BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF041B17

Length=647
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009588089.1|  PREDICTED: LOW QUALITY PROTEIN: probable tyr...    102   1e-21   Nicotiana tomentosiformis
ref|XP_006362449.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  98.6    3e-20   Solanum tuberosum [potatoes]
emb|CDX92008.1|  BnaC03g33100D                                        94.4    1e-19   
ref|XP_004242803.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  94.4    9e-19   Solanum lycopersicum
ref|XP_010463686.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  94.0    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010485586.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  93.2    2e-18   Camelina sativa [gold-of-pleasure]
ref|XP_002884331.1|  tRNA synthetase class I family protein           92.8    2e-18   Arabidopsis lyrata subsp. lyrata
ref|XP_006297370.1|  hypothetical protein CARUB_v10013389mg           93.2    3e-18   
ref|XP_010500171.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  91.3    8e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010500039.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  91.3    9e-18   Camelina sativa [gold-of-pleasure]
ref|XP_009118453.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  90.1    3e-17   Brassica rapa
ref|XP_010276894.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  89.4    5e-17   Nelumbo nucifera [Indian lotus]
ref|XP_009355254.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  89.0    5e-17   Pyrus x bretschneideri [bai li]
ref|XP_009355255.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  89.0    5e-17   Pyrus x bretschneideri [bai li]
ref|XP_004303944.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  89.0    6e-17   Fragaria vesca subsp. vesca
ref|XP_010549888.1|  PREDICTED: tyrosine--tRNA ligase, mitochondrial  89.0    7e-17   Tarenaya hassleriana [spider flower]
emb|CDX74240.1|  BnaA03g28070D                                        88.6    8e-17   
ref|XP_008347911.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  88.6    8e-17   
ref|XP_009134705.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  88.6    8e-17   Brassica rapa
ref|XP_009134703.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  88.6    8e-17   Brassica rapa
ref|XP_008218548.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  88.2    1e-16   Prunus mume [ume]
ref|XP_007222608.1|  hypothetical protein PRUPE_ppa004925mg           88.2    1e-16   Prunus persica
ref|XP_009760674.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  87.8    2e-16   Nicotiana sylvestris
ref|NP_186915.1|  tyrosyl-tRNA synthetase                             87.4    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009591201.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  87.0    3e-16   Nicotiana tomentosiformis
ref|XP_004299915.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  86.7    4e-16   Fragaria vesca subsp. vesca
ref|XP_009348745.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  86.3    4e-16   Pyrus x bretschneideri [bai li]
ref|XP_008339494.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  86.3    4e-16   
ref|XP_009348746.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  86.3    4e-16   Pyrus x bretschneideri [bai li]
ref|XP_008339493.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  86.3    5e-16   
ref|XP_008361702.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  86.3    5e-16   
ref|XP_006408394.1|  hypothetical protein EUTSA_v10020578mg           84.3    2e-15   Eutrema salsugineum [saltwater cress]
ref|XP_009414004.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  82.8    8e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010683748.1|  PREDICTED: tyrosine--tRNA ligase, mitochondrial  82.8    8e-15   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB12925.1|  hypothetical protein B456_002G045400                  79.0    1e-13   Gossypium raimondii
ref|XP_010927782.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  79.0    2e-13   Elaeis guineensis
ref|XP_008801775.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  78.6    2e-13   Phoenix dactylifera
ref|XP_007022035.1|  Tyrosyl-tRNA synthetase, class Ib, bacterial...  77.0    6e-13   
ref|XP_007022036.1|  Tyrosyl-tRNA synthetase, class Ib, bacterial...  77.0    6e-13   
ref|XP_007022034.1|  Tyrosyl-tRNA synthetase isoform 1                77.0    7e-13   
ref|XP_002512791.1|  tyrosyl-tRNA synthetase, putative                76.6    9e-13   
emb|CDP19091.1|  unnamed protein product                              76.3    1e-12   Coffea canephora [robusta coffee]
ref|XP_008783116.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  76.3    1e-12   Phoenix dactylifera
gb|KDO63480.1|  hypothetical protein CISIN_1g037749mg                 75.9    1e-12   Citrus sinensis [apfelsine]
ref|XP_006468947.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  75.9    2e-12   Citrus sinensis [apfelsine]
ref|XP_006446866.1|  hypothetical protein CICLE_v10015023mg           72.4    2e-11   Citrus clementina [clementine]
gb|EYU42284.1|  hypothetical protein MIMGU_mgv1a005712mg              70.9    7e-11   Erythranthe guttata [common monkey flower]
gb|KCW55733.1|  hypothetical protein EUGRSUZ_I01565                   70.5    9e-11   Eucalyptus grandis [rose gum]
gb|KEH34424.1|  tyrosyl-tRNA synthetase                               70.5    1e-10   Medicago truncatula
ref|XP_010028900.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  70.5    1e-10   Eucalyptus grandis [rose gum]
ref|XP_003544330.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  70.1    1e-10   Glycine max [soybeans]
ref|XP_004500343.1|  PREDICTED: tyrosine--tRNA ligase-like            69.3    2e-10   Cicer arietinum [garbanzo]
ref|XP_003519285.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  69.3    2e-10   Glycine max [soybeans]
gb|KDP41896.1|  hypothetical protein JCGZ_26914                       68.6    4e-10   Jatropha curcas
ref|XP_007142062.1|  hypothetical protein PHAVU_008G249300g           68.6    4e-10   Phaseolus vulgaris [French bean]
gb|KHN08832.1|  Tyrosine--tRNA ligase                                 68.2    6e-10   Glycine soja [wild soybean]
gb|KEH32330.1|  tyrosyl-tRNA synthetase                               68.2    6e-10   Medicago truncatula
gb|EYU24457.1|  hypothetical protein MIMGU_mgv1a005745mg              67.8    7e-10   Erythranthe guttata [common monkey flower]
ref|XP_001751567.1|  predicted protein                                67.0    1e-09   
ref|XP_011071261.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  67.0    1e-09   
ref|XP_002980036.1|  hypothetical protein SELMODRAFT_111886           66.2    2e-09   Selaginella moellendorffii
ref|XP_002992920.1|  hypothetical protein SELMODRAFT_136175           66.2    2e-09   
ref|XP_011033705.1|  PREDICTED: tyrosine--tRNA ligase, mitochondrial  65.9    3e-09   Populus euphratica
ref|XP_008453844.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  65.9    3e-09   
ref|XP_004166614.1|  PREDICTED: tyrosine--tRNA ligase-like            65.9    3e-09   
ref|XP_004146892.1|  PREDICTED: tyrosine--tRNA ligase-like            65.9    3e-09   Cucumis sativus [cucumbers]
ref|WP_006340872.1|  tyrosyl-tRNA synthetase                          63.2    2e-08   Parachlamydia acanthamoebae
ref|WP_039376683.1|  tyrosyl-tRNA synthetase                          63.2    2e-08   
ref|NP_001043131.1|  Os01g0500900                                     60.1    3e-07   
ref|XP_006826574.1|  hypothetical protein AMTR_s00138p00020780        60.1    3e-07   Amborella trichopoda
gb|EAZ12037.1|  hypothetical protein OsJ_01916                        59.7    3e-07   Oryza sativa Japonica Group [Japonica rice]
emb|CAN64191.1|  hypothetical protein VITISV_016956                   58.9    7e-07   Vitis vinifera
emb|CBI22389.3|  unnamed protein product                              58.5    8e-07   Vitis vinifera
ref|XP_002265238.2|  PREDICTED: probable tyrosine--tRNA ligase, m...  58.2    1e-06   Vitis vinifera
gb|EPS58486.1|  hypothetical protein M569_16327                       57.4    2e-06   Genlisea aurea
gb|EMT07165.1|  Tyrosyl-tRNA synthetase                               57.4    2e-06   
ref|XP_006645923.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  56.6    4e-06   
gb|KIY99495.1|  tyrosyl-tRNA synthetase                               55.1    4e-06   Monoraphidium neglectum
ref|WP_042279297.1|  tyrosyl-tRNA synthetase                          56.2    4e-06   Candidatus Protochlamydia sp. R18
ref|WP_039359281.1|  tyrosyl-tRNA synthetase                          56.2    4e-06   Candidatus Protochlamydia amoebophila
gb|KIC71389.1|  Tyrosine--tRNA ligase                                 56.2    5e-06   Candidatus Protochlamydia amoebophila
ref|WP_011175719.1|  tyrosyl-tRNA synthetase                          55.5    9e-06   Candidatus Protochlamydia amoebophila
ref|XP_010229641.1|  PREDICTED: LOW QUALITY PROTEIN: probable tyr...  54.7    1e-05   
ref|XP_003574045.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  54.7    2e-05   Brachypodium distachyon [annual false brome]
gb|EMS54027.1|  Tyrosyl-tRNA synthetase                               54.3    2e-05   Triticum urartu
ref|XP_005650588.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   Coccomyxa subellipsoidea C-169
ref|WP_032125960.1|  tyrosyl-tRNA synthetase                          52.8    7e-05   Candidatus Protochlamydia massiliensis
ref|XP_004993733.1|  tyrosyl-tRNA synthetase                          52.0    1e-04   Salpingoeca rosetta
ref|WP_042103652.1|  tyrosyl-tRNA synthetase                          51.6    2e-04   Parachlamydiaceae bacterium HS-T3
ref|XP_004982893.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  51.2    2e-04   Setaria italica
ref|XP_002504529.1|  predicted protein                                50.8    3e-04   Micromonas commoda
ref|XP_005538192.1|  tyrosine--tRNA ligase, mitochondrial or chlo...  50.8    3e-04   Cyanidioschyzon merolae strain 10D
ref|XP_007509051.1|  tyrosyl-tRNA synthetase                          50.8    3e-04   Bathycoccus prasinos
ref|NP_001141566.1|  hypothetical protein                             50.4    4e-04   Zea mays [maize]
ref|XP_010110726.1|  Tyrosine--tRNA ligase                            50.1    5e-04   Morus notabilis



