BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF041A09

Length=651
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFV46216.1|  hypothetical protein                                    355   4e-121   Scutellaria baicalensis [Baikal skullcap]
gb|KDO72893.1|  hypothetical protein CISIN_1g036208mg                   353   1e-119   Citrus sinensis [apfelsine]
ref|XP_008656365.1|  PREDICTED: probable mediator of RNA polymera...    358   2e-116   
ref|XP_009784009.1|  PREDICTED: heat shock cognate 70 kDa protein       357   4e-116   Nicotiana sylvestris
ref|XP_007016460.1|  Heat shock cognate protein 70-1                    357   5e-116   
ref|XP_011091460.1|  PREDICTED: heat shock cognate 70 kDa protein...    356   1e-115   Sesamum indicum [beniseed]
ref|XP_009604213.1|  PREDICTED: heat shock cognate 70 kDa protein       356   1e-115   Nicotiana tomentosiformis
ref|XP_008458892.1|  PREDICTED: heat shock cognate 70 kDa protein       355   2e-115   Cucumis melo [Oriental melon]
ref|XP_010534306.1|  PREDICTED: probable mediator of RNA polymera...    355   2e-115   Tarenaya hassleriana [spider flower]
ref|XP_006424799.1|  hypothetical protein CICLE_v10027981mg             355   2e-115   Citrus clementina [clementine]
ref|XP_006488297.1|  PREDICTED: heat shock cognate 70 kDa protein...    355   3e-115   Citrus sinensis [apfelsine]
ref|XP_006349004.1|  PREDICTED: heat shock cognate 70 kDa protein...    354   5e-115   Solanum tuberosum [potatoes]
gb|KDP44987.1|  hypothetical protein JCGZ_01487                         354   5e-115   Jatropha curcas
ref|XP_006349005.1|  PREDICTED: heat shock cognate 70 kDa protein...    354   5e-115   Solanum tuberosum [potatoes]
ref|XP_009606077.1|  PREDICTED: heat shock cognate 70 kDa protein...    354   5e-115   Nicotiana tomentosiformis
ref|XP_004250959.1|  PREDICTED: heat shock cognate 70 kDa protein       354   6e-115   Solanum lycopersicum
gb|AAB42159.1|  Hsc70                                                   353   9e-115   Solanum lycopersicum
ref|XP_010319122.1|  PREDICTED: heat shock protein 70 isoform 3 i...    353   1e-114   Solanum lycopersicum
ref|NP_001266213.1|  heat shock protein 70 isoform 3                    353   1e-114   Solanum lycopersicum
ref|XP_008776656.1|  PREDICTED: heat shock cognate 70 kDa protein...    353   2e-114   Phoenix dactylifera
ref|XP_006349514.1|  PREDICTED: heat shock cognate 70 kDa protein...    352   2e-114   Solanum tuberosum [potatoes]
ref|XP_004961848.1|  PREDICTED: probable mediator of RNA polymera...    352   2e-114   Setaria italica
ref|XP_002441219.1|  hypothetical protein SORBIDRAFT_09g022580          352   2e-114   Sorghum bicolor [broomcorn]
ref|XP_007132076.1|  hypothetical protein PHAVU_011G065000g             352   2e-114   Phaseolus vulgaris [French bean]
ref|XP_004142749.1|  PREDICTED: heat shock cognate 70 kDa protein...    352   2e-114   Cucumis sativus [cucumbers]
emb|CDP09040.1|  unnamed protein product                                352   2e-114   Coffea canephora [robusta coffee]
ref|XP_009407484.1|  PREDICTED: probable mediator of RNA polymera...    352   3e-114   
ref|XP_010685795.1|  PREDICTED: heat shock cognate 70 kDa protein 2     352   3e-114   Beta vulgaris subsp. vulgaris [field beet]
gb|EAY98319.1|  hypothetical protein OsI_20227                          344   4e-114   Oryza sativa Indica Group [Indian rice]
ref|XP_008802761.1|  PREDICTED: heat shock cognate 70 kDa protein...    352   4e-114   Phoenix dactylifera
ref|XP_010095022.1|  Heat shock 70 kDa protein 4                        352   4e-114   Morus notabilis
ref|XP_009778799.1|  PREDICTED: heat shock cognate 70 kDa protein...    352   5e-114   Nicotiana sylvestris
ref|XP_009419750.1|  PREDICTED: heat shock cognate 70 kDa protein...    352   5e-114   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007027053.1|  Heat shock cognate protein 70-1 isoform 2          345   6e-114   
ref|XP_010253827.1|  PREDICTED: heat shock cognate 70 kDa protein...    350   6e-114   Nelumbo nucifera [Indian lotus]
ref|XP_010937646.1|  PREDICTED: heat shock cognate 70 kDa protein...    351   7e-114   Elaeis guineensis
ref|XP_009380663.1|  PREDICTED: heat shock cognate 70 kDa protein...    351   7e-114   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS60056.1|  heat shock protein 70                                   351   7e-114   Genlisea aurea
ref|XP_011027580.1|  PREDICTED: heat shock cognate 70 kDa protein...    351   8e-114   Populus euphratica
ref|XP_002311161.1|  heat shock protein 70                              351   9e-114   Populus trichocarpa [western balsam poplar]
gb|EYU33210.1|  hypothetical protein MIMGU_mgv1a002616mg                351   9e-114   Erythranthe guttata [common monkey flower]
ref|XP_006365705.1|  PREDICTED: heat shock cognate 70 kDa protein...    351   9e-114   Solanum tuberosum [potatoes]
sp|P09189.1|HSP7C_PETHY  RecName: Full=Heat shock cognate 70 kDa ...    350   1e-113   Petunia x hybrida [garden petunia]
ref|XP_009592776.1|  PREDICTED: heat shock cognate 70 kDa protein...    350   1e-113   Nicotiana tomentosiformis
gb|KFK38606.1|  hypothetical protein AALP_AA3G135800                    341   1e-113   Arabis alpina [alpine rockcress]
gb|EYU41710.1|  hypothetical protein MIMGU_mgv1a022248mg                341   2e-113   Erythranthe guttata [common monkey flower]
ref|XP_004249574.1|  PREDICTED: heat shock cognate 70 kDa protein 2     350   2e-113   
ref|XP_004287404.1|  PREDICTED: heat shock cognate 70 kDa protein...    350   2e-113   Fragaria vesca subsp. vesca
gb|AAS57912.1|  70 kDa heat shock cognate protein 1                     350   2e-113   Vigna radiata [mung bean]
ref|XP_008674843.1|  PREDICTED: heat shock 70 kDa protein-like          350   2e-113   Zea mays [maize]
emb|CCA29120.1|  heat shock protein 70 isoform 1                        350   2e-113   Solanum lycopersicum
ref|XP_002316294.1|  heat shock protein 70                              350   2e-113   Populus trichocarpa [western balsam poplar]
gb|EAY81899.1|  hypothetical protein OsI_37065                          343   3e-113   Oryza sativa Indica Group [Indian rice]
ref|XP_006350760.1|  PREDICTED: heat shock cognate 70 kDa protein...    350   3e-113   Solanum tuberosum [potatoes]
gb|ACJ11745.1|  heat shock protein 70                                   349   3e-113   Gossypium hirsutum [American cotton]
ref|XP_008370710.1|  PREDICTED: heat shock cognate 70 kDa protein 2     349   3e-113   
ref|XP_010558794.1|  PREDICTED: probable mediator of RNA polymera...    349   3e-113   Tarenaya hassleriana [spider flower]
gb|EEC71767.1|  hypothetical protein OsI_04375                          342   4e-113   Oryza sativa Indica Group [Indian rice]
gb|EMT11425.1|  Heat shock cognate 70 kDa protein 1                     349   4e-113   
emb|CDY50531.1|  BnaA01g30490D                                          349   4e-113   Brassica napus [oilseed rape]
ref|XP_010253221.1|  PREDICTED: heat shock cognate 70 kDa protein...    349   4e-113   Nelumbo nucifera [Indian lotus]
gb|KJB55903.1|  hypothetical protein B456_009G100400                    349   4e-113   Gossypium raimondii
gb|EPS64948.1|  hypothetical protein M569_09829                         348   4e-113   Genlisea aurea
ref|XP_010095013.1|  Heat shock 70 kDa protein 4                        349   4e-113   Morus notabilis
gb|AAN86274.1|  non-cell-autonomous heat shock cognate protein 70       349   5e-113   Cucurbita maxima [Boston marrow]
gb|ACJ11742.1|  heat shock protein 70                                   349   5e-113   Gossypium hirsutum [American cotton]
ref|XP_009120551.1|  PREDICTED: probable mediator of RNA polymera...    349   5e-113   Brassica rapa
emb|CCA29121.1|  heat shock protein 70 isoform 2                        348   5e-113   Solanum lycopersicum
ref|XP_009388623.1|  PREDICTED: heat shock cognate 70 kDa protein...    348   6e-113   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006644983.1|  PREDICTED: probable mediator of RNA polymera...    348   6e-113   
ref|XP_002527736.1|  heat shock protein, putative                       348   7e-113   Ricinus communis
gb|KDP35613.1|  hypothetical protein JCGZ_09051                         348   7e-113   Jatropha curcas
gb|KHN21966.1|  Heat shock cognate 70 kDa protein                       348   7e-113   Glycine soja [wild soybean]
gb|KDP44981.1|  hypothetical protein JCGZ_01481                         348   7e-113   Jatropha curcas
gb|AAR17080.1|  heat shock protein 70-3                                 348   8e-113   Nicotiana tabacum [American tobacco]
ref|XP_009620324.1|  PREDICTED: heat shock cognate 70 kDa protein...    348   8e-113   Nicotiana tomentosiformis
ref|XP_004505872.1|  PREDICTED: heat shock cognate 70 kDa protein...    348   8e-113   Cicer arietinum [garbanzo]
ref|XP_003537997.1|  PREDICTED: heat shock cognate 70 kDa protein 2     348   8e-113   Glycine max [soybeans]
ref|NP_001234491.1|  heat shock cognate 70 kDa protein 1                348   9e-113   
ref|XP_009777579.1|  PREDICTED: heat shock cognate 70 kDa protein...    348   9e-113   Nicotiana sylvestris
emb|CDY02235.1|  BnaA03g39320D                                          332   9e-113   
ref|XP_010922357.1|  PREDICTED: heat shock cognate 70 kDa protein 2     348   9e-113   Elaeis guineensis
gb|AAN86275.1|  non-cell-autonomous heat shock cognate protein 70       348   1e-112   Cucurbita maxima [Boston marrow]
ref|XP_008233611.1|  PREDICTED: heat shock cognate 70 kDa protein 2     348   1e-112   Prunus mume [ume]
ref|XP_003539680.2|  PREDICTED: heat shock cognate 70 kDa protein 2     348   1e-112   
ref|XP_008784530.1|  PREDICTED: heat shock cognate 70 kDa protein 2     348   1e-112   Phoenix dactylifera
ref|XP_009786102.1|  PREDICTED: heat shock cognate 70 kDa protein 2     348   1e-112   Nicotiana sylvestris
ref|XP_004142076.1|  PREDICTED: probable mediator of RNA polymera...    348   1e-112   
ref|XP_009597695.1|  PREDICTED: heat shock cognate 70 kDa protein 2     348   1e-112   Nicotiana tomentosiformis
gb|ABP35942.1|  heat shock protein 70                                   348   1e-112   Cyclamen persicum
emb|CDX89754.1|  BnaC03g46680D                                          333   1e-112   
ref|XP_010918390.1|  PREDICTED: heat shock cognate 70 kDa protein...    348   1e-112   Elaeis guineensis
gb|ABR18415.1|  unknown                                                 348   2e-112   Picea sitchensis
ref|XP_006407319.1|  hypothetical protein EUTSA_v10020257mg             347   2e-112   Eutrema salsugineum [saltwater cress]
ref|XP_004142745.1|  PREDICTED: heat shock cognate 70 kDa protein...    347   2e-112   
ref|XP_002528432.1|  heat shock protein, putative                       347   2e-112   Ricinus communis
ref|XP_008458906.1|  PREDICTED: heat shock cognate 70 kDa protein...    347   2e-112   Cucumis melo [Oriental melon]
ref|XP_008447699.1|  PREDICTED: heat shock cognate 70 kDa protein 2     347   3e-112   Cucumis melo [Oriental melon]
ref|XP_010253202.1|  PREDICTED: heat shock cognate 70 kDa protein 2     347   3e-112   Nelumbo nucifera [Indian lotus]
gb|KEH30132.1|  heat shock cognate 70 kDa protein                       345   3e-112   Medicago truncatula
emb|CDY52661.1|  BnaC01g38510D                                          347   3e-112   Brassica napus [oilseed rape]
ref|XP_011027172.1|  PREDICTED: probable mediator of RNA polymera...    347   4e-112   Populus euphratica
gb|AGR45355.1|  HSP70                                                   347   4e-112   Dendrobium officinale
ref|XP_008812036.1|  PREDICTED: probable mediator of RNA polymera...    347   4e-112   Phoenix dactylifera
gb|AIZ68155.1|  heat shock protein 70                                   347   4e-112   Ornithogalum longebracteatum [sea-onion]
ref|XP_007009362.1|  Heat shock cognate protein 70-1                    347   4e-112   
ref|XP_004307259.1|  PREDICTED: probable mediator of RNA polymera...    347   4e-112   Fragaria vesca subsp. vesca
ref|XP_008812042.1|  PREDICTED: heat shock cognate 70 kDa protein...    346   4e-112   Phoenix dactylifera
gb|EAY89450.1|  hypothetical protein OsI_10982                          340   5e-112   Oryza sativa Indica Group [Indian rice]
sp|P27322.1|HSP72_SOLLC  RecName: Full=Heat shock cognate 70 kDa ...    346   5e-112   Solanum lycopersicum
emb|CDP00073.1|  unnamed protein product                                346   5e-112   Coffea canephora [robusta coffee]
gb|EPS68565.1|  hypothetical protein M569_06198                         346   5e-112   Genlisea aurea
ref|XP_004250958.1|  PREDICTED: heat shock cognate 70 kDa protein...    346   5e-112   Solanum lycopersicum
gb|ADD71975.1|  heat shock protein 70                                   346   6e-112   Rhododendron calophytum
ref|XP_003552691.1|  PREDICTED: heat shock cognate 70 kDa protein...    346   6e-112   Glycine max [soybeans]
ref|XP_006348998.1|  PREDICTED: heat shock cognate 70 kDa protein...    346   6e-112   Solanum tuberosum [potatoes]
ref|XP_004492118.1|  PREDICTED: heat shock cognate 70 kDa protein...    346   6e-112   Cicer arietinum [garbanzo]
gb|KHN13891.1|  Heat shock cognate 70 kDa protein 2                     346   7e-112   Glycine soja [wild soybean]
ref|XP_010106444.1|  Heat shock cognate 70 kDa protein                  346   7e-112   Morus notabilis
ref|XP_011094842.1|  PREDICTED: heat shock cognate 70 kDa protein 2     346   7e-112   Sesamum indicum [beniseed]
emb|CDY53148.1|  BnaAnng12070D                                          333   7e-112   Brassica napus [oilseed rape]
ref|XP_007220208.1|  hypothetical protein PRUPE_ppa002641mg             346   7e-112   Prunus persica
ref|XP_006833219.1|  hypothetical protein AMTR_s00072p00181720          346   7e-112   Amborella trichopoda
ref|XP_008784528.1|  PREDICTED: heat shock cognate 70 kDa protein...    345   9e-112   Phoenix dactylifera
gb|KEH30133.1|  heat shock cognate 70 kDa protein                       345   9e-112   Medicago truncatula
ref|XP_009409520.1|  PREDICTED: heat shock cognate 70 kDa protein 2     345   9e-112   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAB72129.1|  heat shock protein 70                                  345   1e-111   Cucumis sativus [cucumbers]
gb|ACJ11740.1|  heat shock protein 70                                   345   1e-111   Gossypium hirsutum [American cotton]
ref|XP_010555208.1|  PREDICTED: heat shock cognate 70 kDa protein...    345   1e-111   Tarenaya hassleriana [spider flower]
emb|CDX73815.1|  BnaA03g32320D                                          345   1e-111   
ref|XP_009135236.1|  PREDICTED: probable mediator of RNA polymera...    345   1e-111   Brassica rapa
ref|XP_002263599.1|  PREDICTED: heat shock cognate 70 kDa protein 2     345   1e-111   Vitis vinifera
ref|XP_008371627.1|  PREDICTED: heat shock cognate 70 kDa protein...    345   1e-111   
emb|CDY00784.1|  BnaC03g37680D                                          345   1e-111   
gb|ACJ54890.1|  heat shock protein 70                                   345   1e-111   Oryza sativa Japonica Group [Japonica rice]
ref|WP_039310754.1|  molecular chaperone DnaK                           345   1e-111   Paenibacillus sp. IHB B 3415
ref|XP_002284008.1|  PREDICTED: heat shock cognate 70 kDa protein 2     345   1e-111   
gb|KJB16980.1|  hypothetical protein B456_002G258500                    344   1e-111   Gossypium raimondii
gb|ABF95267.1|  Heat shock cognate 70 kDa protein, putative, expr...    345   1e-111   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002456611.1|  hypothetical protein SORBIDRAFT_03g039360          345   2e-111   Sorghum bicolor [broomcorn]
ref|XP_004970526.1|  PREDICTED: probable mediator of RNA polymera...    345   2e-111   Setaria italica
ref|XP_002284063.1|  PREDICTED: heat shock cognate 70 kDa protein 2     345   2e-111   Vitis vinifera
ref|XP_010937656.1|  PREDICTED: probable mediator of RNA polymera...    345   2e-111   Elaeis guineensis
ref|NP_001055754.1|  Os05g0460000                                       345   2e-111   
ref|XP_011077460.1|  PREDICTED: heat shock cognate 70 kDa protein...    345   2e-111   Sesamum indicum [beniseed]
ref|NP_001183165.1|  uncharacterized protein LOC100501536               345   2e-111   Zea mays [maize]
gb|AFA51946.1|  heat shock protein 70                                   344   3e-111   Paeonia suffruticosa [moutan peony]
gb|AEK70336.1|  heat shock protein 70                                   344   3e-111   Paeonia lactiflora [common garden peony]
gb|KJB73858.1|  hypothetical protein B456_011G256600                    344   3e-111   Gossypium raimondii
gb|EEC76425.1|  hypothetical protein OsI_14101                          337   3e-111   Oryza sativa Indica Group [Indian rice]
gb|KDP44975.1|  hypothetical protein JCGZ_01475                         343   3e-111   Jatropha curcas
