BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF040L11

Length=607
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009789240.1|  PREDICTED: probable calcium-binding protein ...    180   8e-53   Nicotiana sylvestris
ref|XP_009601106.1|  PREDICTED: probable calcium-binding protein ...    177   1e-51   Nicotiana tomentosiformis
ref|XP_011075386.1|  PREDICTED: probable calcium-binding protein ...    167   1e-47   Sesamum indicum [beniseed]
ref|XP_011078930.1|  PREDICTED: probable calcium-binding protein ...    166   2e-47   Sesamum indicum [beniseed]
emb|CDP14208.1|  unnamed protein product                                163   4e-46   Coffea canephora [robusta coffee]
gb|EYU18659.1|  hypothetical protein MIMGU_mgv1a026895mg                157   1e-43   Erythranthe guttata [common monkey flower]
ref|XP_009595400.1|  PREDICTED: probable calcium-binding protein ...    155   2e-43   Nicotiana tomentosiformis
gb|EYU20776.1|  hypothetical protein MIMGU_mgv1a020784mg                154   1e-42   Erythranthe guttata [common monkey flower]
ref|XP_004249247.1|  PREDICTED: probable calcium-binding protein ...    153   1e-42   Solanum lycopersicum
ref|XP_009765839.1|  PREDICTED: probable calcium-binding protein ...    150   2e-41   Nicotiana sylvestris
ref|XP_006351283.1|  PREDICTED: probable calcium-binding protein ...    150   2e-41   Solanum tuberosum [potatoes]
ref|XP_002276334.1|  PREDICTED: probable calcium-binding protein ...    144   5e-39   Vitis vinifera
ref|XP_004249249.1|  PREDICTED: probable calcium-binding protein ...    137   4e-36   Solanum lycopersicum
ref|XP_009622394.1|  PREDICTED: probable calcium-binding protein ...    135   3e-35   Nicotiana tomentosiformis
ref|XP_006351257.1|  PREDICTED: probable calcium-binding protein ...    133   8e-35   Solanum tuberosum [potatoes]
ref|XP_009763879.1|  PREDICTED: probable calcium-binding protein ...    133   9e-35   Nicotiana sylvestris
ref|XP_010277607.1|  PREDICTED: probable calcium-binding protein ...    126   6e-32   Nelumbo nucifera [Indian lotus]
gb|KDP26218.1|  hypothetical protein JCGZ_22464                         117   8e-29   Jatropha curcas
ref|XP_008240735.1|  PREDICTED: probable calcium-binding protein ...    117   2e-28   Prunus mume [ume]
emb|CBI30075.3|  unnamed protein product                                115   2e-28   Vitis vinifera
emb|CDY14768.1|  BnaC04g47650D                                          116   2e-28   Brassica napus [oilseed rape]
ref|XP_007202521.1|  hypothetical protein PRUPE_ppa010940mg             117   2e-28   Prunus persica
gb|KJB16379.1|  hypothetical protein B456_002G227200                    116   3e-28   Gossypium raimondii
ref|XP_009141989.1|  PREDICTED: probable calcium-binding protein ...    114   1e-27   Brassica rapa
gb|KJB35924.1|  hypothetical protein B456_006G133800                    114   2e-27   Gossypium raimondii
ref|XP_006364430.1|  PREDICTED: probable calcium-binding protein ...    113   3e-27   Solanum tuberosum [potatoes]
ref|XP_004303614.1|  PREDICTED: probable calcium-binding protein ...    112   1e-26   Fragaria vesca subsp. vesca
ref|XP_008392376.1|  PREDICTED: LOW QUALITY PROTEIN: probable cal...    111   2e-26   
emb|CDY06925.1|  BnaA04g23900D                                          110   3e-26   
ref|XP_009341958.1|  PREDICTED: LOW QUALITY PROTEIN: probable cal...    112   4e-26   
ref|NP_001265939.1|  Hop-interacting protein THI026                     110   7e-26   Solanum lycopersicum
ref|XP_008376081.1|  PREDICTED: probable calcium-binding protein ...    111   7e-26   
ref|XP_003625055.1|  hypothetical protein MTR_7g090450                  108   3e-25   Medicago truncatula
gb|AFK42347.1|  unknown                                                 108   4e-25   Medicago truncatula
ref|XP_010554792.1|  PREDICTED: probable calcium-binding protein ...    107   1e-24   Tarenaya hassleriana [spider flower]
ref|XP_006421261.1|  hypothetical protein CICLE_v10005842mg             105   3e-24   Citrus clementina [clementine]
ref|XP_007028573.1|  Calcium-binding EF-hand family protein, puta...    104   4e-24   
ref|XP_006491566.1|  PREDICTED: probable calcium-binding protein ...    105   5e-24   Citrus sinensis [apfelsine]
ref|XP_002534401.1|  Calcium-binding allergen Ole e, putative           104   8e-24   Ricinus communis
ref|XP_008373033.1|  PREDICTED: probable calcium-binding protein ...    104   1e-23   
ref|XP_010544017.1|  PREDICTED: probable calcium-binding protein ...    103   2e-23   Tarenaya hassleriana [spider flower]
ref|XP_010102734.1|  putative calcium-binding protein CML36             103   3e-23   
emb|CDY23852.1|  BnaC04g01850D                                          101   8e-23   Brassica napus [oilseed rape]
ref|XP_002882655.1|  hypothetical protein ARALYDRAFT_897194             101   1e-22   Arabidopsis lyrata subsp. lyrata
ref|XP_010273279.1|  PREDICTED: probable calcium-binding protein ...    101   2e-22   Nelumbo nucifera [Indian lotus]
ref|XP_002323262.1|  Calmodulin-like family protein                     100   2e-22   Populus trichocarpa [western balsam poplar]
ref|XP_002308908.1|  Calmodulin-like family protein                     100   2e-22   Populus trichocarpa [western balsam poplar]
ref|XP_010543513.1|  PREDICTED: probable calcium-binding protein ...  99.4    6e-22   Tarenaya hassleriana [spider flower]