>ref|XP_009588089.1| PREDICTED: LOW QUALITY PROTEIN: probable tyrosine--tRNA ligase, 
mitochondrial [Nicotiana tomentosiformis]
Length=521

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 90/134 (67%), Gaps = 3/134 (2%)
 Frame = +2

Query  254  ARMASVRTFILNGAHRHFSPLFIQKFPIrlltshrrrsslFCYSSSPLCSSAQFIPQLKS  433
            A   ++RTF+LN   + F+  F++   +          SL  +S  P CS +  +   + 
Sbjct  3    AGAGAIRTFLLNATQKPFTSSFLKNISLPTCLFLHNCLSLRSFSHRPFCSISTQLTSQED  62

Query  434  EPEMESDQ---RQRRRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAES  604
             P+ E+ Q   ++ R NV++ILEERGLLESVT+++LRS+CSDPNL PLKVYCGFDPTAES
Sbjct  63   TPQPENFQHSNKKTRPNVLQILEERGLLESVTNDSLRSVCSDPNLGPLKVYCGFDPTAES  122

Query  605  lhlgnllglivlSW  646
            LHLGNLLG IVLSW
Sbjct  123  LHLGNLLGXIVLSW  136



>ref|XP_006362449.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Solanum tuberosum]
Length=522

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 87/129 (67%), Gaps = 4/129 (3%)
 Frame = +2

Query  263  ASVRTFILNGAHRHFSPLFIQKFPIrlltshrrrsslFCYSSSPLCSSAQFIPQLKSEPE  442
            + +R+ +LN   R F+  F++K P+          S   +S  P CS +   P   S+ +
Sbjct  12   SGLRSLLLNTTLRPFTSSFLRKLPLPTYLFLPNTPSHHNFSHRPFCSIS---PLTTSQED  68

Query  443  MESDQRQRRR-NVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgn  619
              S+   + R NV+ ILEERGLLESVTS++LRS+CSDPNL PLKVYCGFDPTAESLHLGN
Sbjct  69   NFSNPNSKSRPNVLHILEERGLLESVTSDSLRSVCSDPNLGPLKVYCGFDPTAESLHLGN  128

Query  620  llglivlSW  646
            LLG+IVLSW
Sbjct  129  LLGIIVLSW  137



>emb|CDX92008.1| BnaC03g33100D [Brassica napus]
Length=262

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 70/91 (77%), Gaps = 7/91 (8%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            F  S +PL SS +F     S   +E+     R NVV+ILEERGLLESVTSENLRS CSDP
Sbjct  49   FSTSRAPLFSSVKF-----STSSLET--AASRSNVVDILEERGLLESVTSENLRSACSDP  101

Query  554  NLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            N+ PLKVYCGFDPTAESLHLGNLLG+IVLSW
Sbjct  102  NVAPLKVYCGFDPTAESLHLGNLLGIIVLSW  132



>ref|XP_004242803.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Solanum 
lycopersicum]
Length=521

 Score = 94.4 bits (233),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 87/138 (63%), Gaps = 4/138 (3%)
 Frame = +2

Query  236  CADNTNARMASVRTFILNGAHRHFSPLFIQKFPIrlltshrrrsslFCYSSSPLCSSAQF  415
             A    A  + +R+ +LN   R F+   ++  P+          S   +S  P CS +  
Sbjct  2    AAAGAGAINSGLRSLLLNTTLRPFTSSLLRILPLPTYVFLPNTPSRHNFSHRPFCSIS--  59

Query  416  IPQLKSEPEMESDQRQRRR-NVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDP  592
             P   S+ ++ S    + R NV+ ILEERGLLESVTS++LRS+CSDPNL PLKVYCGFDP
Sbjct  60   -PLPASQEDIFSKPNSKSRPNVLHILEERGLLESVTSDSLRSVCSDPNLGPLKVYCGFDP  118

Query  593  TAESlhlgnllglivlSW  646
            TAESLHLGNLLG+IVLSW
Sbjct  119  TAESLHLGNLLGIIVLSW  136



>ref|XP_010463686.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Camelina 
sativa]
 ref|XP_010463687.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Camelina 
sativa]
Length=511

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 71/91 (78%), Gaps = 1/91 (1%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            +  S++PL SS +   Q  S PE  + Q   R NVV+ILEERGLLES+TSENLRS CSDP
Sbjct  52   YSTSTTPLFSSVRCSVQSTSSPETLT-QAASRPNVVDILEERGLLESITSENLRSACSDP  110

Query  554  NLPPLKVYCGFDPTAESlhlgnllglivlSW  646
             + PLKVYCGFDPTAESLHLGNLLG+IVLSW
Sbjct  111  KVAPLKVYCGFDPTAESLHLGNLLGIIVLSW  141



>ref|XP_010485586.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Camelina 
sativa]
 ref|XP_010485587.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Camelina 
sativa]
Length=511

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 71/91 (78%), Gaps = 1/91 (1%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            +  S++PL SSA+   Q  S PE  S Q   R NVV+ILEERGLLES+TS NLRS CSDP
Sbjct  52   YSTSTTPLFSSAKCSVQSTSSPETVS-QAVSRPNVVDILEERGLLESITSNNLRSACSDP  110

Query  554  NLPPLKVYCGFDPTAESlhlgnllglivlSW  646
             + PL+VYCGFDPTAESLHLGNLLG+IVLSW
Sbjct  111  KVTPLRVYCGFDPTAESLHLGNLLGIIVLSW  141



>ref|XP_002884331.1| tRNA synthetase class I family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60590.1| tRNA synthetase class I family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=511

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 71/91 (78%), Gaps = 1/91 (1%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            F  S++PL SS +   Q  S  E E +Q   R NVV+ILEERGLLES+TSENLRS CSDP
Sbjct  52   FSTSTTPLFSSVKCSIQSTSSLETE-NQAVSRPNVVDILEERGLLESITSENLRSACSDP  110

Query  554  NLPPLKVYCGFDPTAESlhlgnllglivlSW  646
             + PL+VYCGFDPTAESLHLGNLLG+IVLSW
Sbjct  111  KVAPLRVYCGFDPTAESLHLGNLLGIIVLSW  141



>ref|XP_006297370.1| hypothetical protein CARUB_v10013389mg, partial [Capsella rubella]
 gb|EOA30268.1| hypothetical protein CARUB_v10013389mg, partial [Capsella rubella]
Length=548