ref|XP_007027052.1|  Heat shock cognate protein 70-1 isoform 1          344   3e-111   
ref|XP_004307527.1|  PREDICTED: heat shock cognate 70 kDa protein 2     344   3e-111   Fragaria vesca subsp. vesca
ref|XP_003564580.1|  PREDICTED: heat shock cognate 70 kDa protein       344   3e-111   Brachypodium distachyon [annual false brome]
gb|KEH30131.1|  heat shock cognate 70 kDa protein                       344   3e-111   Medicago truncatula
ref|XP_008802766.1|  PREDICTED: probable mediator of RNA polymera...    344   4e-111   Phoenix dactylifera
ref|XP_006407676.1|  hypothetical protein EUTSA_v10020258mg             344   4e-111   Eutrema salsugineum [saltwater cress]
dbj|BAJ34054.1|  unnamed protein product                                344   4e-111   Eutrema halophilum
ref|XP_006649853.1|  PREDICTED: heat shock cognate 70 kDa protein...    344   4e-111   Oryza brachyantha
gb|ABA95501.2|  Heat shock cognate 70 kDa protein, putative, expr...    343   4e-111   Oryza sativa Japonica Group [Japonica rice]
gb|ADZ46371.1|  HSP70                                                   344   4e-111   Malus hupehensis
gb|EAY89457.1|  hypothetical protein OsI_10990                          337   4e-111   Oryza sativa Indica Group [Indian rice]
ref|XP_009353696.1|  PREDICTED: probable mediator of RNA polymera...    340   5e-111   
gb|EYU19900.1|  hypothetical protein MIMGU_mgv1a002641mg                344   5e-111   Erythranthe guttata [common monkey flower]
gb|ACM42161.1|  heat shock protein 70.58                                343   5e-111   Ageratina adenophora
gb|AAA62445.1|  heat shock protein                                      343   5e-111   Spinacia oleracea
ref|XP_006436010.1|  hypothetical protein CICLE_v10030928mg             343   5e-111   Citrus clementina [clementine]
ref|XP_009357717.1|  PREDICTED: heat shock cognate 70 kDa protein...    343   5e-111   Pyrus x bretschneideri [bai li]
ref|XP_003621869.1|  Heat shock protein                                 343   6e-111   Medicago truncatula
emb|CDY36723.1|  BnaC02g31440D                                          328   6e-111   Brassica napus [oilseed rape]
ref|NP_001068540.1|  Os11g0703900                                       343   6e-111   
ref|XP_006663128.1|  PREDICTED: heat shock cognate 70 kDa protein...    343   6e-111   Oryza brachyantha
gb|ACJ11741.1|  heat shock protein 70                                   343   6e-111   Gossypium hirsutum [American cotton]
ref|NP_187864.1|  heat shock protein 70-4                               343   6e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002312089.1|  heat shock protein 70 cognate                      343   6e-111   
gb|KJB16979.1|  hypothetical protein B456_002G258500                    343   6e-111   Gossypium raimondii
ref|XP_010030977.1|  PREDICTED: heat shock cognate 70 kDa protein 2     343   6e-111   Eucalyptus grandis [rose gum]
emb|CDY16175.1|  BnaA09g29090D                                          330   7e-111   Brassica napus [oilseed rape]
ref|NP_001044757.1|  Os01g0840100                                       343   8e-111   
ref|XP_002532297.1|  heat shock protein, putative                       343   9e-111   Ricinus communis
ref|XP_009414320.1|  PREDICTED: probable mediator of RNA polymera...    343   9e-111   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB46580.1|  hypothetical protein B456_007G375600                    343   9e-111   Gossypium raimondii
ref|XP_002884912.1|  hypothetical protein ARALYDRAFT_897465             343   9e-111   Arabidopsis lyrata subsp. lyrata
gb|KCW50223.1|  hypothetical protein EUGRSUZ_J00023                     342   9e-111   Eucalyptus grandis [rose gum]
ref|XP_010553033.1|  PREDICTED: probable mediator of RNA polymera...    343   1e-110   Tarenaya hassleriana [spider flower]
emb|CDX85038.1|  BnaC05g20170D                                          330   1e-110   
ref|XP_004246402.1|  PREDICTED: heat shock cognate 70 kDa protein...    343   1e-110   Solanum lycopersicum
emb|CAB72130.1|  heat shock protein 70                                  343   1e-110   Cucumis sativus [cucumbers]
emb|CDP09035.1|  unnamed protein product                                343   1e-110   Coffea canephora [robusta coffee]
gb|AAB97316.1|  cytosolic heat shock 70 protein                         343   1e-110   Spinacia oleracea
ref|XP_010030975.1|  PREDICTED: heat shock cognate 70 kDa protein...    343   1e-110   Eucalyptus grandis [rose gum]
gb|ACD93209.1|  heat shock protein 70                                   343   1e-110   Camellia sinensis [black tea]
ref|XP_006424798.1|  hypothetical protein CICLE_v10028007mg             342   1e-110   
gb|KFK38330.1|  hypothetical protein AALP_AA3G100200                    343   1e-110   Arabis alpina [alpine rockcress]
gb|EYU26579.1|  hypothetical protein MIMGU_mgv1a002667mg                343   1e-110   Erythranthe guttata [common monkey flower]
gb|KCW50224.1|  hypothetical protein EUGRSUZ_J00023                     342   1e-110   Eucalyptus grandis [rose gum]
ref|XP_006429028.1|  hypothetical protein CICLE_v10011260mg             343   1e-110   Citrus clementina [clementine]
ref|XP_011028442.1|  PREDICTED: heat shock cognate 70 kDa protein...    342   1e-110   Populus euphratica
ref|XP_010231300.1|  PREDICTED: probable mediator of RNA polymera...    342   2e-110   Brachypodium distachyon [annual false brome]
ref|XP_002465468.1|  hypothetical protein SORBIDRAFT_01g039390          342   2e-110   Sorghum bicolor [broomcorn]
ref|XP_010499184.1|  PREDICTED: probable mediator of RNA polymera...    342   2e-110   Camelina sativa [gold-of-pleasure]
ref|XP_010486980.1|  PREDICTED: probable mediator of RNA polymera...    342   2e-110   Camelina sativa [gold-of-pleasure]
ref|XP_004287145.1|  PREDICTED: heat shock 70 kDa protein               342   2e-110   Fragaria vesca subsp. vesca
gb|ACB70177.1|  70 kDa heat shock protein                               342   2e-110   Capparis spinosa [caper]
gb|AFU34347.1|  70-kDa heat shock protein                               342   2e-110   Ipomoea batatas [batate]
ref|XP_007009369.1|  Heat shock protein 70                              342   2e-110   
gb|AAS57913.1|  70 kDa heat shock cognate protein 2                     342   2e-110   Vigna radiata [mung bean]
ref|XP_010465032.1|  PREDICTED: probable mediator of RNA polymera...    342   2e-110   Camelina sativa [gold-of-pleasure]
ref|XP_010558317.1|  PREDICTED: probable mediator of RNA polymera...    342   2e-110   Tarenaya hassleriana [spider flower]
ref|XP_006297174.1|  hypothetical protein CARUB_v10013178mg             342   2e-110   Capsella rubella
gb|AIU40169.1|  heat shock protein 70                                   342   3e-110   Saccharum arundinaceum
ref|XP_011016414.1|  PREDICTED: heat shock cognate 70 kDa protein 2     342   3e-110   Populus euphratica
ref|XP_007144450.1|  hypothetical protein PHAVU_007G157200g             341   3e-110   Phaseolus vulgaris [French bean]
gb|AAB99745.1|  HSP70                                                   342   3e-110   Triticum aestivum [Canadian hard winter wheat]
gb|KCW50227.1|  hypothetical protein EUGRSUZ_J00025                     344   3e-110   Eucalyptus grandis [rose gum]
gb|KCW50226.1|  hypothetical protein EUGRSUZ_J00025                     344   3e-110   Eucalyptus grandis [rose gum]
ref|XP_007144451.1|  hypothetical protein PHAVU_007G157200g             342   3e-110   Phaseolus vulgaris [French bean]
gb|EMT06830.1|  Heat shock cognate 70 kDa protein                       342   3e-110   
ref|XP_006297173.1|  hypothetical protein CARUB_v10013177mg             342   3e-110   Capsella rubella
gb|ACR38891.1|  heat shock protein 70                                   342   3e-110   Apopellia endiviifolia (species B)
ref|XP_009785159.1|  PREDICTED: heat shock cognate 70 kDa protein...    342   4e-110   Nicotiana sylvestris
ref|XP_009122772.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    341   4e-110   Brassica rapa
ref|XP_009112006.1|  PREDICTED: probable mediator of RNA polymera...    337   4e-110   Brassica rapa
gb|KHN27222.1|  Heat shock cognate 70 kDa protein 2                     342   4e-110   Glycine soja [wild soybean]
ref|XP_009622753.1|  PREDICTED: heat shock cognate 70 kDa protein...    341   4e-110   Nicotiana tomentosiformis
gb|EMS68426.1|  Heat shock cognate 70 kDa protein 4                     341   4e-110   Triticum urartu
ref|XP_002283532.2|  PREDICTED: heat shock cognate 70 kDa protein 2     341   4e-110   Vitis vinifera
gb|AAB88009.1|  heat shock cognate protein HSC70                        341   4e-110   Brassica napus [oilseed rape]
gb|AAP04522.1|  heat shock protein 70                                   341   5e-110   Nicotiana tabacum [American tobacco]
ref|XP_003558228.1|  PREDICTED: heat shock cognate 70 kDa protein...    341   5e-110   Brachypodium distachyon [annual false brome]
ref|XP_004984743.1|  PREDICTED: heat shock cognate 70 kDa protein...    341   5e-110   Setaria italica
gb|AIA22210.1|  heat shock protein 70                                   341   5e-110   Chrysanthemum indicum
gb|AGL07711.1|  heat shock protein 70                                   341   6e-110   Ziziphus jujuba [Chinese jujube]
ref|XP_006341042.1|  PREDICTED: heat shock cognate 70 kDa protein...    341   6e-110   Solanum tuberosum [potatoes]
ref|XP_008776699.1|  PREDICTED: probable mediator of RNA polymera...    341   6e-110   Phoenix dactylifera
dbj|BAK00257.1|  predicted protein                                      341   6e-110   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS51135.1|  Heat shock cognate 70 kDa protein                       340   6e-110   Triticum urartu
ref|NP_001119156.1|  heat shock cognate protein 70-1                    337   6e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001767839.1|  predicted protein                                  341   7e-110   
ref|XP_006378715.1|  hypothetical protein POPTR_0010s21280g             341   7e-110   Populus trichocarpa [western balsam poplar]
ref|XP_008223372.1|  PREDICTED: probable mediator of RNA polymera...    337   7e-110   
ref|XP_003552695.1|  PREDICTED: heat shock cognate 70 kDa protein...    340   8e-110   Glycine max [soybeans]
ref|XP_009414319.1|  PREDICTED: heat shock cognate 70 kDa protein...    340   8e-110   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAA86903.1|  heat shock protein cognate 70                           326   8e-110   Sorghum bicolor [broomcorn]
ref|XP_008658250.1|  PREDICTED: uncharacterized protein LOC100272...    340   1e-109   Zea mays [maize]
ref|XP_003554320.2|  PREDICTED: probable mediator of RNA polymera...    342   1e-109   
emb|CAA31663.1|  hsp70 (AA 6 - 651)                                     340   1e-109   Petunia x hybrida [garden petunia]
ref|XP_010931247.1|  PREDICTED: heat shock cognate 70 kDa protein...    340   1e-109   Elaeis guineensis
ref|XP_006664117.1|  PREDICTED: heat shock cognate 70 kDa protein...    340   1e-109   Oryza brachyantha
ref|XP_001751923.1|  predicted protein                                  340   1e-109   
ref|NP_001049712.1|  Os03g0276500                                       340   1e-109   
ref|XP_009353695.1|  PREDICTED: heat shock cognate 70 kDa protein...    340   1e-109   Pyrus x bretschneideri [bai li]
ref|XP_007207158.1|  hypothetical protein PRUPE_ppa024477mg             340   1e-109   
ref|XP_004156718.1|  PREDICTED: heat shock cognate 70 kDa protein...    340   1e-109   
dbj|BAP90755.1|  heat shock protein 70                                  340   1e-109   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_011027180.1|  PREDICTED: heat shock cognate 70 kDa protein...    340   1e-109   Populus euphratica
ref|XP_002442353.1|  hypothetical protein SORBIDRAFT_08g018750          340   2e-109   Sorghum bicolor [broomcorn]
gb|AIU34470.1|  putative heat shock protein                             340   2e-109   Taraxacum brevicorniculatum
ref|XP_004962705.1|  PREDICTED: probable mediator of RNA polymera...    340   2e-109   Setaria italica
ref|XP_008369876.1|  PREDICTED: probable mediator of RNA polymera...    339   3e-109   
gb|KJB36734.1|  hypothetical protein B456_006G174000                    339   3e-109   Gossypium raimondii
ref|XP_009102555.1|  PREDICTED: probable mediator of RNA polymera...    339   3e-109   Brassica rapa
ref|XP_008674324.1|  PREDICTED: probable mediator of RNA polymera...    339   3e-109   
gb|ACD45076.1|  heat-shock protein 70                                   339   3e-109   Dactylis glomerata [cocksfoot]
ref|XP_003558220.1|  PREDICTED: heat shock cognate 70 kDa protein...    339   3e-109   Brachypodium distachyon [annual false brome]
ref|XP_009338761.1|  PREDICTED: probable mediator of RNA polymera...    339   3e-109   Pyrus x bretschneideri [bai li]
ref|XP_004307529.1|  PREDICTED: heat shock cognate 70 kDa protein...    339   3e-109   Fragaria vesca subsp. vesca
gb|EMT11692.1|  Heat shock cognate 70 kDa protein                       339   3e-109   
emb|CDY31804.1|  BnaC01g27600D                                          332   4e-109   Brassica napus [oilseed rape]
ref|XP_004492128.1|  PREDICTED: heat shock cognate 70 kDa protein...    339   4e-109   
gb|KFK24738.1|  hypothetical protein AALP_AA8G018100                    339   4e-109   Arabis alpina [alpine rockcress]
ref|XP_003521330.1|  PREDICTED: probable mediator of RNA polymera...    339   4e-109   Glycine max [soybeans]
ref|XP_006398709.1|  hypothetical protein EUTSA_v10012922mg             339   4e-109   Eutrema salsugineum [saltwater cress]
gb|AAS09825.1|  heat shock cognate protein 70                           338   5e-109   Eutrema halophilum
ref|XP_008660826.1|  PREDICTED: probable mediator of RNA polymera...    338   5e-109   Zea mays [maize]
ref|XP_010520113.1|  PREDICTED: heat shock cognate 70 kDa protein...    338   6e-109   Tarenaya hassleriana [spider flower]
ref|XP_008241192.1|  PREDICTED: probable mediator of RNA polymera...    338   6e-109   Prunus mume [ume]
gb|KHN02428.1|  Heat shock cognate 70 kDa protein                       338   6e-109   Glycine soja [wild soybean]
ref|XP_007162654.1|  hypothetical protein PHAVU_001G169000g             338   6e-109   Phaseolus vulgaris [French bean]
ref|XP_010486515.1|  PREDICTED: heat shock 70 kDa protein 3-like        338   6e-109   
ref|XP_010473075.1|  PREDICTED: heat shock 70 kDa protein 3-like        338   7e-109   
ref|XP_009366205.1|  PREDICTED: heat shock 70 kDa protein               338   7e-109   
ref|XP_009115390.1|  PREDICTED: probable mediator of RNA polymera...    338   8e-109   
gb|AAV97978.1|  heat shock protein hsp70                                338   8e-109   
ref|XP_008458071.1|  PREDICTED: heat shock cognate 70 kDa protein...    323   8e-109   
ref|XP_011027667.1|  PREDICTED: probable mediator of RNA polymera...    334   8e-109   
ref|NP_001051724.1|  Os03g0821100                                       338   9e-109   
emb|CAA05547.1|  heat shock protein 70                                  338   9e-109   
gb|EMS65159.1|  Heat shock cognate 70 kDa protein                       339   1e-108   
ref|XP_007139236.1|  hypothetical protein PHAVU_008G012600g             338   1e-108   
ref|XP_001783048.1|  predicted protein                                  338   1e-108   
gb|KHN13890.1|  Heat shock cognate 70 kDa protein 2                     340   1e-108   
ref|XP_004493886.1|  PREDICTED: probable mediator of RNA polymera...    337   1e-108   
gb|AAM48131.1|AF509336_1  heat shock protein 70                         337   1e-108   
dbj|BAK07857.1|  predicted protein                                      340   2e-108   
ref|XP_006436017.1|  hypothetical protein CICLE_v10033622mg             337   2e-108   
dbj|BAJ91305.1|  predicted protein                                      337   2e-108   
ref|XP_007203774.1|  hypothetical protein PRUPE_ppa002595mg             337   2e-108   
gb|EMT17408.1|  Heat shock cognate 70 kDa protein                       337   2e-108   
gb|AFW88810.1|  hypothetical protein ZEAMMB73_832667                    340   2e-108   
gb|ABD32895.1|  Heat shock protein Hsp70                                337   2e-108   
gb|EMT07406.1|  Heat shock cognate 70 kDa protein 1                     337   2e-108   
ref|XP_001759874.1|  predicted protein                                  337   2e-108   
gb|ABX76301.1|  heat shock protein 70                                   337   2e-108   
emb|CAA47948.2|  heat shock protein 70                                  337   2e-108   
gb|AAN86276.1|  cell-autonomous heat shock cognate protein 70           337   2e-108   
ref|XP_002873055.1|  predicted protein                                  337   2e-108   
dbj|BAJ86014.1|  predicted protein                                      337   3e-108   
ref|XP_004493999.1|  PREDICTED: heat shock cognate 70 kDa protein...    337   3e-108   