ref|XP_011033138.1|  PREDICTED: probable calcium-binding protein ...  99.4    7e-22   Populus euphratica
gb|KDO37863.1|  hypothetical protein CISIN_1g027592mg                 99.0    1e-21   Citrus sinensis [apfelsine]
ref|XP_004493430.1|  PREDICTED: probable calcium-binding protein ...  98.6    1e-21   Cicer arietinum [garbanzo]
ref|XP_009142741.1|  PREDICTED: probable calcium-binding protein ...  98.2    2e-21   Brassica rapa
emb|CDX79938.1|  BnaA05g02180D                                        97.8    2e-21   
gb|KFK38406.1|  hypothetical protein AALP_AA3G109000                  97.4    3e-21   Arabis alpina [alpine rockcress]
emb|CDY00910.1|  BnaC05g42900D                                        97.8    3e-21   
ref|XP_006411405.1|  hypothetical protein EUTSA_v10017207mg           97.1    6e-21   Eutrema salsugineum [saltwater cress]
ref|NP_187630.1|  putative calcium-binding protein CML36              96.3    8e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006407598.1|  hypothetical protein EUTSA_v10021512mg           96.3    8e-21   Eutrema salsugineum [saltwater cress]
ref|XP_011027298.1|  PREDICTED: probable calcium-binding protein ...  95.9    1e-20   Populus euphratica
ref|XP_010508721.1|  PREDICTED: probable calcium-binding protein ...  95.9    1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_002881773.1|  hypothetical protein ARALYDRAFT_903457           95.5    2e-20   Arabidopsis lyrata subsp. lyrata
ref|XP_008800223.1|  PREDICTED: calmodulin-like                       95.5    2e-20   Phoenix dactylifera
gb|AGV22098.1|  calmodulin-like protein                               95.1    2e-20   Brassica juncea [brown mustard]
gb|KDO37862.1|  hypothetical protein CISIN_1g027592mg                 94.4    5e-20   Citrus sinensis [apfelsine]
emb|CDY60169.1|  BnaAnng16630D                                        94.0    5e-20   Brassica napus [oilseed rape]
ref|XP_008790571.1|  PREDICTED: probable calcium-binding protein ...  94.0    6e-20   Phoenix dactylifera
ref|NP_181672.1|  putative calcium-binding protein CML35              93.2    1e-19   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61257.1|  calmodulin-like protein                               93.2    1e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010938625.1|  PREDICTED: calmodulin-like protein 3             93.2    1e-19   Elaeis guineensis
ref|XP_006296622.1|  hypothetical protein CARUB_v10014618mg           92.8    2e-19   Capsella rubella
ref|XP_010924236.1|  PREDICTED: probable calcium-binding protein ...  92.8    2e-19   Elaeis guineensis
ref|XP_006295474.1|  hypothetical protein CARUB_v10024577mg           91.7    4e-19   Capsella rubella
ref|XP_009146864.1|  PREDICTED: probable calcium-binding protein ...  92.0    6e-19   Brassica rapa
ref|XP_010486615.1|  PREDICTED: probable calcium-binding protein ...  90.9    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_009412818.1|  PREDICTED: probable calcium-binding protein ...  90.1    2e-18   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAA48190.1|  calmodulin like protein                              89.4    3e-18   Arabidopsis thaliana [mouse-ear cress]
gb|KFK36989.1|  hypothetical protein AALP_AA4G198000                  89.0    5e-18   Arabis alpina [alpine rockcress]
ref|XP_010464685.1|  PREDICTED: probable calcium-binding protein ...  88.2    8e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010525531.1|  PREDICTED: probable calcium-binding protein ...  87.8    1e-17   Tarenaya hassleriana [spider flower]
ref|XP_010481256.1|  PREDICTED: probable calcium-binding protein ...  88.2    1e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010505921.1|  PREDICTED: probable calcium-binding protein ...  86.7    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010517632.1|  PREDICTED: probable calcium-binding protein ...  86.7    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_003554140.1|  PREDICTED: probable calcium-binding protein ...  85.1    1e-16   Glycine max [soybeans]
ref|XP_009399974.1|  PREDICTED: probable calcium-binding protein ...  81.3    2e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010056433.1|  PREDICTED: probable calcium-binding protein ...  80.1    7e-15   Eucalyptus grandis [rose gum]
ref|XP_010036330.1|  PREDICTED: probable calcium-binding protein ...  79.3    1e-14   Eucalyptus grandis [rose gum]
ref|XP_006288691.1|  hypothetical protein CARUB_v10002001mg           79.0    1e-14   
ref|XP_007162132.1|  hypothetical protein PHAVU_001G126700g           78.2    3e-14   Phaseolus vulgaris [French bean]
ref|XP_003521150.1|  PREDICTED: probable calcium-binding protein ...  77.4    5e-14   Glycine max [soybeans]
ref|XP_010672963.1|  PREDICTED: probable calcium-binding protein ...  75.5    2e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011070577.1|  PREDICTED: probable calcium-binding protein ...  73.9    6e-13   Sesamum indicum [beniseed]
ref|XP_010931583.1|  PREDICTED: probable calcium-binding protein ...  73.9    8e-13   Elaeis guineensis
ref|XP_010062249.1|  PREDICTED: calcium-binding protein CML24-like    73.6    9e-13   Eucalyptus grandis [rose gum]
gb|EYU46532.1|  hypothetical protein MIMGU_mgv1a021796mg              72.4    1e-12   Erythranthe guttata [common monkey flower]
ref|XP_009037109.1|  hypothetical protein AURANDRAFT_26147            73.2    2e-12   Aureococcus anophagefferens
