKRDLVGFNDEG--NDPSKRSFLDALSDRVVGLHNWSKDIASKLY  153

Query  216  EMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
            EMGR D RK++FA K GL+L++VSL+++ +E        S+WAILTVVVVFEFSIG 
Sbjct  154  EMGRNDRRKVVFAIKAGLSLAIVSLVIYIEE--EQFSKYSIWAILTVVVVFEFSIGA  208



>ref|XP_003630843.1| hypothetical protein MTR_8g104130 [Medicago truncatula]
 gb|AET05319.1| aluminum activated malate transporter family protein [Medicago 
truncatula]
Length=568

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 52/61 (85%), Gaps = 1/61 (2%)
 Frame = -1

Query  225  KAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSY-IGSKSVWAILTVVVVFEFSIG  49
            KA +MGR DPRKIIFAAKMGLAL+++SLL+F KEP +  IG  SVWAILTVVVVFEFSIG
Sbjct  56   KACQMGRSDPRKIIFAAKMGLALTIISLLIFLKEPFNKDIGRNSVWAILTVVVVFEFSIG  115

Query  48   T  46
             
Sbjct  116  A  116



>ref|XP_011008233.1| PREDICTED: aluminum-activated malate transporter 9-like [Populus 
euphratica]
 ref|XP_011008242.1| PREDICTED: aluminum-activated malate transporter 9-like [Populus 
euphratica]
 ref|XP_011008252.1| PREDICTED: aluminum-activated malate transporter 9-like [Populus 
euphratica]
 ref|XP_011008258.1| PREDICTED: aluminum-activated malate transporter 9-like [Populus 
euphratica]
 ref|XP_011008266.1| PREDICTED: aluminum-activated malate transporter 9-like [Populus 
euphratica]
Length=545

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 78/121 (64%), Gaps = 5/121 (4%)
 Frame = -1

Query  390  RRSFMGASREGLLSRGGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEM  211
            R +++ +S+E     G  S ++E     Q+    +L+   +++S    D ++ +++A+EM
Sbjct  7    RHNYVESSKEWQPLLGSLSGDVE-----QAGKCKYLNLLSEKISKSLNDFQDFAVRAWEM  61

Query  210  GRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGTQNILN  31
            GR DP+K+IFA KMGLALS+VSLL+F+K     I   S+WAILTV+V+FE+SIG   I  
Sbjct  62   GRSDPKKVIFAIKMGLALSIVSLLIFWKGSNEDISQYSIWAILTVIVMFEYSIGATFIKG  121

Query  30   F  28
            F
Sbjct  122  F  122



>ref|XP_010487771.1| PREDICTED: aluminum-activated malate transporter 9-like isoform 
X2 [Camelina sativa]
Length=583

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -1

Query  270  DRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVW  91
            DR+S  F  VK+ + KA++MG  DPRKI+F+AK+GLAL +V+LL+FF+EP   +   SVW
Sbjct  64   DRISGVFDGVKDVARKAWDMGVSDPRKIVFSAKIGLALMIVALLIFFQEPNPDLSRYSVW  123

Query  90   AILTVVVVFEFSIG  49
            AILTVVVVFEF+I 
Sbjct  124  AILTVVVVFEFTIA  137



>ref|XP_006584854.1| PREDICTED: aluminum-activated malate transporter 9-like isoform 
X2 [Glycine max]
Length=539

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -1

Query  273  RDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSV  94
            ++   +++   K  + KA EMGR DPRKIIF+AK+GLAL+++SLL+F KEP + + S  V
Sbjct  46   QEEEQSWWNTFKRVAEKALEMGRSDPRKIIFSAKLGLALTILSLLIFLKEPFADLSSYCV  105

Query  93   WAILTVVVVFEFSIGT  46
            WAILTVVVVFEF+IG 
Sbjct  106  WAILTVVVVFEFNIGA  121



>ref|XP_003532498.1| PREDICTED: aluminum-activated malate transporter 9-like isoform 
X1 [Glycine max]
 gb|KHN16583.1| Aluminum-activated malate transporter 9 [Glycine soja]
Length=576

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -1

Query  273  RDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSV  94
            ++   +++   K  + KA EMGR DPRKIIF+AK+GLAL+++SLL+F KEP + + S  V
Sbjct  46   QEEEQSWWNTFKRVAEKALEMGRSDPRKIIFSAKLGLALTILSLLIFLKEPFADLSSYCV  105

Query  93   WAILTVVVVFEFSIGT  46
            WAILTVVVVFEF+IG 
Sbjct  106  WAILTVVVVFEFNIGA  121



>ref|XP_003630841.1| hypothetical protein MTR_8g104110 [Medicago truncatula]
 gb|AET05317.1| aluminum activated malate transporter family protein [Medicago 
truncatula]
Length=578

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 52/61 (85%), Gaps = 1/61 (2%)
 Frame = -1

Query  225  KAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPL-SYIGSKSVWAILTVVVVFEFSIG  49
            KA+EMGR DPRKIIFAAKMGLAL+++SLL+F KEP  + I   SVWAILTVVVVFEFSIG
Sbjct  61   KAWEMGRSDPRKIIFAAKMGLALTIISLLIFLKEPFKNDISRHSVWAILTVVVVFEFSIG  120

Query  48   T  46
             
Sbjct  121  A  121



>emb|CDY26161.1| BnaA06g12560D [Brassica napus]
Length=560

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = -1

Query  276  FRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKS  97
            F D+++ F    ++  + A+EMG  DPRKIIF+AKMGLAL+LVS+LVFFK P S + +  
Sbjct  63   FSDKITGFVTKSQDVLVTAWEMGTSDPRKIIFSAKMGLALTLVSILVFFKLPGSELSNHY  122

Query  96   VWAILTVVVVFEFSIG  49
            +WAILT+VVVFEFSIG
Sbjct  123  LWAILTIVVVFEFSIG  138



>ref|XP_004300533.1| PREDICTED: aluminum-activated malate transporter 9 [Fragaria 
vesca subsp. vesca]
Length=597

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = -1

Query  270  DRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVW  91
            D+V  +   V+  S +A +MG+ DPRKI+F+AKMGLAL L+SLL+F KEP   +   SVW
Sbjct  56   DKVVGWCRTVQGVSRRAIKMGKSDPRKIVFSAKMGLALMLISLLIFLKEPFKQLSRYSVW  115

Query  90   AILTVVVVFEFSIGT  46
            AILTVVVVFEFSIG 
Sbjct  116  AILTVVVVFEFSIGA  130



>ref|XP_009149285.1| PREDICTED: putative aluminum-activated malate transporter 3 [Brassica 
rapa]
Length=581

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = -1

Query  276  FRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKS  97
            F D+++ F    ++  + A+EMG  DPRKIIF+AKMGLAL+LVS+LVFFK P S + +  
Sbjct  63   FSDKITGFVTKSQDVLVTAWEMGTSDPRKIIFSAKMGLALTLVSILVFFKLPGSELSNHY  122

Query  96   VWAILTVVVVFEFSIG  49
            +WAILT+VVVFEFSIG
Sbjct  123  LWAILTIVVVFEFSIG  138



>ref|XP_009381461.1| PREDICTED: aluminum-activated malate transporter 9-like [Musa 
acuminata subsp. malaccensis]
Length=568

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 69/117 (59%), Gaps = 6/117 (5%)
 Frame = -1

Query  399  ESLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKA  220
            ES   +F   S E LLS      E     P Q   RG  H   D  +A +  +   +++ 
Sbjct  6    ESFHYNFEQRSNERLLSSTILYHE---PYPRQ---RGCFHRLADGAAATWACLCGLAVEG  59

Query  219  YEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIG  49
            +E GR DPRK++FAAKMGLAL+++SLL+F +     +   SVWAILTVVVVFEFSIG
Sbjct  60   WEFGRSDPRKVVFAAKMGLALTIISLLIFLRVTFHDLSKHSVWAILTVVVVFEFSIG  116



>gb|EYU40875.1| hypothetical protein MIMGU_mgv1a003508mg [Erythranthe guttata]
Length=580

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = -1

Query  282  HGFRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGS  103
            H  R RV   + D      KA EMGRKDPRKII+A K G AL++VSLL+F+K+PLS +  
Sbjct  20   HSLRVRVVQLWSDYWGFFKKALEMGRKDPRKIIYAVKNGFALAVVSLLIFWKDPLSDVSQ  79

Query  102  KSVWAILTVVVVFEFSIGTQNILNF  28
             ++WAILTV+V+FEFSIG   I  F
Sbjct  80   FAIWAILTVIVMFEFSIGATFIKGF  104



>gb|AAW81734.1| Putative expressed protein [Brassica oleracea]
Length=581

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = -1

Query  276  FRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKS  97
            F D+++ F    ++  + A+EMG  DPRKIIF+AKMGLAL+LVS+LVFFK P S + +  
Sbjct  63   FSDKITGFVTKSQDVFVTAWEMGTSDPRKIIFSAKMGLALTLVSILVFFKLPGSELSNHY  122

Query  96   VWAILTVVVVFEFSIG  49
            +WAILT+VVVFEFSIG
Sbjct  123  LWAILTIVVVFEFSIG  138



>ref|XP_010498230.1| PREDICTED: putative aluminum-activated malate transporter 3 [Camelina 
sativa]
Length=587

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 80/133 (60%), Gaps = 11/133 (8%)
 Frame = -1

Query  414  GNAYSESLRRS--FMGASREGLLSR------GGCSSELEWGIPSQSTNRGFLHGFR---D  268
            G+ +  S RR   F G+ R+ +  R       G S   E GIP++ +       +R   D
Sbjct  12   GSMFDGSFRRGSMFDGSFRQSIKDRLIPQHTRGYSYVNEDGIPNEDSTSVRCCSYRYFSD  71

Query  267  RVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWA  88
            +++A     ++  + A++MG  DPRKIIF+AKMGLAL+L S+L+FFK P   + S  +WA
Sbjct  72   KITALVKTSQDVFVTAWKMGTSDPRKIIFSAKMGLALTLTSILIFFKIPGLELSSHYLWA  131

Query  87   ILTVVVVFEFSIG  49
            ILTVVV+FEFSIG
Sbjct  132  ILTVVVIFEFSIG  144



>emb|CDY19211.1| BnaC05g14120D [Brassica napus]
Length=564

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = -1

Query  276  FRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKS  97
            F D+++ F    ++  + A+EMG  DPRKIIF+AKMGLAL+LVS+LVFFK P S + +  
Sbjct  63   FSDKITGFVTKSQDVFVTAWEMGTSDPRKIIFSAKMGLALTLVSILVFFKLPGSELSNHY  122

Query  96   VWAILTVVVVFEFSIG  49
            +WAILT+VVVFEFSIG
Sbjct  123  LWAILTIVVVFEFSIG  138



>gb|KEH27049.1| aluminum activated malate transporter family protein [Medicago 
truncatula]
Length=599

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = -1

Query  279  GFRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSK  100
            GF D +  F+   K  + +A+EMG  DPRK +F+AKMGLAL L+SLL+F K+P   +G  
Sbjct  63   GFSDGIVEFWKKSKRVAGRAWEMGVSDPRKFVFSAKMGLALILISLLIFLKQPFPDVGKY  122

Query  99   SVWAILTVVVVFEFSIG  49
            SVWAILTVVVVFEFSIG
Sbjct  123  SVWAILTVVVVFEFSIG  139



>ref|XP_006362575.1| PREDICTED: aluminum-activated malate transporter 9-like [Solanum 
tuberosum]
Length=327

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = -1

Query  273  RDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSV  94
            R+    +F ++++ + KA EMG+ DPRKIIF+ KMG AL  VSLL+F+KEP   I   S+
Sbjct  27   RNGYCIYFNNIQDFAKKAIEMGKNDPRKIIFSLKMGFALFFVSLLIFWKEPFPEIAQFSI  86

Query  93   WAILTVVVVFEFSIG  49
            WAILTV+++FEF+IG
Sbjct  87   WAILTVLIMFEFTIG  101



>ref|XP_010477020.1| PREDICTED: putative aluminum-activated malate transporter 3 [Camelina 
sativa]
Length=586

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 79/133 (59%), Gaps = 11/133 (8%)
 Frame = -1

Query  414  GNAYSESLRRS--FMGASREGLLSR------GGCSSELEWGIPSQSTNRGFLHGFR---D  268
            G+ +  S RR   F G+ R+ +  R       G S   E GIP++ T       +R   D
Sbjct  12   GSMFDGSFRRGSMFDGSFRQSIKDRLIPQHTRGYSYVNEDGIPNEDTTSVRCCSYRYFSD  71

Query  267  RVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWA  88
            +++A     ++    A++MG  DPRKIIF+AKMGLAL+L S+L+FFK P   + S  +WA
Sbjct  72   KITALVKKSQDVLDTAWKMGTSDPRKIIFSAKMGLALTLTSILIFFKIPGLELSSHYLWA  131

Query  87   ILTVVVVFEFSIG  49
            ILTVVV+FEFSIG
Sbjct  132  ILTVVVIFEFSIG  144



>ref|XP_009115329.1| PREDICTED: aluminum-activated malate transporter 4-like [Brassica 
rapa]
 ref|XP_009115330.1| PREDICTED: aluminum-activated malate transporter 4-like [Brassica 
rapa]
Length=573