ref|XP_009374678.1|  PREDICTED: probable mediator of RNA polymera...    337   3e-108   
ref|XP_003621886.1|  Heat shock protein                                 337   3e-108   
ref|NP_195870.1|  heat shock cognate protein 70-1                       337   3e-108   
emb|CAA52684.1|  heat shock protein 70 cognate                          337   3e-108   
ref|XP_006287234.1|  hypothetical protein CARUB_v10000420mg             337   3e-108   
ref|XP_001767221.1|  predicted protein                                  337   3e-108   
dbj|BAK02194.1|  predicted protein                                      337   3e-108   
gb|ACJ85522.1|  unknown                                                 337   3e-108   
ref|XP_007207204.1|  hypothetical protein PRUPE_ppa002646mg             336   4e-108   
ref|XP_010273662.1|  PREDICTED: heat shock 70 kDa protein               336   4e-108   
ref|XP_008223380.1|  PREDICTED: heat shock cognate 70 kDa protein...    336   4e-108   
ref|XP_010464591.1|  PREDICTED: heat shock 70 kDa protein 3             336   4e-108   
gb|ACV52590.1|  heat shock protein 70-like protein                      320   4e-108   
gb|KJB20862.1|  hypothetical protein B456_003G169700                    336   4e-108   
ref|XP_003578898.1|  PREDICTED: heat shock cognate 70 kDa protein 2     336   5e-108   
gb|EMS52605.1|  Heat shock cognate 70 kDa protein 1                     336   5e-108   
gb|EYU19903.1|  hypothetical protein MIMGU_mgv1a002628mg                336   7e-108   
gb|EMS65063.1|  Heat shock cognate 70 kDa protein                       336   7e-108   
ref|XP_007139240.1|  hypothetical protein PHAVU_008G013000g             335   8e-108   
ref|XP_010423853.1|  PREDICTED: probable mediator of RNA polymera...    335   8e-108   
ref|XP_010452093.1|  PREDICTED: probable mediator of RNA polymera...    335   8e-108   
ref|NP_187555.1|  heat shock protein 70-3                               335   1e-107   
ref|XP_001785822.1|  predicted protein                                  335   1e-107   
ref|XP_002312090.1|  heat shock protein 70 cognate                      335   2e-107   
gb|AAV98051.1|  heat shock protein 70                                   335   2e-107   
ref|NP_176036.1|  heat shock protein ERD2                               333   2e-107   
gb|AGZ15406.1|  heat shock cognate 70 kDa protein                       334   2e-107   
ref|XP_008450536.1|  PREDICTED: heat shock 70 kDa protein               334   2e-107   
ref|XP_003625487.1|  Heat shock protein                                 336   3e-107   
ref|XP_011034570.1|  PREDICTED: heat shock 70 kDa protein isoform X1    334   4e-107   
ref|XP_004981251.1|  PREDICTED: heat shock cognate 70 kDa protein...    333   4e-107   
ref|XP_007023492.1|  Heat shock protein 70B                             334   4e-107   
ref|XP_008384260.1|  PREDICTED: heat shock 70 kDa protein isoform X1    333   5e-107   
ref|XP_010669896.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    347   5e-107   
ref|XP_002891955.1|  early-responsive to dehydration 2                  332   6e-107   
sp|P29357.3|HSP7E_SPIOL  RecName: Full=Chloroplast envelope membr...    333   6e-107   
ref|NP_195869.1|  heat shock protein 70                                 333   6e-107   
ref|XP_007216987.1|  hypothetical protein PRUPE_ppa002598mg             333   6e-107   
ref|XP_004302715.1|  PREDICTED: probable mediator of RNA polymera...    333   7e-107   
gb|KDP41951.1|  hypothetical protein JCGZ_26969                         333   7e-107   
ref|XP_006427662.1|  hypothetical protein CICLE_v10025114mg             333   7e-107   
ref|XP_011027182.1|  PREDICTED: heat shock cognate 70 kDa protein...    333   9e-107   
ref|XP_007216991.1|  hypothetical protein PRUPE_ppa002591mg             333   9e-107   
ref|XP_003563611.1|  PREDICTED: heat shock cognate 70 kDa protein...    333   1e-106   
ref|NP_001148198.1|  heat shock cognate 70 kDa protein 2                332   1e-106   
gb|ACC93947.1|  heat-shock protein 70                                   332   2e-106   
ref|NP_001167696.1|  heat shock cognate 70 kDa protein 2                332   2e-106   
ref|XP_001781229.1|  predicted protein                                  332   2e-106   
ref|XP_002873056.1|  HSC70-1                                            332   2e-106   
emb|CCD74508.1|  early-responsive to dehydration 2                      331   2e-106   
ref|XP_009358419.1|  PREDICTED: heat shock 70 kDa protein-like          332   2e-106   
ref|XP_006427666.1|  hypothetical protein CICLE_v10025102mg             332   2e-106   
gb|EMS45385.1|  Heat shock cognate 70 kDa protein 1                     335   2e-106   
ref|XP_007013854.1|  Heat shock protein 70B                             332   2e-106   
ref|XP_008228833.1|  PREDICTED: heat shock 70 kDa protein               332   2e-106   
ref|XP_010495044.1|  PREDICTED: probable mediator of RNA polymera...    330   2e-106   
ref|XP_002468097.1|  hypothetical protein SORBIDRAFT_01g039530          332   2e-106   
ref|XP_006368489.1|  heat shock protein 70 cognate                      332   3e-106   
emb|CAA83548.1|  PsHSC71.0                                              331   3e-106   
ref|XP_007016452.1|  Heat shock cognate protein 70-1                    332   4e-106   
ref|XP_004152854.1|  PREDICTED: heat shock 70 kDa protein-like          331   5e-106   
gb|KFK37144.1|  hypothetical protein AALP_AA4G218800                    330   5e-106   
gb|KJB49429.1|  hypothetical protein B456_008G119200                    330   6e-106   
ref|XP_010063598.1|  PREDICTED: heat shock 70 kDa protein               331   6e-106   
ref|XP_010423858.1|  PREDICTED: probable mediator of RNA polymera...    330   6e-106   
gb|KJB20110.1|  hypothetical protein B456_003G133400                    330   8e-106   
ref|XP_006378714.1|  heat shock protein 70 cognate                      330   9e-106   
ref|XP_010273661.1|  PREDICTED: heat shock 70 kDa protein-like          330   1e-105   
ref|XP_010490742.1|  PREDICTED: probable mediator of RNA polymera...    330   1e-105   
ref|XP_009789460.1|  PREDICTED: heat shock 70 kDa protein               330   1e-105   
ref|XP_010318701.1|  PREDICTED: heat shock 70 kDa protein 5             330   1e-105   
gb|KDO55354.1|  hypothetical protein CISIN_1g043296mg                   330   1e-105   
ref|XP_006341414.1|  PREDICTED: heat shock cognate 70 kDa protein...    330   1e-105   
ref|XP_004984739.1|  PREDICTED: probable mediator of RNA polymera...    330   1e-105   
ref|XP_009354217.1|  PREDICTED: heat shock 70 kDa protein-like          330   1e-105   
gb|KCW74480.1|  hypothetical protein EUGRSUZ_E03189                     326   1e-105   
ref|XP_010265523.1|  PREDICTED: heat shock 70 kDa protein-like          330   2e-105   
ref|XP_006493389.1|  PREDICTED: heat shock 70 kDa protein-like          330   2e-105   
ref|XP_010094065.1|  Heat shock 70 kDa protein                          329   2e-105   
ref|XP_009615698.1|  PREDICTED: heat shock 70 kDa protein               329   3e-105   
emb|CDO98244.1|  unnamed protein product                                329   3e-105   
gb|KJB83911.1|  hypothetical protein B456_013G270600                    329   3e-105   
ref|XP_008342822.1|  PREDICTED: heat shock 70 kDa protein-like          328   4e-105   
ref|XP_010463615.1|  PREDICTED: probable mediator of RNA polymera...    328   5e-105   
gb|EYU21748.1|  hypothetical protein MIMGU_mgv1a020843mg                328   5e-105   
ref|XP_010063602.1|  PREDICTED: probable mediator of RNA polymera...    325   5e-105   
ref|XP_010423825.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    328   5e-105   
ref|XP_010484430.1|  PREDICTED: probable mediator of RNA polymera...    328   5e-105   
ref|XP_002968525.1|  hypothetical protein SELMODRAFT_440382             328   5e-105   
ref|XP_011034569.1|  PREDICTED: heat shock 70 kDa protein-like          328   6e-105   
ref|XP_002987209.1|  hypothetical protein SELMODRAFT_125427             328   9e-105   
ref|XP_009122774.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    325   9e-105   
ref|XP_002976367.1|  hypothetical protein SELMODRAFT_443126             327   1e-104   
gb|KCW70839.1|  hypothetical protein EUGRSUZ_F03980                     331   1e-104   
gb|KDP41952.1|  hypothetical protein JCGZ_26970                         327   1e-104   
ref|XP_002512741.1|  heat shock protein, putative                       327   1e-104   
ref|XP_010678398.1|  PREDICTED: heat shock 70 kDa protein-like          327   2e-104   
ref|XP_011082530.1|  PREDICTED: heat shock 70 kDa protein-like          327   2e-104   
ref|XP_008342826.1|  PREDICTED: heat shock 70 kDa protein-like          327   2e-104   
ref|XP_002512742.1|  heat shock protein, putative                       327   2e-104   
ref|XP_008353760.1|  PREDICTED: heat shock 70 kDa protein isoform X4    327   2e-104   
ref|XP_010094064.1|  Heat shock cognate 70 kDa protein                  327   2e-104   
ref|XP_008353758.1|  PREDICTED: heat shock 70 kDa protein isoform X2    326   3e-104   
ref|XP_008342821.1|  PREDICTED: heat shock 70 kDa protein-like          326   4e-104   
ref|XP_008353759.1|  PREDICTED: heat shock 70 kDa protein isoform X3    326   5e-104   
ref|XP_009354216.1|  PREDICTED: heat shock 70 kDa protein-like          326   6e-104   
dbj|BAA04848.1|  HSP70                                                  325   6e-104   
gb|ACT34017.1|  heat shock cognate 70 kDa protein                       325   6e-104   
gb|KFK32679.1|  hypothetical protein AALP_AA6G274700                    325   6e-104   
ref|XP_003549537.1|  PREDICTED: heat shock 70 kDa protein-like is...    325   6e-104   
ref|XP_008353757.1|  PREDICTED: heat shock 70 kDa protein isoform X1    325   8e-104   
ref|XP_010063601.1|  PREDICTED: probable mediator of RNA polymera...    324   8e-104   
ref|XP_002976219.1|  hypothetical protein SELMODRAFT_443120             325   8e-104   
ref|XP_002987127.1|  hypothetical protein SELMODRAFT_446858             325   8e-104   
ref|XP_010456365.1|  PREDICTED: probable mediator of RNA polymera...    332   9e-104   
ref|XP_007154870.1|  hypothetical protein PHAVU_003G154800g             325   1e-103   
sp|P11143.2|HSP70_MAIZE  RecName: Full=Heat shock 70 kDa protein        325   1e-103   
ref|XP_006486093.1|  PREDICTED: probable mediator of RNA polymera...    333   1e-103   
ref|XP_009357719.1|  PREDICTED: heat shock cognate 70 kDa protein...    325   1e-103   
ref|XP_010063600.1|  PREDICTED: heat shock 70 kDa protein 5-like ...    325   1e-103   
ref|XP_010063599.1|  PREDICTED: heat shock 70 kDa protein-like is...    325   2e-103   
gb|AGT97046.1|  heat shock protein 70                                   324   2e-103   
ref|XP_006368490.1|  heat shock protein 70 cognate                      323   4e-103   
ref|XP_011073307.1|  PREDICTED: heat shock 70 kDa protein-like          323   4e-103   
ref|XP_008365320.1|  PREDICTED: heat shock 70 kDa protein               323   5e-103   
ref|XP_011079384.1|  PREDICTED: heat shock 70 kDa protein               323   5e-103   
ref|XP_003519161.1|  PREDICTED: heat shock 70 kDa protein-like          323   8e-103   
ref|XP_004507753.1|  PREDICTED: heat shock 70 kDa protein-like          322   1e-102   
ref|XP_002277050.1|  PREDICTED: heat shock 70 kDa protein               322   1e-102   
gb|ABK25453.1|  unknown                                                 322   1e-102   
ref|XP_008354483.1|  PREDICTED: heat shock cognate 70 kDa protein...    314   1e-102   
gb|EMT15100.1|  Heat shock cognate 70 kDa protein 1                     334   2e-102   
ref|XP_006346613.1|  PREDICTED: heat shock 70 kDa protein-like          320   4e-102   
ref|XP_006416851.1|  hypothetical protein EUTSA_v10007031mg             320   5e-102   
ref|XP_006290203.1|  hypothetical protein CARUB_v10003889mg             320   7e-102   
ref|XP_010537859.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    320   9e-102   
ref|XP_009399566.1|  PREDICTED: heat shock 70 kDa protein-like          320   1e-101   
gb|KCW53915.1|  hypothetical protein EUGRSUZ_J03127                     319   1e-101   
gb|AAA82975.1|  PsHSP71.2                                               319   2e-101   
emb|CDP02832.1|  unnamed protein product                                319   2e-101   
gb|KDP38702.1|  hypothetical protein JCGZ_04055                         318   2e-101   
dbj|BAJ34597.1|  unnamed protein product                                318   3e-101   
ref|XP_010091163.1|  Heat shock 70 kDa protein                          318   3e-101   
ref|XP_010034044.1|  PREDICTED: heat shock 70 kDa protein-like          318   5e-101   
ref|XP_010905019.1|  PREDICTED: heat shock 70 kDa protein               318   7e-101   
ref|XP_010929169.1|  PREDICTED: heat shock 70 kDa protein-like          317   7e-101   
ref|XP_003610287.1|  Heat-shock protein                                 317   8e-101   
prf||1205208A  heat shock protein hsp70                                 317   8e-101
gb|AAS57914.1|  70 kDa heat shock cognate protein 3                     317   9e-101   
ref|XP_006343624.1|  PREDICTED: heat shock 70 kDa protein-like          317   2e-100   
ref|XP_009771888.1|  PREDICTED: heat shock 70 kDa protein-like          317   2e-100   
gb|KHN14134.1|  Heat shock 70 kDa protein                               316   3e-100   
sp|P26413.1|HSP70_SOYBN  RecName: Full=Heat shock 70 kDa protein        315   4e-100   
ref|XP_006826662.1|  hypothetical protein AMTR_s00137p00032560          316   4e-100   
ref|XP_004242612.1|  PREDICTED: heat shock 70 kDa protein-like          315   4e-100   
ref|XP_009149047.1|  PREDICTED: heat shock 70 kDa protein 5             315   4e-100   
ref|XP_010476705.1|  PREDICTED: heat shock 70 kDa protein 5             315   5e-100   
ref|XP_009622824.1|  PREDICTED: heat shock 70 kDa protein-like          315   6e-100   
ref|XP_010497610.1|  PREDICTED: heat shock 70 kDa protein 5-like        315   8e-100   
ref|NP_173055.1|  heat shock protein 70B                                314   1e-99    
ref|XP_010459142.1|  PREDICTED: heat shock 70 kDa protein 5-like        314   2e-99    
ref|XP_002303859.2|  heat shock protein 70 cognate                      312   1e-98    
emb|CDX83960.1|  BnaC08g16850D                                          312   1e-98    
ref|XP_008794364.1|  PREDICTED: heat shock 70 kDa protein-like          311   1e-98    
emb|CDX96825.1|  BnaA08g23680D                                          311   1e-98    
ref|XP_009110463.1|  PREDICTED: heat shock 70 kDa protein 5-like        311   1e-98    
gb|EYU34331.1|  hypothetical protein MIMGU_mgv1a021436mg                311   2e-98    
ref|XP_006306285.1|  hypothetical protein CARUB_v10012149mg             311   2e-98    
gb|ETM50132.1|  hsp70-like protein                                      295   3e-98    
ref|XP_002892893.1|  HSP70B                                             310   5e-98    
ref|XP_010687621.1|  PREDICTED: heat shock 70 kDa protein-like          310   6e-98    
gb|AAC84134.1|  heat shock protein                                      293   1e-97    
dbj|BAM44861.1|  heat shock protein                                     298   1e-97    
emb|CAA54419.1|  heat shock cognate 70-1                                308   3e-97    
emb|CBI31691.3|  unnamed protein product                                301   3e-97    
ref|XP_001016243.1|  dnaK protein                                       308   4e-97    
ref|XP_002884737.1|  heat shock cognate 70 kDa protein 3                308   4e-97    
gb|EPS69582.1|  heat shock protein hsp70                                307   5e-97    
gb|KDO55360.1|  hypothetical protein CISIN_1g038511mg                   307   5e-97    
ref|XP_008891371.1|  hsp70-like protein                                 293   6e-97    
sp|P26791.1|HSP70_DAUCA  RecName: Full=Heat shock 70 kDa protein        307   6e-97    
dbj|BAE48223.1|  heat shock protein 70                                  307   7e-97    
gb|KDO67637.1|  hypothetical protein CISIN_1g041815mg                   301   1e-96    
ref|XP_008864395.1|  hsp70-like protein                                 296   2e-96    
emb|CBJ32839.1|  Molecular chaperones HSP70/HSC70, HSP70 superfamily    305   3e-96    
gb|ETL43818.1|  hsp70-like protein                                      290   4e-96    
gb|KDD74618.1|  heat shock protein Hsp70                                304   4e-96    
ref|XP_006220075.1|  PREDICTED: heat shock 70 kDa protein A-like        290   5e-96    
gb|AFP57558.1|  heat shock cognate protein 70                           293   5e-96    
emb|CAN66715.1|  hypothetical protein VITISV_041184                     305   6e-96    
emb|CDP00079.1|  unnamed protein product                                303   8e-96    