ref|XP_009770094.1|  PREDICTED: calmodulin-like                       71.2    3e-12   Nicotiana sylvestris
gb|EYC14046.1|  hypothetical protein Y032_0042g679                    71.2    4e-12   Ancylostoma ceylanicum
gb|EYC14045.1|  hypothetical protein Y032_0042g679                    70.9    5e-12   Ancylostoma ceylanicum
ref|XP_004230637.1|  PREDICTED: calmodulin-like                       70.5    5e-12   Solanum lycopersicum
ref|XP_002671503.1|  predicted protein                                70.9    5e-12   Naegleria gruberi strain NEG-M
ref|XP_010924246.1|  PREDICTED: probable calcium-binding protein ...  72.8    5e-12   
ref|XP_006351748.1|  PREDICTED: calmodulin-5/6/7/8-like               70.5    6e-12   Solanum tuberosum [potatoes]
gb|EYC14044.1|  hypothetical protein Y032_0042g679                    70.9    7e-12   Ancylostoma ceylanicum
ref|XP_003536119.1|  PREDICTED: calmodulin-like protein 11-like       69.7    1e-11   Glycine max [soybeans]
emb|CDW53538.1|  Calmodulin                                           70.1    1e-11   Trichuris trichiura
ref|XP_011079925.1|  PREDICTED: calmodulin-like                       69.7    1e-11   Sesamum indicum [beniseed]
gb|KDP21392.1|  hypothetical protein JCGZ_21863                       70.1    2e-11   Jatropha curcas
gb|KHN04934.1|  Calmodulin-like protein 8                             69.3    2e-11   Glycine soja [wild soybean]
ref|XP_011082591.1|  PREDICTED: calmodulin-like                       69.3    2e-11   Sesamum indicum [beniseed]
ref|XP_008789596.1|  PREDICTED: probable calcium-binding protein ...  70.1    2e-11   Phoenix dactylifera
ref|XP_003556466.1|  PREDICTED: calmodulin-like protein 8-like is...  68.6    3e-11   Glycine max [soybeans]
gb|KFD49502.1|  hypothetical protein M513_09613                       69.7    3e-11   Trichuris suis
ref|XP_008786895.1|  PREDICTED: probable calcium-binding protein ...  68.9    3e-11   Phoenix dactylifera
ref|XP_010922185.1|  PREDICTED: probable calcium-binding protein ...  68.9    3e-11   Elaeis guineensis
ref|XP_011084270.1|  PREDICTED: calcium-binding allergen Ole e 8-...  68.2    4e-11   Sesamum indicum [beniseed]
ref|XP_009617304.1|  PREDICTED: calmodulin-like                       68.2    4e-11   Nicotiana tomentosiformis
ref|XP_008550049.1|  PREDICTED: calmodulin-A-like                     68.9    5e-11   Microplitis demolitor
ref|XP_011072994.1|  PREDICTED: calcium-binding allergen Ole e 8-...  67.8    6e-11   Sesamum indicum [beniseed]
ref|XP_011066820.1|  PREDICTED: neo-calmodulin-like                   68.6    7e-11   Acromyrmex echinatior
gb|EZA54087.1|  Calmodulin                                            68.2    7e-11   Ooceraea biroi
ref|XP_011150176.1|  PREDICTED: neo-calmodulin-like isoform X3        68.6    8e-11   Harpegnathos saltator
gb|EFN67816.1|  Calmodulin                                            68.2    8e-11   Camponotus floridanus
ref|XP_011307674.1|  PREDICTED: neo-calmodulin-like isoform X3        68.6    8e-11   Fopius arisanus
ref|NP_495043.1|  Protein CAL-8                                       67.0    8e-11   Caenorhabditis elegans [roundworm]
gb|ELU13700.1|  hypothetical protein CAPTEDRAFT_169155                67.8    8e-11   Capitella teleta
ref|XP_011339099.1|  PREDICTED: neo-calmodulin-like isoform X3        68.2    8e-11   Ooceraea biroi
ref|XP_011257081.1|  PREDICTED: neo-calmodulin-like isoform X3        68.2    8e-11   Camponotus floridanus
ref|XP_003108906.1|  hypothetical protein CRE_11951                   67.0    8e-11   Caenorhabditis remanei
ref|XP_011171909.1|  PREDICTED: neo-calmodulin-like                   68.6    8e-11   Solenopsis invicta [imported red fire ant]
ref|XP_010526084.1|  PREDICTED: calmodulin-like protein 4             67.8    8e-11   Tarenaya hassleriana [spider flower]
ref|XP_006402687.1|  hypothetical protein EUTSA_v10006367mg           67.8    9e-11   Eutrema salsugineum [saltwater cress]
ref|XP_008381330.1|  PREDICTED: probable calcium-binding protein ...  67.0    9e-11   Malus domestica [apple tree]
ref|XP_011498410.1|  PREDICTED: neo-calmodulin-like isoform X2        68.2    1e-10   Ceratosolen solmsi marchali
gb|EAY86614.1|  hypothetical protein OsI_07995                        67.0    1e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_008378130.1|  PREDICTED: probable calcium-binding protein ...  67.0    1e-10   Malus domestica [apple tree]
dbj|GAA42135.2|  calmodulin-like protein 1                            67.0    1e-10   Clonorchis sinensis [oriental liver fluke]
ref|XP_011150177.1|  PREDICTED: neo-calmodulin-like isoform X4        67.4    1e-10   Harpegnathos saltator
ref|XP_011257080.1|  PREDICTED: calmodulin-A-like isoform X2          68.2    1e-10   Camponotus floridanus
ref|XP_011150175.1|  PREDICTED: calmodulin-A-like isoform X2          68.2    1e-10   Harpegnathos saltator
ref|XP_009370750.1|  PREDICTED: calmodulin-like protein 11            66.6    1e-10   Pyrus x bretschneideri [bai li]
ref|XP_011307673.1|  PREDICTED: calmodulin-A-like isoform X2          68.2    1e-10   Fopius arisanus
gb|EGI57712.1|  Calmodulin                                            67.4    1e-10   Acromyrmex echinatior
ref|XP_004503360.1|  PREDICTED: probable calcium-binding protein ...  67.4    1e-10   Cicer arietinum [garbanzo]
ref|XP_011339098.1|  PREDICTED: calmodulin-A-like isoform X2          68.2    1e-10   