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 73/123 (59%), Gaps = 6/123 (5%)
 Frame = -1

Query  381  FMGASREGLLSRGGCSSE--LEWGIPS---QSTNRGFLHGFRDRVSAFFGDVKETSIKAY  217
            F   +R+ LLSR GCS     + GI S   +S  R F   F D + A +  + + +   Y
Sbjct  8    FGDQTRDALLSRKGCSDFGFNDSGIISDDRRSKWRCF-RFFSDGIVASWKALYDFAASLY  66

Query  216  EMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGTQNI  37
            EMGR D RK+ FA KMG+AL+L S +++ KEPL      +VWAILTVVVVFE+SIG   +
Sbjct  67   EMGRSDRRKVYFAVKMGVALALCSFVIYLKEPLHDASKYAVWAILTVVVVFEYSIGATLV  126

Query  36   LNF  28
              F
Sbjct  127  KGF  129



>gb|KFK39175.1| hypothetical protein AALP_AA3G210100 [Arabis alpina]
Length=598

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -1

Query  270  DRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVW  91
            +++S  + + K+ + KA+EMG  DPRKI+F+AK+GLAL++V++L+FF+EP   +   SVW
Sbjct  57   EKISGLYQESKDVARKAWEMGVSDPRKIVFSAKIGLALTIVAVLIFFQEPNPDLSRYSVW  116

Query  90   AILTVVVVFEFSIG  49
            AILTVVVVFEF+IG
Sbjct  117  AILTVVVVFEFTIG  130



>ref|XP_010459458.1| PREDICTED: putative aluminum-activated malate transporter 3 isoform 
X1 [Camelina sativa]
Length=586

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 79/133 (59%), Gaps = 11/133 (8%)
 Frame = -1

Query  414  GNAYSESLRRS--FMGASREGLLSR------GGCSSELEWGIPSQSTNRGFLHGFR---D  268
            G+ +  S RR   F G+ R+ +  R       G S   E GIP++ +       +R   D
Sbjct  12   GSMFDGSFRRGSMFDGSFRQSIKDRLIPQHTRGYSYVNEDGIPNEDSTSVRCCSYRYFSD  71

Query  267  RVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWA  88
            +++A     ++  + A+ MG  DPRKIIF+AKMGLAL+L S+L+FFK P   + S  +WA
Sbjct  72   KITALVKKSQDVFVTAWTMGTSDPRKIIFSAKMGLALTLTSILIFFKIPGLELSSHYLWA  131

Query  87   ILTVVVVFEFSIG  49
            ILTVVV+FEFSIG
Sbjct  132  ILTVVVIFEFSIG  144



>ref|NP_173919.1| Aluminum activated malate transporter family protein [Arabidopsis 
thaliana]
 sp|Q9C6L8.1|ALMT4_ARATH RecName: Full=Aluminum-activated malate transporter 4; Short=AtALMT4 
[Arabidopsis thaliana]
 gb|AAG50799.1|AC079281_1 hypothetical protein [Arabidopsis thaliana]
 gb|AEE30631.1| Aluminum activated malate transporter family protein [Arabidopsis 
thaliana]
Length=548

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 69/120 (58%), Gaps = 9/120 (8%)
 Frame = -1

Query  369  SREGLLSRGGCSSELEWGIPSQST---NRGFLHGFR---DRVSAFFGDVKETSIKAYEMG  208
            +RE  LSR  CS   ++G    +     R     FR   D ++A +  + +   K YEMG
Sbjct  5    TREAFLSRKACS---DFGFNDSNIIDDRRSKFRCFRFCSDGITASWKALYDIGAKLYEMG  61

Query  207  RKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGTQNILNF  28
            R D RK+ F+ KMG+AL+L S +++ KEPL      +VWAILTVVVVFE+SIG   +  F
Sbjct  62   RSDRRKVYFSVKMGMALALCSFVIYLKEPLRDASKYAVWAILTVVVVFEYSIGATLVKGF  121



>ref|XP_007152778.1| hypothetical protein PHAVU_004G158900g [Phaseolus vulgaris]
 gb|ESW24772.1| hypothetical protein PHAVU_004G158900g [Phaseolus vulgaris]
Length=593

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 72/125 (58%), Gaps = 9/125 (7%)
 Frame = -1

Query  396  SLRRSFMGASREGLLS-RGGCSSELEWGIPSQSTNRGF-------LHGFRDRVSAFFGDV  241
            S R SF    +E LLS +GG  S++   +P       +            D +   +   
Sbjct  13   SFRHSF-AEKKERLLSMKGGGYSQIGIALPESDEEDNWPPRRCCSYRAVSDGIVGTWKSA  71

Query  240  KETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFE  61
            K  + +A+EMG  DPRKIIF+AKMGLAL L++LL+F K+P   I   SVWAILTVVVVFE
Sbjct  72   KRVAARAWEMGMSDPRKIIFSAKMGLALILLTLLIFLKKPFEDISRYSVWAILTVVVVFE  131

Query  60   FSIGT  46
            FSIG 
Sbjct  132  FSIGA  136



>ref|XP_009617358.1| PREDICTED: aluminum-activated malate transporter 9-like [Nicotiana 
tomentosiformis]
 ref|XP_009617359.1| PREDICTED: aluminum-activated malate transporter 9-like [Nicotiana 
tomentosiformis]
 ref|XP_009617360.1| PREDICTED: aluminum-activated malate transporter 9-like [Nicotiana 
tomentosiformis]
Length=542

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 62/83 (75%), Gaps = 1/83 (1%)
 Frame = -1

Query  276  FRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKS  97
              DR ++FF ++++ + KA EMGR DPRKIIF+ KMG ALS VSLL+F+K+P + I   +
Sbjct  38   LNDRFTSFFNNLQDFAKKAIEMGRNDPRKIIFSLKMGFALSFVSLLIFWKKP-NDIAQFA  96

Query  96   VWAILTVVVVFEFSIGTQNILNF  28
            +WAILTV+V+FEFSIG   I  F
Sbjct  97   IWAILTVLVMFEFSIGATLIKGF  119



>ref|XP_004298292.1| PREDICTED: aluminum-activated malate transporter 9-like [Fragaria 
vesca subsp. vesca]
Length=521

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 60/83 (72%), Gaps = 2/83 (2%)
 Frame = -1

Query  270  DRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSY--IGSKS  97
             +V  F  D+ + ++KA+EMGR DPRK+IFA KMGLALS+VS L+F+KE      IG  S
Sbjct  30   QKVMKFREDILDFALKAWEMGRSDPRKVIFAIKMGLALSIVSSLIFWKESFHNIDIGQYS  89

Query  96   VWAILTVVVVFEFSIGTQNILNF  28
            +WAILTV+V+FEFSIG   I  F
Sbjct  90   IWAILTVIVMFEFSIGGTFIKGF  112



>ref|XP_006838424.1| hypothetical protein AMTR_s00002p00112740 [Amborella trichopoda]
 gb|ERN00993.1| hypothetical protein AMTR_s00002p00112740 [Amborella trichopoda]
Length=588

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 73/119 (61%), Gaps = 6/119 (5%)
 Frame = -1

Query  396  SLRRSFMGASREGLLS-RGGCSSELE-WGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIK  223
            S+R +FM  S + LLS + G  S+ E W         G      DR+   +  + E +I 
Sbjct  7    SIRYNFMERSTQRLLSQKEGYDSDSEGW----DWKRCGCFPRIGDRLRKIWNGIGENAIY  62

Query  222  AYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
             ++ G+ DPRK+IFAAK+G+ALS+VSLL+F KEP   I   S+WAI TVVVVFEFSIG 
Sbjct  63   GWQFGKSDPRKLIFAAKVGMALSIVSLLIFLKEPFMDISVYSIWAIFTVVVVFEFSIGA  121



>emb|CDY24400.1| BnaCnng04670D [Brassica napus]
Length=579

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = -1

Query  276  FRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKS  97
            F D + A +  V + + K YEMGR D RK+ FA KMG+AL+L S +++ KEPL+     +
Sbjct  49   FSDGIIASWMAVHDVAAKLYEMGRSDRRKVYFAVKMGMALALCSFVIYLKEPLADASKYA  108

Query  96   VWAILTVVVVFEFSIGTQNILNF  28
            VWAILTVVVVFE+SIG   +  F
Sbjct  109  VWAILTVVVVFEYSIGATLVKGF  131



>ref|XP_010465944.1| PREDICTED: aluminum-activated malate transporter 9 [Camelina 
sativa]
Length=596

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -1

Query  270  DRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVW  91
            +R+S     VK+ + KA++MG  DPRKI+F+AK+GLAL +V+LL+FF+EP   +   SVW
Sbjct  61   ERISGVVDGVKDVAKKAWDMGVSDPRKIVFSAKIGLALMIVALLIFFQEPNPDLSRYSVW  120

Query  90   AILTVVVVFEFSIG  49
            AILTVVVVFEF+IG
Sbjct  121  AILTVVVVFEFTIG  134



>gb|KFK44001.1| hypothetical protein AALP_AA1G202000 [Arabis alpina]
Length=586

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = -1

Query  276  FRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKS  97
            F D+++AF    ++  + A++MG  DPRK+IF+AKMGLAL+L+S+L+FFK P S + +  
Sbjct  68   FLDKITAFVEKSQDVLVTAWQMGTSDPRKVIFSAKMGLALTLISILIFFKLPGSELSNHY  127

Query  96   VWAILTVVVVFEFSIGT  46
            +WAILT+VV+FEFSIG 
Sbjct  128  LWAILTIVVIFEFSIGA  144



>ref|XP_006415877.1| hypothetical protein EUTSA_v10007220mg [Eutrema salsugineum]
 gb|ESQ34230.1| hypothetical protein EUTSA_v10007220mg [Eutrema salsugineum]
Length=569

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 70/124 (56%), Gaps = 9/124 (7%)
 Frame = -1

Query  381  FMGASREGLLSRGGCSSELEWGIPSQST---NRGFLHGFR---DRVSAFFGDVKETSIKA  220
            F   +REGLL +  CS   ++G    S     R     FR   D + A +  + + +   
Sbjct  3    FEDQTREGLLHQKSCS---DFGFNDSSIVDDRRSKFRCFRFFSDGIIASWKALYDIAANL  59

Query  219  YEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGTQN  40
            YEMGR D RK+ F+ KMG+AL+L S +++ KEPL      +VWAILTVVVVFE+SIG   
Sbjct  60   YEMGRSDRRKLYFSVKMGMALALCSFVIYLKEPLRDASKYAVWAILTVVVVFEYSIGATL  119

Query  39   ILNF  28
            +  F
Sbjct  120  VKGF  123



>gb|KHN21559.1| Aluminum-activated malate transporter 9 [Glycine soja]
Length=574

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 54/70 (77%), Gaps = 1/70 (1%)
 Frame = -1

Query  252  FGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKE-PLSYIGSKSVWAILTV  76
            +  VK  + KA+EMGR DPRKIIF+AKMGLAL+L+S L+F KE P   +   SVWAILTV
Sbjct  42   WNSVKRVAEKAWEMGRSDPRKIIFSAKMGLALTLISFLIFLKEPPFKDMSRYSVWAILTV  101

Query  75   VVVFEFSIGT  46
            VVVFEF+IG 
Sbjct  102  VVVFEFTIGA  111



>ref|XP_004238944.1| PREDICTED: aluminum-activated malate transporter 9-like [Solanum 
lycopersicum]
Length=524

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = -1

Query  273  RDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSV  94
            R+    +F ++++ + KA EMG+ DPRKIIF+ KMG AL  VSLL+F+KEP   I   S+
Sbjct  28   RNGCCIYFNNIQDFAKKAIEMGKNDPRKIIFSLKMGFALFFVSLLIFWKEPFPEIAQFSI  87

Query  93   WAILTVVVVFEFSIG  49
            WAILTV+++FEF+IG
Sbjct  88   WAILTVLIMFEFTIG  102



>ref|XP_010677979.1| PREDICTED: aluminum-activated malate transporter 9 [Beta vulgaris 
subsp. vulgaris]
Length=617

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 70/126 (56%), Gaps = 9/126 (7%)
 Frame = -1

Query  396  SLRRSFMGA-SREGLLSRGGCSSELEWGIP--------SQSTNRGFLHGFRDRVSAFFGD  244
            S R SF     RE LL   G       G+P         Q+ N    +        ++  
Sbjct  61   SFRYSFAERRERERLLQSKGHGYSSSLGLPFLEDPLEQHQNINHHQKNCLIKTFVNWWNG  120

Query  243  VKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVF  64
              E + KA +MG+ DPRKI+F+AKMGLAL+L+S L+F K+P   +G  SVWAILTVVVVF
Sbjct  121  FAEFTKKAVDMGKSDPRKIVFSAKMGLALTLLSFLIFLKKPFEDLGRYSVWAILTVVVVF  180

Query  63   EFSIGT  46
            EFSIG 
Sbjct  181  EFSIGA  186



>ref|XP_003524381.1| PREDICTED: aluminum-activated malate transporter 9-like [Glycine 
max]
Length=576

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 54/70 (77%), Gaps = 1/70 (1%)
 Frame = -1