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 71/91 (78%), Gaps = 1/91 (1%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            F  S++PL S  +   Q  S P+ E +Q   R NVV+ILEERGLLES+TSENLRS CSDP
Sbjct  89   FSTSTTPLFSYVKCSVQSTSTPQTE-NQAVSRPNVVDILEERGLLESITSENLRSACSDP  147

Query  554  NLPPLKVYCGFDPTAESlhlgnllglivlSW  646
             + PL+VYCGFDPTAESLHLGNLLG+IVLSW
Sbjct  148  KVAPLRVYCGFDPTAESLHLGNLLGIIVLSW  178



>ref|XP_010500171.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Camelina sativa]
Length=505

 Score = 91.3 bits (225),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 71/91 (78%), Gaps = 1/91 (1%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            +  S++PL SSA+   Q  S PE  + Q   R NVV+ILEERGLLESVTSENLRS  SDP
Sbjct  46   YSTSTTPLFSSAKCSVQSTSSPETVT-QTVSRPNVVDILEERGLLESVTSENLRSASSDP  104

Query  554  NLPPLKVYCGFDPTAESlhlgnllglivlSW  646
             + PL+VYCGFDPTAESLHLGNLLG+IVLSW
Sbjct  105  KVAPLRVYCGFDPTAESLHLGNLLGIIVLSW  135



>ref|XP_010500039.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Camelina sativa]
 ref|XP_010500108.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Camelina sativa]
Length=511

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 71/91 (78%), Gaps = 1/91 (1%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            +  S++PL SSA+   Q  S PE  + Q   R NVV+ILEERGLLESVTSENLRS  SDP
Sbjct  52   YSTSTTPLFSSAKCSVQSTSSPETVT-QTVSRPNVVDILEERGLLESVTSENLRSASSDP  110

Query  554  NLPPLKVYCGFDPTAESlhlgnllglivlSW  646
             + PL+VYCGFDPTAESLHLGNLLG+IVLSW
Sbjct  111  KVAPLRVYCGFDPTAESLHLGNLLGIIVLSW  141



>ref|XP_009118453.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brassica 
rapa]
 ref|XP_009118460.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brassica 
rapa]
 ref|XP_009118468.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brassica 
rapa]
 ref|XP_009118475.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brassica 
rapa]
Length=503

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 69/91 (76%), Gaps = 6/91 (7%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            F  S++PL     F P   S  E E  Q   R NVV+IL+ERGLLESVTSENLRS CSDP
Sbjct  52   FSTSTTPL-----FAPVKCSTLETEV-QAVSRPNVVDILQERGLLESVTSENLRSACSDP  105

Query  554  NLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            N+ PLKVYCGFDPTAESLHLGNLLG+IVLSW
Sbjct  106  NVAPLKVYCGFDPTAESLHLGNLLGIIVLSW  136



>ref|XP_010276894.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Nelumbo 
nucifera]
Length=531

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            R NVVEILEERGLLES+TSENLRS CS+PNL PLKVYCGFDPTAESLHLGNLLG+IVLSW
Sbjct  76   RLNVVEILEERGLLESITSENLRSACSNPNLNPLKVYCGFDPTAESLHLGNLLGIIVLSW  135



>ref|XP_009355254.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Pyrus x bretschneideri]
Length=486

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            R NVVEILEERGLLESVTSE+LR  CSDPNLPPLKVYCGFDPTAESLHLGNL+G++VLSW
Sbjct  62   RPNVVEILEERGLLESVTSEHLRQSCSDPNLPPLKVYCGFDPTAESLHLGNLIGIVVLSW  121



>ref|XP_009355255.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009355256.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009355257.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009355258.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
Length=482

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            R NVVEILEERGLLESVTSE+LR  CSDPNLPPLKVYCGFDPTAESLHLGNL+G++VLSW
Sbjct  58   RPNVVEILEERGLLESVTSEHLRQSCSDPNLPPLKVYCGFDPTAESLHLGNLIGIVVLSW  117



>ref|XP_004303944.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Fragaria 
vesca subsp. vesca]
Length=482

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 71/95 (75%), Gaps = 6/95 (6%)
 Frame = +2

Query  380  YSSSPLCSSAQF-IPQLKSEPEMESDQR-----QRRRNVVEILEERGLLESVTSENLRSI  541
            Y S PLC  + F +P+    P + S  +       R+NVV+ILEERGLLES+TSE LR  
Sbjct  20   YYSLPLCVPSFFRVPRFHRNPILLSAVKCLQSSSGRQNVVDILEERGLLESLTSEQLRHA  79

Query  542  CSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            CSDP++PPLKVYCGFDPTAESLHLGNLLGLIVLSW
Sbjct  80   CSDPSIPPLKVYCGFDPTAESLHLGNLLGLIVLSW  114



>ref|XP_010549888.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Tarenaya hassleriana]
Length=516

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 61/71 (86%), Gaps = 3/71 (4%)
 Frame = +2

Query  434  EPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhl  613
            EPE   +Q   R NVV+ILEERGLLES+TSENLRS CSDP L PLKVYCGFDPTAESLHL
Sbjct  72   EPE---NQVASRPNVVDILEERGLLESITSENLRSACSDPTLGPLKVYCGFDPTAESLHL  128

Query  614  gnllglivlSW  646
            GNLLG+IVLSW
Sbjct  129  GNLLGIIVLSW  139



>emb|CDX74240.1| BnaA03g28070D [Brassica napus]
Length=500

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 69/91 (76%), Gaps = 7/91 (8%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            F  S++PL SS +      S   +E+     R NVV ILEERGLLES+TSENLRS CSDP
Sbjct  50   FSTSTAPLFSSVKC-----STSSLET--AASRPNVVTILEERGLLESITSENLRSACSDP  102

Query  554  NLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            N+ PLKVYCGFDPTAESLHLGNLLG+IVLSW
Sbjct  103  NVAPLKVYCGFDPTAESLHLGNLLGIIVLSW  133



>ref|XP_008347911.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008347912.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008347913.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008365305.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008365306.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008365307.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
Length=482

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            R NVVEILEERGLLES+TSE+LR  CSDPNLPPLKVYCGFDPTAESLHLGNL+G++VLSW
Sbjct  58   RPNVVEILEERGLLESITSEHLRQSCSDPNLPPLKVYCGFDPTAESLHLGNLIGIVVLSW  117



>ref|XP_009134705.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Brassica rapa]
 ref|XP_009134706.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Brassica rapa]
 ref|XP_009134707.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Brassica rapa]
Length=500

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 69/91 (76%), Gaps = 7/91 (8%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            F  S++PL SS +      S   +E+     R NVV ILEERGLLES+TSENLRS CSDP
Sbjct  50   FSTSTAPLFSSVKC-----STSSLET--AASRPNVVTILEERGLLESITSENLRSACSDP  102

Query  554  NLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            N+ PLKVYCGFDPTAESLHLGNLLG+IVLSW
Sbjct  103  NVAPLKVYCGFDPTAESLHLGNLLGIIVLSW  133



>ref|XP_009134703.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Brassica rapa]
Length=520

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 69/91 (76%), Gaps = 7/91 (8%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            F  S++PL SS +      S   +E+     R NVV ILEERGLLES+TSENLRS CSDP
Sbjct  70   FSTSTAPLFSSVKC-----STSSLET--AASRPNVVTILEERGLLESITSENLRSACSDP  122

Query  554  NLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            N+ PLKVYCGFDPTAESLHLGNLLG+IVLSW
Sbjct  123  NVAPLKVYCGFDPTAESLHLGNLLGIIVLSW  153



>ref|XP_008218548.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Prunus 
mume]
 ref|XP_008218549.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Prunus 
mume]
 ref|XP_008218550.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Prunus 
mume]
Length=485

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            R+NVVEILEERGLLES+TSE+LR  CSDP+LPPLKVYCGFDPTAESLHLGNLLG+IVLSW
Sbjct  60   RQNVVEILEERGLLESLTSEHLRQACSDPSLPPLKVYCGFDPTAESLHLGNLLGIIVLSW  119



>ref|XP_007222608.1| hypothetical protein PRUPE_ppa004925mg [Prunus persica]
 gb|EMJ23807.1| hypothetical protein PRUPE_ppa004925mg [Prunus persica]
Length=485

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            R+NVVEILEERGLLES+TSE+LR  CSDP+LPPLKVYCGFDPTAESLHLGNLLG+IVLSW
Sbjct  60   RQNVVEILEERGLLESLTSEHLRQACSDPSLPPLKVYCGFDPTAESLHLGNLLGIIVLSW  119