>gb|AFV46216.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=233

 Score =   355 bits (912),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 169/176 (96%), Positives = 175/176 (99%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GPGDKPMIVV++KGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVNHKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVLTKMKEIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLTKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>gb|KDO72893.1| hypothetical protein CISIN_1g036208mg, partial [Citrus sinensis]
Length=279

 Score =   353 bits (906),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 168/176 (95%), Positives = 174/176 (99%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVIAG GDKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLNKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_008656365.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Zea mays]
 gb|AFW82225.1| hypothetical protein ZEAMMB73_366749 [Zea mays]
Length=649

 Score =   358 bits (918),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 169/173 (98%), Positives = 173/173 (100%), Gaps = 0/173 (0%)
 Frame = +1

Query  133  KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  312
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct  3    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  62

Query  313  MNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEEI  492
            MNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKV+AGPGDKPMIVVSYKGEDKQFSAEEI
Sbjct  63   MNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVVAGPGDKPMIVVSYKGEDKQFSAEEI  122

Query  493  SSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            SSMVLTKMKEIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  123  SSMVLTKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  175



>ref|XP_009784009.1| PREDICTED: heat shock cognate 70 kDa protein [Nicotiana sylvestris]
Length=651

 Score =   357 bits (916),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 168/176 (95%), Positives = 174/176 (99%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SDPSVQSDMKLWPFKVIAGPGDKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGPGDKPMIVVTYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVLTKMKEIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_007016460.1| Heat shock cognate protein 70-1 [Theobroma cacao]
 gb|EOY34079.1| Heat shock cognate protein 70-1 [Theobroma cacao]
Length=650

 Score =   357 bits (915),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 169/176 (96%), Positives = 175/176 (99%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SD SVQSDMKLWPFKVIAGPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDMKLWPFKVIAGPGDKPMIVVTYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVLTKMKEIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLTKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_011091460.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Sesamum 
indicum]
Length=649

 Score =   356 bits (913),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 169/176 (96%), Positives = 174/176 (99%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GPGDKPMIVVSYKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVSYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_009604213.1| PREDICTED: heat shock cognate 70 kDa protein [Nicotiana tomentosiformis]
Length=651

 Score =   356 bits (913),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 167/176 (95%), Positives = 174/176 (99%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SDPSVQSDMKLWPFKVIAGPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGPGDKPMIVVTYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVLTKMKEIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_008458892.1| PREDICTED: heat shock cognate 70 kDa protein [Cucumis melo]
Length=648

 Score =   355 bits (911),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 167/176 (95%), Positives = 175/176 (99%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SDPSVQSDMKLWPFKVIAGPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPLNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVLTKM+EIAEA+LGS+VKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLTKMREIAEAYLGSSVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_010534306.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Tarenaya hassleriana]
Length=653

 Score =   355 bits (911),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 167/176 (95%), Positives = 176/176 (100%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRRYSDPSV++DMKLWPFKVI+GPGDKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRYSDPSVKADMKLWPFKVISGPGDKPMIVVNYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVLTKM+EIAEA+LG++VKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLTKMREIAEAYLGTSVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_006424799.1| hypothetical protein CICLE_v10027981mg [Citrus clementina]
 gb|ESR38039.1| hypothetical protein CICLE_v10027981mg [Citrus clementina]
Length=649

 Score =   355 bits (910),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 168/176 (95%), Positives = 174/176 (99%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVIAG GDKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLNKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_006488297.1| PREDICTED: heat shock cognate 70 kDa protein-like [Citrus sinensis]
Length=649

 Score =   355 bits (910),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 168/176 (95%), Positives = 174/176 (99%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVIAG GDKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLNKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_006349004.1| PREDICTED: heat shock cognate 70 kDa protein-like [Solanum tuberosum]
Length=652

 Score =   354 bits (909),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 167/176 (95%), Positives = 173/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GP DKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVTYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVLTKMKEIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>gb|KDP44987.1| hypothetical protein JCGZ_01487 [Jatropha curcas]
Length=648

 Score =   354 bits (908),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 167/176 (95%), Positives = 173/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SDPSVQ DMKLWPFKVIAGPGDKPMIVVSYKGE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDPSVQGDMKLWPFKVIAGPGDKPMIVVSYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_006349005.1| PREDICTED: heat shock cognate 70 kDa protein-like [Solanum tuberosum]
Length=652

 Score =   354 bits (909),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 167/176 (95%), Positives = 173/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GP DKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVTYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVLTKMKEIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_009606077.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   354 bits (908),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 167/176 (95%), Positives = 173/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GP DKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVNYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEAFLG+T+KNAVVTVPAYFNDSQRQATKDAG+ISGLNVMRI
Sbjct  121  EEISSMVLVKMKEIAEAFLGTTIKNAVVTVPAYFNDSQRQATKDAGIISGLNVMRI  176



>ref|XP_004250959.1| PREDICTED: heat shock cognate 70 kDa protein [Solanum lycopersicum]
Length=654

 Score =   354 bits (908),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  127  AGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ  306
            AGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
Sbjct  4    AGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ  63

Query  307  VAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAE  486
            VAMNP NTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GPGDKPMIVV+YKGE+KQFSAE
Sbjct  64   VAMNPVNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVTYKGEEKQFSAE  123

Query  487  EISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EISSMVLTKMKEIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  124  EISSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  178



>gb|AAB42159.1| Hsc70 [Solanum lycopersicum]
Length=651

 Score =   353 bits (907),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 167/176 (95%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GP DKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVNYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEAFLG+T+KNAVVTVPAYFNDSQRQATKDAG ISGLNVMRI
Sbjct  121  EEISSMVLIKMKEIAEAFLGTTIKNAVVTVPAYFNDSQRQATKDAGTISGLNVMRI  176



>ref|XP_010319122.1| PREDICTED: heat shock protein 70 isoform 3 isoform X1 [Solanum 
lycopersicum]
Length=652

 Score =   353 bits (907),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 167/176 (95%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GP DKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVNYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEAFLG+T+KNAVVTVPAYFNDSQRQATKDAG ISGLNVMRI
Sbjct  121  EEISSMVLIKMKEIAEAFLGTTIKNAVVTVPAYFNDSQRQATKDAGTISGLNVMRI  176



>ref|NP_001266213.1| heat shock protein 70 isoform 3 [Solanum lycopersicum]
 emb|CCA29122.1| heat shock protein 70 isoform 3 [Solanum lycopersicum]
Length=651

 Score =   353 bits (906),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 167/176 (95%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GP DKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVNYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEAFLG+T+KNAVVTVPAYFNDSQRQATKDAG ISGLNVMRI
Sbjct  121  EEISSMVLIKMKEIAEAFLGTTIKNAVVTVPAYFNDSQRQATKDAGTISGLNVMRI  176



>ref|XP_008776656.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=649

 Score =   353 bits (905),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 167/173 (97%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  133  KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  312
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct  3    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  62

Query  313  MNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEEI  492
            MNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVIAGPGDKPMIVV YKGE+KQFSAEEI
Sbjct  63   MNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGPGDKPMIVVQYKGEEKQFSAEEI  122

Query  493  SSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            SSMVL KMKEIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  123  SSMVLMKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  175



>ref|XP_006349514.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=647

 Score =   352 bits (904),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 168/176 (95%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFKVI GPGDKPMIVV+YKGEDKQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPGDKPMIVVNYKGEDKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_004961848.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Setaria italica]
Length=649

 Score =   352 bits (904),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 166/173 (96%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  133  KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  312
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct  3    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  62

Query  313  MNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEEI  492
            MNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKV+AGP DKPMIVV+YKGE+KQFSAEEI
Sbjct  63   MNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVVAGPADKPMIVVNYKGEEKQFSAEEI  122

Query  493  SSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            SSMVLTKMKEIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  123  SSMVLTKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  175



>ref|XP_002441219.1| hypothetical protein SORBIDRAFT_09g022580 [Sorghum bicolor]
 gb|EES19649.1| hypothetical protein SORBIDRAFT_09g022580 [Sorghum bicolor]
Length=649

 Score =   352 bits (904),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 166/174 (95%), Positives = 172/174 (99%), Gaps = 0/174 (0%)
 Frame = +1

Query  130  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  309
             KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
Sbjct  2    AKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  310  AMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEE  489
            AMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKV+AGP DKPMIVV+YKGE+KQFSAEE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVVAGPADKPMIVVNYKGEEKQFSAEE  121

Query  490  ISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            ISSMVLTKMKEIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  122  ISSMVLTKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  175



>ref|XP_007132076.1| hypothetical protein PHAVU_011G065000g [Phaseolus vulgaris]
 gb|ESW04070.1| hypothetical protein PHAVU_011G065000g [Phaseolus vulgaris]
Length=649

 Score =   352 bits (904),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 167/176 (95%), Positives = 173/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR++D +VQSDMKLWPFKVIAGPGDKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDAAVQSDMKLWPFKVIAGPGDKPMIVVNYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_004142749.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 1 [Cucumis 
sativus]
 ref|XP_004156712.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 1 [Cucumis 
sativus]
 gb|KGN51294.1| hypothetical protein Csa_5G514500 [Cucumis sativus]
Length=648

 Score =   352 bits (904),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 166/176 (94%), Positives = 174/176 (99%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPLNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVLTKM+EIAEA+LGS+VKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLTKMREIAEAYLGSSVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>emb|CDP09040.1| unnamed protein product [Coffea canephora]
Length=649

 Score =   352 bits (904),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 166/176 (94%), Positives = 174/176 (99%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SD SVQSD+KLWPFKVI GPGDKPMI+V+YKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EE+SSMVLTKMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEVSSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_009407484.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
 ref|XP_009407485.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
Length=649

 Score =   352 bits (903),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 167/177 (94%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +1

Query  121  LMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  300
            +  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60

Query  301  NQVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFS  480
            NQVAMNP NTVFDAKRLIGRRYSDPSVQSD+KLWPFKVIAGPGDKPMIVV YKGE+KQFS
Sbjct  61   NQVAMNPINTVFDAKRLIGRRYSDPSVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFS  120

Query  481  AEEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            AEEISSMVL KMKEIAEA+LG+TVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  AEEISSMVLIKMKEIAEAYLGTTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  177



>ref|XP_010685795.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Beta vulgaris 
subsp. vulgaris]
Length=648

 Score =   352 bits (903),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 174/176 (99%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GP DKPMIVV++KGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVNHKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EE+SSMVLTKMKEIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEVSSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>gb|EAY98319.1| hypothetical protein OsI_20227 [Oryza sativa Indica Group]
Length=410

 Score =   344 bits (883),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 161/173 (93%), Positives = 170/173 (98%), Gaps = 0/173 (0%)
 Frame = +1

Query  133  KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  312
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct  3    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  62

Query  313  MNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEEI  492
            MNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKV+ GPGDKPMIVV YKGE+KQF+AEEI
Sbjct  63   MNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVVPGPGDKPMIVVQYKGEEKQFAAEEI  122

Query  493  SSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            SSMVL KM+EIAEA+LGS++KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  123  SSMVLIKMREIAEAYLGSSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  175



>ref|XP_008802761.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   352 bits (902),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 167/176 (95%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SD SVQSD+KLWPFKVIAGPGDKPMI V YKGEDKQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIGVQYKGEDKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EE+SSMVL KMKEIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEVSSMVLMKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_010095022.1| Heat shock 70 kDa protein 4 [Morus notabilis]
 gb|EXB58128.1| Heat shock 70 kDa protein 4 [Morus notabilis]
Length=651

 Score =   352 bits (902),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 175/176 (99%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SDPSVQSD+KLWPFKVIAGPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDIKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_009778799.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
Length=650

 Score =   352 bits (902),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 166/176 (94%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR++DPSVQSDMKLWPFKVI GP DKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFNDPSVQSDMKLWPFKVIPGPADKPMIVVNYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEAFLG+T+KNAVVTVPAYFNDSQRQATKDAG ISGLNVMRI
Sbjct  121  EEISSMVLVKMKEIAEAFLGTTIKNAVVTVPAYFNDSQRQATKDAGTISGLNVMRI  176



>ref|XP_009419750.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=648

 Score =   352 bits (902),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRRYSD SVQSD+KLWPFKV+ GPGDKPMI+V Y+GEDKQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRYSDASVQSDIKLWPFKVVPGPGDKPMIIVQYRGEDKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_007027053.1| Heat shock cognate protein 70-1 isoform 2, partial [Theobroma 
cacao]
 gb|EOY07555.1| Heat shock cognate protein 70-1 isoform 2, partial [Theobroma 
cacao]
Length=457

 Score =   345 bits (885),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = +1

Query  121  LMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  300
            +MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  16   VMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  75

Query  301  NQVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFS  480
            NQVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVI+GPGDKPMIVVSYKGE+KQF+
Sbjct  76   NQVAMNPVNTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGDKPMIVVSYKGEEKQFA  135

Query  481  AEEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            AEEISSMVL KM+EIAEAFLG  VKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  136  AEEISSMVLMKMREIAEAFLGFAVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  192



>ref|XP_010253827.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nelumbo 
nucifera]
Length=619

 Score =   350 bits (899),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 173/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVIAGPGDKPMI+VSYKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIMVSYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_010937646.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Elaeis guineensis]
Length=648

 Score =   351 bits (901),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 167/176 (95%), Positives = 173/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SD SVQSD+KLWPFKV+AGPGDKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDVSVQSDIKLWPFKVVAGPGDKPMIVVQYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLMKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_009380663.1| PREDICTED: heat shock cognate 70 kDa protein-like [Musa acuminata 
subsp. malaccensis]
Length=647

 Score =   351 bits (900),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 166/174 (95%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +1

Query  130  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  309
             KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
Sbjct  2    AKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  310  AMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEE  489
            AMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVIAGPGDKPMIVV YKGE+KQFS EE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGPGDKPMIVVQYKGEEKQFSPEE  121

Query  490  ISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            ISSMVLTKMKEIAEA+LG+TVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  122  ISSMVLTKMKEIAEAYLGTTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  175



>gb|EPS60056.1| heat shock protein 70 [Genlisea aurea]
Length=653

 Score =   351 bits (901),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 167/176 (95%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRRYSD SVQSD++LWPFKVI GPGDKPMIVVSYKGEDKQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRYSDASVQSDIQLWPFKVIPGPGDKPMIVVSYKGEDKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_011027580.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   351 bits (900),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 164/176 (93%), Positives = 174/176 (99%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SDPSVQSD+KLWPFKVIAGPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQSDVKLWPFKVIAGPGDKPMIVVTYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_002311161.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEE88528.1| heat shock protein 70 [Populus trichocarpa]
Length=648

 Score =   351 bits (900),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 164/176 (93%), Positives = 174/176 (99%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SDPSVQSD+KLWPFKVIAGPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQSDVKLWPFKVIAGPGDKPMIVVTYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|EYU33210.1| hypothetical protein MIMGU_mgv1a002616mg [Erythranthe guttata]
Length=653

 Score =   351 bits (900),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 166/176 (94%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SDPSVQSDMK WPFKVI GP +KPMIVVS+KGEDKQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKHWPFKVIPGPAEKPMIVVSHKGEDKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_006365705.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   351 bits (900),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 166/176 (94%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GP DKPMIVV+YKGE+K+FSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVNYKGEEKEFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEAFLG T+KNAVVTVPAYFNDSQRQATKDAG ISGLNVMRI
Sbjct  121  EEISSMVLIKMKEIAEAFLGITIKNAVVTVPAYFNDSQRQATKDAGTISGLNVMRI  176



>sp|P09189.1|HSP7C_PETHY RecName: Full=Heat shock cognate 70 kDa protein [Petunia x hybrida]
 emb|CAA30018.1| heat shock protein 70 [Petunia x hybrida]
Length=651

 Score =   350 bits (899),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 164/176 (93%), Positives = 173/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SDPSVQSD+KLWPFKVI GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDPSVQSDIKLWPFKVIPGPGDKPMIVVTYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVLTKMKEIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_009592776.1| PREDICTED: heat shock cognate 70 kDa protein 1-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   350 bits (899),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 167/176 (95%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQ DMKLWPFKVI GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDTSVQGDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVLTKMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>gb|KFK38606.1| hypothetical protein AALP_AA3G135800 [Arabis alpina]
Length=357

 Score =   341 bits (874),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SDPSVQ+DM+ WPFKVI+GP +KPMIVV++KGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQADMRHWPFKVISGPAEKPMIVVNHKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEAFLG+ VKNAVVTVPAYFNDSQRQATKDAG ISGLNV+RI
Sbjct  121  EEISSMVLIKMREIAEAFLGNPVKNAVVTVPAYFNDSQRQATKDAGAISGLNVLRI  176



>gb|EYU41710.1| hypothetical protein MIMGU_mgv1a022248mg, partial [Erythranthe 
guttata]
Length=371

 Score =   341 bits (875),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFK+I GPGDKP+IVV+YKGEDKQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFNDASVQSDIKLWPFKLIPGPGDKPLIVVNYKGEDKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_004249574.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Solanum lycopersicum]
Length=644

 Score =   350 bits (898),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 166/176 (94%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFKVI GPGDKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEAFLG+TVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLIKMKEIAEAFLGTTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_004287404.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Fragaria 
vesca subsp. vesca]
Length=649

 Score =   350 bits (898),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQ DMKLWPFKV+AGPGDKPMIVVSYKGEDKQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDSSVQGDMKLWPFKVVAGPGDKPMIVVSYKGEDKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNV+RI
Sbjct  121  EEISSMVLVKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRI  176



>gb|AAS57912.1| 70 kDa heat shock cognate protein 1 [Vigna radiata]
Length=649

 Score =   350 bits (898),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 167/176 (95%), Positives = 173/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SD SVQSD+KLWPFKVI+G GDKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGAGDKPMIVVNYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_008674843.1| PREDICTED: heat shock 70 kDa protein-like [Zea mays]
 tpg|DAA56909.1| TPA: hypothetical protein ZEAMMB73_648566 [Zea mays]
Length=648

 Score =   350 bits (898),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 165/174 (95%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +1