Query  252  FGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKE-PLSYIGSKSVWAILTV  76
            +  VK  + KA+EMGR DPRKIIF+AKMGLAL+L+S L+F KE P   +   SVWAILTV
Sbjct  44   WNSVKRVAEKAWEMGRSDPRKIIFSAKMGLALTLISFLIFLKEPPFKDMSRYSVWAILTV  103

Query  75   VVVFEFSIGT  46
            VVVFEF+IG 
Sbjct  104  VVVFEFTIGA  113



>ref|XP_010534735.1| PREDICTED: aluminum-activated malate transporter 9-like, partial 
[Tarenaya hassleriana]
Length=235

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = -1

Query  270  DRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVW  91
            +++S FF    + + KA++MG  DPRKI+F+AKM LAL++V++L+FF+EP   +   SVW
Sbjct  61   EKLSGFFLYAGDVARKAWDMGASDPRKIVFSAKMALALTIVAVLIFFQEPNPDLSRYSVW  120

Query  90   AILTVVVVFEFSIGT  46
            AILTVVVVFEF+IG 
Sbjct  121  AILTVVVVFEFTIGA  135



>emb|CDX95521.1| BnaC01g34130D [Brassica napus]
Length=1295

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 71/128 (55%), Gaps = 12/128 (9%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNRGFLHG------------FRDRVSAF  253
            S R       RE LLS  G S      I S     G  H                ++S  
Sbjct  7    SFRNGNHAEKRERLLSNNGFSDMRFGDIESNDLLEGDGHARTRLCCCCSCGDISGKISGV  66

Query  252  FGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVV  73
            + D K+ + KA+ MG  DPRKI+F+AK+GLAL++V++L+F++EP   +   SVWAILTVV
Sbjct  67   YEDAKDVARKAWAMGVSDPRKIVFSAKIGLALTIVAVLIFYQEPNPDLSRYSVWAILTVV  126

Query  72   VVFEFSIG  49
            VVFEF+IG
Sbjct  127  VVFEFTIG  134



>ref|XP_008243202.1| PREDICTED: aluminum-activated malate transporter 9-like [Prunus 
mume]
Length=533

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = -1

Query  255  FFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTV  76
            ++ D+ + + KA+EMGR DPRK+IFA KMGLALS+VSLL+F+K+    IG  S+WAILTV
Sbjct  23   YWKDLLDFASKAWEMGRSDPRKVIFAIKMGLALSIVSLLIFWKKSYHDIGQYSIWAILTV  82

Query  75   VVVFEFSIGTQNILNF  28
            +V+FEFSIG   I  F
Sbjct  83   IVMFEFSIGGTFIKGF  98



>ref|XP_007046270.1| Aluminum-activated malate transporter 9 [Theobroma cacao]
 gb|EOY02102.1| Aluminum-activated malate transporter 9 [Theobroma cacao]
Length=553

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = -1

Query  288  FLHGFRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYI  109
            +L   R ++   + D+K+   KA EMGR DPRK+IFA KMGLALS+VSLL+F+K     I
Sbjct  36   YLKVTRAKIKNSWDDLKDFGRKALEMGRSDPRKVIFAMKMGLALSIVSLLIFWKGSFEDI  95

Query  108  GSKSVWAILTVVVVFEFSIGTQNILNF  28
               S+WAILTV+V+FEFSIG   I  F
Sbjct  96   AQYSIWAILTVIVMFEFSIGATFIKGF  122



>ref|XP_003630842.1| Aluminum activated malate transporter [Medicago truncatula]
Length=619

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 66/87 (76%), Gaps = 8/87 (9%)
 Frame = -1

Query  243  VKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVF  64
            +K  + KA+EMGR DPRKIIFAAKMGLAL+L+SLL+F KEP  +    SVWAILTVVVVF
Sbjct  51   MKLVAEKAWEMGRSDPRKIIFAAKMGLALALISLLIFLKEPFDFT-RHSVWAILTVVVVF  109

Query  63   EFSIGTQNI--LNF----LFLP-KFDT  4
            EFSI +Q I  +N+    +F+P  FDT
Sbjct  110  EFSIVSQVIFEINYEKVCVFIPFAFDT  136



>gb|EYU28992.1| hypothetical protein MIMGU_mgv1a017875mg, partial [Erythranthe 
guttata]
Length=311

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 55/85 (65%), Gaps = 0/85 (0%)
 Frame = -1

Query  282  HGFRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGS  103
            H    RV   + D      KA +MGRKDPRKIIFA K GLALSLVSL +F+K PL     
Sbjct  9    HSIHVRVVQVWSDSWNFYKKAVQMGRKDPRKIIFAIKSGLALSLVSLFIFWKYPLPDASQ  68

Query  102  KSVWAILTVVVVFEFSIGTQNILNF  28
             S+WAILTVVV+FEFSIG   I  F
Sbjct  69   FSIWAILTVVVMFEFSIGATFIKGF  93



>ref|XP_006589701.1| PREDICTED: aluminum-activated malate transporter 4-like isoform 
X2 [Glycine max]
Length=471

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 71/117 (61%), Gaps = 4/117 (3%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAY  217
            S R SF+  S+E LLS+  C    +    + +  R FL    D V +F    ++ + K Y
Sbjct  16   SFRHSFLEKSKERLLSKKDCKDFDD--DDNAAPKRSFLDALSDGVISFHNWSRDVASKLY  73

Query  216  EMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
            EMGR D RK+IFA K GL+L++VSL+++ +E        SVWAILTVVVVFEFSIG 
Sbjct  74   EMGRSDRRKVIFAVKAGLSLAIVSLVIYIEE--EQFSKYSVWAILTVVVVFEFSIGA  128



>ref|XP_003536690.1| PREDICTED: aluminum-activated malate transporter 4-like isoform 
X1 [Glycine max]
Length=561

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 71/117 (61%), Gaps = 4/117 (3%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAY  217
            S R SF+  S+E LLS+  C    +    + +  R FL    D V +F    ++ + K Y
Sbjct  16   SFRHSFLEKSKERLLSKKDCKDFDDDD--NAAPKRSFLDALSDGVISFHNWSRDVASKLY  73

Query  216  EMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
            EMGR D RK+IFA K GL+L++VSL+++ +E        SVWAILTVVVVFEFSIG 
Sbjct  74   EMGRSDRRKVIFAVKAGLSLAIVSLVIYIEE--EQFSKYSVWAILTVVVVFEFSIGA  128



>gb|KHN05579.1| Aluminum-activated malate transporter 4 [Glycine soja]
Length=552

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 71/117 (61%), Gaps = 4/117 (3%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAY  217
            S R SF+  S+E LLS+  C    +    + +  R FL    D V +F    ++ + K Y
Sbjct  7    SFRHSFLEKSKERLLSKKDCKDFDDDD--NAAPKRSFLDALSDGVISFHNWSRDVASKLY  64

Query  216  EMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
            EMGR D RK+IFA K GL+L++VSL+++ +E        SVWAILTVVVVFEFSIG 
Sbjct  65   EMGRSDRRKVIFAVKAGLSLAIVSLVIYIEE--EQFSKYSVWAILTVVVVFEFSIGA  119



>ref|XP_010551282.1| PREDICTED: aluminum-activated malate transporter 4-like [Tarenaya 
hassleriana]
Length=581

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 75/133 (56%), Gaps = 13/133 (10%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEWGI-------PSQSTNRGFLHGFR---DRVSAFFG  247
            + R++F   SRE LL   G S   ++G+             R     FR   D V++ + 
Sbjct  7    AFRQNFPEPSRERLLPHKGFS---DFGLNDAGRVSAGSDGRRSKFRCFRLCSDGVTSSWK  63

Query  246  DVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVV  67
             + + ++K YEMGR D RK+ FA KMG AL+L SL++F KEPL      +VW+ILTVVVV
Sbjct  64   ALHDVAVKLYEMGRSDRRKVFFAVKMGFALALCSLVIFLKEPLQEANQYAVWSILTVVVV  123

Query  66   FEFSIGTQNILNF  28
            FE+S+G   +  F
Sbjct  124  FEYSVGATLVKGF  136



>ref|XP_009761788.1| PREDICTED: aluminum-activated malate transporter 9-like [Nicotiana 
sylvestris]
 ref|XP_009761789.1| PREDICTED: aluminum-activated malate transporter 9-like [Nicotiana 
sylvestris]
 ref|XP_009761790.1| PREDICTED: aluminum-activated malate transporter 9-like [Nicotiana 
sylvestris]
Length=541

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 62/83 (75%), Gaps = 1/83 (1%)
 Frame = -1

Query  276  FRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKS  97
              D+ ++FF ++++ + KA EMGR DPRKIIF+ KMG ALS VSLL+F+K+P + I   +
Sbjct  38   LNDKFTSFFNNLQDFAKKAIEMGRNDPRKIIFSLKMGFALSFVSLLIFWKKP-NDIAQFA  96

Query  96   VWAILTVVVVFEFSIGTQNILNF  28
            +WAILTV+V+FEFSIG   I  F
Sbjct  97   IWAILTVLVMFEFSIGATLIKGF  119



>ref|XP_006297373.1| hypothetical protein CARUB_v10013392mg, partial [Capsella rubella]
 gb|EOA30271.1| hypothetical protein CARUB_v10013392mg, partial [Capsella rubella]
Length=547

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 64/118 (54%), Gaps = 19/118 (16%)
 Frame = -1

Query  381  FMGASREGLLSRGGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRK  202
            F   SRE LLS  G S +                GF D  +  F  +     K YEMG+ 
Sbjct  9    FHQQSRERLLSENGYSDD---------------SGFLDESNWCFRGMA----KLYEMGQA  49

Query  201  DPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGTQNILNF  28
            DPRK+ FA KMG+ALSL S+++F KEPL      SVW ILTVVVVFE+S+G   +  F
Sbjct  50   DPRKVFFAVKMGMALSLCSIVIFLKEPLHEASKYSVWGILTVVVVFEYSVGATLVKGF  107



>ref|XP_009109882.1| PREDICTED: aluminum-activated malate transporter 4 [Brassica 
rapa]
Length=578

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = -1

Query  276  FRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKS  97
            F D + A +  + + + K YEMGR D RK+ FA KMG+AL+L S +++ KEPL+     +
Sbjct  49   FSDGIVASWMALYDVAAKLYEMGRSDRRKVYFAVKMGMALALCSFVIYLKEPLADASKYA  108

Query  96   VWAILTVVVVFEFSIGTQNILNF  28
            VWAILTVVVVFE+SIG   +  F
Sbjct  109  VWAILTVVVVFEYSIGATLVKGF  131



>ref|XP_003530492.1| PREDICTED: aluminum-activated malate transporter 4-like [Glycine 
max]
Length=558

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 73/129 (57%), Gaps = 6/129 (5%)
 Frame = -1

Query  423  MAAGNAYSESLRRSFMGASREGLLSRGGCSSELEWG---IPSQSTNRGFLHGFRDRVSAF  253
            MAA    S SLR+ F   S+E LLSR   S EL        + +      H   DRV+ F
Sbjct  1    MAAAATRSVSLRQIFAERSKERLLSRKDLS-ELRLNGNTTATATAAAATPHTLSDRVARF  59

Query  252  FGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVV  73
               V     +  EM R DPRK++FAAK GL+L+LVSL ++ KE    +   S+WAILTVV
Sbjct  60   GEGVGRFFRELREMARSDPRKVVFAAKAGLSLALVSLFIYIKE--EQLSKYSIWAILTVV  117

Query  72   VVFEFSIGT  46
            VVFEFS+G 
Sbjct  118  VVFEFSVGA  126



>ref|XP_007222486.1| hypothetical protein PRUPE_ppa004106mg [Prunus persica]
 gb|EMJ23685.1| hypothetical protein PRUPE_ppa004106mg [Prunus persica]
Length=529

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -1

Query  255  FFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTV  76
            ++ D  + + KA+EMGR DPRK+IFA KMGLALS+VSLL+F+K+    IG  S+WAILTV
Sbjct  3    YWKDSLDFASKAWEMGRSDPRKVIFAIKMGLALSIVSLLIFWKKSYHDIGQYSIWAILTV  62

Query  75   VVVFEFSIGTQNILNF  28
            +V+FEFSIG   I  F
Sbjct  63   IVMFEFSIGGTFIKGF  78



>ref|XP_010459460.1| PREDICTED: putative aluminum-activated malate transporter 3 isoform 
X2 [Camelina sativa]
Length=525

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -1

Query  276  FRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKS  97
            F D+++A     ++  + A+ MG  DPRKIIF+AKMGLAL+L S+L+FFK P   + S  
Sbjct  8    FSDKITALVKKSQDVFVTAWTMGTSDPRKIIFSAKMGLALTLTSILIFFKIPGLELSSHY  67

Query  96   VWAILTVVVVFEFSIG  49
            +WAILTVVV+FEFSIG
Sbjct  68   LWAILTVVVIFEFSIG  83



>gb|AET05318.2| aluminum activated malate transporter family protein [Medicago 
truncatula]
Length=576

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = -1

Query  243  VKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVF  64
            +K  + KA+EMGR DPRKIIFAAKMGLAL+L+SLL+F KEP  +    SVWAILTVVVVF
Sbjct  51   MKLVAEKAWEMGRSDPRKIIFAAKMGLALALISLLIFLKEPFDFT-RHSVWAILTVVVVF  109