gb|KEH26932.1|  EF hand calcium-binding family protein                67.0    1e-10   Medicago truncatula
ref|XP_008216621.1|  PREDICTED: calmodulin-A-like                     68.2    1e-10   
ref|XP_007144825.1|  hypothetical protein PHAVU_007G187200g           66.6    1e-10   Phaseolus vulgaris [French bean]
ref|XP_011307672.1|  PREDICTED: calmodulin-beta-like isoform X1       68.2    1e-10   Fopius arisanus
gb|KGG50401.1|  calmodulin                                            67.0    1e-10   Mitosporidium daphniae
ref|XP_011150174.1|  PREDICTED: calmodulin-beta-like isoform X1       68.2    1e-10   Harpegnathos saltator
ref|XP_011427007.1|  PREDICTED: calmodulin-A-like                     66.6    1e-10   Crassostrea gigas
ref|XP_003695096.1|  PREDICTED: calmodulin-like                       66.6    1e-10   
ref|XP_011339096.1|  PREDICTED: calmodulin-beta-like isoform X1       68.2    1e-10   Ooceraea biroi
ref|XP_011416014.1|  PREDICTED: calmodulin-A-like isoform X2          66.2    1e-10   
ref|XP_011416012.1|  PREDICTED: calmodulin-A-like isoform X1          66.6    1e-10   
ref|XP_002630726.1|  Hypothetical protein CBG02410                    66.2    1e-10   Caenorhabditis briggsae
ref|XP_003400211.1|  PREDICTED: calmodulin-like                       68.2    2e-10   Bombus terrestris [large earth bumblebee]
gb|EPS63975.1|  hypothetical protein M569_10810                       66.6    2e-10   Genlisea aurea
ref|XP_006558598.1|  PREDICTED: calmodulin-like isoform X5            67.4    2e-10   Apis mellifera [bee]
ref|XP_011498409.1|  PREDICTED: neo-calmodulin-like isoform X1        67.8    2e-10   Ceratosolen solmsi marchali
ref|XP_011257079.1|  PREDICTED: calmodulin-beta-like isoform X1       67.8    2e-10   Camponotus floridanus
ref|XP_006616491.1|  PREDICTED: calmodulin-like isoform X5            67.4    2e-10   Apis dorsata [rock honeybee]
ref|XP_008801290.1|  PREDICTED: probable calcium-binding protein ...  66.6    2e-10   Phoenix dactylifera
ref|XP_011257082.1|  PREDICTED: neo-calmodulin-like isoform X4        66.6    2e-10   Camponotus floridanus
ref|XP_008389977.1|  PREDICTED: probable calcium-binding protein ...  67.8    2e-10   
ref|XP_011498411.1|  PREDICTED: neo-calmodulin-like isoform X3        66.6    2e-10   Ceratosolen solmsi marchali
ref|XP_006558597.1|  PREDICTED: calmodulin-like isoform X4            67.4    2e-10   Apis mellifera [bee]
ref|XP_006616490.1|  PREDICTED: calmodulin-like isoform X4            67.4    2e-10   Apis dorsata [rock honeybee]
ref|XP_009334418.1|  PREDICTED: probable calcium-binding protein ...  66.2    2e-10   Pyrus x bretschneideri [bai li]
ref|XP_006558596.1|  PREDICTED: calmodulin-like isoform X3            67.4    2e-10   Apis mellifera [bee]
ref|XP_006616489.1|  PREDICTED: calmodulin-like isoform X3            67.4    2e-10   Apis dorsata [rock honeybee]
emb|CAP24100.2|  Protein CBG02410                                     65.9    2e-10   Caenorhabditis briggsae
gb|AFK83800.1|  calmodulin                                            65.9    2e-10   Mnemiopsis leidyi [American comb jelly]
ref|XP_009371792.1|  PREDICTED: probable calcium-binding protein ...  65.9    2e-10   Pyrus x bretschneideri [bai li]
ref|XP_006616488.1|  PREDICTED: calmodulin-like isoform X2            67.4    2e-10   Apis dorsata [rock honeybee]
gb|KCW78265.1|  hypothetical protein EUGRSUZ_D02448                   65.9    2e-10   Eucalyptus grandis [rose gum]
ref|XP_624589.2|  PREDICTED: calmodulin-like isoformX2                67.4    2e-10   Apis mellifera [bee]
ref|XP_011498412.1|  PREDICTED: neo-calmodulin-like isoform X4        66.2    2e-10   Ceratosolen solmsi marchali
ref|XP_006616487.1|  PREDICTED: calmodulin-like isoform X1            67.4    3e-10   Apis dorsata [rock honeybee]
ref|XP_003372739.1|  EF hand domain containing protein                67.0    3e-10   Trichinella spiralis
ref|XP_006647478.1|  PREDICTED: probable calcium-binding protein ...  65.9    3e-10   Oryza brachyantha
ref|XP_001622774.1|  predicted protein                                65.9    3e-10   Nematostella vectensis
ref|XP_004923690.1|  PREDICTED: calmodulin-like                       66.6    3e-10   
ref|XP_004308823.1|  PREDICTED: calmodulin-5/6/7/8-like               66.2    3e-10   Fragaria vesca subsp. vesca
gb|EPS64880.1|  hypothetical protein M569_09899                       65.5    3e-10   Genlisea aurea
gb|EFZ10130.1|  hypothetical protein SINV_07599                       65.9    3e-10   
ref|XP_010053891.1|  PREDICTED: calmodulin-like protein 3             66.2    3e-10   Eucalyptus grandis [rose gum]
ref|XP_008381742.1|  PREDICTED: probable calcium-binding protein ...  65.9    3e-10   Malus domestica [apple tree]
ref|XP_007295339.1|  calmodulin                                       65.5    4e-10   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gb|EHJ76967.1|  putative calmodulin-A                                 65.5    4e-10   
ref|XP_966558.2|  PREDICTED: neo-calmodulin-like                      65.5    5e-10   
gb|ETN58735.1|  calmodulin                                            65.5    5e-10   Anopheles darlingi [American malaria mosquito]
ref|NP_001173067.1|  Os02g0606501                                     65.1    6e-10   
gb|EKC32559.1|  Calmodulin                                            67.0    7e-10   Crassostrea gigas