Query  130  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  309
             KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
Sbjct  2    AKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  310  AMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEE  489
            AMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GPGDKPMIVVSYKGE+KQF+AEE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVSYKGEEKQFAAEE  121

Query  490  ISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            ISSMVL KMKEIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  122  ISSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  175



>emb|CCA29120.1| heat shock protein 70 isoform 1 [Solanum lycopersicum]
Length=648

 Score =   350 bits (897),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 166/176 (94%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQ DMKLWPFKVI GPGDKPMIVV+YKGE+K+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQEDMKLWPFKVIPGPGDKPMIVVTYKGEEKEFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_002316294.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEF02465.1| heat shock protein 70 [Populus trichocarpa]
Length=648

 Score =   350 bits (897),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 164/176 (93%), Positives = 173/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SDPSVQSD+KLWPFKV+AGPGDKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDPSVQSDIKLWPFKVVAGPGDKPMIVVTYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEAFLG++V NAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAFLGTSVNNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|EAY81899.1| hypothetical protein OsI_37065 [Oryza sativa Indica Group]
Length=434

 Score =   343 bits (879),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVIAGPGDKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_006350760.1| PREDICTED: heat shock cognate 70 kDa protein 1-like [Solanum 
tuberosum]
Length=648

 Score =   350 bits (897),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 166/176 (94%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQ DMKLWPFKVI GPGDKPMIVV+YKGE+K+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQEDMKLWPFKVIPGPGDKPMIVVTYKGEEKEFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>gb|ACJ11745.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score =   349 bits (896),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 164/176 (93%), Positives = 173/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRRYSD SVQSDMKLWPFKVIAGPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRYSDSSVQSDMKLWPFKVIAGPGDKPMIVVTYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_008370710.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Malus domestica]
Length=649

 Score =   349 bits (896),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GPGDKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVXYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGS+VKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGSSVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_010558794.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Tarenaya hassleriana]
Length=649

 Score =   349 bits (896),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 164/176 (93%), Positives = 173/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRRYSDPSVQ+DMKLWPFKVI GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRYSDPSVQADMKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG++VKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGTSVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|EEC71767.1| hypothetical protein OsI_04375 [Oryza sativa Indica Group]
Length=423

 Score =   342 bits (877),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +1

Query  130  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  309
             KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQV
Sbjct  2    AKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQV  61

Query  310  AMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEE  489
            AMNP NTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GPGDKPMIVV YKGE+KQFSAEE
Sbjct  62   AMNPINTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVQYKGEEKQFSAEE  121

Query  490  ISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            ISSMVL KM+EIAEA+LGS +KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  122  ISSMVLIKMREIAEAYLGSNIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  175



>gb|EMT11425.1| Heat shock cognate 70 kDa protein 1 [Aegilops tauschii]
Length=648

 Score =   349 bits (895),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 164/176 (93%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR SDPSVQSDMKLWPFKVIAGPGDKPMIVV YKGE+K+F+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRVSDPSVQSDMKLWPFKVIAGPGDKPMIVVQYKGEEKEFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>emb|CDY50531.1| BnaA01g30490D [Brassica napus]
Length=650

 Score =   349 bits (895),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 163/176 (93%), Positives = 174/176 (99%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SDPSVQ+DM+ WPFKVI+GP +KPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQADMRHWPFKVISGPAEKPMIVVNYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVLTKM+EIAEAFLG++VKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLTKMREIAEAFLGTSVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_010253221.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nelumbo 
nucifera]
Length=648

 Score =   349 bits (895),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVIAGPGDKPMIVV+YKGEDKQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVTYKGEDKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|KJB55903.1| hypothetical protein B456_009G100400 [Gossypium raimondii]
Length=650

 Score =   349 bits (895),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SD SVQSDMKLWPFKVI GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDSSVQSDMKLWPFKVIPGPGDKPMIVVTYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLMKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|EPS64948.1| hypothetical protein M569_09829, partial [Genlisea aurea]
Length=635

 Score =   348 bits (894),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  118  LLMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  297
            LLMA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA
Sbjct  7    LLMAVKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  66

Query  298  KNQVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQF  477
            KNQVAMNP NTVFDAKRLIGRR+SDPSVQSD+KLWPFKVIAG GDKPMIVVSYKGE+KQF
Sbjct  67   KNQVAMNPINTVFDAKRLIGRRFSDPSVQSDIKLWPFKVIAGAGDKPMIVVSYKGEEKQF  126

Query  478  SAEEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            SAEEISSMVL KMKE AEA+LG++VKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  127  SAEEISSMVLIKMKETAEAYLGTSVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  184



>ref|XP_010095013.1| Heat shock 70 kDa protein 4 [Morus notabilis]
 gb|EXB58119.1| Heat shock 70 kDa protein 4 [Morus notabilis]
Length=648

 Score =   349 bits (895),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 163/176 (93%), Positives = 174/176 (99%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR++DPSVQSD+KLWPFKVI+GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFNDPSVQSDIKLWPFKVISGPGDKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|AAN86274.1| non-cell-autonomous heat shock cognate protein 70 [Cucurbita 
maxima]
Length=647

 Score =   349 bits (895),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD  VQSD+KLWPFKVIAGPGDKPMIVVSYKGEDKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDAPVQSDIKLWPFKVIAGPGDKPMIVVSYKGEDKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|ACJ11742.1| heat shock protein 70 [Gossypium hirsutum]
 gb|KJB67650.1| hypothetical protein B456_010G202100 [Gossypium raimondii]
Length=648

 Score =   349 bits (895),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 164/176 (93%), Positives = 173/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRRYSD SVQSDMKLWPFKVIAGPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRYSDSSVQSDMKLWPFKVIAGPGDKPMIVVTYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_009120551.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Brassica rapa]
Length=650

 Score =   349 bits (895),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 163/176 (93%), Positives = 174/176 (99%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SDPSVQ+DM+ WPFKVI+GP +KPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQADMRHWPFKVISGPAEKPMIVVNYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVLTKM+EIAEAFLG++VKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLTKMREIAEAFLGTSVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>emb|CCA29121.1| heat shock protein 70 isoform 2 [Solanum lycopersicum]
Length=644

 Score =   348 bits (894),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFKVI GPGDKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL +MKEIAEAFLG+TVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLIRMKEIAEAFLGTTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_009388623.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=649

 Score =   348 bits (894),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 164/176 (93%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRRYSD SVQSD+KLWPFKVIAGPGDKPMIVV YKGE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRYSDSSVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNV+RI
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRI  176



>ref|XP_006644983.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Oryza brachyantha]
Length=649

 Score =   348 bits (894),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 165/173 (95%), Positives = 169/173 (98%), Gaps = 0/173 (0%)
 Frame = +1

Query  133  KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  312
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVA
Sbjct  3    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVA  62

Query  313  MNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEEI  492
            MNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVI GPGDKPMIVV YKGE+KQFSAEEI
Sbjct  63   MNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIPGPGDKPMIVVQYKGEEKQFSAEEI  122

Query  493  SSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            SSMVL KMKEIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVI GLNVMRI
Sbjct  123  SSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIGGLNVMRI  175



>ref|XP_002527736.1| heat shock protein, putative [Ricinus communis]
 gb|EEF34649.1| heat shock protein, putative [Ricinus communis]
Length=647

 Score =   348 bits (894),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 164/176 (93%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFKVI GPGDKPMI+VSYKGEDKQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFTDASVQSDIKLWPFKVIPGPGDKPMIIVSYKGEDKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|KDP35613.1| hypothetical protein JCGZ_09051 [Jatropha curcas]
Length=648

 Score =   348 bits (894),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 164/176 (93%), Positives = 173/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFKVI+GPGDKPMIVVSYKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKVISGPGDKPMIVVSYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|KHN21966.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=646

 Score =   348 bits (894),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SD SVQ DMKLWPFKVI GP +KPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIPGPAEKPMIVVNYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLMKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>gb|KDP44981.1| hypothetical protein JCGZ_01481 [Jatropha curcas]
Length=648

 Score =   348 bits (894),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVI GPGDKPMIVVSYKGEDKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIVVSYKGEDKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG+TVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGTTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|AAR17080.1| heat shock protein 70-3 [Nicotiana tabacum]
Length=648

 Score =   348 bits (894),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVI+GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGDKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_009620324.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   348 bits (894),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVI+GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGDKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_004505872.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=649

 Score =   348 bits (894),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 167/176 (95%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR SD SVQSDMKLWPFKVI GP +KPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRISDASVQSDMKLWPFKVIPGPAEKPMIVVNYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLMKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_003537997.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Glycine max]
Length=649

 Score =   348 bits (893),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SD SVQ DMKLWPFKVI GP +KPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIPGPAEKPMIVVNYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLMKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|NP_001234491.1| heat shock cognate 70 kDa protein 1 [Solanum lycopersicum]
 sp|P24629.1|HSP71_SOLLC RecName: Full=Heat shock cognate 70 kDa protein 1 [Solanum lycopersicum]
 emb|CAA37970.1| heat shock protein cognate 70 [Solanum lycopersicum]
Length=650

 Score =   348 bits (893),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVA+NP NTVFDAKRLIGRR+SD SVQ DMKLWPFKVI GPGDKPMIVV+YKGE+K+F+A
Sbjct  61   QVALNPINTVFDAKRLIGRRFSDASVQEDMKLWPFKVIPGPGDKPMIVVTYKGEEKEFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_009777579.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
Length=648

 Score =   348 bits (893),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVI+GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGDKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>emb|CDY02235.1| BnaA03g39320D [Brassica napus]
Length=185

 Score =   332 bits (852),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFK+I GP DKPMIVVSYKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKIIPGPADKPMIVVSYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG T+KNAVVTVPAYFNDSQRQATKDAGVI+GLN   +
Sbjct  121  EEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNATSV  176



>ref|XP_010922357.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Elaeis guineensis]
Length=648

 Score =   348 bits (893),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SD SVQSD+KLWPFKVI GPGDKPMIVV YKGEDKQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIVVQYKGEDKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG TVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLMKMREIAEAYLGYTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|AAN86275.1| non-cell-autonomous heat shock cognate protein 70 [Cucurbita 
maxima]
Length=652

 Score =   348 bits (893),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDNERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVIAGPGDKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIAGPGDKPMIVVNYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EE+SSMVL KMKEIAEA+LG+TVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEVSSMVLIKMKEIAEAYLGTTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_008233611.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Prunus mume]
Length=649

 Score =   348 bits (893),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 173/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GPGDKPMIVV+YKGE++QF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVTYKGEERQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG++VKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGASVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_003539680.2| PREDICTED: heat shock cognate 70 kDa protein 2 [Glycine max]
 gb|KHN32117.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=649

 Score =   348 bits (893),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFKVI GP DKPMIVV+YKG++KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPADKPMIVVNYKGDEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_008784530.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Phoenix dactylifera]
Length=649

 Score =   348 bits (893),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKV+AGPGDKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDVKLWPFKVVAGPGDKPMIVVQYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKE AEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLIKMKETAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_009786102.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nicotiana sylvestris]
Length=648

 Score =   348 bits (893),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SD SVQSDMKLWPFKVI G GDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGAGDKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEAFLG+TVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLIKMKEIAEAFLGTTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_004142076.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Cucumis sativus]
 ref|XP_004161675.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Cucumis sativus]
 gb|KGN54238.1| Heat shock protein 70 [Cucumis sativus]
Length=647

 Score =   348 bits (892),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 164/176 (93%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVI GPGDKPMI+VSYKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIIVSYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_009597695.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nicotiana tomentosiformis]
Length=648

 Score =   348 bits (892),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SD SVQSDMKLWPFKVI G GDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGAGDKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEAFLG+TVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLIKMKEIAEAFLGTTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>gb|ABP35942.1| heat shock protein 70 [Cyclamen persicum]
Length=650

 Score =   348 bits (892),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFKVIAGPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>emb|CDX89754.1| BnaC03g46680D [Brassica napus]
Length=224

 Score =   333 bits (855),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  40   MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  99

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFK+I GP DKPMIVVSYKGE+KQF+A
Sbjct  100  QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKIIPGPADKPMIVVSYKGEEKQFAA  159

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG T+KNAVVTVPAYFNDSQRQATKDAGVI+GLN   +
Sbjct  160  EEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNATSV  215



>ref|XP_010918390.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Elaeis guineensis]
Length=649

 Score =   348 bits (892),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 165/173 (95%), Positives = 169/173 (98%), Gaps = 0/173 (0%)
 Frame = +1

Query  133  KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  312
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct  3    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  62

Query  313  MNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEEI  492
            MNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GP DKPMIVV YKGE+KQFSAEEI
Sbjct  63   MNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPNDKPMIVVQYKGEEKQFSAEEI  122

Query  493  SSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            SSMVL KMKEIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  123  SSMVLMKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  175



>gb|ABR18415.1| unknown [Picea sitchensis]
 gb|ACN39931.1| unknown [Picea sitchensis]
 gb|ACN39963.1| unknown [Picea sitchensis]
Length=652

 Score =   348 bits (892),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 163/173 (94%), Positives = 172/173 (99%), Gaps = 0/173 (0%)
 Frame = +1

Query  133  KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  312
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct  3    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  62

Query  313  MNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEEI  492
            MNPTNTVFDAKRLIGRR+SDP+VQ+DMKLWPFKVI+GP +KPMIVVSYKGEDKQF+AEEI
Sbjct  63   MNPTNTVFDAKRLIGRRFSDPTVQNDMKLWPFKVISGPAEKPMIVVSYKGEDKQFAAEEI  122

Query  493  SSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            SSMVLTKMKEIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  123  SSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  175



>ref|XP_006407319.1| hypothetical protein EUTSA_v10020257mg [Eutrema salsugineum]
 gb|ESQ48772.1| hypothetical protein EUTSA_v10020257mg [Eutrema salsugineum]
Length=650

 Score =   347 bits (891),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 173/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SDPSVQ+DM+ WPFKV++GP +KPMIVV++KGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQADMRHWPFKVVSGPAEKPMIVVNHKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVLTKM+EIAEAFLGS +KNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLTKMREIAEAFLGSPIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_004142745.1| PREDICTED: heat shock cognate 70 kDa protein-like [Cucumis sativus]
 gb|KGN51286.1| Heat shock protein 70 [Cucumis sativus]
Length=652

 Score =   347 bits (891),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVIAGP DKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPSDKPMIVVNYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEA+LG+TVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLIKMKEIAEAYLGTTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_002528432.1| heat shock protein, putative [Ricinus communis]
 gb|EEF33915.1| heat shock protein, putative [Ricinus communis]
Length=649

 Score =   347 bits (891),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 164/176 (93%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRRYSD SVQSD+KLWPFKVIAGPGDKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRYSDASVQSDIKLWPFKVIAGPGDKPMIVVAYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGLTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_008458906.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cucumis 
melo]
Length=652

 Score =   347 bits (891),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEG AIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGTAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SDPSVQSD+KLWPFKVIAGP DKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDPSVQSDIKLWPFKVIAGPSDKPMIVVNYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEA+LG+TVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLIKMKEIAEAYLGTTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_008447699.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Cucumis melo]
Length=647

 Score =   347 bits (890),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 164/176 (93%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVI GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_010253202.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nelumbo nucifera]
Length=648

 Score =   347 bits (890),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 164/176 (93%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVIAGPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVTYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|KEH30132.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=578

 Score =   345 bits (884),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR SD SVQSDMKLWPFKVI GP DKPMIVV+YK E+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRISDVSVQSDMKLWPFKVIPGPADKPMIVVNYKAEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLMKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>emb|CDY52661.1| BnaC01g38510D [Brassica napus]
Length=647

 Score =   347 bits (889),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 173/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MASKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SDPSVQ+DM+ WPFKVI+GP +KPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQADMRHWPFKVISGPAEKPMIVVNYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVLTKM+EIAEAFLG++VKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLTKMREIAEAFLGTSVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_011027172.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c isoform X1 [Populus euphratica]
 ref|XP_011027173.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c isoform X2 [Populus euphratica]
Length=648

 Score =   347 bits (889),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SDPSVQ+D+KLWPFKV+AGPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDPSVQNDIKLWPFKVVAGPGDKPMIVVTYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEAFLG+ V NAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAFLGTAVNNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|AGR45355.1| HSP70 [Dendrobium catenatum]
Length=647

 Score =   347 bits (889),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 164/176 (93%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVI GPGDKPMIVV YKGEDKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIVVQYKGEDKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG+TVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGATVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_008812036.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Phoenix dactylifera]
Length=647

 Score =   347 bits (889),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = +1

Query  130  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  309
             KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
Sbjct  2    AKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  310  AMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEE  489
            AMNPTNTVFDAKRLIGRR+SDPSVQ+D KLWPFKVIAGPGDKPMIVV YKGE+KQFS EE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQADRKLWPFKVIAGPGDKPMIVVQYKGEEKQFSPEE  121

Query  490  ISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            ISSMVLTKMKEIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  122  ISSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  175



>gb|AIZ68155.1| heat shock protein 70 [Ornithogalum saundersiae]
Length=648

 Score =   347 bits (889),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFK+I+GPGDKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKLISGPGDKPMIVVQYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_007009362.1| Heat shock cognate protein 70-1 [Theobroma cacao]
 gb|EOY18172.1| Heat shock cognate protein 70-1 [Theobroma cacao]
Length=652

 Score =   347 bits (889),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 163/176 (93%), Positives = 173/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFKVIAGPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDSSVQSDIKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_004307259.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Fragaria vesca subsp. vesca]
Length=649

 Score =   347 bits (889),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 163/176 (93%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR++DPSVQ D+K WPFKV+AGP +KPMIVVSYKGE+KQFSA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFNDPSVQGDIKHWPFKVVAGPAEKPMIVVSYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVLTKM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLTKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_008812042.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   346 bits (888),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 164/176 (93%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD  VQSD+KLWPFKV+AGPGDKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDACVQSDVKLWPFKVVAGPGDKPMIVVQYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEA+LGSTVKN VVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLMKMKEIAEAYLGSTVKNGVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>gb|EAY89450.1| hypothetical protein OsI_10982 [Oryza sativa Indica Group]
Length=438