Query  63   EFSIGT  46
            EFSIG 
Sbjct  110  EFSIGA  115



>ref|XP_011077123.1| PREDICTED: aluminum-activated malate transporter 4 [Sesamum indicum]
Length=564

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 57/81 (70%), Gaps = 3/81 (4%)
 Frame = -1

Query  270  DRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVW  91
            D+ + +F D    S +A EMGR DPRKI+ A KMGLALS+VSLL+F+KEP       S+W
Sbjct  45   DKFTQYFKDF---SRRALEMGRNDPRKIMHAIKMGLALSIVSLLIFWKEPFPDAAQYSIW  101

Query  90   AILTVVVVFEFSIGTQNILNF  28
            AILTV+V+FEFSIG   I  F
Sbjct  102  AILTVIVMFEFSIGATFIKGF  122



>ref|XP_008360056.1| PREDICTED: aluminum-activated malate transporter 4-like [Malus 
domestica]
Length=521

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -1

Query  246  DVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVV  67
            D+ + ++ A++MGR DPRKIIFA KMGLALS VSLL+F+K+    +G  S+WAILTV+V+
Sbjct  37   DLLDFAVNAWQMGRSDPRKIIFAIKMGLALSTVSLLIFWKKSYRDVGQYSIWAILTVIVM  96

Query  66   FEFSIGTQNILNF  28
            FEFSIG   I  F
Sbjct  97   FEFSIGGTFIKGF  109



>gb|KDP20105.1| hypothetical protein JCGZ_05874 [Jatropha curcas]
Length=587

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 79/123 (64%), Gaps = 10/123 (8%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEWGIPS---QSTNRGFLHGFR---DRVSAFFGDVKE  235
            S R +F    RE LLS  G S   E G P+   +  N      +R   D V+ F   V++
Sbjct  7    SFRYTF-AEKRERLLSTKGYS---EIGFPNIYEEQYNSRNCCSYRFWCDNVAGFCRSVQD  62

Query  234  TSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFS  55
             +IKAYEMGR DPRKI+FAAKMGLAL L+S+L+F KEP+  +   SVWA+LTVVVVFEFS
Sbjct  63   VAIKAYEMGRSDPRKIVFAAKMGLALMLISMLIFLKEPIKELSRYSVWAVLTVVVVFEFS  122

Query  54   IGT  46
            IG 
Sbjct  123  IGA  125



>ref|XP_006416605.1| hypothetical protein EUTSA_v10007198mg [Eutrema salsugineum]
 gb|ESQ34958.1| hypothetical protein EUTSA_v10007198mg [Eutrema salsugineum]
Length=577

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 84/145 (58%), Gaps = 9/145 (6%)
 Frame = -1

Query  483  STP*NQISDRTKAFRFRG*SMAAGNAYSESLRRSFMGASREGLLSRGGCSSELEWGIPSQ  304
            + P  + S R   F  RG SM  G ++ +SLR   +            C  +L+   P +
Sbjct  2    AAPKLESSRRGSMFDRRG-SMFDG-SFRQSLRDRLIPQQTRDY----SCIVDLDDKTPVR  55

Query  303  STNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKE  124
              +  +   F ++++ F    ++    A+EMG  DPRKIIF+AKMGLAL+LVS+L+FFK 
Sbjct  56   CCSYRY---FSEKITGFVKKSQDVLATAWEMGTSDPRKIIFSAKMGLALTLVSILIFFKL  112

Query  123  PLSYIGSKSVWAILTVVVVFEFSIG  49
            P S + +  +WAILT+VV+FEFSIG
Sbjct  113  PGSELSNHYLWAILTIVVIFEFSIG  137



>ref|XP_010031884.1| PREDICTED: aluminum-activated malate transporter 9 [Eucalyptus 
grandis]
 gb|KCW83847.1| hypothetical protein EUGRSUZ_B00717 [Eucalyptus grandis]
 gb|KCW83848.1| hypothetical protein EUGRSUZ_B00717 [Eucalyptus grandis]
Length=572

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 78/117 (67%), Gaps = 7/117 (6%)
 Frame = -1

Query  378  MGASREGLLSRGGCSSELEWGIPSQSTNR-GFLHGFR---DRVSAFFGDVKETSIKAYEM  211
            MG+ +E L+S  G  SEL       + +R G    +R   + V+ ++ +++  + KAY M
Sbjct  1    MGSLKERLISTRG-YSELGLSYIGTTNDRSGSCCSYRRAREAVARWWKNLERVASKAYNM  59

Query  210  GRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSK--SVWAILTVVVVFEFSIGT  46
            G+ DPRKI+F+AKMGLAL+LVSLL+F+K P ++  +   SVWA+LTV+ VFEFSIG 
Sbjct  60   GKSDPRKIVFSAKMGLALTLVSLLIFWKAPFNFKDTSRYSVWALLTVITVFEFSIGA  116



>gb|KJB50730.1| hypothetical protein B456_008G184300 [Gossypium raimondii]
Length=545

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 61/98 (62%), Gaps = 0/98 (0%)
 Frame = -1

Query  321  WGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsl  142
            WG     + R  L   R+++   + +  + + KA EMGR DPRK+IFA KMGLALSL SL
Sbjct  23   WGNEDGGSRRRGLKVMREKIKNSWVEFNDFARKALEMGRSDPRKVIFAVKMGLALSLTSL  82

Query  141  lvfFKEPLSYIGSKSVWAILTVVVVFEFSIGTQNILNF  28
            L+F+K         S+WAILTV+V+FEFSIG   I  F
Sbjct  83   LIFWKGSYQDFAQYSIWAILTVIVMFEFSIGATFIKGF  120



>ref|XP_010527530.1| PREDICTED: aluminum-activated malate transporter 4-like [Tarenaya 
hassleriana]
Length=580

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 73/132 (55%), Gaps = 7/132 (5%)
 Frame = -1

Query  402  SESLRRSFMGASREGLLSRGGCSS-------ELEWGIPSQSTNRGFLHGFRDRVSAFFGD  244
            S S  +SF+  SRE LL R G S         +      + +N G      D ++  +  
Sbjct  5    SGSFPQSFVEPSRERLLPRKGFSDFGFNDSVGVSTAADGRRSNFGCFRLCSDGIAGSWRA  64

Query  243  VKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVF  64
            + + + K YEMGR D RK++FA KMG AL+L S L+F K+PL      +VWAILTVVVVF
Sbjct  65   LYDFAGKLYEMGRSDRRKVLFAVKMGFALALCSFLIFLKQPLKDASKYAVWAILTVVVVF  124

Query  63   EFSIGTQNILNF  28
            E+S+G   +  F
Sbjct  125  EYSVGATLVKGF  136



>ref|XP_002890274.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66533.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=575

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -1

Query  276  FRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKS  97
            F D+++      K+  + A+E+G  DPRKIIF+AKMGLAL+L S+L+FFK P   + S  
Sbjct  64   FSDKITGAVKKSKDVLVTAWELGTSDPRKIIFSAKMGLALTLTSILIFFKIPGLELSSHY  123

Query  96   VWAILTVVVVFEFSIG  49
            +WAILTVVV+FEFSIG
Sbjct  124  LWAILTVVVIFEFSIG  139



>ref|XP_010097443.1| Aluminum-activated malate transporter 9 [Morus notabilis]
 gb|EXB68331.1| Aluminum-activated malate transporter 9 [Morus notabilis]
Length=557

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = -1

Query  309  SQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfF  130
            S +T+   L+  + +++ F+ D  + + KA+EMGR DPRKIIFA KMGLAL+LVSLL+F+
Sbjct  32   STTTSCLCLNSMKKKMNKFWKDSVDFARKAWEMGRSDPRKIIFAFKMGLALALVSLLIFW  91

Query  129  KEPLSYIGSKSVWAILTVVVVFEFS  55
            KE    I    +WAILTV+V+FEFS
Sbjct  92   KESYHDIDQYVIWAILTVIVMFEFS  116



>ref|XP_010551149.1| PREDICTED: aluminum-activated malate transporter 9 [Tarenaya 
hassleriana]
Length=599

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = -1

Query  270  DRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVW  91
            +++S FF    + + KA++MG  DPRKI+F+AKM LAL++V++L+FF+EP   +   SVW
Sbjct  61   EKLSGFFLYAGDVARKAWDMGASDPRKIVFSAKMALALTIVAVLIFFQEPNPDLSRYSVW  120

Query  90   AILTVVVVFEFSIGT  46
            AILTVVVVFEF+IG 
Sbjct  121  AILTVVVVFEFTIGA  135



>ref|XP_010102832.1| Aluminum-activated malate transporter 9 [Morus notabilis]
 gb|EXB94192.1| Aluminum-activated malate transporter 9 [Morus notabilis]
Length=564

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = -1

Query  309  SQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfF  130
            S +T+   L+  + +++ F+ D  + + KA+EMGR DPRKIIFA KMGLAL+LVSLL+F+
Sbjct  32   STTTSCLCLNSMKKKMNKFWKDSVDFARKAWEMGRSDPRKIIFAFKMGLALALVSLLIFW  91

Query  129  KEPLSYIGSKSVWAILTVVVVFEFS  55
            KE    I    +WAILTV+V+FEFS
Sbjct  92   KESYHDIDQYVIWAILTVIVMFEFS  116



>ref|NP_173278.1| putative aluminum-activated malate transporter 3 [Arabidopsis 
thaliana]
 sp|Q9LPQ8.1|ALMT3_ARATH RecName: Full=Putative aluminum-activated malate transporter 
3; Short=AtALMT3 [Arabidopsis thaliana]
 gb|AAF25997.1|AC013354_16 F15H18.9 [Arabidopsis thaliana]
 gb|AEE29713.1| putative aluminum-activated malate transporter 3 [Arabidopsis 
thaliana]
Length=581

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -1

Query  276  FRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKS  97
            F D+++     +K+  + A+EMG  DPRK+IF+AKMGLAL+L S+L+FFK P   +    
Sbjct  63   FSDKITGVVKKLKDVLVTAWEMGTADPRKMIFSAKMGLALTLTSILIFFKIPGLELSGHY  122

Query  96   VWAILTVVVVFEFSIG  49
            +WAILTVVV+FEFSIG
Sbjct  123  LWAILTVVVIFEFSIG  138



>ref|XP_004497108.1| PREDICTED: aluminum-activated malate transporter 4-like [Cicer 
arietinum]
Length=565

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 67/125 (54%), Gaps = 13/125 (10%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSR--------GGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGDV  241
            S R SF+  S+E LL++             E E   P    N   L    DRVS      
Sbjct  18   SFRHSFLEKSKERLLAKKEYPDFAFNDPLDEDEDAAPKNCFN---LDALSDRVSNIRNAT  74

Query  240  KETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFE  61
             +   K YEMGR D RK++FA K GL+L+LVSL ++ KE    +   S+WAILTVVVVFE
Sbjct  75   TDFIAKLYEMGRSDRRKVVFAMKAGLSLALVSLFIYIKE--EQLSKYSIWAILTVVVVFE  132

Query  60   FSIGT  46
            FSIG 
Sbjct  133  FSIGA  137



>ref|XP_007160367.1| hypothetical protein PHAVU_002G315600g [Phaseolus vulgaris]
 gb|ESW32361.1| hypothetical protein PHAVU_002G315600g [Phaseolus vulgaris]
Length=578

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = -1

Query  279  GFRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSK  100
            G +  +  ++  VK  + KA+EMGR DPRKIIF+AK GLAL+L+SLL+F +EP   +   
Sbjct  43   GEQSTMVKWWNTVKRVTGKAWEMGRSDPRKIIFSAKTGLALALLSLLIFLREPFKDMSLY  102

Query  99   SVWAILTVVVVFEFSIG  49
             VWAILTVVVVFEFSIG
Sbjct  103  CVWAILTVVVVFEFSIG  119



>gb|KJB52978.1| hypothetical protein B456_008G286300 [Gossypium raimondii]
Length=528

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = -1

Query  270  DRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFK-EPLSYIGSKSV  94
            ++V+ F  +V+  + +A++MG  DPRKI+F+AKMGLAL+L+SLL+F K EP+  +   SV
Sbjct  49   EKVTGFLKEVQYVAGQAWQMGISDPRKIVFSAKMGLALALISLLIFLKEEPIKELSQYSV  108

Query  93   WAILTVVVVFEFSIGT  46
            WAILTVVVVFEFSIG 
Sbjct  109  WAILTVVVVFEFSIGA  124



>gb|KJB52977.1| hypothetical protein B456_008G286300 [Gossypium raimondii]
Length=497

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = -1

Query  270  DRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFK-EPLSYIGSKSV  94
            ++V+ F  +V+  + +A++MG  DPRKI+F+AKMGLAL+L+SLL+F K EP+  +   SV
Sbjct  49   EKVTGFLKEVQYVAGQAWQMGISDPRKIVFSAKMGLALALISLLIFLKEEPIKELSQYSV  108

Query  93   WAILTVVVVFEFSIGT  46
            WAILTVVVVFEFSIG 
Sbjct  109  WAILTVVVVFEFSIGA  124



>gb|KHG23241.1| Aluminum-activated malate transporter 9 -like protein [Gossypium 
arboreum]
Length=587