>ref|XP_009760674.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Nicotiana 
sylvestris]
Length=522

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 69/92 (75%), Gaps = 6/92 (7%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPE-MESDQRQRRRNVVEILEERGLLESVTSENLRSICSD  550
            FCYSS+ L S           PE  ++     R NV++ILEERGLLESVTS++LRS+CSD
Sbjct  51   FCYSSTQLTSQED-----NPRPEKWQNPNSNTRPNVLQILEERGLLESVTSDSLRSVCSD  105

Query  551  PNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
             NL PLKVYCGFDPTAESLHLGNLLG+IVLSW
Sbjct  106  SNLGPLKVYCGFDPTAESLHLGNLLGIIVLSW  137



>ref|NP_186915.1| tyrosyl-tRNA synthetase [Arabidopsis thaliana]
 gb|AAF32473.1| putative tyrosyl-tRNA synthetase [Arabidopsis thaliana]
 dbj|BAD95182.1| putative tyrosyl-tRNA synthetase [Arabidopsis thaliana]
 gb|ABK32110.1| At3g02660 [Arabidopsis thaliana]
 gb|AEE73845.1| tyrosyl-tRNA synthetase [Arabidopsis thaliana]
Length=511

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 62/72 (86%), Gaps = 1/72 (1%)
 Frame = +2

Query  431  SEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlh  610
            S PE E +Q   R NVV+ILEERGLLES+TSENLRS CSDP + PL+VYCGFDPTAESLH
Sbjct  71   SSPETE-NQAVFRPNVVDILEERGLLESITSENLRSACSDPKVAPLRVYCGFDPTAESLH  129

Query  611  lgnllglivlSW  646
            LGNLLG+IVLSW
Sbjct  130  LGNLLGIIVLSW  141



>ref|XP_009591201.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Nicotiana 
tomentosiformis]
Length=522

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 68/92 (74%), Gaps = 6/92 (7%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPE-MESDQRQRRRNVVEILEERGLLESVTSENLRSICSD  550
            FCYSS+ L S           PE  ++     R NV++ILEERGLLESVTS++LRS+CSD
Sbjct  51   FCYSSTQLTSQED-----NPRPEKWQNPNNNTRPNVLQILEERGLLESVTSDSLRSVCSD  105

Query  551  PNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
             N  PLKVYCGFDPTAESLHLGNLLG+IVLSW
Sbjct  106  SNFGPLKVYCGFDPTAESLHLGNLLGIIVLSW  137



>ref|XP_004299915.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Fragaria 
vesca subsp. vesca]
 ref|XP_011464831.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Fragaria 
vesca subsp. vesca]
Length=487

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +2

Query  464  RRRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlS  643
            RR NV++ILEERGLLES+TSE LR  CSDP++PPLKVYCGFDPTAESLHLGNLLGLIVLS
Sbjct  59   RRHNVIDILEERGLLESMTSEQLRHACSDPSVPPLKVYCGFDPTAESLHLGNLLGLIVLS  118

Query  644  W  646
            W
Sbjct  119  W  119



>ref|XP_009348745.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Pyrus x bretschneideri]
Length=486

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            R NVVEILEERGLLES+TSE+LR +CSDP LPPLKVYCGFDPTAESLHLGNL+G++VLSW
Sbjct  62   RPNVVEILEERGLLESLTSEHLRQVCSDPILPPLKVYCGFDPTAESLHLGNLIGIVVLSW  121



>ref|XP_008339494.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Malus domestica]
Length=482

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            R NVVEILEERGLLES+TSE+LR +C+DPNL PLKVYCGFDPTAESLHLGNL+G++VLSW
Sbjct  58   RPNVVEILEERGLLESLTSEHLRQVCTDPNLXPLKVYCGFDPTAESLHLGNLIGIVVLSW  117



>ref|XP_009348746.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009348747.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009348748.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009348749.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
Length=482

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            R NVVEILEERGLLES+TSE+LR +CSDP LPPLKVYCGFDPTAESLHLGNL+G++VLSW
Sbjct  58   RPNVVEILEERGLLESLTSEHLRQVCSDPILPPLKVYCGFDPTAESLHLGNLIGIVVLSW  117



>ref|XP_008339493.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Malus domestica]
Length=486

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            R NVVEILEERGLLES+TSE+LR +C+DPNL PLKVYCGFDPTAESLHLGNL+G++VLSW
Sbjct  62   RPNVVEILEERGLLESLTSEHLRQVCTDPNLXPLKVYCGFDPTAESLHLGNLIGIVVLSW  121



>ref|XP_008361702.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
Length=482

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            R NVVEILEERGLLES+TSE+LR +C+DPNL PLKVYCGFDPTAESLHLGNL+G++ LSW
Sbjct  58   RPNVVEILEERGLLESLTSEHLRQVCTDPNLXPLKVYCGFDPTAESLHLGNLIGIVXLSW  117



>ref|XP_006408394.1| hypothetical protein EUTSA_v10020578mg [Eutrema salsugineum]
 ref|XP_006408395.1| hypothetical protein EUTSA_v10020578mg [Eutrema salsugineum]
 gb|ESQ49847.1| hypothetical protein EUTSA_v10020578mg [Eutrema salsugineum]
 gb|ESQ49848.1| hypothetical protein EUTSA_v10020578mg [Eutrema salsugineum]
Length=499

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 67/91 (74%), Gaps = 10/91 (11%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            F  S++PL SS +   Q              R NVV+ILEERGLLES+TSE+LRS CSDP
Sbjct  52   FSASTTPLLSSVKCSIQ----------STVSRPNVVDILEERGLLESITSESLRSACSDP  101

Query  554  NLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            ++ PLKVYCGFDPTAESLHLGNLLG+IVLSW
Sbjct  102  SVAPLKVYCGFDPTAESLHLGNLLGIIVLSW  132



>ref|XP_009414004.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Musa 
acuminata subsp. malaccensis]
Length=535

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +2

Query  401  SSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYC  580
            SS+Q  P+    P    D   R  NVV+IL+ERGL+ES+TSENLRS CS P   PLKVYC
Sbjct  49   SSSQPAPETLEAPIQGLDSSTRAPNVVDILQERGLIESITSENLRSACSTPAANPLKVYC  108

Query  581  GFDPTAESlhlgnllglivlSW  646
            GFDPTAESLHLGNLLG+IVLSW
Sbjct  109  GFDPTAESLHLGNLLGIIVLSW  130



>ref|XP_010683748.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010683749.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010683750.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010683751.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
Length=498

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 1/64 (2%)
 Frame = +2

Query  458  RQRRRNVVEILEERGLLESVTSENLRSICS-DPNLPPLKVYCGFDPTAESlhlgnllgli  634
            +QR RNVVEILEERGL+ES+TS+NLRS  S D N PPLKVYCGFDPTAESLHLGNL+G+I
Sbjct  68   QQRSRNVVEILEERGLIESITSDNLRSASSLDNNHPPLKVYCGFDPTAESLHLGNLIGII  127

Query  635  vlSW  646
            VLSW
Sbjct  128  VLSW  131



>gb|KJB12925.1| hypothetical protein B456_002G045400 [Gossypium raimondii]
Length=491

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            NVV+ILEERGLLES+T+ENLR +CSD    PLKVYCGFDPTAESLHLGNLLGLIVLSW
Sbjct  61   NVVKILEERGLLESITNENLRLVCSDQTAGPLKVYCGFDPTAESLHLGNLLGLIVLSW  118



>ref|XP_010927782.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Elaeis 
guineensis]
Length=544

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 62/80 (78%), Gaps = 5/80 (6%)
 Frame = +2

Query  422  QLKSEPEMESDQRQRRR-----NVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGF  586
            Q  ++P +E   R         NVV+IL+ERGL+ES+TSE++RS CS+P++ PLKVYCGF
Sbjct  43   QSATQPTLEDSTRNLDSIAGIPNVVDILQERGLVESITSESIRSACSNPSISPLKVYCGF  102

Query  587  DPTAESlhlgnllglivlSW  646
            DPTAESLHLGNLL LIVLSW
Sbjct  103  DPTAESLHLGNLLALIVLSW  122