 Score =   340 bits (871),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD KLWPFKV+ GPGDKPMI V YKGE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDTSVQSDAKLWPFKVLPGPGDKPMIGVQYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKE AEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLNKMKETAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>sp|P27322.1|HSP72_SOLLC RecName: Full=Heat shock cognate 70 kDa protein 2 [Solanum lycopersicum]
 emb|CAA37971.1| heat shock protein cognate 70 [Solanum lycopersicum]
Length=644

 Score =   346 bits (888),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFKVI GPGDKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEAFLG+TVKNAVVTVPAY NDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLIKMKEIAEAFLGTTVKNAVVTVPAYSNDSQRQATKDAGVISGLNVMRI  176



>emb|CDP00073.1| unnamed protein product [Coffea canephora]
Length=634

 Score =   346 bits (887),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 163/176 (93%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFKVIAG GDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPLNTVFDAKRLIGRRFSDSSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEA+LG+++KNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLNKMKEIAEAYLGTSIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>gb|EPS68565.1| hypothetical protein M569_06198 [Genlisea aurea]
Length=650

 Score =   346 bits (888),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVIAG GDKPMIVVSYKGEDKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGVGDKPMIVVSYKGEDKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIA+A+LG+TVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMKEIADAYLGTTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_004250958.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
lycopersicum]
Length=649

 Score =   346 bits (888),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKV  GPGDKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVTPGPGDKPMIVVNYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>gb|ADD71975.1| heat shock protein 70 [Rhododendron calophytum]
Length=651

 Score =   346 bits (888),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 164/176 (93%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFKVIAGPG+KPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVIAGPGEKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLVKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_003552691.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform 1 [Glycine 
max]
Length=649

 Score =   346 bits (888),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 164/176 (93%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFKVI GP DKPMIVV+YKGEDKQFSA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPADKPMIVVNYKGEDKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_006348998.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   346 bits (888),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKV  GPGDKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVTPGPGDKPMIVVNYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_004492118.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=649

 Score =   346 bits (888),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR SD SVQSDMKLWPFKVI GP DKPMIVV+YKGEDKQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRISDASVQSDMKLWPFKVIPGPADKPMIVVNYKGEDKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVLTKM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLTKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|KHN13891.1| Heat shock cognate 70 kDa protein 2 [Glycine soja]
Length=649

 Score =   346 bits (887),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 164/176 (93%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFKVI GP DKPMIVV+YKGEDKQFSA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPADKPMIVVNYKGEDKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_010106444.1| Heat shock cognate 70 kDa protein [Morus notabilis]
 gb|EXC10620.1| Heat shock cognate 70 kDa protein [Morus notabilis]
Length=652

 Score =   346 bits (888),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SDPSVQ+DMKLWPFKVIAGPGDKPMIVV++KGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQNDMKLWPFKVIAGPGDKPMIVVNHKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEA+LG  +KNAVVTVPAYFNDSQRQATKDAGVI+ LNVMRI
Sbjct  121  EEISSMVLIKMKEIAEAYLGIAIKNAVVTVPAYFNDSQRQATKDAGVIASLNVMRI  176



>ref|XP_011094842.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Sesamum indicum]
Length=646

 Score =   346 bits (887),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 163/176 (93%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR++D SVQSD+KLWPFKVI GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFTDASVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>emb|CDY53148.1| BnaAnng12070D [Brassica napus]
Length=256

 Score =   333 bits (853),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFK+I GP DKPMIVVSYKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIVVSYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG T+KNAVVTVPAYFNDSQRQATKDAGVI+GLN   +
Sbjct  121  EEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNATSV  176



>ref|XP_007220208.1| hypothetical protein PRUPE_ppa002641mg [Prunus persica]
 gb|EMJ21407.1| hypothetical protein PRUPE_ppa002641mg [Prunus persica]
Length=649

 Score =   346 bits (887),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GPGDKPMIVV+YKGE++QF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVTYKGEERQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG +VKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGLSVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_006833219.1| hypothetical protein AMTR_s00072p00181720 [Amborella trichopoda]
 gb|ERM98497.1| hypothetical protein AMTR_s00072p00181720 [Amborella trichopoda]
Length=657

 Score =   346 bits (888),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 164/176 (93%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVI GPGDKPMIVV YKGEDKQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIVVQYKGEDKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGS VKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLMKMREIAEAYLGSAVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_008784528.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   345 bits (886),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERL+GDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLVGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SD SVQSDM+LWPFKVI GPGDKP+IVV YKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDTSVQSDMRLWPFKVIPGPGDKPLIVVQYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGS++KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLMKMREIAEAYLGSSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|KEH30133.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   345 bits (886),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR SD SVQSDMKLWPFKVI GP DKPMIVV+YK E+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRISDVSVQSDMKLWPFKVIPGPADKPMIVVNYKAEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLMKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_009409520.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Musa acuminata 
subsp. malaccensis]
Length=648

 Score =   345 bits (886),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 164/176 (93%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVI GPGDKPMIVV YKGEDKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVQYKGEDKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEA+LGS VKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMKEIAEAYLGSVVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>emb|CAB72129.1| heat shock protein 70 [Cucumis sativus]
Length=652

 Score =   345 bits (886),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/176 (93%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEI ANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIFANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVIAGP DKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPSDKPMIVVNYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEA+LG+TVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLIKMKEIAEAYLGTTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>gb|ACJ11740.1| heat shock protein 70 [Gossypium hirsutum]
Length=647

 Score =   345 bits (886),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 163/176 (93%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD KLWPFKVIAGPGDKPMI V+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDTKLWPFKVIAGPGDKPMICVAYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_010555208.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Tarenaya 
hassleriana]
Length=652

 Score =   345 bits (886),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 163/176 (93%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD KLWPFKVI GPGDKPMIVV+YKGEDKQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDAKLWPFKVIPGPGDKPMIVVNYKGEDKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>emb|CDX73815.1| BnaA03g32320D [Brassica napus]
Length=652

 Score =   345 bits (886),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 173/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SDPSVQ+DM+ WPFKVI+GP +KPMI V+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQADMRHWPFKVISGPAEKPMISVNYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVLTKM+EIAEA+LG+++KNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLTKMREIAEAYLGTSIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_009135236.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Brassica rapa]
Length=652

 Score =   345 bits (886),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 173/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SDPSVQ+DM+ WPFKVI+GP +KPMI V+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQADMRHWPFKVISGPAEKPMISVNYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVLTKM+EIAEA+LG+++KNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLTKMREIAEAYLGTSIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_002263599.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=649

 Score =   345 bits (886),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERL+GDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLVGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD +VQSD+KLWPFKV+AGPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDATVQSDIKLWPFKVVAGPGDKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGS VKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLMKMREIAEAYLGSAVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_008371627.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Malus domestica]
 gb|AAF34134.1| high molecular weight heat shock protein [Malus domestica]
Length=650

 Score =   345 bits (885),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRRYSDPSVQ DMK WPFKVI GPGDKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRYSDPSVQGDMKHWPFKVIPGPGDKPMIVVIYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGS++KNAVVTVPAYFNDSQRQATKDAGVI+GLNV+RI
Sbjct  121  EEISSMVLVKMREIAEAYLGSSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRI  176



>emb|CDY00784.1| BnaC03g37680D [Brassica napus]
Length=650

 Score =   345 bits (885),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 173/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SDPSVQ+DM+ WPFKVI+GP +KPMI V+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQADMRHWPFKVISGPAEKPMISVNYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVLTKM+EIAEA+LG+++KNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLTKMREIAEAYLGTSIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>gb|ACJ54890.1| heat shock protein 70 [Oryza sativa Japonica Group]
Length=653

 Score =   345 bits (886),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 173/177 (98%), Gaps = 1/177 (1%)
 Frame = +1

Query  124  MAG-KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  300
            MAG KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGNKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60

Query  301  NQVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFS  480
            NQVAMNPTNTVFDAKRLIGRR+SDPSVQ+DMK+WPFKV+ GP DKPMIVV+YKGE+K+FS
Sbjct  61   NQVAMNPTNTVFDAKRLIGRRFSDPSVQADMKMWPFKVVPGPADKPMIVVTYKGEEKKFS  120

Query  481  AEEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            AEEISSMVLTKMKEIAEAFL +T+KNAV+TVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  AEEISSMVLTKMKEIAEAFLSTTIKNAVITVPAYFNDSQRQATKDAGVISGLNVMRI  177



>ref|WP_039310754.1| molecular chaperone DnaK [Paenibacillus sp. IHB B 3415]
 gb|AHL69785.1| heat shock protein [Camellia sinensis]
 gb|KHL91223.1| molecular chaperone DnaK [Paenibacillus sp. IHB B 3415]
Length=650

 Score =   345 bits (885),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 163/176 (93%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR++D SVQSDMKLWPFKVIAGPGDKPMI V+YKGE+K F+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFTDASVQSDMKLWPFKVIAGPGDKPMIGVNYKGEEKLFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_002284008.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
 emb|CAN81694.1| hypothetical protein VITISV_017873 [Vitis vinifera]
Length=648

 Score =   345 bits (885),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/176 (93%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVI GPGDKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVVYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|KJB16980.1| hypothetical protein B456_002G258500 [Gossypium raimondii]
Length=613

 Score =   344 bits (882),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFKVIAGPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDSSVQSDIKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG TVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGFTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|ABF95267.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
 gb|EAZ26449.1| hypothetical protein OsJ_10337 [Oryza sativa Japonica Group]
Length=653

 Score =   345 bits (885),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 173/177 (98%), Gaps = 1/177 (1%)
 Frame = +1

Query  124  MAG-KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  300
            MAG KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGNKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60

Query  301  NQVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFS  480
            NQVAMNPTNTVFDAKRLIGRR+SDPSVQ+DMK+WPFKV+ GP DKPMIVV+YKGE+K+FS
Sbjct  61   NQVAMNPTNTVFDAKRLIGRRFSDPSVQADMKMWPFKVVPGPADKPMIVVTYKGEEKKFS  120

Query  481  AEEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            AEEISSMVLTKMKEIAEAFL +T+KNAV+TVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  AEEISSMVLTKMKEIAEAFLSTTIKNAVITVPAYFNDSQRQATKDAGVISGLNVMRI  177



>ref|XP_002456611.1| hypothetical protein SORBIDRAFT_03g039360 [Sorghum bicolor]
 gb|EES01731.1| hypothetical protein SORBIDRAFT_03g039360 [Sorghum bicolor]
Length=648

 Score =   345 bits (885),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = +1

Query  130  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  309
             K EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
Sbjct  2    AKSEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  310  AMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEE  489
            AMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GPGDKPMIVV+YKGE+KQF+AEE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFAAEE  121

Query  490  ISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            ISSMVL KM+EIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  122  ISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  175



>ref|XP_004970526.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Setaria italica]
Length=648

 Score =   345 bits (885),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = +1

Query  130  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  309
             K EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
Sbjct  2    AKSEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  310  AMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEE  489
            AMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GPGDKPMIVV+YKGE+KQF+AEE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFAAEE  121

Query  490  ISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            ISSMVL KM+EIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  122  ISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  175



>ref|XP_002284063.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=652

 Score =   345 bits (885),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 173/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVIAGPGDKPMIVV+Y+GE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIAGPGDKPMIVVNYRGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG+++KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGTSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_010937656.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Elaeis guineensis]
Length=647

 Score =   345 bits (884),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +1

Query  130  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  309
             KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
Sbjct  2    AKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  310  AMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEE  489
            AMNPTNTVFDAKRLIGRR+SDPSVQ+DMKLWPFKVIAGPGDKP+IVV YKGE+K F+ EE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQADMKLWPFKVIAGPGDKPLIVVQYKGEEKHFTPEE  121

Query  490  ISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            ISSMVLTKMKEIAEA+LG TVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  122  ISSMVLTKMKEIAEAYLGITVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  175



>ref|NP_001055754.1| Os05g0460000 [Oryza sativa Japonica Group]
 gb|AAT39165.1| putative hsp70 [Oryza sativa Japonica Group]
 dbj|BAF17668.1| Os05g0460000 [Oryza sativa Japonica Group]
 dbj|BAH01403.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63984.1| hypothetical protein OsJ_18811 [Oryza sativa Japonica Group]
Length=646

 Score =   345 bits (884),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/173 (93%), Positives = 170/173 (98%), Gaps = 0/173 (0%)
 Frame = +1

Query  133  KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  312
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct  3    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  62

Query  313  MNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEEI  492
            MNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKV+ GPGDKPMIVV YKGE+KQF+AEEI
Sbjct  63   MNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVVPGPGDKPMIVVQYKGEEKQFAAEEI  122

Query  493  SSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            SSMVL KM+EIAEA+LGS++KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  123  SSMVLIKMREIAEAYLGSSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  175



>ref|XP_011077460.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Sesamum 
indicum]
Length=646

 Score =   345 bits (884),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR++D SVQSD+KLWPFKVI GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFTDASVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG+TVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLMKMREIAEAYLGATVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|NP_001183165.1| uncharacterized protein LOC100501536 [Zea mays]
 gb|ACR35910.1| unknown [Zea mays]
 gb|AFW84633.1| heat shock protein1 [Zea mays]
Length=648

 Score =   345 bits (884),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 162/173 (94%), Positives = 169/173 (98%), Gaps = 0/173 (0%)
 Frame = +1

Query  133  KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  312
            K EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKNQVA
Sbjct  3    KSEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVA  62

Query  313  MNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEEI  492
            MNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GPGDKPMIVV+YKGE+KQF+AEEI
Sbjct  63   MNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFAAEEI  122

Query  493  SSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            SSMVL KMKEIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  123  SSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  175



>gb|AFA51946.1| heat shock protein 70 [Paeonia suffruticosa]
Length=650

 Score =   344 bits (883),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SD SVQSD+KLWPFK+I GP +KPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKLIPGPAEKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLMKMREIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|AEK70336.1| heat shock protein 70 [Paeonia lactiflora]
Length=650

 Score =   344 bits (883),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SD SVQSD+KLWPFK+I GP +KPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKLIPGPAEKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLMKMREIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|KJB73858.1| hypothetical protein B456_011G256600 [Gossypium raimondii]
Length=652

 Score =   344 bits (883),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWP+KVIAG GDKPMI+VSYKGEDKQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDSSVQSDIKLWPYKVIAGSGDKPMIIVSYKGEDKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVLTKM+EIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLTKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|EEC76425.1| hypothetical protein OsI_14101 [Oryza sativa Indica Group]
Length=434

 Score =   337 bits (865),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 167/173 (97%), Gaps = 0/173 (0%)
 Frame = +1

Query  133  KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  312
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKNQVA
Sbjct  5    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVA  64

Query  313  MNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEEI  492
            MNP NTVFDAKRLIGRR+SD SVQSD+K+WP+KVI GPGDKPMIVV YKGE+KQFSAEEI
Sbjct  65   MNPINTVFDAKRLIGRRFSDASVQSDIKMWPYKVIPGPGDKPMIVVQYKGEEKQFSAEEI  124

Query  493  SSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            SSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  125  SSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  177



>gb|KDP44975.1| hypothetical protein JCGZ_01475 [Jatropha curcas]
Length=617

 Score =   343 bits (880),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFKVI GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG TVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGITVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_007027052.1| Heat shock cognate protein 70-1 isoform 1 [Theobroma cacao]
 gb|EOY07554.1| Heat shock cognate protein 70-1 isoform 1 [Theobroma cacao]
Length=646

 Score =   344 bits (882),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 163/176 (93%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVI+GPGDKPMIVVSYKGE+KQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGDKPMIVVSYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEAFLG  VKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLMKMREIAEAFLGFAVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_004307527.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Fragaria vesca 
subsp. vesca]
Length=651

 Score =   344 bits (883),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQ DMKLWPFKV+AGPGDKPMI VSYKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQGDMKLWPFKVVAGPGDKPMINVSYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG+TVKNAVVTVPAYFNDSQRQATKDAGVI+GLNV+RI
Sbjct  121  EEISSMVLVKMREIAEAYLGTTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRI  176



>ref|XP_003564580.1| PREDICTED: heat shock cognate 70 kDa protein [Brachypodium distachyon]
Length=654

 Score =   344 bits (883),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MA  GEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAKGGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GPGDKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVQYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEI EA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMKEIGEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|KEH30131.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   344 bits (883),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 163/176 (93%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+ D SVQSDMKLWPFKVI GP DKPMIVV+YK E+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFGDVSVQSDMKLWPFKVIPGPADKPMIVVNYKAEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVISGLNV+RI
Sbjct  121  EEISSMVLMKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVLRI  176



>ref|XP_008802766.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Phoenix dactylifera]
Length=648

 Score =   344 bits (882),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +1

Query  130  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  309
             K EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
Sbjct  2    AKAEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  310  AMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEE  489
            AMNPTNTVFDAKRLIGRR+SDPSVQ+DMKLWPFKVI GPGDKPMIVV YK E+KQFSAEE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQNDMKLWPFKVIPGPGDKPMIVVQYKCEEKQFSAEE  121

Query  490  ISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            ISSMVL KMKEIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  122  ISSMVLMKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  175



>ref|XP_006407676.1| hypothetical protein EUTSA_v10020258mg [Eutrema salsugineum]
 gb|ESQ49129.1| hypothetical protein EUTSA_v10020258mg [Eutrema salsugineum]
Length=650

 Score =   344 bits (882),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFK+I GP DKPMIVV+YKGEDK+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIVVNYKGEDKEFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSM+L KM+EIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMILIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>dbj|BAJ34054.1| unnamed protein product [Thellungiella halophila]
Length=650

 Score =   344 bits (882),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFK+I GP DKPMIVV+YKGEDK+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIVVNYKGEDKEFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSM+L KM+EIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMILIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_006649853.1| PREDICTED: heat shock cognate 70 kDa protein-like [Oryza brachyantha]
Length=653

 Score =   344 bits (882),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 174/177 (98%), Gaps = 1/177 (1%)
 Frame = +1

Query  124  MAG-KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  300
            MAG KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGNKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60