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = -1

Query  270  DRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFK-EPLSYIGSKSV  94
            ++V+ F  +V+  + +A++MG  DPRKI+F+AKMGLAL+L+SLL+F K EP+  +   SV
Sbjct  49   EKVTGFLKEVQYVAGQAWQMGISDPRKIVFSAKMGLALALISLLIFLKEEPIKELSQYSV  108

Query  93   WAILTVVVVFEFSIGT  46
            WAILTVVVVFEFSIG 
Sbjct  109  WAILTVVVVFEFSIGA  124



>gb|KJB52976.1| hypothetical protein B456_008G286300 [Gossypium raimondii]
Length=587

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = -1

Query  270  DRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFK-EPLSYIGSKSV  94
            ++V+ F  +V+  + +A++MG  DPRKI+F+AKMGLAL+L+SLL+F K EP+  +   SV
Sbjct  49   EKVTGFLKEVQYVAGQAWQMGISDPRKIVFSAKMGLALALISLLIFLKEEPIKELSQYSV  108

Query  93   WAILTVVVVFEFSIGT  46
            WAILTVVVVFEFSIG 
Sbjct  109  WAILTVVVVFEFSIGA  124



>emb|CDY36105.1| BnaA08g19430D [Brassica napus]
Length=570

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = -1

Query  276  FRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKS  97
            F D + A +  + + + K YEMG  D RK+ FA KMG+AL+L S +++ KEPL+     +
Sbjct  49   FSDGIVASWMALYDVAAKLYEMGLSDRRKVYFAVKMGMALALCSFVIYLKEPLADASKYA  108

Query  96   VWAILTVVVVFEFSIGTQNILNF  28
            VWAILTVVVVFE+SIG   +  F
Sbjct  109  VWAILTVVVVFEYSIGATLVKGF  131



>ref|XP_011078420.1| PREDICTED: aluminum-activated malate transporter 4-like [Sesamum 
indicum]
Length=550

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 56/83 (67%), Gaps = 1/83 (1%)
 Frame = -1

Query  276  FRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKS  97
              DRV   + D    S KA EMGR DPRK+I+A KMG AL+LVSL +F+K+P   +   S
Sbjct  28   MHDRVLQLWLDSCNFSKKALEMGRNDPRKVIYAIKMGFALALVSLFIFWKKPAD-VSQFS  86

Query  96   VWAILTVVVVFEFSIGTQNILNF  28
            +WAILTV+V+FEFSIG   I  F
Sbjct  87   IWAILTVIVMFEFSIGATFIKGF  109



>ref|XP_010467518.1| PREDICTED: aluminum-activated malate transporter 6 isoform X1 
[Camelina sativa]
Length=543

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = -1

Query  225  KAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
            K YEMG  DPRK+ FA KMG+ALSL S+++F KEPL      SVW ILTVVVVFE+S+G 
Sbjct  29   KLYEMGHSDPRKLFFAVKMGMALSLCSVVIFLKEPLHNASKYSVWGILTVVVVFEYSVGA  88

Query  45   QNILNF  28
              +  F
Sbjct  89   TLVKGF  94



>ref|XP_010489374.1| PREDICTED: aluminum-activated malate transporter 6-like isoform 
X1 [Camelina sativa]
Length=541

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = -1

Query  225  KAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
            K YEMG  DPRK+ FA KMG+ALSL S+++F KEPL      SVW ILTVVVVFE+S+G 
Sbjct  29   KLYEMGHSDPRKLFFAVKMGMALSLCSVVIFLKEPLHNASKYSVWGILTVVVVFEYSVGA  88

Query  45   QNILNF  28
              +  F
Sbjct  89   TLVKGF  94



>ref|XP_010514996.1| PREDICTED: aluminum-activated malate transporter 6-like isoform 
X1 [Camelina sativa]
Length=539

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = -1

Query  225  KAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
            K YEMG  DPRK+ FA KMG+AL L S+++F KEPL      SVW ILTVVVVFE+S+G 
Sbjct  29   KLYEMGHSDPRKLFFAVKMGMALCLCSVVIFLKEPLHSASKYSVWGILTVVVVFEYSVGA  88

Query  45   QNILNF  28
              +  F
Sbjct  89   TLVKGF  94



>ref|XP_010320773.1| PREDICTED: aluminum-activated malate transporter 9-like [Solanum 
lycopersicum]
Length=540

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = -1

Query  270  DRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVW  91
            +++ +FF ++++ + KA EMG+ DPRKIIF+ KMG ALS VSLL+F+K+P   +   ++W
Sbjct  43   EKLKSFFNNIQDFAEKAIEMGKNDPRKIIFSLKMGFALSFVSLLIFWKKPTD-VAQFAIW  101

Query  90   AILTVVVVFEFSIGTQNILNF  28
            AILTV+V+FEF+IG   I  F
Sbjct  102  AILTVLVMFEFTIGATFIKGF  122



>gb|KFK40123.1| hypothetical protein AALP_AA3G333300 [Arabis alpina]
Length=543

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 70/120 (58%), Gaps = 18/120 (15%)
 Frame = -1

Query  387  RSFMGASREGLLSRGGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEMG  208
            RSF   SRE L+S+ G S   ++G+   S +R F    RD   A          K YEMG
Sbjct  6    RSFQDQSRERLVSQKGNS---DFGL-DDSNHRCF----RDCGIA----------KLYEMG  47

Query  207  RKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGTQNILNF  28
              D RK+IFA KMG+AL+L S+++F K PL      SVWAILTVVVVFE+S+G   +  F
Sbjct  48   CSDHRKLIFAVKMGMALALCSVVIFLKGPLHDASKFSVWAILTVVVVFEYSVGATLVKGF  107



>gb|KDP29387.1| hypothetical protein JCGZ_18308 [Jatropha curcas]
Length=555

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 64/93 (69%), Gaps = 1/93 (1%)
 Frame = -1

Query  306  QSTNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFK  127
            +++    L   R ++     ++++ + KA+EMGR DPRKIIFA KMGLAL++VSLL+F+K
Sbjct  23   ETSKPSCLSFLRKKIKKSLNELQDFAGKAWEMGRSDPRKIIFAIKMGLALAIVSLLIFWK  82

Query  126  EPLSYIGSKSVWAILTVVVVFEFSIGTQNILNF  28
              L  I   S+WAILTV+V+FE+SIG   I  F
Sbjct  83   -GLYDISQYSIWAILTVIVMFEYSIGATFIKGF  114



>gb|KHN32029.1| Aluminum-activated malate transporter 9 [Glycine soja]
Length=513

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -1

Query  213  MGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
            MGR DPRKIIF+AKMGLAL L+SLL+F K+P   I   SVWAILTVVVVFEFSIG 
Sbjct  1    MGRSDPRKIIFSAKMGLALILLSLLIFLKQPFEDIAKHSVWAILTVVVVFEFSIGA  56



>emb|CDO98443.1| unnamed protein product [Coffea canephora]
Length=595

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 75/127 (59%), Gaps = 11/127 (9%)
 Frame = -1

Query  396  SLRRSFMGA-SREGLLS--RGGCSSEL-----EWGIPSQST-NRGFLHGFRDRVSAFFGD  244
            S R+SF     RE LLS  R G  SEL      W   ++     G     +D+    +  
Sbjct  7    SFRQSFAEKRERERLLSSHRSGDFSELPRFSRSWDDEAEERFGCGCCSSMKDKFLELWKK  66

Query  243  VKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEP--LSYIGSKSVWAILTVVV  70
            +   +I+A++ G+ DPR ++F+AKMGLA+ L+SLL+F K+P  +  +   SVWAILTVVV
Sbjct  67   LMSVAIRAWDTGKADPRVVVFSAKMGLAMMLISLLIFLKQPAAMKDLTRYSVWAILTVVV  126

Query  69   VFEFSIG  49
            VFEFSIG
Sbjct  127  VFEFSIG  133



>ref|XP_010537442.1| PREDICTED: putative aluminum-activated malate transporter 3 [Tarenaya 
hassleriana]
Length=593

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 70/115 (61%), Gaps = 3/115 (3%)
 Frame = -1

Query  384  SFMGASREGLLSRGGCSSELEWGIPSQSTNRGFLHGFR---DRVSAFFGDVKETSIKAYE  214
            SF  + +E  LS     S+L +       +      +R   +++  F  + +E  + A+E
Sbjct  17   SFKQSMKERFLSTNRGYSDLRYSYDHDDASSEQCRPYRWLCNKIMGFLRNTQEVFVVAWE  76

Query  213  MGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIG  49
            MG+ DPRK+IF+AKM LAL+L SLLVF+KE  + I    VWAILTVVVVFEFSIG
Sbjct  77   MGKSDPRKVIFSAKMALALTLTSLLVFWKELGADINRYFVWAILTVVVVFEFSIG  131



>ref|XP_008339686.1| PREDICTED: aluminum-activated malate transporter 9-like [Malus 
domestica]
Length=482

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -1

Query  246  DVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVV  67
            D+   + KA++MGR DPRK+IFA KMGLALS VSLL+F+K+    +   S+WAILTV+V+
Sbjct  11   DLLHFASKAWQMGRSDPRKVIFAIKMGLALSTVSLLIFWKKSYRDVSQYSIWAILTVIVM  70

Query  66   FEFSIGTQNILNF  28
            FEFSIG   I  F
Sbjct  71   FEFSIGGTFIKGF  83



>ref|XP_006362576.1| PREDICTED: aluminum-activated malate transporter 9-like [Solanum 
tuberosum]
Length=508

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 59/77 (77%), Gaps = 1/77 (1%)
 Frame = -1

Query  258  AFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILT  79
            +FF ++++ + KA EMG+ DPRKIIF+ KMG ALS VSLL+F+K+P + +   ++WAILT
Sbjct  19   SFFNNIQDFAKKAIEMGKNDPRKIIFSLKMGFALSFVSLLIFWKKP-TDVAQFAIWAILT  77

Query  78   VVVVFEFSIGTQNILNF  28
            V+V+FEF+IG   I  F
Sbjct  78   VLVMFEFTIGATFIKGF  94



>ref|XP_002529136.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33249.1| conserved hypothetical protein [Ricinus communis]
Length=542

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 64/94 (68%), Gaps = 4/94 (4%)
 Frame = -1

Query  309  SQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfF  130
            S+ST    L G   +V     ++++ + KA++MGR DPRKIIFA KMG+ALS+VSLL+F 
Sbjct  19   SKSTCLSLLSG---KVRRSLNELQDFAKKAWDMGRSDPRKIIFAIKMGMALSIVSLLIFC  75

Query  129  KEPLSYIGSKSVWAILTVVVVFEFSIGTQNILNF  28
            K  +  I   S+WAILTV+V+FE++IG   I  F
Sbjct  76   K-AVEDISQYSIWAILTVIVMFEYTIGATFIKGF  108



>gb|KEH44248.1| aluminum activated malate transporter family protein [Medicago 
truncatula]
Length=551

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 68/119 (57%), Gaps = 5/119 (4%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNRGF--LHGFRDRVSAFFGDVKETSIK  223
            S R S +  SRE LL++ G   + ++     +  R    L    +RV       ++   K
Sbjct  13   SFRHSILEKSRERLLAKKGYPDD-DFNYNDSAPKRSCFDLDALSERVVNIRNVFRDFIGK  71

Query  222  AYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
             YEMGR D R+++FA K GL+L+LVSL ++ KE    +   S+WAILTVVVVFEFSIG 
Sbjct  72   LYEMGRSDRRRVVFAMKAGLSLALVSLFIYIKE--KQLSKYSIWAILTVVVVFEFSIGA  128



>ref|XP_003520033.1| PREDICTED: aluminum-activated malate transporter 4-like isoform 
X1 [Glycine max]
 ref|XP_006574876.1| PREDICTED: aluminum-activated malate transporter 4-like isoform 
X2 [Glycine max]
Length=551

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 67/120 (56%), Gaps = 13/120 (11%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNR---GFLHGFRDRVSAFFGDVKETSI  226
            SLR+ F   S+E LLSR          +P   +N    G L    DR +  +  V E   
Sbjct  7    SLRQIFAERSKERLLSRHE--------LPLNGSNNRAGGILRVLADRTATVYKGVCEFFR  58

Query  225  KAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
            +  EM R D RK+ FAAK GL+L+LVSL ++ KE    +   S+WA+LTVV++FEFS+G 
Sbjct  59   QLQEMARSDRRKVAFAAKAGLSLALVSLFIYVKE--EQLSKYSIWAVLTVVLIFEFSVGA  116



>gb|ACU18485.1| unknown [Glycine max]
Length=114

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -1

Query  270  DRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVW  91
            D   +++   K  + KA EMGR DPRKIIF+AK+GLAL+++SLL+F KEP + + S  VW
Sbjct  46   DEEQSWWNTFKRVAGKALEMGRSDPRKIIFSAKLGLALTILSLLIFLKEPFADLSSYCVW  105

Query  90   AILTVV  73
            AILTV 
Sbjct  106  AILTVC  111



>gb|EEC80367.1| hypothetical protein OsI_22476 [Oryza sativa Indica Group]
Length=597

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 62/106 (58%), Gaps = 24/106 (23%)
 Frame = -1

Query  366  REGLLSRGGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRKDPRKI  187
            +EGL+ R G ++   WG                        V+  + + + + R DPRK 
Sbjct  63   KEGLVRRAGAAASRVWG-----------------------AVRGAAEELWALARADPRKA  99