>ref|XP_008801775.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Phoenix 
dactylifera]
Length=544

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 64/80 (80%), Gaps = 5/80 (6%)
 Frame = +2

Query  422  QLKSEPEMESDQRQRRR-----NVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGF  586
            Q  ++P +E+  R         NVV+IL+ERGL+ES+TSE++RS CS+P++ PLKVYCGF
Sbjct  43   QSAAQPTLEAQARNLDSLAGIPNVVDILQERGLVESITSESIRSACSNPSVSPLKVYCGF  102

Query  587  DPTAESlhlgnllglivlSW  646
            DPTAESLHLGNLLGLIVLSW
Sbjct  103  DPTAESLHLGNLLGLIVLSW  122



>ref|XP_007022035.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
2 [Theobroma cacao]
 gb|EOY13560.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
2 [Theobroma cacao]
Length=486

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            NV++ILEERGLLESVT+ENLR  CSD    PLKVYCGFDPTAESLHLGNLLGLIVLSW
Sbjct  61   NVIKILEERGLLESVTNENLRLACSDQTAGPLKVYCGFDPTAESLHLGNLLGLIVLSW  118



>ref|XP_007022036.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
3 [Theobroma cacao]
 ref|XP_007022037.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
3 [Theobroma cacao]
 gb|EOY13561.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
3 [Theobroma cacao]
 gb|EOY13562.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
3 [Theobroma cacao]
Length=491

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            NV++ILEERGLLESVT+ENLR  CSD    PLKVYCGFDPTAESLHLGNLLGLIVLSW
Sbjct  61   NVIKILEERGLLESVTNENLRLACSDQTAGPLKVYCGFDPTAESLHLGNLLGLIVLSW  118



>ref|XP_007022034.1| Tyrosyl-tRNA synthetase isoform 1 [Theobroma cacao]
 gb|EOY13559.1| Tyrosyl-tRNA synthetase isoform 1 [Theobroma cacao]
Length=542

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            NV++ILEERGLLESVT+ENLR  CSD    PLKVYCGFDPTAESLHLGNLLGLIVLSW
Sbjct  117  NVIKILEERGLLESVTNENLRLACSDQTAGPLKVYCGFDPTAESLHLGNLLGLIVLSW  174



>ref|XP_002512791.1| tyrosyl-tRNA synthetase, putative [Ricinus communis]
 gb|EEF49294.1| tyrosyl-tRNA synthetase, putative [Ricinus communis]
Length=492

 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 55/61 (90%), Gaps = 3/61 (5%)
 Frame = +2

Query  464  RRRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlS  643
            RR+NVV+ILEERGLLESVTS+NLRS CS   +  LKVYCGFDPTAESLHLGNL+G+IVLS
Sbjct  63   RRQNVVDILEERGLLESVTSDNLRSACS---ISTLKVYCGFDPTAESLHLGNLIGIIVLS  119

Query  644  W  646
            W
Sbjct  120  W  120



>emb|CDP19091.1| unnamed protein product [Coffea canephora]
Length=525

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 55/60 (92%), Gaps = 2/60 (3%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSD--PNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            NVVEILE+RGLLES+TS+ LRS+CS   PN PPL+VYCGFDPTA+SLHLGNLLG+IVLSW
Sbjct  96   NVVEILEQRGLLESLTSDGLRSVCSSSAPNQPPLRVYCGFDPTADSLHLGNLLGIIVLSW  155



>ref|XP_008783116.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Phoenix 
dactylifera]
 ref|XP_008783117.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Phoenix 
dactylifera]
Length=543

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 49/66 (74%), Gaps = 5/66 (8%)
 Frame = +2

Query  422  QLKSEPEMESDQRQRR-----RNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGF  586
            Q  ++P +E+  R         NVV+IL+ERGL+ES+TSE++RS CS+P + PLKVYCGF
Sbjct  42   QSAAQPTLEAQARNLDSPSGIANVVDILQERGLVESITSESIRSACSNPIVSPLKVYCGF  101

Query  587  DPTAES  604
            DPTAES
Sbjct  102  DPTAES  107



>gb|KDO63480.1| hypothetical protein CISIN_1g037749mg [Citrus sinensis]
Length=495

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 66/87 (76%), Gaps = 3/87 (3%)
 Frame = +2

Query  386  SSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPP  565
            +S   SS   + QL+S+P+ ++    R  NVV+ILE RGLLES+TS+NLRS+ S  N   
Sbjct  45   NSAFFSSISCVHQLQSDPQTQT--HGRHPNVVDILERRGLLESITSDNLRSLAS-SNEKT  101

Query  566  LKVYCGFDPTAESlhlgnllglivlSW  646
            LKVYCGFDPTAESLHLGNLLG+IVLSW
Sbjct  102  LKVYCGFDPTAESLHLGNLLGIIVLSW  128



>ref|XP_006468947.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Citrus sinensis]
Length=493

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 66/87 (76%), Gaps = 3/87 (3%)
 Frame = +2

Query  386  SSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPP  565
            +S   SS   + QL+S+P+ ++    R  NVV+ILE RGLLES+TS+NLRS+ S  N   
Sbjct  43   NSAFFSSISCVHQLQSDPQTQT--HGRHPNVVDILERRGLLESITSDNLRSLAS-SNEKT  99

Query  566  LKVYCGFDPTAESlhlgnllglivlSW  646
            LKVYCGFDPTAESLHLGNLLG+IVLSW
Sbjct  100  LKVYCGFDPTAESLHLGNLLGIIVLSW  126



>ref|XP_006446866.1| hypothetical protein CICLE_v10015023mg [Citrus clementina]
 gb|ESR60106.1| hypothetical protein CICLE_v10015023mg [Citrus clementina]
Length=493

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 64/87 (74%), Gaps = 3/87 (3%)
 Frame = +2

Query  386  SSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPP  565
            +S   SS   + QL+S+P+ ++    R  NVV+  E RGLLES+TS+NLRS+ S  N   
Sbjct  43   NSAFFSSISCVQQLQSDPQTQT--HGRHPNVVDTFERRGLLESITSDNLRSLAS-SNEKT  99

Query  566  LKVYCGFDPTAESlhlgnllglivlSW  646
            LKVYCGFDPTAESLHLGNLLG+IVLSW
Sbjct  100  LKVYCGFDPTAESLHLGNLLGIIVLSW  126



>gb|EYU42284.1| hypothetical protein MIMGU_mgv1a005712mg [Erythranthe guttata]
Length=473

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 50/59 (85%), Gaps = 4/59 (7%)
 Frame = +2

Query  470  RNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            RNVVEILEERGLLES+T + LR     PN PPL+VYCGFDPTAESLHLGNLL LIVLSW
Sbjct  44   RNVVEILEERGLLESLTGDALRR----PNHPPLRVYCGFDPTAESLHLGNLLALIVLSW  98



>gb|KCW55733.1| hypothetical protein EUGRSUZ_I01565, partial [Eucalyptus grandis]
Length=479

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 52/58 (90%), Gaps = 2/58 (3%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            NVV++LEERGLLESVTSENLRS CS  +   L+VYCGFDPTAESLHLGNLLG+IVLSW
Sbjct  48   NVVDVLEERGLLESVTSENLRSACSSGS--GLRVYCGFDPTAESLHLGNLLGIIVLSW  103



>gb|KEH34424.1| tyrosyl-tRNA synthetase [Medicago truncatula]
Length=500

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +2

Query  470  RNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            RNV+ ILEERGLL+S+T+++LRSI S+    PLKVYCGFDPTAESLHLGNLLGLIVLSW
Sbjct  59   RNVIRILEERGLLDSLTNDSLRSISSNTINAPLKVYCGFDPTAESLHLGNLLGLIVLSW  117



>ref|XP_010028900.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Eucalyptus 
grandis]
Length=506

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 52/58 (90%), Gaps = 2/58 (3%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            NVV++LEERGLLESVTSENLRS CS  +   L+VYCGFDPTAESLHLGNLLG+IVLSW
Sbjct  75   NVVDVLEERGLLESVTSENLRSACSSGS--GLRVYCGFDPTAESLHLGNLLGIIVLSW  130



>ref|XP_003544330.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Glycine max]
Length=490