ref|XP_002430223.1|  calmodulin-A, putative                           65.1    7e-10   Pediculus humanus corporis [human body lice]
gb|ABK21927.1|  unknown                                               64.3    7e-10   Picea sitchensis
ref|XP_005704341.1|  calmodulin isoform 1                             64.7    7e-10   Galdieria sulphuraria
ref|XP_004136671.1|  PREDICTED: probable calcium-binding protein ...  64.7    8e-10   
ref|XP_009786057.1|  PREDICTED: calmodulin-like protein 8             64.3    8e-10   Nicotiana sylvestris
ref|XP_004159632.1|  PREDICTED: probable calcium-binding protein ...  64.7    8e-10   
gb|EFA08949.1|  hypothetical protein TcasGA2_TC006656                 64.7    8e-10   Tribolium castaneum [rust-red flour beetle]
gb|EZA53976.1|  Calmodulin                                            65.5    8e-10   Ooceraea biroi
ref|XP_008472657.1|  PREDICTED: calmodulin-like                       65.1    9e-10   
emb|CDP19328.1|  unnamed protein product                              64.3    9e-10   Coffea canephora [robusta coffee]
ref|XP_006432946.1|  hypothetical protein CICLE_v10002774mg           64.3    9e-10   Citrus clementina [clementine]
ref|XP_002520954.1|  calmodulin, putative                             63.9    9e-10   Ricinus communis
ref|XP_003704227.1|  PREDICTED: calmodulin-like                       65.9    9e-10   
emb|CDX98375.1|  BnaC06g17360D                                        64.7    1e-09   
ref|XP_008368689.1|  PREDICTED: calmodulin-like protein 11            63.9    1e-09   
ref|XP_312402.5|  AGAP002536-PA                                       65.9    1e-09   Anopheles gambiae str. PEST
ref|XP_002721725.1|  PREDICTED: calmodulin-like protein 3             63.9    1e-09   Oryctolagus cuniculus [domestic rabbit]
ref|XP_003494757.1|  PREDICTED: calmodulin-like isoform 1             65.5    1e-09   
gb|EEC68815.1|  hypothetical protein OsI_37379                        63.9    1e-09   Oryza sativa Indica Group [Indian rice]
gb|ENN77948.1|  hypothetical protein YQE_05625                        63.9    1e-09   Dendroctonus ponderosae
ref|XP_011140005.1|  PREDICTED: calmodulin-like isoform X3            65.9    1e-09   
ref|XP_010920375.1|  PREDICTED: probable calcium-binding protein ...  64.3    1e-09   Elaeis guineensis
ref|XP_971297.2|  PREDICTED: neo-calmodulin-like isoform X3           65.1    1e-09   Tribolium castaneum [rust-red flour beetle]
gb|EEE52718.1|  hypothetical protein OsJ_35129                        63.9    1e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009104207.1|  PREDICTED: calmodulin-like protein 4             64.7    1e-09   Brassica rapa
ref|XP_003393814.1|  PREDICTED: calmodulin-like                       65.5    1e-09   Bombus terrestris [large earth bumblebee]
emb|CDX67796.1|  BnaA07g18360D                                        64.7    1e-09   
ref|XP_002970730.1|  hypothetical protein SELMODRAFT_94292            63.9    1e-09   
gb|ERG81872.1|  calmodulin-2                                          63.9    1e-09   
emb|CDJ96123.1|  EF hand domain containing protein                    63.9    1e-09   Haemonchus contortus [red stomach worm]
ref|XP_009392676.1|  PREDICTED: probable calcium-binding protein ...  64.3    1e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011140004.1|  PREDICTED: calmodulin-like isoform X2            65.9    1e-09   
ref|XP_003494758.1|  PREDICTED: calmodulin-like isoform 2             65.5    1e-09   
ref|XP_003554273.1|  PREDICTED: calmodulin-3-like                     63.9    1e-09   Glycine max [soybeans]
ref|XP_001652329.1|  AAEL006921-PA                                    65.9    1e-09   Aedes aegypti
gb|AHY86314.1|  Y-GECO1                                               66.6    1e-09   synthetic construct
ref|XP_504759.1|  YALI0E34111p                                        63.9    1e-09   Yarrowia lipolytica CLIB122
gb|AHY86315.1|  Y-GECO1f                                              66.6    1e-09   synthetic construct
emb|CEL63589.1|  Calmodulin OS=Agaricus bisporus PE=1 SV=2            63.5    1e-09   Rhizoctonia solani AG-1 IB
ref|XP_008197240.1|  PREDICTED: neo-calmodulin-like isoform X2        65.1    1e-09   Tribolium castaneum [rust-red flour beetle]
ref|XP_009048149.1|  hypothetical protein LOTGIDRAFT_148903           63.5    1e-09   Lottia gigantea
ref|XP_008197239.1|  PREDICTED: neo-calmodulin-like isoform X1        65.1    1e-09   Tribolium castaneum [rust-red flour beetle]
ref|XP_004867158.1|  PREDICTED: calmodulin isoform X3                 63.9    1e-09   
ref|XP_001625680.1|  predicted protein                                63.5    1e-09   Nematostella vectensis
ref|XP_002969393.1|  hypothetical protein SELMODRAFT_91501            63.9    1e-09   
ref|XP_007298032.1|  EF-hand                                          63.9    1e-09   Stereum hirsutum FP-91666 SS1
ref|XP_011140003.1|  PREDICTED: calmodulin-like protein 11 isofor...  65.9    1e-09   
gb|EFA05282.1|  hypothetical protein TcasGA2_TC015439                 65.5    1e-09   
ref|XP_006568278.1|  PREDICTED: probable calcium-binding protein ...  65.1    1e-09   
gb|KDQ10734.1|  hypothetical protein BOTBODRAFT_190368                63.5    1e-09   Botryobasidium botryosum FD-172 SS1
ref|XP_006430624.1|  hypothetical protein CICLE_v10013012mg           63.5    1e-09   Citrus clementina [clementine]