Query  186  IFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIG  49
            +FAAK+GLAL+L+SLLVF +EP   + S SVWAILTVVVVFEFSIG
Sbjct  100  VFAAKVGLALALISLLVFVREPRDIV-SHSVWAILTVVVVFEFSIG  144



>ref|XP_007157596.1| hypothetical protein PHAVU_002G082600g [Phaseolus vulgaris]
 gb|ESW29590.1| hypothetical protein PHAVU_002G082600g [Phaseolus vulgaris]
Length=553

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 70/127 (55%), Gaps = 6/127 (5%)
 Frame = -1

Query  423  MAAGNAYSESLRRSFMGASREGLLSRGGCSS-ELEWGIPSQSTNRGFLHGFRDRVSAFFG  247
            MAA N    SLR+ F   S+E LLSR   S   L     S S       GF  R+  F  
Sbjct  1    MAARNG---SLRQIFTERSKERLLSRKDFSELRLNGNNSSSSGGGAIRDGFSGRMVRFCD  57

Query  246  DVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVV  67
               E   +  EM R D RK++FAAK GL+L++VSL ++ KE    +   S+WAILTVV+V
Sbjct  58   GFGEFFYQLREMARSDRRKVVFAAKAGLSLAVVSLFIYIKE--EQLSKYSIWAILTVVLV  115

Query  66   FEFSIGT  46
            FEFS+G 
Sbjct  116  FEFSVGA  122



>ref|XP_006656868.1| PREDICTED: aluminum-activated malate transporter 9-like, partial 
[Oryza brachyantha]
Length=523

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = -1

Query  243  VKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVF  64
            V++  ++ +   R DPRK +FAAK+GLAL+L+SLLVF +EP   + S SVWAILTVVVVF
Sbjct  6    VRDAVVELWAFARADPRKAVFAAKVGLALALISLLVFLREPRDIV-SHSVWAILTVVVVF  64

Query  63   EFSIGT  46
            EFSIG 
Sbjct  65   EFSIGA  70



>ref|XP_002454337.1| hypothetical protein SORBIDRAFT_04g029000 [Sorghum bicolor]
 gb|EES07313.1| hypothetical protein SORBIDRAFT_04g029000 [Sorghum bicolor]
Length=592

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 70/118 (59%), Gaps = 9/118 (8%)
 Frame = -1

Query  378  MGASREGLLSRGGCSSEL---EWGIP-----SQSTNRGFLHGFRDRVSAFFGDVKETSIK  223
            +G  R  L  RGG    L   +WG+P     +     G   G   R+      V+  +++
Sbjct  15   LGTLRSTLDHRGGAREPLLAFDWGVPDGEHAAWGVEDGSARGVVGRLRRVAQAVRALAVE  74

Query  222  AYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIG  49
             +   RKDPRK +FAAK+ +AL+L++LLVF +EP S I S SVWAILTVVVVFEFSIG
Sbjct  75   MWAFARKDPRKPVFAAKVAVALALITLLVFLREP-SDIASHSVWAILTVVVVFEFSIG  131



>ref|XP_010273911.1| PREDICTED: aluminum-activated malate transporter 9-like [Nelumbo 
nucifera]
Length=571

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 72/121 (60%), Gaps = 9/121 (7%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNRG----FLHGFR-DRVSAFFGDVKET  232
            S +  F   S+E LLS+       E G+ S   + G    +   F  + ++  +  +++ 
Sbjct  7    SFKYYFAQRSKERLLSQSLKEGYSEIGLGSMDGHDGRTRCWCSNFTTETITNLWTWLQQI  66

Query  231  SIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSI  52
            + +A+  GR DPRKII +AKMGLAL L+SL++ FK+    +   SVWAI+TVVVVFEFS+
Sbjct  67   AFEAWNFGRSDPRKIISSAKMGLALVLISLIILFKD----LSQNSVWAIMTVVVVFEFSV  122

Query  51   G  49
            G
Sbjct  123  G  123



>ref|XP_007157597.1| hypothetical protein PHAVU_002G082700g [Phaseolus vulgaris]
 gb|ESW29591.1| hypothetical protein PHAVU_002G082700g [Phaseolus vulgaris]
Length=553

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 69/127 (54%), Gaps = 6/127 (5%)
 Frame = -1

Query  423  MAAGNAYSESLRRSFMGASREGLLSRGGCSS-ELEWGIPSQSTNRGFLHGFRDRVSAFFG  247
            MAA N    SLR+ F   S+E LLSR   S   L     S S       G   R+  F  
Sbjct  1    MAARNG---SLRQIFAERSKERLLSRKDFSELRLNGNNSSSSGGGAVRDGLSGRMVRFCD  57

Query  246  DVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVV  67
               E   +  EM R D RK++FAAK GL+L++VSL ++ KE    +   S+WAILTVVVV
Sbjct  58   GFGEFFWQLREMARSDRRKVVFAAKAGLSLAVVSLFIYIKE--EQLSKYSIWAILTVVVV  115

Query  66   FEFSIGT  46
            FEFS+G 
Sbjct  116  FEFSVGA  122



>ref|XP_010651907.1| PREDICTED: aluminum-activated malate transporter 2 isoform X1 
[Vitis vinifera]
Length=513

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 64/106 (60%), Gaps = 19/106 (18%)
 Frame = -1

Query  366  REGLLSRGGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRKDPRKI  187
            R GL++RG       W  P      G +  FRD+V        E + KA ++G++DPR+I
Sbjct  8    RAGLIARG-------WRWP-----WGLIEKFRDKVV-------EAARKAKKLGQEDPRRI  48

Query  186  IFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIG  49
            I + K+GLA++LVSL+ +F       G  ++WA+LTVVVVFEFS+G
Sbjct  49   IHSLKVGLAITLVSLMYYFNPAYGDFGVSTMWAVLTVVVVFEFSVG  94



>ref|XP_002262763.1| PREDICTED: aluminum-activated malate transporter 2 isoform X2 
[Vitis vinifera]
 emb|CBI28348.3| unnamed protein product [Vitis vinifera]
Length=506

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 64/106 (60%), Gaps = 19/106 (18%)
 Frame = -1

Query  366  REGLLSRGGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRKDPRKI  187
            R GL++RG       W  P      G +  FRD+V        E + KA ++G++DPR+I
Sbjct  8    RAGLIARG-------WRWP-----WGLIEKFRDKVV-------EAARKAKKLGQEDPRRI  48

Query  186  IFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIG  49
            I + K+GLA++LVSL+ +F       G  ++WA+LTVVVVFEFS+G
Sbjct  49   IHSLKVGLAITLVSLMYYFNPAYGDFGVSTMWAVLTVVVVFEFSVG  94



>dbj|BAD53534.1| aluminum-activated malate transporter-like [Oryza sativa Japonica 
Group]
 dbj|BAD54396.1| aluminum-activated malate transporter-like [Oryza sativa Japonica 
Group]
 gb|EAZ00457.1| hypothetical protein OsI_22477 [Oryza sativa Indica Group]
 gb|EAZ36580.1| hypothetical protein OsJ_20921 [Oryza sativa Japonica Group]
Length=152

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = -1

Query  207  RKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGTQNIL  34
            R DPRK +FAAK+GLAL+L+SLLVF +EP   + S SVWAILTVVVVFEFSI   ++L
Sbjct  85   RADPRKAVFAAKVGLALALISLLVFVREPRDIV-SHSVWAILTVVVVFEFSIVKVDML  141



>emb|CAN81826.1| hypothetical protein VITISV_020247 [Vitis vinifera]
Length=508

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 64/106 (60%), Gaps = 19/106 (18%)
 Frame = -1

Query  366  REGLLSRGGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRKDPRKI  187
            R GL++RG       W  P      G +  FRD+V        E + KA ++G++DPR+I
Sbjct  8    RAGLIARG-------WRWP-----WGLIEKFRDKVV-------EAARKAKKLGQEDPRRI  48

Query  186  IFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIG  49
            I + K+GLA++LVSL+ +F       G  ++WA+LTVVVVFEFS+G
Sbjct  49   IHSLKVGLAITLVSLIYYFNPAYGDFGVSTMWAVLTVVVVFEFSVG  94



>ref|NP_001057354.1| Os06g0268800 [Oryza sativa Japonica Group]
 dbj|BAD53533.1| aluminum-activated malate transporter-like [Oryza sativa Japonica 
Group]
 dbj|BAD54395.1| aluminum-activated malate transporter-like [Oryza sativa Japonica 
Group]
 dbj|BAF19268.1| Os06g0268800 [Oryza sativa Japonica Group]
 dbj|BAH00177.1| unnamed protein product [Oryza sativa Japonica Group]
Length=388

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 46/58 (79%), Gaps = 1/58 (2%)
 Frame = -1

Query  219  YEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
            +   R DPRK +FAAK+GLAL+L+SLLVF +EP   I S SVWAILTVVVVFEFSIG 
Sbjct  89   WAFARADPRKAVFAAKVGLALALISLLVFLREPRD-IVSHSVWAILTVVVVFEFSIGA  145



>gb|EAZ36579.1| hypothetical protein OsJ_20920 [Oryza sativa Japonica Group]
Length=545

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 1/57 (2%)
 Frame = -1

Query  219  YEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIG  49
            +   R DPRK +FAAK+GLAL+L+SLLVF +EP   + S SVWAILTVVVVFEFSIG
Sbjct  37   WAFARADPRKAVFAAKVGLALALISLLVFLREPRDIV-SHSVWAILTVVVVFEFSIG  92



>ref|XP_004965201.1| PREDICTED: aluminum-activated malate transporter 9-like [Setaria 
italica]
Length=592

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 46/57 (81%), Gaps = 1/57 (2%)
 Frame = -1

Query  219  YEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIG  49
            +   R DPRK +FAAK+GLAL+L++LLVF +EP   + S SVWAILTVVVVFEFSIG
Sbjct  69   WAFARADPRKAVFAAKVGLALALITLLVFLREPHDIV-SHSVWAILTVVVVFEFSIG  124



>ref|XP_006441921.1| hypothetical protein CICLE_v10023819mg [Citrus clementina]
 gb|ESR55161.1| hypothetical protein CICLE_v10023819mg [Citrus clementina]
Length=502

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 67/102 (66%), Gaps = 12/102 (12%)
 Frame = -1

Query  396  SLRRSFMGASREGLLSRGGCSSELEWGIPSQSTNRGFLHGFR--------DRVSAFFGDV  241
            S R SF   S+E LLSR G S   ++G+ S + + G   G +        D V+ F+ ++
Sbjct  7    SFRHSFAERSKERLLSRKGYS---DFGLNS-TDDDGSEDGIKCRCFRWISDGVTNFWTNL  62

Query  240  KETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLS  115
            +   I+ Y+MGRKDPRK +FAAKMGL+L+LVSL+VFFKEPLS
Sbjct  63   QNIFIQFYDMGRKDPRKAVFAAKMGLSLALVSLVVFFKEPLS  104



>ref|XP_002529135.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33248.1| conserved hypothetical protein [Ricinus communis]
Length=539

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 56/99 (57%), Gaps = 23/99 (23%)
 Frame = -1

Query  258  AFFGDVKETSI----------------------KAYEMGRKDPRKIIFAAKMGLAlslvs  145
            +F GDV ETSI                      KA+EMG  DPRK+IFA KMGLALS+V 
Sbjct  13   SFMGDVDETSIPTCLVSSEKDKKSLNKWKYFAEKAWEMGWSDPRKVIFAIKMGLALSIVY  72

Query  144  llvfFKEPLSYIGSKSVWAILTVVVVFEFSIGTQNILNF  28
             L+F K     I   SVWAIL V+++FE++IG   I +F
Sbjct  73   FLIFSKANRD-ISQYSVWAILIVILMFEYTIGVTFIKSF  110



>ref|XP_006409304.1| hypothetical protein EUTSA_v10022649mg [Eutrema salsugineum]
 gb|ESQ50757.1| hypothetical protein EUTSA_v10022649mg [Eutrema salsugineum]
Length=514

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 58/119 (49%), Gaps = 33/119 (28%)
 Frame = -1

Query  384  SFMGASREGLLSRGGCSSELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEMGR  205
            SF   SRE LLSR GCSS+   GI                             K Y    
Sbjct  7    SFAEQSRERLLSRKGCSSKCFCGIA----------------------------KLY----  34

Query  204  KDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGTQNILNF  28
             D +K+ FA KMG AL++ SL++  KEPL      SVWAILTVVVVFE+S+G   +  F
Sbjct  35   -DRKKLFFAVKMGTALAVCSLVILLKEPLHAASKFSVWAILTVVVVFEYSVGATLVKGF  92



>ref|XP_010088642.1| Aluminum-activated malate transporter 2 [Morus notabilis]
 gb|EXC36055.1| Aluminum-activated malate transporter 2 [Morus notabilis]
Length=509

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 59/97 (61%), Gaps = 0/97 (0%)
 Frame = -1

Query  336  SSELEWGIPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAl  157
            SS+ E    S S  R     F+  +    G V E S K  ++G+ DPR+II + K+GLA+
Sbjct  3    SSDQEPSGTSPSFGRRVFKAFKALLERMSGKVVEFSRKLKKLGQDDPRRIIHSLKVGLAI  62