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 51/58 (88%), Gaps = 2/58 (3%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            NV+ ILEERGL+ES+TS+ LRS C  P  PPLKVYCGFDPTAESLHLGNLLGLIVLSW
Sbjct  59   NVIGILEERGLVESITSDALRSACLTP--PPLKVYCGFDPTAESLHLGNLLGLIVLSW  114



>ref|XP_004500343.1| PREDICTED: tyrosine--tRNA ligase-like [Cicer arietinum]
Length=501

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +2

Query  470  RNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            R+VV ILEERGLL+S+T++ LRSI S+    PLKVYCGFDPTAESLHLGNLLGLIVLSW
Sbjct  58   RSVVGILEERGLLDSITNDTLRSISSNTINAPLKVYCGFDPTAESLHLGNLLGLIVLSW  116



>ref|XP_003519285.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Glycine max]
Length=496

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 52/64 (81%), Gaps = 2/64 (3%)
 Frame = +2

Query  455  QRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllgli  634
            +R    NV+ ILEERGL+ES+TS+ LRS C  P   PLKVYCGFDPTAESLHLGNLLGLI
Sbjct  51   RRNNNYNVIGILEERGLVESITSDALRSACLTP--APLKVYCGFDPTAESLHLGNLLGLI  108

Query  635  vlSW  646
            VLSW
Sbjct  109  VLSW  112



>gb|KDP41896.1| hypothetical protein JCGZ_26914 [Jatropha curcas]
Length=509

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 53/61 (87%), Gaps = 2/61 (3%)
 Frame = +2

Query  464  RRRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlS  643
            R  NVV+ILEERGLLES+TS+NLRSI S  N   ++VYCGFDPTAESLHLGNLLG+IVLS
Sbjct  79   RHPNVVDILEERGLLESLTSDNLRSISSTSN--NVRVYCGFDPTAESLHLGNLLGIIVLS  136

Query  644  W  646
            W
Sbjct  137  W  137



>ref|XP_007142062.1| hypothetical protein PHAVU_008G249300g [Phaseolus vulgaris]
 gb|ESW14056.1| hypothetical protein PHAVU_008G249300g [Phaseolus vulgaris]
Length=478

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 54/64 (84%), Gaps = 4/64 (6%)
 Frame = +2

Query  455  QRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllgli  634
            Q+Q  RNV+EILEERGL+ES+TS+ LR+ CS      +KVYCGFDPTAESLHLGNLLG+I
Sbjct  46   QQQPLRNVIEILEERGLVESITSDALRAACS----SSVKVYCGFDPTAESLHLGNLLGII  101

Query  635  vlSW  646
            VLSW
Sbjct  102  VLSW  105



>gb|KHN08832.1| Tyrosine--tRNA ligase [Glycine soja]
Length=482

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 56/69 (81%), Gaps = 7/69 (10%)
 Frame = +2

Query  455  QRQRRRN-----VVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgn  619
            Q+Q RRN     V+ ILEERGL+ES+TS+ LRS C  P  PPLKVYCGFDPTAESLHLGN
Sbjct  45   QQQPRRNNNNNNVIGILEERGLVESITSDALRSACLTP--PPLKVYCGFDPTAESLHLGN  102

Query  620  llglivlSW  646
            LLGLIVLSW
Sbjct  103  LLGLIVLSW  111



>gb|KEH32330.1| tyrosyl-tRNA synthetase [Medicago truncatula]
Length=482

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +2

Query  455  QRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllgli  634
            Q Q+  NV+ ILE+RGLL+S+T+E+LR+I S+    PLKVYCGFDPTA+SLHLGNLL LI
Sbjct  43   QHQQPPNVIGILEQRGLLDSITNESLRTISSNTINAPLKVYCGFDPTAQSLHLGNLLALI  102

Query  635  vlSW  646
            VLSW
Sbjct  103  VLSW  106



>gb|EYU24457.1| hypothetical protein MIMGU_mgv1a005745mg [Erythranthe guttata]
Length=472

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 49/59 (83%), Gaps = 4/59 (7%)
 Frame = +2

Query  470  RNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            RNVVEILEERGLLES+T + LR      N PPL+VYCGFDPTAESLHLGNLL LIVLSW
Sbjct  44   RNVVEILEERGLLESLTGDALRR----QNHPPLRVYCGFDPTAESLHLGNLLALIVLSW  98



>ref|XP_001751567.1| predicted protein [Physcomitrella patens]
 gb|EDQ83884.1| predicted protein [Physcomitrella patens]
Length=502

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 50/59 (85%), Gaps = 3/59 (5%)
 Frame = +2

Query  470  RNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            RNVVE+LEERGL+ESVTSE L++ C       LKVYCGFDPTAESLHLGNLLG+IVLSW
Sbjct  78   RNVVEVLEERGLIESVTSEELKATCMKQR---LKVYCGFDPTAESLHLGNLLGIIVLSW  133



>ref|XP_011071261.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Sesamum 
indicum]
Length=503

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 52/60 (87%), Gaps = 2/60 (3%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            RRNVV ILEERGLL+S+TS+ LR    D  LPPL+VYCGFDPTA+SLHLGNLLG+IVLSW
Sbjct  42   RRNVVHILEERGLLDSLTSDALRR--PDLPLPPLRVYCGFDPTAQSLHLGNLLGIIVLSW  99



>ref|XP_002980036.1| hypothetical protein SELMODRAFT_111886 [Selaginella moellendorffii]
 gb|EFJ18906.1| hypothetical protein SELMODRAFT_111886 [Selaginella moellendorffii]
Length=467

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 3/46 (7%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAES  604
            RRNVVEILE+RGL+ES+  E+L+  C +    P+KVYCGFDPTAES
Sbjct  49   RRNVVEILEQRGLVESIAGESLKKACDE---KPIKVYCGFDPTAES  91



>ref|XP_002992920.1| hypothetical protein SELMODRAFT_136175 [Selaginella moellendorffii]
 gb|EFJ06009.1| hypothetical protein SELMODRAFT_136175 [Selaginella moellendorffii]
Length=467

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 3/46 (7%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAES  604
            RRNVVEILE+RGL+ES+  E+L+  C +    P+KVYCGFDPTAES
Sbjct  49   RRNVVEILEQRGLVESIAGESLKKACDE---KPIKVYCGFDPTAES  91



>ref|XP_011033705.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Populus euphratica]
Length=502

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 53/65 (82%), Gaps = 3/65 (5%)
 Frame = +2

Query  452  DQRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllgl  631
            D  + R +VV+ILEERGLLES+TS+NLRSI +      LK YCGFDPTAESLHLGNLLG+
Sbjct  59   DPMRSRSSVVDILEERGLLESITSDNLRSISTT---STLKAYCGFDPTAESLHLGNLLGI  115

Query  632  ivlSW  646
            IVLSW
Sbjct  116  IVLSW  120



>ref|XP_008453844.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Cucumis 
melo]
Length=493

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 52/58 (90%), Gaps = 4/58 (7%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            NV++ILE+RGLL+S+TS+NLRS     +L PLKVYCGFDPTA+SLHLGNLLGLIVLSW
Sbjct  67   NVIQILEQRGLLDSITSDNLRS----ASLSPLKVYCGFDPTAQSLHLGNLLGLIVLSW  120



>ref|XP_004166614.1| PREDICTED: tyrosine--tRNA ligase-like [Cucumis sativus]
Length=493

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 52/58 (90%), Gaps = 4/58 (7%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            NV++ILE+RGLL+S+TS+NLRS     +L PLKVYCGFDPTA+SLHLGNLLGLIVLSW
Sbjct  67   NVIQILEQRGLLDSITSDNLRS----ASLSPLKVYCGFDPTAQSLHLGNLLGLIVLSW  120



>ref|XP_004146892.1| PREDICTED: tyrosine--tRNA ligase-like [Cucumis sativus]
 gb|KGN53185.1| hypothetical protein Csa_4G025150 [Cucumis sativus]
Length=493

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 52/58 (90%), Gaps = 4/58 (7%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            NV++ILE+RGLL+S+TS+NLRS     +L PLKVYCGFDPTA+SLHLGNLLGLIVLSW
Sbjct  67   NVIQILEQRGLLDSITSDNLRS----ASLSPLKVYCGFDPTAQSLHLGNLLGLIVLSW  120