Query  301  NQVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFS  480
            NQVAMNPTNTVFDAKRLIGRR+SDPSVQ+DMK+WPFKV+ GPGDKPMIVV++KGE+K+FS
Sbjct  61   NQVAMNPTNTVFDAKRLIGRRFSDPSVQADMKMWPFKVVPGPGDKPMIVVTHKGEEKKFS  120

Query  481  AEEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            AEEISSMVLTKMKEIAEAFL +T+KNAV+TVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  AEEISSMVLTKMKEIAEAFLSTTIKNAVITVPAYFNDSQRQATKDAGVIAGLNVMRI  177



>gb|ABA95501.2| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=615

 Score =   343 bits (879),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVIAGPGDKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|ADZ46371.1| HSP70 [Malus hupehensis]
Length=650

 Score =   344 bits (882),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRRYSDPSVQ DMK WPFK I GPGDKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRYSDPSVQGDMKHWPFKAIPGPGDKPMIVVMYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGS++KNAVVTVPAYFNDSQRQATKDAGVI+GLNV+RI
Sbjct  121  EEISSMVLVKMREIAEAYLGSSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRI  176



>gb|EAY89457.1| hypothetical protein OsI_10990 [Oryza sativa Indica Group]
Length=415

 Score =   337 bits (863),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 169/173 (98%), Gaps = 1/173 (1%)
 Frame = +1

Query  124  MAG-KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  300
            MAG KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGNKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60

Query  301  NQVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFS  480
            NQVAMNPTNTVFDAKRLIGRR+SDPSVQ+DMK+WPFKV+ GP DKPMIVV+YKGE+K+FS
Sbjct  61   NQVAMNPTNTVFDAKRLIGRRFSDPSVQADMKMWPFKVVPGPADKPMIVVTYKGEEKKFS  120

Query  481  AEEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLN  639
            AEEISSMVLTKMKEIAEAFL +T+KNAV+TVPAYFNDSQRQATKDAGVISGLN
Sbjct  121  AEEISSMVLTKMKEIAEAFLSTTIKNAVITVPAYFNDSQRQATKDAGVISGLN  173



>ref|XP_009353696.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e isoform X2 [Pyrus x bretschneideri]
Length=520

 Score =   340 bits (872),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR++D ++QSDMKLWPFKVIAG GDKP IVV+YKGEDKQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFTDATIQSDMKLWPFKVIAGAGDKPTIVVNYKGEDKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVLTKM+EIAEA+LGSTVKN+VVTVPAYFNDSQRQATKDAGVI+G+NVMRI
Sbjct  121  EEISSMVLTKMREIAEAYLGSTVKNSVVTVPAYFNDSQRQATKDAGVIAGMNVMRI  176



>gb|EYU19900.1| hypothetical protein MIMGU_mgv1a002641mg [Erythranthe guttata]
Length=651

 Score =   344 bits (882),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SDPSVQ+DMKLWPFKVI GP +KPMIVVSYKGE+KQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQADMKLWPFKVIPGPAEKPMIVVSYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNV+RI
Sbjct  121  EEISSMVLIKMREIAEAYLGKTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRI  176



>gb|ACM42161.1| heat shock protein 70.58 [Ageratina adenophora]
Length=645

 Score =   343 bits (881),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 163/176 (93%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SD SVQSD+KLWPFKV  GPG+KPMI V+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVTPGPGEKPMISVNYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEAFLG+TVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLIKMKEIAEAFLGTTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>gb|AAA62445.1| heat shock protein [Spinacia oleracea]
 gb|AAB88134.1| cytosolic heat shock 70 protein [Spinacia oleracea]
Length=647

 Score =   343 bits (881),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQ+DMK WPFKV++GPG+KPMI V+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQADMKHWPFKVVSGPGEKPMIGVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVLTKMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_006436010.1| hypothetical protein CICLE_v10030928mg [Citrus clementina]
 gb|ESR49250.1| hypothetical protein CICLE_v10030928mg [Citrus clementina]
Length=648

 Score =   343 bits (881),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SD SVQ DMKLWPFKVIAGP DKPMI V+YKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_009357717.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform X1 [Pyrus 
x bretschneideri]
Length=650

 Score =   343 bits (881),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SDPSVQ DMK WPFKVI GPGDKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQGDMKHWPFKVIPGPGDKPMIVVIYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGS++KNAVVTVPAYFNDSQRQATKDAGVI+GLNV+RI
Sbjct  121  EEISSMVLVKMREIAEAYLGSSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRI  176



>ref|XP_003621869.1| Heat shock protein [Medicago truncatula]
 gb|AES78087.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=648

 Score =   343 bits (881),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 163/176 (93%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR SD SVQSDMKLWPFKVIAGPG+KPMI V+YKGEDKQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRISDASVQSDMKLWPFKVIAGPGEKPMIGVNYKGEDKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNV+RI
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRI  176



>emb|CDY36723.1| BnaC02g31440D [Brassica napus]
Length=195

 Score =   328 bits (841),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDR+EIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRIEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFK+I GP DKPMIVVSYKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKIIPGPADKPMIVVSYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG T+KN VVTVPAYFNDSQRQATKDAGVI+GLN   +
Sbjct  121  EEISSMVLIKMREIAEAYLGVTIKNDVVTVPAYFNDSQRQATKDAGVIAGLNATSV  176



>ref|NP_001068540.1| Os11g0703900 [Oryza sativa Japonica Group]
 gb|AAX95352.1| dnaK-type molecular chaperone hsp70 - rice (fragment) [Oryza 
sativa Japonica Group]
 gb|ABA95500.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF28903.1| Os11g0703900 [Oryza sativa Japonica Group]
Length=649

 Score =   343 bits (881),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVIAGPGDKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_006663128.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Oryza brachyantha]
Length=649

 Score =   343 bits (881),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVIAGPGDKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|ACJ11741.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score =   343 bits (881),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFKVIAGPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDSSVQSDIKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG TVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGFTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|NP_187864.1| heat shock protein 70-4 [Arabidopsis thaliana]
 sp|Q9LHA8.1|MD37C_ARATH RecName: Full=Probable mediator of RNA polymerase II transcription 
subunit 37c; AltName: Full=Heat shock 70 kDa protein 4; 
AltName: Full=Heat shock cognate 70 kDa protein 4; AltName: 
Full=Heat shock cognate protein 70-4; Short=AtHsc70-4; AltName: 
Full=Heat shock protein 70-4; Short=AtHsp70-4 [Arabidopsis 
thaliana]
 gb|AAG51030.1|AC069474_29 heat shock protein 70; 34105-36307 [Arabidopsis thaliana]
 dbj|BAB02269.1| 70 kDa heat shock protein [Arabidopsis thaliana]
 gb|AAL06844.1| AT3g12580/T2E22_110 [Arabidopsis thaliana]
 gb|AAL06851.1| AT3g12580/T2E22_110 [Arabidopsis thaliana]
 gb|AAL24367.1| 70 kDa heat shock protein [Arabidopsis thaliana]
 gb|AEE75218.1| heat shock protein 70-4 [Arabidopsis thaliana]
Length=650

 Score =   343 bits (881),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRRYSDPSVQ+D   WPFKV++GPG+KPMIVV++KGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRYSDPSVQADKSHWPFKVVSGPGEKPMIVVNHKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEAFLGS VKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAFLGSPVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_002312089.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|EEE89456.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   343 bits (881),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRRYSD SVQSD+KLWPFKVI GP +KPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRYSDASVQSDIKLWPFKVIPGPAEKPMIVVTYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|KJB16979.1| hypothetical protein B456_002G258500 [Gossypium raimondii]
Length=648

 Score =   343 bits (881),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFKVIAGPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDSSVQSDIKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG TVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGFTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_010030977.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Eucalyptus grandis]
Length=649

 Score =   343 bits (881),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR++D SVQSD+K WPFKV  GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFADASVQSDIKHWPFKVTPGPGDKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVLTKM+EIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLTKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>emb|CDY16175.1| BnaA09g29090D [Brassica napus]
Length=257

 Score =   330 bits (846),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +1

Query  121  LMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  300
            + AGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MSAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60

Query  301  NQVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFS  480
            NQVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFK+I GP DKPMIVV YKGE+KQF+
Sbjct  61   NQVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIVVDYKGEEKQFA  120

Query  481  AEEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            AEEISSMVL KM+EIAEA+LG T+KNAVVTVPAYFNDSQRQATKDAGVI+GLN   +
Sbjct  121  AEEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNATSV  177



>ref|NP_001044757.1| Os01g0840100 [Oryza sativa Japonica Group]
 dbj|BAB67894.1| putative HSP70 [Oryza sativa Japonica Group]
 dbj|BAB93214.1| putative HSP70 [Oryza sativa Japonica Group]
 dbj|BAF06671.1| Os01g0840100 [Oryza sativa Japonica Group]
 gb|EAZ14100.1| hypothetical protein OsJ_04024 [Oryza sativa Japonica Group]
 dbj|BAH01518.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADM86881.1| 70kDa heat shock protein [Oryza sativa Japonica Group]
 gb|ADR66969.1| 70 kDa heat shock protein [Oryza sativa Japonica Group]
Length=648

 Score =   343 bits (880),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +1

Query  130  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  309
             KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQV
Sbjct  2    AKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQV  61

Query  310  AMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEE  489
            AMNP NTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GPGDKPMIVV YKGE+KQFSAEE
Sbjct  62   AMNPINTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVQYKGEEKQFSAEE  121

Query  490  ISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            ISSMVL KM+EIAEA+LGS +KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  122  ISSMVLIKMREIAEAYLGSNIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  175



>ref|XP_002532297.1| heat shock protein, putative [Ricinus communis]
 gb|EEF30081.1| heat shock protein, putative [Ricinus communis]
Length=652

 Score =   343 bits (880),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVI GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_009414320.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
Length=648

 Score =   343 bits (880),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFKV +GPGDKPMI V YKGE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKVTSGPGDKPMIAVQYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEA+LGS VKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLMKMKEIAEAYLGSVVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>gb|KJB46580.1| hypothetical protein B456_007G375600 [Gossypium raimondii]
 gb|KJB46581.1| hypothetical protein B456_007G375600 [Gossypium raimondii]
 gb|KJB46582.1| hypothetical protein B456_007G375600 [Gossypium raimondii]
Length=647

 Score =   343 bits (880),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD KLWPFKVI GPGDKPMI V+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDTKLWPFKVIPGPGDKPMICVTYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_002884912.1| hypothetical protein ARALYDRAFT_897465 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61171.1| hypothetical protein ARALYDRAFT_897465 [Arabidopsis lyrata subsp. 
lyrata]
Length=650

 Score =   343 bits (880),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRRYSDPSVQ+D   WPFKVI+GPG+KPMIVV++KGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRYSDPSVQADKSHWPFKVISGPGEKPMIVVNHKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEAFLG+ VKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLVKMREIAEAFLGTPVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>gb|KCW50223.1| hypothetical protein EUGRSUZ_J00023 [Eucalyptus grandis]
Length=615

 Score =   342 bits (877),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFKVI GPG+KPMI+V+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFNDSSVQSDIKLWPFKVIPGPGEKPMIIVTYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_010553033.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Tarenaya hassleriana]
Length=652

 Score =   343 bits (880),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVI GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>emb|CDX85038.1| BnaC05g20170D [Brassica napus]
Length=263

 Score =   330 bits (846),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +1

Query  121  LMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  300
            +  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MSGGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60

Query  301  NQVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFS  480
            NQVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFK+I GP DKPMIVVSYKGE+KQF+
Sbjct  61   NQVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIVVSYKGEEKQFA  120

Query  481  AEEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            AEEISSMVL KM+EIAEA+LG T+KNAVVTVPAYFNDSQRQATKDAGVI+GLN   +
Sbjct  121  AEEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNATSV  177



>ref|XP_004246402.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
lycopersicum]
Length=649

 Score =   343 bits (880),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD +VQSD+K WPFKVIAGPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDATVQSDIKHWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>emb|CAB72130.1| heat shock protein 70 [Cucumis sativus]
Length=647

 Score =   343 bits (879),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QV MNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVI GPGDKPMI+VSYKG +KQF+A
Sbjct  61   QVTMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIIVSYKGGEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>emb|CDP09035.1| unnamed protein product [Coffea canephora]
Length=650

 Score =   343 bits (879),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR SD SVQ+D+KLWPFKVIAGPGDKPMI V+YKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRLSDSSVQNDIKLWPFKVIAGPGDKPMIAVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKE+AEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMKEVAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|AAB97316.1| cytosolic heat shock 70 protein [Spinacia oleracea]
 gb|AAB88132.1| cytosolic heat shock 70 protein [Spinacia oleracea]
 gb|AAB88133.1| cytosolic heat shock 70 protein [Spinacia oleracea]
Length=651

 Score =   343 bits (880),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFKVI G GDKPMIVVSYKGEDK+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGAGDKPMIVVSYKGEDKEFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEAFLG T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAFLGLTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_010030975.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Eucalyptus 
grandis]
 gb|KCW50222.1| hypothetical protein EUGRSUZ_J00023 [Eucalyptus grandis]
Length=649

 Score =   343 bits (879),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFKVI GPG+KPMI+V+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFNDSSVQSDIKLWPFKVIPGPGEKPMIIVTYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|ACD93209.1| heat shock protein 70 [Camellia sinensis]
Length=677

 Score =   343 bits (881),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 163/176 (93%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR++D SVQSDMKLWPFKVIAGPGDKPMI V+YKGE+K F+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFTDASVQSDMKLWPFKVIAGPGDKPMIGVNYKGEEKLFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_006424798.1| hypothetical protein CICLE_v10028007mg [Citrus clementina]
 gb|ESR38038.1| hypothetical protein CICLE_v10028007mg [Citrus clementina]
Length=636

 Score =   342 bits (878),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFT+TERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTNTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SDP VQ DMKLWPF+VIAG GDKPMIVV+YK E+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPLVQKDMKLWPFQVIAGAGDKPMIVVNYKCEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEI+SMVLTKMKEIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVISGL VMRI
Sbjct  121  EEITSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLKVMRI  176



>gb|KFK38330.1| hypothetical protein AALP_AA3G100200 [Arabis alpina]
Length=650

 Score =   343 bits (879),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFK+I GP DKPMI+V+YKGEDK+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIIVNYKGEDKEFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSM+L KM+EIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMILIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|EYU26579.1| hypothetical protein MIMGU_mgv1a002667mg [Erythranthe guttata]
Length=648

 Score =   343 bits (879),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SD  VQ DMK+WPFKVI GPG+KPMIVV+YKGEDKQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDAPVQGDMKMWPFKVIPGPGEKPMIVVNYKGEDKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|KCW50224.1| hypothetical protein EUGRSUZ_J00023 [Eucalyptus grandis]
Length=632

 Score =   342 bits (877),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFKVI GPG+KPMI+V+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFNDSSVQSDIKLWPFKVIPGPGEKPMIIVTYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_006429028.1| hypothetical protein CICLE_v10011260mg [Citrus clementina]
 ref|XP_006480766.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Citrus sinensis]
 gb|ESR42268.1| hypothetical protein CICLE_v10011260mg [Citrus clementina]
 gb|KDO41235.1| hypothetical protein CISIN_1g006381mg [Citrus sinensis]
Length=647

 Score =   343 bits (879),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD +VQSD KLWPFKVIAG GDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDATVQSDTKLWPFKVIAGAGDKPMIVVTYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_011028442.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   342 bits (878),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRRY+D SVQSD+KLWPFKVI GP +KPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRYTDTSVQSDIKLWPFKVIPGPAEKPMIVVTYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_010231300.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Brachypodium distachyon]
Length=649

 Score =   342 bits (878),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 170/173 (98%), Gaps = 0/173 (0%)
 Frame = +1

Query  133  KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  312
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct  3    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  62

Query  313  MNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEEI  492
            MNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GPGDKPMIVV +KGE+KQF+AEEI
Sbjct  63   MNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVQHKGEEKQFAAEEI  122

Query  493  SSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            SSMVL KM+EIAEA+LG+++KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  123  SSMVLIKMREIAEAYLGNSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  175



>ref|XP_002465468.1| hypothetical protein SORBIDRAFT_01g039390 [Sorghum bicolor]
 gb|EER92466.1| hypothetical protein SORBIDRAFT_01g039390 [Sorghum bicolor]
Length=652

 Score =   342 bits (878),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +1

Query  121  LMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  300
            + + KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MASSKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60

Query  301  NQVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFS  480
            NQVAMNPTNTVFDAKRLIGRR+SDPSVQ+DMK+WPFKV+ GP DKPMIVV+YKGE+K+FS
Sbjct  61   NQVAMNPTNTVFDAKRLIGRRFSDPSVQADMKMWPFKVVPGPADKPMIVVTYKGEEKKFS  120

Query  481  AEEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            AEEISSMVLTKMKEIAEA+L +T+KNAV+TVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  AEEISSMVLTKMKEIAEAYLSTTIKNAVITVPAYFNDSQRQATKDAGVIAGLNVMRI  177



>ref|XP_010499184.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=650

 Score =   342 bits (878),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRRYSDPSVQSD+K WPF V +GP +KPMI V+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRYSDPSVQSDLKHWPFTVKSGPAEKPMITVNYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEAFLGS VKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAFLGSPVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_010486980.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=650

 Score =   342 bits (878),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRRYSDPSVQSD+K WPF V +GP +KPMI V+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRYSDPSVQSDLKHWPFTVKSGPAEKPMITVNYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEAFLGS VKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAFLGSPVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_004287145.1| PREDICTED: heat shock 70 kDa protein [Fragaria vesca subsp. vesca]
Length=653

 Score =   342 bits (878),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MA K EG AIGIDLGTTYSCVGVWQ+DRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAAKTEGKAIGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SDPSVQ+DMKLWPFKV+AGPGDKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPQNTVFDAKRLIGRRFSDPSVQADMKLWPFKVVAGPGDKPMIVVTYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEA+LG T+KNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLIKMKEIAEAYLGQTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>gb|ACB70177.1| 70 kDa heat shock protein [Capparis spinosa]
Length=649