emb|CBX24386.1|  hypothetical_protein                                 64.3    2e-09   Oryza glaberrima
ref|NP_001066080.1|  Os12g0132300                                     63.9    2e-09   
ref|XP_010043960.1|  PREDICTED: probable calcium-binding protein ...  63.9    2e-09   Eucalyptus grandis [rose gum]
ref|XP_002734090.1|  PREDICTED: calmodulin-like                       63.5    2e-09   Saccoglossus kowalevskii
ref|XP_007208587.1|  hypothetical protein PRUPE_ppa023004mg           63.5    2e-09   
gb|KFK40244.1|  hypothetical protein AALP_AA3G348900                  64.3    2e-09   Arabis alpina [alpine rockcress]
ref|XP_004605359.1|  PREDICTED: calmodulin-like protein 3             63.2    2e-09   Sorex araneus [Eurasian shrew]
ref|XP_006443961.1|  hypothetical protein CICLE_v10022698mg           63.2    2e-09   Citrus clementina [clementine]
ref|XP_003544994.1|  PREDICTED: probable calcium-binding protein ...  63.2    2e-09   Glycine max [soybeans]
ref|XP_003689570.1|  PREDICTED: uncharacterized protein LOC100865094  65.5    2e-09   Apis florea [dwarf honeybee]
ref|XP_009775333.1|  PREDICTED: probable calcium-binding protein ...  63.5    2e-09   Nicotiana sylvestris
gb|KDP23657.1|  hypothetical protein JCGZ_23490                       63.2    2e-09   Jatropha curcas
ref|XP_003758346.1|  PREDICTED: calmodulin-like                       63.5    2e-09   
dbj|BAN28652.1|  calmodulin2                                          63.2    2e-09   Coprinopsis cinerea okayama7#130
ref|XP_392226.2|  PREDICTED: probable calcium-binding protein CML...  65.5    2e-09   
ref|XP_007215081.1|  hypothetical protein PRUPE_ppa012612mg           63.2    2e-09   Prunus persica
gb|EMS64097.1|  Putative calmodulin-like protein 2                    63.2    2e-09   Triticum urartu
gb|EYU30122.1|  hypothetical protein MIMGU_mgv1a025962mg              63.5    2e-09   Erythranthe guttata [common monkey flower]
ref|XP_009606381.1|  PREDICTED: probable calcium-binding protein ...  63.2    2e-09   Nicotiana tomentosiformis
ref|XP_009611663.1|  PREDICTED: calmodulin-like protein 8             63.2    2e-09   Nicotiana tomentosiformis
ref|NP_004057.1|  centrin-1                                           63.5    2e-09   Homo sapiens [man]
ref|XP_006568277.1|  PREDICTED: probable calcium-binding protein ...  65.5    2e-09   
sp|O96102.3|CALM_PHYPO  RecName: Full=Calmodulin; Short=CaM           63.2    2e-09   Physarum polycephalum
gb|EHH17309.1|  hypothetical protein EGK_13688                        63.2    2e-09   Macaca mulatta [rhesus macaque]
ref|XP_004241038.1|  PREDICTED: calmodulin-like protein 8             63.2    2e-09   Solanum lycopersicum
ref|XP_009408507.1|  PREDICTED: calmodulin-like protein 11            63.2    2e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006125555.1|  PREDICTED: calmodulin-like isoform X2            63.2    2e-09   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_010935758.1|  PREDICTED: neo-calmodulin-like                   62.8    2e-09   Elaeis guineensis
ref|XP_004897704.1|  PREDICTED: calmodulin-like protein 3             62.8    2e-09   
ref|XP_006609940.1|  PREDICTED: probable calcium-binding protein ...  65.5    2e-09   Apis dorsata [rock honeybee]
ref|XP_011055887.1|  PREDICTED: calmodulin isoform X2                 65.1    2e-09   Acromyrmex echinatior
ref|XP_003630938.1|  Calcium-binding pollen allergen                  63.5    3e-09   
ref|XP_006088486.1|  PREDICTED: calmodulin-like protein 3             62.8    3e-09   Myotis lucifugus
gb|AEO16865.1|  GEX-GECO1                                             65.5    3e-09   synthetic construct
ref|XP_009351545.1|  PREDICTED: probable calcium-binding protein ...  63.5    3e-09   
ref|XP_006350654.1|  PREDICTED: calmodulin-like protein 11-like       62.8    3e-09   
gb|AFV80092.1|  calmodulin-like protein                               62.8    3e-09   
ref|XP_011339456.1|  PREDICTED: calmodulin isoform X2                 65.1    3e-09   
gb|EYU17655.1|  hypothetical protein MIMGU_mgv1a015081mg              63.2    3e-09   
ref|XP_001326924.1|  calmodulin                                       62.8    3e-09   
ref|XP_003616365.1|  Polcalcin Nic t                                  62.4    3e-09   
prf||0608335A  calmodulin                                             62.8    3e-09
ref|XP_011055888.1|  PREDICTED: calmodulin isoform X3                 64.7    3e-09   
ref|XP_004302046.1|  PREDICTED: calmodulin-like protein 11            62.8    3e-09   
dbj|GAM17285.1|  hypothetical protein SAMD00019534_004600             63.2    3e-09   
ref|XP_011339457.1|  PREDICTED: calmodulin isoform X3                 64.7    3e-09   
ref|XP_007033045.1|  Calmodulin like 23, putative                     62.8    3e-09   
ref|XP_002965450.1|  hypothetical protein SELMODRAFT_83841            62.8    3e-09   
gb|AET05414.2|  EF hand calcium-binding family protein                63.2    3e-09   
ref|XP_008119752.1|  PREDICTED: calmodulin                            63.5    3e-09   
ref|XP_002733157.1|  PREDICTED: calmodulin-like                       62.8    3e-09   
gb|KIW16124.1|  calmodulin                                            63.5    3e-09   
gb|EKC20233.1|  Calmodulin                                            65.5    3e-09   
ref|XP_011288132.1|  PREDICTED: calmodulin                            62.8    3e-09   