Query  156  slvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
            +LVSL  +FK      G  ++WA+LTVVVVFEFS+G+
Sbjct  63   TLVSLFYYFKPLYDGFGVNAIWAVLTVVVVFEFSVGS  99



>dbj|BAK01253.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=588

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = -1

Query  219  YEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
            +   R DPRK +FAAK+GLAL+L+S LVF +EP   + S SVWAILTVVVVFEFSIG 
Sbjct  78   WAFARADPRKPVFAAKVGLALALISFLVFLREPRDIV-SHSVWAILTVVVVFEFSIGA  134



>ref|XP_003563969.1| PREDICTED: aluminum-activated malate transporter 9-like [Brachypodium 
distachyon]
Length=589

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 45/54 (83%), Gaps = 1/54 (2%)
 Frame = -1

Query  207  RKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
            R DPRK +FAAK+GLALSL+SLLVF +EP   + S SVWAILTVVVVFEFSIG 
Sbjct  84   RADPRKPVFAAKVGLALSLISLLVFLREPRDIV-SHSVWAILTVVVVFEFSIGA  136



>ref|NP_179338.1| aluminum-activated malate transporter 6 [Arabidopsis thaliana]
 sp|Q9SHM1.1|ALMT6_ARATH RecName: Full=Aluminum-activated malate transporter 6; Short=AtALMT6 
[Arabidopsis thaliana]
 gb|AAD32904.1| unknown protein [Arabidopsis thaliana]
 gb|AEC06632.1| Aluminium activated malate transporter family protein [Arabidopsis 
thaliana]
Length=538

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -1

Query  216  EMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGTQNI  37
            E+G  D R+I FA KMG+AL+L S+++F KEPL      SVW ILTVVVVFE+S+G   +
Sbjct  31   ELGHSDRRRIFFAVKMGMALALCSVVIFLKEPLHDASKYSVWGILTVVVVFEYSVGATLV  90

Query  36   LNF  28
              F
Sbjct  91   KGF  93



>gb|KHN27182.1| Aluminum-activated malate transporter 4 [Glycine soja]
Length=526

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 54/88 (61%), Gaps = 4/88 (5%)
 Frame = -1

Query  303  STNR--GFLHGFRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfF  130
            S NR  G L    DR +  +  V E   +  EM R D RK+ FAAK GL+L+LVSL ++ 
Sbjct  6    SNNRAGGILRVLADRTATVYKGVCEFFRQLQEMARSDRRKVAFAAKAGLSLALVSLFIYV  65

Query  129  KEPLSYIGSKSVWAILTVVVVFEFSIGT  46
            KE    +   S+WA+LTVV++FEFS+G 
Sbjct  66   KE--EQLSKYSIWAVLTVVLIFEFSVGA  91



>ref|XP_006649014.1| PREDICTED: aluminum-activated malate transporter 9-like [Oryza 
brachyantha]
Length=546

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 1/54 (2%)
 Frame = -1

Query  207  RKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
            RKDPRK +FAAK+  AL L++LLVF +EP   I S SVWAILTVVVVFEFSIG 
Sbjct  42   RKDPRKPVFAAKVATALGLITLLVFLREPTD-IASHSVWAILTVVVVFEFSIGA  94



>ref|XP_006838425.1| hypothetical protein AMTR_s00002p00115520 [Amborella trichopoda]
 gb|ERN00994.1| hypothetical protein AMTR_s00002p00115520 [Amborella trichopoda]
Length=542

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 48/78 (62%), Gaps = 4/78 (5%)
 Frame = -1

Query  279  GFRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSK  100
            GFR+R+      V + +  A+E  + DPR++IF AKMGLAL+ V L+ FF  PL  + S 
Sbjct  37   GFRERIDG----VCDNASYAWEFAKADPRRVIFGAKMGLALATVCLIGFFDVPLMDLSSF  92

Query  99   SVWAILTVVVVFEFSIGT  46
              W I  VV VFEFSIG 
Sbjct  93   VTWGIFAVVAVFEFSIGA  110



>ref|XP_002532651.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29724.1| conserved hypothetical protein [Ricinus communis]
Length=584

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = -1

Query  270  DRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVW  91
            D++  F   V++ +++AYEMGR DPRKI+F+AKMGLAL L+SLL+F KE    +   SVW
Sbjct  52   DKIIGFVRQVQDVAVEAYEMGRNDPRKIVFSAKMGLALMLISLLIFLKESSKDLSRYSVW  111

Query  90   AILTVVVVFEFSIGT  46
            A+LTVVVVFEFSIG 
Sbjct  112  AVLTVVVVFEFSIGA  126



>emb|CDY24338.1| BnaA07g02630D [Brassica napus]
Length=361

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 53/96 (55%), Gaps = 4/96 (4%)
 Frame = -1

Query  312  PSQSTNRGFLHGFRDRVSAF-FGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllv  136
            P QS   G L   R R S F F D +        +   D RK+ FA KMG+AL++ S L+
Sbjct  39   PEQS-REGLLS--RKRYSGFGFNDSRRRFCGICNLWHSDRRKLFFAVKMGMALAICSFLI  95

Query  135  fFKEPLSYIGSKSVWAILTVVVVFEFSIGTQNILNF  28
            F KEPL       VWAILTVVVVFE+S+G   +  F
Sbjct  96   FLKEPLHAASKFYVWAILTVVVVFEYSVGATLVKGF  131



>ref|XP_010236888.1| PREDICTED: aluminum-activated malate transporter 9-like [Brachypodium 
distachyon]
Length=588

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 54/79 (68%), Gaps = 4/79 (5%)
 Frame = -1

Query  273  RDRVSAF---FGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGS  103
            RDR  A     G V   + + +   RKDPRK +++AK+  AL+L++LLVF +EP S I S
Sbjct  40   RDRAPALRRAAGAVLAGAREMWAFARKDPRKPVYSAKVATALALITLLVFLREP-SDIVS  98

Query  102  KSVWAILTVVVVFEFSIGT  46
             SVWAILTVVVVFE++IG 
Sbjct  99   HSVWAILTVVVVFEYTIGA  117



>ref|XP_010088643.1| Aluminum-activated malate transporter 2 [Morus notabilis]
 gb|EXC36056.1| Aluminum-activated malate transporter 2 [Morus notabilis]
Length=483

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = -1

Query  276  FRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKS  97
            F+       G V E S K  ++G+ DPR+II + K+GLA++LVSL  +FK      G  +
Sbjct  21   FKALAEKMLGKVVEFSRKLKKLGQDDPRRIIHSLKVGLAITLVSLFYYFKPLYDGFGVNA  80

Query  96   VWAILTVVVVFEFSIGT  46
            +WA+LTVVVVFEFS+G 
Sbjct  81   IWAVLTVVVVFEFSVGA  97



>gb|KEH44433.1| aluminum activated malate transporter family protein [Medicago 
truncatula]
Length=536

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = -1

Query  303  STNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKE  124
            S++  F++   D+V  F G V+    + +++G+ DPR+I+ + K+GLAL+LVSLL   + 
Sbjct  15   SSHWKFIYSLADKVKRFPGLVRR---EIWKVGKDDPRRILHSLKVGLALALVSLLYLMEP  71

Query  123  PLSYIGSKSVWAILTVVVVFEFSIG  49
                IGS ++WA++TVVVV EF++G
Sbjct  72   LFKGIGSNAMWAVMTVVVVMEFTVG  96



>ref|XP_004154705.1| PREDICTED: LOW QUALITY PROTEIN: aluminum-activated malate transporter 
7-like [Cucumis sativus]
Length=413

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = -1

Query  279  GFRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSK  100
            G + ++S     V E   K  ++ + DPR+++ + K+GLA++LVSL  +F+     +G+ 
Sbjct  18   GLKAKISKIMAKVIELFKKTKKLAKDDPRRVVHSLKVGLAITLVSLFYYFEPLYDGLGAS  77

Query  99   SVWAILTVVVVFEFSIG  49
            ++WAILTVVVVFEFSIG
Sbjct  78   AMWAILTVVVVFEFSIG  94



>gb|KHN23120.1| Aluminum-activated malate transporter 12 [Glycine soja]
Length=519

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 56/80 (70%), Gaps = 3/80 (4%)
 Frame = -1

Query  288  FLHGFRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYI  109
            +++ F D+V +F G  +  +   +++G++DPR+++ A K+G+AL+LVSLL   +     I
Sbjct  16   YVYSFADKVKSFPGLARRAT---WKVGKEDPRRVVHALKVGMALTLVSLLYLMEPLFKGI  72

Query  108  GSKSVWAILTVVVVFEFSIG  49
            G  ++WA++TVVVV EF++G
Sbjct  73   GKNAMWAVMTVVVVMEFTVG  92



>gb|KFK41279.1| hypothetical protein AALP_AA2G109500 [Arabis alpina]
Length=545

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -1

Query  237  ETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEF  58
            E   K Y M   D RK+ FA KMG+ALSL SL++F KEPL      +VWAILTVV++FE+
Sbjct  49   EVPAKLYAMRHSDRRKLYFAMKMGIALSLCSLVIFLKEPLQDASKYAVWAILTVVLIFEY  108

Query  57   SIGTQNILNF  28
             +G   +  F
Sbjct  109  YVGATLVKGF  118



>ref|XP_010419084.1| PREDICTED: aluminum-activated malate transporter 5, partial [Camelina 
sativa]
Length=526

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -1

Query  237  ETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEF  58
            E   K Y MG  D RK+ F+ KMG+AL+L S L+F KEPL      ++WAILTVV++FE+
Sbjct  30   EAPAKLYAMGHSDRRKLYFSLKMGIALALCSFLIFLKEPLQDASKFAIWAILTVVLIFEY  89

Query  57   SIGTQNILNF  28
             +G   +  F
Sbjct  90   YVGATLVKGF  99



>ref|XP_009121112.1| PREDICTED: aluminum-activated malate transporter 6 isoform X1 
[Brassica rapa]
Length=540

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 53/96 (55%), Gaps = 4/96 (4%)
 Frame = -1

Query  312  PSQSTNRGFLHGFRDRVSAF-FGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllv  136
            P QS   G L   R R S F F D +        +   D RK+ FA KMG+AL++ S L+
Sbjct  20   PEQS-REGLLS--RKRYSGFGFNDSRRRFCGICNLWHSDRRKLFFAVKMGMALAICSFLI  76

Query  135  fFKEPLSYIGSKSVWAILTVVVVFEFSIGTQNILNF  28
            F KEPL       VWAILTVVVVFE+S+G   +  F
Sbjct  77   FLKEPLHAASKFYVWAILTVVVVFEYSVGATLVKGF  112



>ref|XP_004139139.1| PREDICTED: aluminum-activated malate transporter 2-like [Cucumis 
sativus]
 gb|KGN66582.1| hypothetical protein Csa_1G630860 [Cucumis sativus]
Length=454

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = -1

Query  279  GFRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSK  100
            G + ++S     V E   K  ++ + DPR+++ + K+GLA++LVSL  +F+     +G+ 
Sbjct  18   GLKAKISKIMAKVIELFKKTKKLAKDDPRRVVHSLKVGLAITLVSLFYYFEPLYDGLGAS  77

Query  99   SVWAILTVVVVFEFSIG  49
            ++WAILTVVVVFEFSIG
Sbjct  78   AMWAILTVVVVFEFSIG  94



>ref|XP_003535771.2| PREDICTED: aluminum-activated malate transporter 12-like [Glycine 
max]
Length=813

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = -1

Query  303  STNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKE  124
            S+   +++ F D+V +F G  +  +   +++G++DPR+++ A K+G+AL+LVSLL   + 
Sbjct  11   SSQLRYVYSFADKVKSFPGWARRAT---WKVGKEDPRRVVHALKVGMALTLVSLLYLMEP  67

Query  123  PLSYIGSKSVWAILTVVVVFEFSIG  49
                IG  ++WA++TVVVV EF++G
Sbjct  68   LFKGIGKNAMWAVMTVVVVMEFTVG  92



>ref|XP_010474207.1| PREDICTED: aluminum-activated malate transporter 5-like [Camelina 
sativa]
Length=497

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -1

Query  237  ETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEF  58
            E   K Y MG  D RK+ F+ KMG+AL+L S ++F KEPL      +VWAILTVV++FE+
Sbjct  45   EAPAKLYAMGHSDRRKLYFSFKMGVALALCSFVIFLKEPLRDASKYAVWAILTVVLIFEY  104

Query  57   SIGT  46
             +G 
Sbjct  105  YVGA  108



>gb|EAZ24499.1| hypothetical protein OsJ_08260 [Oryza sativa Japonica Group]
Length=517

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = -1

Query  219  YEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
            +   RKDPRK +FAAK+  AL+L++LLVF +EP   + + +VWAILTVVVVFEFSIG 
Sbjct  2    WAFARKDPRKPVFAAKVATALALITLLVFLREPTD-LANHAVWAILTVVVVFEFSIGA  58



>ref|XP_010415488.1| PREDICTED: aluminum-activated malate transporter 5-like [Camelina 
sativa]
Length=539

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -1

Query  237  ETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEF  58
            E   K Y MG  D RK+ F+ KMG+AL+L S ++F KEPL      +VWAILTVV++FE+
Sbjct  45   EAPAKLYAMGHSDRRKLYFSFKMGVALALCSFVIFLKEPLRDASKFAVWAILTVVLIFEY  104