>ref|WP_006340872.1| tyrosyl-tRNA synthetase [Parachlamydia acanthamoebae]
 gb|EFB41848.1| hypothetical protein pah_c022o146 [Parachlamydia acanthamoebae 
str. Hall's coccus]
 emb|CCB86267.1| tyrosyl-tRNA synthetase [Parachlamydia acanthamoebae UV-7]
Length=430

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 48/59 (81%), Gaps = 4/59 (7%)
 Frame = +2

Query  470  RNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            +NV++IL+ERG +E++TS NL+ I S     PLKVYCGFDPTAESLHLGN++ ++ L+W
Sbjct  2    QNVIDILQERGFIEAMTSNNLKEITS----TPLKVYCGFDPTAESLHLGNMVAIMGLAW  56



>ref|WP_039376683.1| tyrosyl-tRNA synthetase [Parachlamydia acanthamoebae]
 gb|KIA77993.1| Tyrosine--tRNA ligase [Parachlamydia acanthamoebae]
Length=437

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 48/59 (81%), Gaps = 4/59 (7%)
 Frame = +2

Query  470  RNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            +NV++IL+ERG +E++TS NL+ I S     PLKVYCGFDPTAESLHLGN++ ++ L+W
Sbjct  2    QNVIDILQERGFIEAMTSNNLKEITS----TPLKVYCGFDPTAESLHLGNMVAIMGLAW  56



>ref|NP_001043131.1| Os01g0500900 [Oryza sativa Japonica Group]
 dbj|BAB64064.1| putative tyrosine-tRNA ligase [Oryza sativa Japonica Group]
 dbj|BAF05045.1| Os01g0500900 [Oryza sativa Japonica Group]
 gb|EAY74203.1| hypothetical protein OsI_02083 [Oryza sativa Indica Group]
 dbj|BAG90095.1| unnamed protein product [Oryza sativa Japonica Group]
Length=497

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 49/60 (82%), Gaps = 2/60 (3%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            RR+VVE+L ERGL+E+ TSE+L S  + P    LK YCGFDPTAESLHLGNLLGL+VLSW
Sbjct  46   RRSVVEVLRERGLVEATTSESLGSASASPR--ELKAYCGFDPTAESLHLGNLLGLVVLSW  103



>ref|XP_006826574.1| hypothetical protein AMTR_s00138p00020780 [Amborella trichopoda]
 gb|ERM93811.1| hypothetical protein AMTR_s00138p00020780 [Amborella trichopoda]
Length=495

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +2

Query  449  SDQRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllg  628
            + + Q  +NV+++LE+RGL++S+TS++L+S  S+PN  PLKVYCGFDPTAESLHLGNLLG
Sbjct  53   ASKAQNCKNVIQVLEDRGLVDSITSQDLKSASSNPNSSPLKVYCGFDPTAESLHLGNLLG  112

Query  629  livlSW  646
            LIVLSW
Sbjct  113  LIVLSW  118



>gb|EAZ12037.1| hypothetical protein OsJ_01916 [Oryza sativa Japonica Group]
Length=545

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 49/60 (82%), Gaps = 2/60 (3%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            RR+VVE+L ERGL+E+ TSE+L S  + P    LK YCGFDPTAESLHLGNLLGL+VLSW
Sbjct  46   RRSVVEVLRERGLVEATTSESLGSASASPR--ELKAYCGFDPTAESLHLGNLLGLVVLSW  103


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 44/56 (79%), Gaps = 2/56 (4%)
 Frame = +2

Query  479  VEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            V +L ERGL+E+ TSE+L S  + P    LK YCGFDPTAESLHLGNLLGL+VLSW
Sbjct  122  VSVLRERGLVEATTSESLGSASASPR--ELKAYCGFDPTAESLHLGNLLGLVVLSW  175



>emb|CAN64191.1| hypothetical protein VITISV_016956 [Vitis vinifera]
Length=868

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 35/46 (76%), Gaps = 3/46 (7%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAES  604
            R NV+EILE+RGL++S+TS  LR+  S      LKVYCGFDPTAES
Sbjct  58   RSNVIEILEQRGLVDSITSPILRASSSTQT---LKVYCGFDPTAES  100



>emb|CBI22389.3| unnamed protein product [Vitis vinifera]
Length=399

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 49/60 (82%), Gaps = 3/60 (5%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            R NV+EILE+RGL++S+TS  LR+  S      LKVYCGFDPTAESLHLGNLLGLIVLSW
Sbjct  58   RSNVIEILEQRGLVDSITSPILRASSSTQT---LKVYCGFDPTAESLHLGNLLGLIVLSW  114



>ref|XP_002265238.2| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Vitis 
vinifera]
Length=485

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 49/60 (82%), Gaps = 3/60 (5%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            R NV+EILE+RGL++S+TS  LR+  S      LKVYCGFDPTAESLHLGNLLGLIVLSW
Sbjct  58   RSNVIEILEQRGLVDSITSPILRASSSTQT---LKVYCGFDPTAESLHLGNLLGLIVLSW  114



>gb|EPS58486.1| hypothetical protein M569_16327, partial [Genlisea aurea]
Length=428

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 49/60 (82%), Gaps = 4/60 (7%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            R NVVEIL++RGL+ES+T++      S  NL  ++VYCGFDPTAESLHLGNL+GLIVLSW
Sbjct  6    RLNVVEILQQRGLVESITAD----AGSLSNLSAVRVYCGFDPTAESLHLGNLVGLIVLSW  61



>gb|EMT07165.1| Tyrosyl-tRNA synthetase [Aegilops tauschii]
Length=512

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +2

Query  458  RQRRRNVVEILEERGLLESVTSENLRSICS-DPNLPPLKVYCGFDPTAESlhlgnllgli  634
            R  RR VV++L ERGL+E+ TSE L S  +       LKVYCGFDPTAESLHLGNLLGL+
Sbjct  44   RTVRRGVVDVLRERGLVEATTSEALGSSSAVSGEQQQLKVYCGFDPTAESLHLGNLLGLV  103

Query  635  vlSW  646
             LSW
Sbjct  104  ALSW  107



>ref|XP_006645923.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Oryza brachyantha]
Length=485

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 2/59 (3%)
 Frame = +2

Query  470  RNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            R+VV++L ERGL+E+ TSE L S  + P    LK YCGFDPTAESLHLGNLLGL+ LSW
Sbjct  34   RSVVDVLRERGLVEATTSETLGSGSASPR--ELKAYCGFDPTAESLHLGNLLGLVALSW  90



>gb|KIY99495.1| tyrosyl-tRNA synthetase [Monoraphidium neglectum]
Length=216

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 49/63 (78%), Gaps = 3/63 (5%)
 Frame = +2

Query  458  RQRRRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllgliv  637
            R    NVV+IL ERGL++ VTSE+L S+ +  +   L VYCGFDPTA+SLHLGNLLG+IV
Sbjct  25   RGATANVVQILRERGLVQEVTSEDLESLAAQTS---LSVYCGFDPTADSLHLGNLLGIIV  81

Query  638  lSW  646
            L+W
Sbjct  82   LAW  84



>ref|WP_042279297.1| tyrosyl-tRNA synthetase [Candidatus Protochlamydia sp. R18]
Length=425

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 46/58 (79%), Gaps = 4/58 (7%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            NV+++L ERG +++VTSE +R + +     P+KVYCGFDPTA+SLHLGNL+ ++ L+W
Sbjct  3    NVIDVLRERGFIDAVTSEEIRQLTN----QPIKVYCGFDPTADSLHLGNLVAIMGLAW  56



>ref|WP_039359281.1| tyrosyl-tRNA synthetase [Candidatus Protochlamydia amoebophila]
Length=425

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 46/58 (79%), Gaps = 4/58 (7%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            NV+++L ERG +++VTSE +R + +     P+KVYCGFDPTA+SLHLGNL+ ++ L+W
Sbjct  3    NVIDVLRERGFIDAVTSEEIRQLTN----QPIKVYCGFDPTADSLHLGNLVAIMGLAW  56



>gb|KIC71389.1| Tyrosine--tRNA ligase [Candidatus Protochlamydia amoebophila]
Length=437