ref|XP_001852053.1|  calmodulin                                       64.7    3e-09   
gb|KDO48936.1|  hypothetical protein CISIN_1g031616mg                 62.8    3e-09   
gb|EPX74846.1|  calmodulin Cam1                                       62.8    3e-09   
ref|NP_593340.1|  calmodulin Cam1                                     62.8    3e-09   
prf||0711223A  calmodulin                                             62.4    3e-09
gb|EPY50961.1|  calmodulin Cam1                                       62.4    3e-09   
ref|XP_008808019.1|  PREDICTED: calmodulin-like                       62.4    3e-09   
ref|XP_002738868.1|  PREDICTED: calmodulin-like                       62.4    3e-09   
sp|P02595.2|CALM_PATSP  RecName: Full=Calmodulin; Short=CaM           62.4    3e-09   
ref|XP_005704340.1|  calmodulin isoform 2                             62.8    3e-09   
ref|XP_011055886.1|  PREDICTED: caltractin isoform X1                 64.7    3e-09   
gb|EKC24243.1|  Calmodulin                                            65.5    3e-09   
ref|XP_003580040.2|  PREDICTED: probable calcium-binding protein ...  64.3    3e-09   
ref|XP_005605456.1|  PREDICTED: calmodulin                            62.4    3e-09   
ref|XP_001113485.1|  PREDICTED: calmodulin-like isoform 4             62.8    3e-09   
ref|XP_006471667.1|  PREDICTED: calmodulin-like protein 11-like       62.4    3e-09   
sp|P62184.2|CALM_RENRE  RecName: Full=Calmodulin; Short=CaM           62.4    3e-09   
ref|XP_008800225.1|  PREDICTED: probable calcium-binding protein ...  63.2    3e-09   
gb|EPS62655.1|  hypothetical protein M569_12136                       62.8    3e-09   
gb|KFY20747.1|  hypothetical protein V491_03461                       62.8    4e-09   
ref|XP_004349444.1|  calmodulin                                       62.4    4e-09   
ref|XP_004970312.1|  PREDICTED: calmodulin-3-like isoform X1          62.8    4e-09   
ref|XP_011444268.1|  PREDICTED: calmodulin-like                       62.4    4e-09   
gb|KHN40730.1|  Putative calcium-binding protein CML25                62.4    4e-09   
ref|XP_002063560.1|  GK19414                                          62.4    4e-09   
ref|XP_003004863.1|  calmodulin                                       62.4    4e-09   
ref|XP_010038682.1|  PREDICTED: calmodulin-like protein 11            62.4    4e-09   
ref|XP_008359373.1|  PREDICTED: calmodulin-like protein 8             62.4    4e-09   
ref|NP_081692.1|  calmodulin-like protein 3                           62.4    4e-09   
ref|XP_011159042.1|  PREDICTED: probable calcium-binding protein ...  63.5    4e-09   
ref|XP_006432945.1|  hypothetical protein CICLE_v10003695mg           62.4    4e-09   
ref|XP_002974189.1|  hypothetical protein SELMODRAFT_100711           62.8    4e-09   
ref|XP_004971250.1|  PREDICTED: probable calcium-binding protein ...  63.5    4e-09   
ref|XP_006122412.1|  PREDICTED: calmodulin                            62.4    4e-09   
sp|Q39752.3|CALM_FAGSY  RecName: Full=Calmodulin; Short=CaM           62.4    4e-09   
ref|NP_001237178.1|  uncharacterized protein LOC100527005             62.4    4e-09   
ref|XP_009405944.1|  PREDICTED: neo-calmodulin-like                   62.4    4e-09   
ref|XP_008791135.1|  PREDICTED: calmodulin-like protein 8             62.4    4e-09   
ref|XP_006583713.1|  PREDICTED: probable calcium-binding protein ...  62.8    4e-09   
gb|KJB08532.1|  hypothetical protein B456_001G087100                  62.4    4e-09   
prf||1003191A  calmodulin                                             62.4    4e-09
gb|EHB00855.1|  Calmodulin                                            62.8    4e-09   
ref|XP_006568276.1|  PREDICTED: probable calcium-binding protein ...  64.7    4e-09   
ref|XP_009386769.1|  PREDICTED: calmodulin-like                       62.0    4e-09   
ref|XP_010033692.1|  PREDICTED: probable calcium-binding protein ...  62.4    4e-09   
ref|XP_009403239.1|  PREDICTED: calmodulin-like protein 3             62.0    4e-09   
gb|ELK12789.1|  Calmodulin                                            62.4    4e-09   
ref|XP_006662709.1|  PREDICTED: putative calmodulin-like protein ...  62.4    4e-09   
gb|EHB13359.1|  Calmodulin                                            62.0    4e-09   
ref|XP_010104706.1|  putative calcium-binding protein CML25           62.8    5e-09   
ref|XP_008835072.1|  PREDICTED: calmodulin-like protein 3             62.0    5e-09   
ref|XP_005869569.1|  PREDICTED: calmodulin-like protein 3             62.0    5e-09   
ref|XP_004498255.1|  PREDICTED: probable calcium-binding protein ...  62.8    5e-09   
ref|NP_191503.1|  calmodulin-like protein 4                           62.8    5e-09   
gb|AAG00262.1|AF089808_1  calmodulin                                  62.0    5e-09   
ref|XP_005383897.1|  PREDICTED: calmodulin-like protein 3 isoform X1  62.0    5e-09   
ref|XP_004970313.1|  PREDICTED: calmodulin-3-like isoform X2          62.0    5e-09   
ref|XP_007141898.1|  hypothetical protein PHAVU_008G235100g           62.0    5e-09   
gb|KJB82531.1|  hypothetical protein B456_013G201100                  62.0    5e-09   
ref|XP_008229213.1|  PREDICTED: probable calcium-binding protein ...  62.0    5e-09   
ref|NP_001270011.1|  calmodulin 2 (phosphorylase kinase, delta)       62.0    5e-09   