Query  57   SIGTQNILNF  28
             +G   +  F
Sbjct  105  CVGATLVKGF  114



>ref|XP_002887192.1| F24J5.16 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63451.1| F24J5.16 [Arabidopsis lyrata subsp. lyrata]
Length=532

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -1

Query  237  ETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEF  58
            E   K Y MG  D RK+ F+ KMG+AL+L S ++F KEPL      +VWAILTVV++FE+
Sbjct  37   EAPAKLYAMGHSDRRKLYFSFKMGIALALCSFVIFLKEPLQDASKFAVWAILTVVLIFEY  96

Query  57   SIGTQNILNF  28
             +G   +  F
Sbjct  97   YVGATLVKGF  106



>dbj|BAD15928.1| putative aluminum-activated malate transporter [Oryza sativa 
Japonica Group]
 dbj|BAD16367.1| putative aluminum-activated malate transporter [Oryza sativa 
Japonica Group]
 gb|EAY87399.1| hypothetical protein OsI_08806 [Oryza sativa Indica Group]
Length=584

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = -1

Query  219  YEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
            +   RKDPRK +FAAK+  AL+L++LLVF +EP   + + +VWAILTVVVVFEFSIG 
Sbjct  69   WAFARKDPRKPVFAAKVATALALITLLVFLREPTD-LANHAVWAILTVVVVFEFSIGA  125



>ref|XP_007015684.1| Aluminum activated malate transporter family protein, putative 
[Theobroma cacao]
 gb|EOY33303.1| Aluminum activated malate transporter family protein, putative 
[Theobroma cacao]
Length=456

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 53/80 (66%), Gaps = 3/80 (4%)
 Frame = -1

Query  288  FLHGFRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYI  109
            +L   R++   F   V E + K  ++G++DPR++  + KMGLAL+LVS+  +F+      
Sbjct  22   WLKALRNK---FNARVTEIARKTKQIGQQDPRRVYHSLKMGLALTLVSVFYYFQPVYDGF  78

Query  108  GSKSVWAILTVVVVFEFSIG  49
            G  ++WA+LTVVVVFEFS+G
Sbjct  79   GDNAMWAVLTVVVVFEFSVG  98



>ref|XP_002886114.1| hypothetical protein ARALYDRAFT_319696 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62373.1| hypothetical protein ARALYDRAFT_319696 [Arabidopsis lyrata subsp. 
lyrata]
Length=539

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = -1

Query  225  KAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
            K  E+G  D R+  FA KMG+AL+L S+++F KEPL      SVW ILTVVVVFE+ +G 
Sbjct  28   KLCELGHSDRRRTFFAVKMGMALALCSVVIFLKEPLHDASKYSVWGILTVVVVFEYYVGA  87

Query  45   QNILNF  28
              +  F
Sbjct  88   TLVKGF  93



>gb|AAD49983.1|AC008075_16 F24J5.16 [Arabidopsis thaliana]
Length=533

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -1

Query  237  ETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEF  58
            E   K Y +G  D RK+ F+ KMG+AL+L S ++F KEPL      +VWAILTVV++FE+
Sbjct  37   EAPAKLYALGHSDRRKLYFSIKMGIALALCSFVIFLKEPLQDASKFAVWAILTVVLIFEY  96

Query  57   SIGTQNILNF  28
             +G   +  F
Sbjct  97   YVGATLVKGF  106



>ref|XP_010511869.1| PREDICTED: aluminum-activated malate transporter 5-like [Camelina 
sativa]
Length=535

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -1

Query  237  ETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEF  58
            E   K Y MG  D RK+ F+ KMG+AL+L S L+F KEPL      ++WAILTVV++FE+
Sbjct  39   EAPAKLYAMGHSDRRKLYFSFKMGVALALCSFLIFLKEPLQDASKFAIWAILTVVLIFEY  98

Query  57   SIGTQNILNF  28
             +G   +  F
Sbjct  99   YVGATLVKGF  108



>ref|XP_008450295.1| PREDICTED: aluminum-activated malate transporter 2-like [Cucumis 
melo]
Length=458

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = -1

Query  264  VSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAI  85
            V + F  + E   KA  +G+ DPR++I A K+GL L++VSLL ++K      G  ++WA+
Sbjct  19   VKSLFAKLVEIGKKAKALGKDDPRRVIHALKLGLTLTIVSLLYYYKPLYDNFGVSAMWAV  78

Query  84   LTVVVVFEFSIGT  46
            +TVVVV EFS+G 
Sbjct  79   MTVVVVLEFSVGA  91



>ref|NP_564935.1| Aluminum activated malate transporter family protein [Arabidopsis 
thaliana]
 sp|Q93Z29.1|ALMT5_ARATH RecName: Full=Aluminum-activated malate transporter 5; Short=AtALMT5 
[Arabidopsis thaliana]
 gb|AAL25603.1| At1g68600/F24J5_14 [Arabidopsis thaliana]
 gb|AAM98268.1| At1g68600/F24J5_14 [Arabidopsis thaliana]
 gb|AEE34818.1| Aluminum activated malate transporter family protein [Arabidopsis 
thaliana]
Length=537

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -1

Query  237  ETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEF  58
            E   K Y +G  D RK+ F+ KMG+AL+L S ++F KEPL      +VWAILTVV++FE+
Sbjct  41   EAPAKLYALGHSDRRKLYFSIKMGIALALCSFVIFLKEPLQDASKFAVWAILTVVLIFEY  100

Query  57   SIGTQNILNF  28
             +G   +  F
Sbjct  101  YVGATLVKGF  110



>gb|KFK28482.1| hypothetical protein AALP_AA7G001700 [Arabis alpina]
Length=564

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = -1

Query  243  VKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVF  64
            +K+   + +++G++DPR++I A K+GLAL+LVSLL   +     IGS ++WA++TVVVV 
Sbjct  30   IKKIPKRLWDVGKQDPRRVIHALKVGLALTLVSLLYLMEPLFKGIGSNAIWAVMTVVVVL  89

Query  63   EFSIG  49
            EFS G
Sbjct  90   EFSAG  94



>gb|KFK28481.1| hypothetical protein AALP_AA7G001700 [Arabis alpina]
Length=510

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = -1

Query  243  VKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVF  64
            +K+   + +++G++DPR++I A K+GLAL+LVSLL   +     IGS ++WA++TVVVV 
Sbjct  30   IKKIPKRLWDVGKQDPRRVIHALKVGLALTLVSLLYLMEPLFKGIGSNAIWAVMTVVVVL  89

Query  63   EFSIG  49
            EFS G
Sbjct  90   EFSAG  94



>ref|XP_008376196.1| PREDICTED: aluminum-activated malate transporter 10 [Malus domestica]
Length=497

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 56/111 (50%), Gaps = 11/111 (10%)
 Frame = -1

Query  348  RGGCSSELEWGI-----------PSQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRK  202
            RGG    +EWGI           P        L G +  V      V    +KA+++G  
Sbjct  9    RGGLGVSVEWGINVADGTNNASVPESGLVDKALLGLKGMVGGLVLKVWRFLVKAWKLGVD  68

Query  201  DPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIG  49
            +PRK I A K+GLA+S+V L  + +     +G  +VWA +TVVVVFE ++G
Sbjct  69   EPRKAIHALKVGLAISVVLLFYYMRSLYEGVGGNAVWADMTVVVVFESTVG  119



>ref|XP_008450296.1| PREDICTED: aluminum-activated malate transporter 2-like [Cucumis 
melo]
Length=454

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = -1

Query  279  GFRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSK  100
            G + ++S     V E   K  ++ + DPR+I+ + K+GLA++LVSL  +F+     +G+ 
Sbjct  18   GLKAKISKLKAKVIELFKKTKKLAKDDPRRIVHSLKVGLAITLVSLFYYFEPLYDGLGAS  77

Query  99   SVWAILTVVVVFEFSIG  49
            ++WAILTVVVVFEFS+G
Sbjct  78   AMWAILTVVVVFEFSVG  94



>ref|XP_003555194.1| PREDICTED: aluminum-activated malate transporter 12-like [Glycine 
max]
Length=519

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 55/79 (70%), Gaps = 3/79 (4%)
 Frame = -1

Query  285  LHGFRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIG  106
            ++ F D+V +F G  +  +   +++G++DPR+++ A K+G+AL+LVSLL   +     IG
Sbjct  17   VYSFADKVKSFPGLARRAT---WKVGKEDPRRVVHALKVGMALTLVSLLYLMEPLFKGIG  73

Query  105  SKSVWAILTVVVVFEFSIG  49
              ++WA++TVVVV EF++G
Sbjct  74   KNAMWAVMTVVVVMEFTVG  92



>emb|CDP04954.1| unnamed protein product [Coffea canephora]
Length=496

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -1

Query  171  MGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
            MGLALS V++L+FFKEPLSYIG  S+WAILTVVVVFEFSIG 
Sbjct  1    MGLALSFVTILIFFKEPLSYIGQYSIWAILTVVVVFEFSIGA  42



>ref|XP_009342772.1| PREDICTED: aluminum-activated malate transporter 2-like [Pyrus 
x bretschneideri]
Length=272

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = -1

Query  249  GDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVV  70
            G +   +++  E+G+ DPRKII + K+GLAL+LVSL  +FK      G  ++WAILTVVV
Sbjct  21   GKIVGFALRLKELGKDDPRKIIHSFKVGLALTLVSLFYYFKPLYEGFGLAAMWAILTVVV  80

Query  69   VFEFSIG  49
            VFEFS+G
Sbjct  81   VFEFSVG  87



>dbj|BAJ87572.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=582

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 42/51 (82%), Gaps = 1/51 (2%)
 Frame = -1

Query  201  DPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIG  49
            DPRK +FAAK+ LA++L+SLL F +EP  ++ S SVWA+LT VVVFEFSIG
Sbjct  78   DPRKPVFAAKVALAIALMSLLAFVREPRDFV-SHSVWALLTAVVVFEFSIG  127



>ref|XP_010474208.1| PREDICTED: aluminum-activated malate transporter 5-like [Camelina 
sativa]
Length=525

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = -1

Query  225  KAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
            K Y MG  D RK+ F+ KMG+AL+L S L+F KEPL      ++WAILTVV++FE+ +G 
Sbjct  33   KLYAMGHSDRRKLYFSFKMGIALALCSFLIFLKEPLQDASKFAIWAILTVVLIFEYYVGA  92

Query  45   QNILNF  28
              +  F
Sbjct  93   TLVKGF  98



>gb|KJB24154.1| hypothetical protein B456_004G130400 [Gossypium raimondii]
Length=502

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = -1

Query  315  IPSQSTNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllv  136
            +P+    R    G +  +S F   V+    KA+++G  DPRK+I   K+GLAL++VSL  
Sbjct  27   VPATGLARKAWLGIKGLISGFALKVRMFVKKAWDVGTNDPRKVIHCIKVGLALAIVSLFY  86

Query  135  fFKEPLSYIGSKSVWAILTVVVVFEFSIG  49
            F +     +G  ++WA++TVVVVFE ++G
Sbjct  87   FMRPLYDGVGGNAMWAVMTVVVVFEPTVG  115



>ref|XP_010511868.1| PREDICTED: aluminum-activated malate transporter 5-like [Camelina 
sativa]
Length=541

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = -1

Query  225  KAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVWAILTVVVVFEFSIGT  46
            K Y MG  D RK+ F+ KMG+AL+L S +VF KEPL      +VWAILTVV++FE+ +G 
Sbjct  49   KLYAMGHSDRRKLYFSFKMGVALALCSFVVFLKEPLRDASKFAVWAILTVVLIFEYYVGA  108

Query  45   QNILNF  28
              +  F
Sbjct  109  TLVKGF  114



>ref|XP_008238285.1| PREDICTED: aluminum-activated malate transporter 12-like [Prunus 
mume]
Length=523

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 51/74 (69%), Gaps = 3/74 (4%)
 Frame = -1

Query  270  DRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKEPLSYIGSKSVW  91
            D++  F G V ET    +++GR+DPR++I A K+GLAL+LVSLL   +     IG  ++W
Sbjct  24   DKMRRFPGLVWET---VWKVGREDPRRVIHALKVGLALTLVSLLYLIQPLYVGIGQNAIW  80

Query  90   AILTVVVVFEFSIG  49
            A++TVVVV EF+ G
Sbjct  81   AVMTVVVVLEFTAG  94



>ref|XP_011003846.1| PREDICTED: aluminum-activated malate transporter 2-like isoform 
X3 [Populus euphratica]
Length=386

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 56/86 (65%), Gaps = 3/86 (3%)
 Frame = -1

Query  303  STNRGFLHGFRDRVSAFFGDVKETSIKAYEMGRKDPRKIIFAAKMGLAlslvsllvfFKE  124
            +  R +L+  R +   F   V +T+    ++G+ DPR++I + K+GLAL+LVS+  +++ 
Sbjct  15   TQGRRWLNALRVK---FKAKVADTARNIKKVGQDDPRRVIHSLKVGLALALVSIFYYYQP  71

Query  123  PLSYIGSKSVWAILTVVVVFEFSIGT  46
              S  G  ++WAI+TVVVVFEFS+G 
Sbjct  72   LYSNFGVTAMWAIMTVVVVFEFSVGA  97



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1014965446875