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 46/58 (79%), Gaps = 4/58 (7%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            NV+++L ERG +++VTSE +R + +     P+KVYCGFDPTA+SLHLGNL+ ++ L+W
Sbjct  15   NVIDVLRERGFIDAVTSEEIRQLTN----QPIKVYCGFDPTADSLHLGNLVAIMGLAW  68



>ref|WP_011175719.1| tyrosyl-tRNA synthetase [Candidatus Protochlamydia amoebophila]
 sp|Q6MC06.1|SYY_PARUW RecName: Full=Tyrosine--tRNA ligase; AltName: Full=Tyrosyl-tRNA 
synthetase; Short=TyrRS [Candidatus Protochlamydia amoebophila 
UWE25]
 emb|CAF23893.1| probable tyrosine-tRNA ligase [Candidatus Protochlamydia amoebophila 
UWE25]
Length=425

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 46/58 (79%), Gaps = 4/58 (7%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            NV+++L ERG +++VTSE +R + +     P+KVYCGFDPTA+SLHLGNL+ ++ L+W
Sbjct  3    NVMDVLRERGFIDAVTSEEIRQLTN----QPIKVYCGFDPTADSLHLGNLVAIMGLAW  56



>ref|XP_010229641.1| PREDICTED: LOW QUALITY PROTEIN: probable tyrosine--tRNA ligase, 
mitochondrial [Brachypodium distachyon]
Length=473

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 46/61 (75%), Gaps = 1/61 (2%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSI-CSDPNLPPLKVYCGFDPTAESlhlgnllglivlS  643
            RR+VV++L ERGL+E+ TSE L S   +      LK YCGFDPTAESLHLGNLLGL+ LS
Sbjct  50   RRSVVDVLRERGLVEATTSEALGSSPSAGGQQQQLKAYCGFDPTAESLHLGNLLGLVALS  109

Query  644  W  646
            W
Sbjct  110  W  110



>ref|XP_003574045.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brachypodium 
distachyon]
Length=512

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 46/61 (75%), Gaps = 1/61 (2%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSI-CSDPNLPPLKVYCGFDPTAESlhlgnllglivlS  643
            RR+VV++L ERGL+E+ TSE L S   +      LK YCGFDPTAESLHLGNLLGL+ LS
Sbjct  50   RRSVVDVLRERGLVEATTSEALGSSPSAGGQQQQLKAYCGFDPTAESLHLGNLLGLVALS  109

Query  644  W  646
            W
Sbjct  110  W  110



>gb|EMS54027.1| Tyrosyl-tRNA synthetase [Triticum urartu]
Length=796

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENL-RSICSDPNLPPLKVYCGFDPTAES  604
            RR VV++L ERGL+E+ TSE L  S  +      LKVYCGFDPTAES
Sbjct  331  RRGVVDVLRERGLVEATTSEALGSSSAASGEQQKLKVYCGFDPTAES  377



>ref|XP_005650588.1| tyrosyl-tRNA synthetase [Coccomyxa subellipsoidea C-169]
 gb|EIE26044.1| tyrosyl-tRNA synthetase [Coccomyxa subellipsoidea C-169]
Length=450

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 51/71 (72%), Gaps = 5/71 (7%)
 Frame = +2

Query  434  EPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhl  613
            EPE E   +Q +  +VE+L  RGL++ +TS +L  + +  NL    VYCGFDPTAESLHL
Sbjct  10   EPEKEQGAQQLK--IVEVLRSRGLVQDITSPSLEKVAATENLT---VYCGFDPTAESLHL  64

Query  614  gnllglivlSW  646
            GNLLG+IVL+W
Sbjct  65   GNLLGIIVLTW  75



>ref|WP_032125960.1| tyrosyl-tRNA synthetase [Chlamydia sp. 'Diamant']
Length=424

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 44/58 (76%), Gaps = 4/58 (7%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
             ++++L ERG +++VTSE +R +       P+KVYCGFDPTA+SLHLGNL+ ++ L+W
Sbjct  3    TIIDVLRERGFIDAVTSEEIRQLTQ----QPVKVYCGFDPTADSLHLGNLVAIMGLAW  56



>ref|XP_004993733.1| tyrosyl-tRNA synthetase [Salpingoeca rosetta]
 gb|EGD73451.1| tyrosyl-tRNA synthetase [Salpingoeca rosetta]
Length=459

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 36/60 (60%), Gaps = 6/60 (10%)
 Frame = +2

Query  425  LKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAES  604
            L+  P  + DQR   R  V  LEERGLL+  TS+ LR++C    L    VYCGFDPTA +
Sbjct  2    LQGMPMQQLDQR---RPFVGTLEERGLLKDSTSDELRTLCEKEQLT---VYCGFDPTART  55



>ref|WP_042103652.1| tyrosyl-tRNA synthetase [Parachlamydiaceae bacterium HS-T3]
Length=420

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 44/59 (75%), Gaps = 4/59 (7%)
 Frame = +2

Query  470  RNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            +NVV+IL+ERG +++ TS+ +  +       P++VYCGFDPTA+SLHLGN + ++ L+W
Sbjct  2    KNVVKILKERGFIDATTSDEIEQLVE----KPIRVYCGFDPTADSLHLGNFVAIMGLAW  56



>ref|XP_004982893.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Setaria italica]
Length=494

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 45/58 (78%), Gaps = 4/58 (7%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
             VV++L ERGL+E+ TSE L +  + P    LKVYCGFDPTAESLHLGNLLGL+ LSW
Sbjct  49   GVVDVLRERGLVEATTSEALAA--ARPG--ELKVYCGFDPTAESLHLGNLLGLVALSW  102



>ref|XP_002504529.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65787.1| predicted protein [Micromonas sp. RCC299]
Length=506

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSEN-LRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlS  643
            + +VV++L+ERGLL++ T+E+ LR  C++ +L    VYCGFDPTA+SLHLGNLLG++VL+
Sbjct  76   KADVVDVLKERGLLDACTNEDELRKACAEGSLS---VYCGFDPTADSLHLGNLLGIVVLA  132

Query  644  W  646
            W
Sbjct  133  W  133



>ref|XP_005538192.1| tyrosine--tRNA ligase, mitochondrial or chloroplast [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM82156.1| tyrosine--tRNA ligase, mitochondrial or chloroplast [Cyanidioschyzon 
merolae strain 10D]
Length=522

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 34/44 (77%), Gaps = 4/44 (9%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAES  604
            NV+++LE RGL+++VTS ++ ++C+     P+ VY GFDPTA+S
Sbjct  85   NVIQVLESRGLIDAVTSTDVYAVCAR----PVAVYVGFDPTADS  124



>ref|XP_007509051.1| tyrosyl-tRNA synthetase [Bathycoccus prasinos]
 emb|CCO19508.1| tyrosyl-tRNA synthetase [Bathycoccus prasinos]
Length=486

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 45/58 (78%), Gaps = 3/58 (5%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            NV+ IL ERGLL++ TSE      S+    P++VYCGFDPTA+SLHLGNLLG++VLSW
Sbjct  63   NVLNILRERGLLDACTSE---GSLSEATQKPVRVYCGFDPTADSLHLGNLLGIVVLSW  117



>ref|NP_001141566.1| hypothetical protein [Zea mays]
 gb|ACF86629.1| unknown [Zea mays]
 tpg|DAA37471.1| TPA: hypothetical protein ZEAMMB73_107188 [Zea mays]
Length=496

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 46/58 (79%), Gaps = 4/58 (7%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
             VV++L +RGL+E++TSE L +  + P    LKVYCGFDPTAESLHLGNLLGL+ LSW
Sbjct  52   GVVDVLMKRGLVEAITSEALAA--ARPG--ELKVYCGFDPTAESLHLGNLLGLVALSW  105



>ref|XP_010110726.1| Tyrosine--tRNA ligase [Morus notabilis]
 gb|EXC27891.1| Tyrosine--tRNA ligase [Morus notabilis]
Length=481

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 42/53 (79%), Gaps = 5/53 (9%)
 Frame = +2

Query  488  LEERGLLESVTSENLRSICSDPNLPPLKVYCGFDPTAESlhlgnllglivlSW  646
            LE+RGLL+S+TS+NLR+  S     PL  YCGFDPTA SLHLGNLL LIVLSW
Sbjct  69   LEQRGLLDSLTSDNLRTTSS-----PLTAYCGFDPTAPSLHLGNLLALIVLSW  116



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 974366829000