 Score =   342 bits (878),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRRYSD SVQ+DMKLWPFKV+ G GDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRYSDSSVQADMKLWPFKVVPGSGDKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEAFLG T+KN VVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAFLGCTIKNGVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|AFU34347.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34348.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34349.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34350.1| 70-kDa heat shock protein [Ipomoea batatas]
Length=652

 Score =   342 bits (878),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFKVI GPGDKPMIVV+YKGE+K+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVIPGPGDKPMIVVTYKGEEKEFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_007009369.1| Heat shock protein 70 [Theobroma cacao]
 gb|EOY18179.1| Heat shock protein 70 [Theobroma cacao]
Length=649

 Score =   342 bits (877),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR++D +VQSD+KLWPFKVIAGP DKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDATVQSDIKLWPFKVIAGPADKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|AAS57913.1| 70 kDa heat shock cognate protein 2 [Vigna radiata]
Length=648

 Score =   342 bits (877),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFKV +GPGDKPMI V+YKGEDKQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKVFSGPGDKPMIQVNYKGEDKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG+TVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLMKMREIAEAYLGTTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_010465032.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=650

 Score =   342 bits (877),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRRYSDPSVQSD+K WPF V +GP +KPMI V+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRYSDPSVQSDLKHWPFTVKSGPAEKPMITVNYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEAFLGS VKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAFLGSPVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_010558317.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Tarenaya hassleriana]
Length=654

 Score =   342 bits (877),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVI GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_006297174.1| hypothetical protein CARUB_v10013178mg [Capsella rubella]
 gb|EOA30072.1| hypothetical protein CARUB_v10013178mg [Capsella rubella]
Length=649

 Score =   342 bits (877),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD  LWPFK+I+GPG+KPMIVV+YKGEDK+FSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDRALWPFKIISGPGEKPMIVVNYKGEDKEFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSM+L KM+EIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMILIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|AIU40169.1| heat shock protein 70 [Saccharum arundinaceum]
Length=648

 Score =   342 bits (877),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/173 (93%), Positives = 169/173 (98%), Gaps = 0/173 (0%)
 Frame = +1

Query  133  KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  312
            KGEGPAIGI+LGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct  3    KGEGPAIGIELGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  62

Query  313  MNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEEI  492
            MNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GPGDKPMIVV+YKGE+KQF+AEEI
Sbjct  63   MNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFAAEEI  122

Query  493  SSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            SSMVL KMKEIA  +LGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  123  SSMVLIKMKEIAGGYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  175



>ref|XP_011016414.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Populus euphratica]
Length=648

 Score =   342 bits (877),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSC+GVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCIGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRRY+D SVQSD+KLWPFKVI GP +KPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRYTDTSVQSDIKLWPFKVIPGPAEKPMIVVTYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_007144450.1| hypothetical protein PHAVU_007G157200g [Phaseolus vulgaris]
 gb|ESW16444.1| hypothetical protein PHAVU_007G157200g [Phaseolus vulgaris]
Length=614

 Score =   341 bits (874),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR SD SVQSDMKLWPFKV AGPGDKPMI VSYKGEDKQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRVSDASVQSDMKLWPFKVFAGPGDKPMIQVSYKGEDKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG+++KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLMKMREIAEAYLGTSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|AAB99745.1| HSP70 [Triticum aestivum]
 gb|EMT04103.1| Heat shock cognate 70 kDa protein [Aegilops tauschii]
Length=648

 Score =   342 bits (876),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 169/173 (98%), Gaps = 0/173 (0%)
 Frame = +1

Query  133  KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  312
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct  3    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  62

Query  313  MNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEEI  492
            MNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GP DKPMIVV+YKGE+KQF+AEEI
Sbjct  63   MNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVNYKGEEKQFAAEEI  122

Query  493  SSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            SSMVL KM+EIAEAFLG++VKNAVVTVPAYFNDSQRQATKDAG I+GLNV+RI
Sbjct  123  SSMVLIKMREIAEAFLGNSVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRI  175



>gb|KCW50227.1| hypothetical protein EUGRSUZ_J00025 [Eucalyptus grandis]
Length=735

 Score =   344 bits (883),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  94   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  153

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR++D SVQSD+K WPFKV  GPGDKPMIVV+YKGE+KQF+A
Sbjct  154  QVAMNPINTVFDAKRLIGRRFADASVQSDIKHWPFKVTPGPGDKPMIVVNYKGEEKQFAA  213

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVLTKM+EIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  214  EEISSMVLTKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  269



>gb|KCW50226.1| hypothetical protein EUGRSUZ_J00025 [Eucalyptus grandis]
Length=742

 Score =   344 bits (883),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  94   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  153

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR++D SVQSD+K WPFKV  GPGDKPMIVV+YKGE+KQF+A
Sbjct  154  QVAMNPINTVFDAKRLIGRRFADASVQSDIKHWPFKVTPGPGDKPMIVVNYKGEEKQFAA  213

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVLTKM+EIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  214  EEISSMVLTKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  269



>ref|XP_007144451.1| hypothetical protein PHAVU_007G157200g [Phaseolus vulgaris]
 gb|ESW16445.1| hypothetical protein PHAVU_007G157200g [Phaseolus vulgaris]
Length=648

 Score =   342 bits (876),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR SD SVQSDMKLWPFKV AGPGDKPMI VSYKGEDKQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRVSDASVQSDMKLWPFKVFAGPGDKPMIQVSYKGEDKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG+++KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLMKMREIAEAYLGTSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|EMT06830.1| Heat shock cognate 70 kDa protein [Aegilops tauschii]
Length=647

 Score =   342 bits (876),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MA  GEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAKGGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GP DKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVQYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEI EA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMKEIGEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_006297173.1| hypothetical protein CARUB_v10013177mg [Capsella rubella]
 gb|EOA30071.1| hypothetical protein CARUB_v10013177mg [Capsella rubella]
Length=650

 Score =   342 bits (876),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRRYSDPSVQ+DM  WPF V +GP +KPMI V+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRYSDPSVQADMLHWPFTVKSGPAEKPMITVNYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVLTKM+EIAEAFLG++VKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLTKMREIAEAFLGTSVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>gb|ACR38891.1| heat shock protein 70 [Pellia endiviifolia (species B)]
 gb|ACR38900.1| heat shock protein 70 [Pellia endiviifolia (species B)]
Length=651

 Score =   342 bits (876),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SD SVQ DMKLWPFKV  GPGDKPMI V YKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDGSVQDDMKLWPFKVTPGPGDKPMIGVQYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNV+RI
Sbjct  121  EEISSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRI  176



>ref|XP_009785159.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
 dbj|BAM24707.1| Heat shock protein 70 [Nicotiana tabacum]
Length=649

 Score =   342 bits (876),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR++D SVQSD+K WPFKVI GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFADASVQSDIKHWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNV+RI
Sbjct  121  EEISSMVLIKMREIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRI  176



>ref|XP_009122772.1| PREDICTED: LOW QUALITY PROTEIN: probable mediator of RNA polymerase 
II transcription subunit 37e [Brassica rapa]
Length=646

 Score =   341 bits (875),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFK+IAGP +KPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIAGPAEKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_009112006.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Brassica rapa]
Length=517

 Score =   337 bits (865),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 158/176 (90%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLW FK+IAGP +KPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWLFKIIAGPAEKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|KHN27222.1| Heat shock cognate 70 kDa protein 2 [Glycine soja]
Length=649

 Score =   342 bits (876),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR SD SVQSDMKLWPFKVI GP DKPMIVV+YKGEDKQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRISDASVQSDMKLWPFKVIPGPADKPMIVVNYKGEDKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_009622753.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=649

 Score =   341 bits (875),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR++D SVQSD+K WPFKVI GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFADASVQSDIKHWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNV+RI
Sbjct  121  EEISSMVLIKMREIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRI  176



>gb|EMS68426.1| Heat shock cognate 70 kDa protein 4 [Triticum urartu]
Length=648

 Score =   341 bits (875),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 169/173 (98%), Gaps = 0/173 (0%)
 Frame = +1

Query  133  KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  312
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct  3    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  62

Query  313  MNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEEI  492
            MNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GP DKPMIVV+YKGE+KQF+AEEI
Sbjct  63   MNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVNYKGEEKQFAAEEI  122

Query  493  SSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            SSMVL KM+EIAEAFLG++VKNAVVTVPAYFNDSQRQATKDAG I+GLNV+RI
Sbjct  123  SSMVLIKMREIAEAFLGNSVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRI  175



>ref|XP_002283532.2| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=650

 Score =   341 bits (875),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+K W FKV+ GPGDKPMI V+YKGEDKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKHWSFKVVPGPGDKPMITVTYKGEDKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|AAB88009.1| heat shock cognate protein HSC70 [Brassica napus]
Length=645

 Score =   341 bits (875),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFK+IAGP +KPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIAGPAEKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|AAP04522.1| heat shock protein 70 [Nicotiana tabacum]
Length=648

 Score =   341 bits (875),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFK I+GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKGISGPGDKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSM L KMKE+AEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMGLIKMKEMAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_003558228.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Brachypodium 
distachyon]
Length=651

 Score =   341 bits (875),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD KLWPFKVI GPGDKPMI V Y+GEDKQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDAKLWPFKVIPGPGDKPMIGVQYRGEDKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKE AEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLNKMKETAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>ref|XP_004984743.1| PREDICTED: heat shock cognate 70 kDa protein-like [Setaria italica]
Length=650

 Score =   341 bits (875),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 158/176 (90%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIG+AAKN
Sbjct  1    MASKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGEAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SDPSVQ+DMK+WPFKV+ GP DKPMIVV+YKGE+K+FSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQADMKMWPFKVVPGPADKPMIVVTYKGEEKKFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVLTKMKEIAEA+L +T+KNAV+TVPAYFNDSQRQATKDAGVI+GLNV RI
Sbjct  121  EEISSMVLTKMKEIAEAYLSTTIKNAVITVPAYFNDSQRQATKDAGVIAGLNVTRI  176



>gb|AIA22210.1| heat shock protein 70 [Chrysanthemum indicum]
Length=647

 Score =   341 bits (874),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SD SVQSD+KLWPFKV  GP +KPMI V+YKGE+K F+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVTPGPAEKPMIAVNYKGEEKTFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  176



>gb|AGL07711.1| heat shock protein 70 [Ziziphus jujuba]
Length=654

 Score =   341 bits (875),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTV DAKRLIGRRYSD SVQSD+KLWPFKVI G GDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVLDAKRLIGRRYSDASVQSDIKLWPFKVIPGAGDKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_006341042.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   341 bits (874),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD +VQSD+K WPFKVI GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDATVQSDIKHWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_008776699.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Phoenix dactylifera]
Length=648

 Score =   341 bits (874),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVA+NP NTVFDAKRLIGRR+SD SVQ+DMKLWPFKV+AGPGDKP+I V YKGE+KQF+A
Sbjct  61   QVAINPINTVFDAKRLIGRRFSDASVQNDMKLWPFKVVAGPGDKPLIAVQYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GL+VMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLSVMRI  176



>dbj|BAK00257.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=648

 Score =   341 bits (874),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 169/173 (98%), Gaps = 0/173 (0%)
 Frame = +1

Query  133  KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  312
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct  3    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  62

Query  313  MNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEEI  492
            MNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GP DKPMI+V+YKGE+KQF+AEEI
Sbjct  63   MNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIIVNYKGEEKQFAAEEI  122

Query  493  SSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            SSMVL KM+EIAEAFLG++VKNAVVTVPAYFNDSQRQATKDAG I+GLNV+RI
Sbjct  123  SSMVLIKMREIAEAFLGNSVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRI  175



>gb|EMS51135.1| Heat shock cognate 70 kDa protein [Triticum urartu]
Length=610

 Score =   340 bits (871),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 169/177 (95%), Gaps = 1/177 (1%)
 Frame = +1

Query  124  MAGKG-EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  300
            MA KG EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAKKGGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  60

Query  301  NQVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFS  480
            NQVAMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GP DKPMIVV YKGE+KQF+
Sbjct  61   NQVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVQYKGEEKQFA  120

Query  481  AEEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            AEEISSMVL KMKEI EA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  AEEISSMVLIKMKEIGEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  177



>ref|NP_001119156.1| heat shock cognate protein 70-1 [Arabidopsis thaliana]
 gb|AED90481.1| heat shock cognate protein 70-1 [Arabidopsis thaliana]
Length=521

 Score =   337 bits (864),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 157/176 (89%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFK+ AGP DKPMI V YKGE+K+F+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDSSVQSDMKLWPFKIQAGPADKPMIYVEYKGEEKEFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_001767839.1| predicted protein [Physcomitrella patens]
 gb|EDQ67353.1| predicted protein [Physcomitrella patens]
Length=649

 Score =   341 bits (874),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SD SVQSDMKLWPFK+  GPG+KPMI V YKGE+K F+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDMKLWPFKITPGPGEKPMISVQYKGEEKTFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EE+SSMVL KMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNV+RI
Sbjct  121  EEVSSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRI  176



>ref|XP_006378715.1| hypothetical protein POPTR_0010s21280g [Populus trichocarpa]
 gb|ERP56512.1| hypothetical protein POPTR_0010s21280g [Populus trichocarpa]
Length=649

 Score =   341 bits (874),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFKVI+GPGDKPMI V+YKGE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKVISGPGDKPMIGVTYKGEEKQFSA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG+ +KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGTAIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_008223372.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e isoform X1 [Prunus mume]
Length=519

 Score =   337 bits (864),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 158/176 (90%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGD+AKN
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDSAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD S+QSDMKLWPFKVI G GDKP IVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASIQSDMKLWPFKVIPGAGDKPTIVVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVLTKM+EIAEA+LGS VKNAVVTVPAYFNDSQRQATKDAGVI+G+NVMRI
Sbjct  121  EEISSMVLTKMREIAEAYLGSAVKNAVVTVPAYFNDSQRQATKDAGVIAGMNVMRI  176



>ref|XP_003552695.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Glycine 
max]
 gb|KHN13895.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=647

 Score =   340 bits (873),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 163/176 (93%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEG AIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGLAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR SDPSVQSDMKLWPFKV AG G+KPMI V+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRVSDPSVQSDMKLWPFKVTAGAGEKPMIGVNYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVLTKM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLTKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_009414319.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=649

 Score =   340 bits (873),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEI+ANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIVANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR++DPSVQSD+K WPFKV+AG  DKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFNDPSVQSDIKHWPFKVVAGAADKPMIVVQYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>gb|AAA86903.1| heat shock protein cognate 70, partial [Sorghum bicolor]
Length=209

 Score =   326 bits (835),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 153/176 (87%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKG+GP+IGIDLGTTYSCVGVWQ DRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGDGPSIGIDLGTTYSCVGVWQRDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFK I+GPG+KPMIVV +KGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKGISGPGEKPMIVVQHKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+E AEA+LGST+KNAVVTVPAYFNDSQRQ TKDAGVI+GLNV+RI
Sbjct  121  EEISSMVLIKMRETAEAYLGSTIKNAVVTVPAYFNDSQRQGTKDAGVIAGLNVLRI  176



>ref|XP_008658250.1| PREDICTED: uncharacterized protein LOC100272911 isoform X1 [Zea 
mays]
 gb|AFW88811.1| hypothetical protein ZEAMMB73_832667 [Zea mays]
Length=652

 Score =   340 bits (873),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 172/177 (97%), Gaps = 1/177 (1%)
 Frame = +1

Query  124  MAG-KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  300
            MAG KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGNKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60

Query  301  NQVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFS  480
            NQVAMNPTNTVFDAKRLIGRR+SDPSVQ+DMK+WPFKV+ GP DKPMIVV+YKGE+K+FS
Sbjct  61   NQVAMNPTNTVFDAKRLIGRRFSDPSVQADMKMWPFKVVPGPADKPMIVVTYKGEEKKFS  120

Query  481  AEEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            AEEISSMVLTKMKEIAEA+L +T+KNAV+TVPAYFNDSQRQATKDAGVI+GLNV RI
Sbjct  121  AEEISSMVLTKMKEIAEAYLSTTIKNAVITVPAYFNDSQRQATKDAGVIAGLNVTRI  177



>ref|XP_003554320.2| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Glycine max]
Length=721

 Score =   342 bits (878),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  68   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  127

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVIAG  DKPMIVV+YKGE+KQF+A
Sbjct  128  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIAGAADKPMIVVNYKGEEKQFAA  187

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  188  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  243



>emb|CAA31663.1| hsp70 (AA 6 - 651) [Petunia x hybrida]
Length=646

 Score =   340 bits (872),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  139  EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  318
            EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKNQVAMN
Sbjct  1    EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVAMN  60

Query  319  PTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEEISS  498
            P NTVFDAKRLIGRR+SDPSVQSD+KLWPFKVI GPGDKPMIVV+YKGE+KQF+AEEISS
Sbjct  61   PINTVFDAKRLIGRRFSDPSVQSDIKLWPFKVIPGPGDKPMIVVTYKGEEKQFAAEEISS  120

Query  499  MVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            MVLTKMKEIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  MVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  171



>ref|XP_010931247.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Elaeis guineensis]
Length=648

 Score =   340 bits (872),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/176 (90%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVA NPTNTVFDAKRLIGRR++D SV++DMKLWPFK +AGPGDKP+I V YKGE+KQF+A
Sbjct  61   QVATNPTNTVFDAKRLIGRRFTDASVKNDMKLWPFKAVAGPGDKPLIAVQYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_006664117.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Oryza brachyantha]
Length=649

 Score =   340 bits (872),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFKVI GPGDKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDTSVQSDIKLWPFKVIPGPGDKPMIVVQYKGEEKQFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EEISSMVL KM+EIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRI
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI  176



>ref|XP_001751923.1| predicted protein [Physcomitrella patens]
 gb|EDQ83358.1| predicted protein [Physcomitrella patens]
Length=648

 Score =   340 bits (872),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  303
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  304  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  483
            QVAMNPTNTVFDAKRLIGRR+SD SVQSDMKLWPFK+  GPG+KPMI V YKGE+K F+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDMKLWPFKITPGPGEKPMISVMYKGEEKTFAA  120

Query  484  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI  651
            EE+SSMVL KMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+GLNV+RI
Sbjct  121  EEVSSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRI  176



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1001432574250