ref|XP_003519336.1|  PREDICTED: probable calcium-binding protein ...  62.0    5e-09   
ref|XP_010917630.1|  PREDICTED: calmodulin-like protein 11            62.0    5e-09   
ref|XP_003702283.1|  PREDICTED: calmodulin-like                       63.5    5e-09   
ref|XP_007223528.1|  hypothetical protein PRUPE_ppa012032mg           62.4    5e-09   
ref|NP_001104289.1|  calmodulin                                       62.0    5e-09   
ref|XP_005354963.1|  PREDICTED: calmodulin-like protein 3             62.0    5e-09   
gb|EYU41429.1|  hypothetical protein MIMGU_mgv1a021942mg              62.0    5e-09   
ref|XP_011427009.1|  PREDICTED: calmodulin-A-like                     62.0    5e-09   
ref|XP_002459097.1|  hypothetical protein SORBIDRAFT_03g045770        62.4    5e-09   
ref|XP_006839639.1|  PREDICTED: calmodulin                            62.0    5e-09   
gb|ADT61781.1|  calmodulin                                            62.0    5e-09   
ref|XP_001755625.1|  predicted protein                                62.0    5e-09   
dbj|BAM78547.1|  GCaMP7a                                              64.7    5e-09   
ref|XP_009388516.1|  PREDICTED: calmodulin-like protein 8             62.0    5e-09   
gb|EMT00032.1|  Calmodulin                                            62.0    6e-09   
gb|ADD38579.1|  Calmodulin                                            62.0    6e-09   
sp|Q0IUU4.2|CML2_ORYSJ  RecName: Full=Putative calmodulin-like pr...  62.4    6e-09   
ref|XP_011339455.1|  PREDICTED: calmodulin-like protein 5 isoform X1  64.3    6e-09   
ref|XP_005071796.1|  PREDICTED: calmodulin-like protein 3             62.0    6e-09   
ref|XP_003494993.1|  PREDICTED: calmodulin-like protein 3             61.6    6e-09   
gb|KDR16279.1|  Calmodulin                                            62.8    6e-09   
ref|XP_011436587.1|  PREDICTED: calmodulin-A-like                     61.6    6e-09   
ref|XP_010512205.1|  PREDICTED: calmodulin-like protein 4             62.4    6e-09   
gb|ACT88125.1|  AT15141p                                              62.0    6e-09   
ref|XP_008221464.1|  PREDICTED: probable calcium-binding protein ...  62.4    6e-09   
ref|XP_004361968.1|  calmodulin                                       61.6    6e-09   
ref|XP_005383080.1|  PREDICTED: calmodulin-like                       61.6    6e-09   
ref|XP_010469361.1|  PREDICTED: calmodulin-like protein 4             62.4    6e-09   
emb|CDO99124.1|  unnamed protein product                              61.6    6e-09   
ref|XP_008443339.1|  PREDICTED: probable calcium-binding protein ...  62.8    6e-09   
ref|XP_007160425.1|  hypothetical protein PHAVU_002G320800g           62.4    6e-09   
ref|XP_011429055.1|  PREDICTED: calmodulin-A-like isoform X1          62.0    6e-09   
ref|XP_011429056.1|  PREDICTED: calmodulin-A-like isoform X2          61.6    6e-09   
gb|KFK37167.1|  hypothetical protein AALP_AA4G222400                  62.0    6e-09   
ref|XP_001361466.1|  GA10810                                          61.6    6e-09   
ref|XP_009414956.1|  PREDICTED: probable calcium-binding protein ...  62.0    6e-09   
gb|ELV14138.1|  Calmodulin                                            62.0    6e-09   
ref|XP_006291828.1|  hypothetical protein CARUB_v10018003mg           62.8    6e-09   
pdb|2K0J|A  Chain A, Solution Structure Of Cam Complexed To Drp1p     61.6    7e-09   
pdb|4DJC|A  Chain A, 1.35 A Crystal Structure Of The Nav1.5 Diii-...  61.6    7e-09   
ref|XP_006990261.1|  PREDICTED: calmodulin-like protein 3             61.6    7e-09   
ref|XP_007200520.1|  hypothetical protein PRUPE_ppa012929mg           61.6    7e-09   
ref|XP_009702107.1|  PREDICTED: calmodulin-like                       62.0    7e-09   
ref|XP_002968790.1|  hypothetical protein SELMODRAFT_17991            61.2    7e-09   
ref|XP_002274476.1|  PREDICTED: probable calcium-binding protein ...  61.6    7e-09   
emb|CDY72611.1|  BnaCnng78560D                                        62.4    7e-09   
gb|ACO12252.1|  Calmodulin                                            61.6    7e-09   
ref|XP_008305625.1|  PREDICTED: calmodulin-like                       61.6    7e-09   
ref|XP_002160750.1|  PREDICTED: calmodulin-like                       62.0    7e-09   
ref|XP_008931196.1|  PREDICTED: calmodulin                            62.0    7e-09   
ref|XP_011281779.1|  PREDICTED: calmodulin                            61.6    7e-09   
gb|ETE70432.1|  Calmodulin                                            62.0    7e-09   
gb|ACH46218.1|  putative calmodulin variant 1                         61.6    7e-09   
ref|NP_001151507.1|  calmodulin                                       61.6    7e-09   
emb|CDY06002.1|  BnaA09g37780D                                        62.0    7e-09   
ref|XP_002319638.2|  hypothetical protein POPTR_0013s03770g           60.8    8e-09   
sp|P11121.2|CALM_PYUSP  RecName: Full=Calmodulin; Short=CaM           61.6    8e-09   
ref|XP_004867156.1|  PREDICTED: calmodulin isoform X1                 62.4    8e-09   
gb|ACN35459.1|  unknown                                               62.4    8e-09   
ref|XP_004298507.1|  PREDICTED: probable calcium-binding protein ...  62.0    8e-09   
gb|EMT07142.1|  Putative calcium-binding protein CML10                62.0    8e-09   
ref|XP_004336073.1|  Calmodulin, putative                             61.2    8e-09   
tpg|DAA39264.1|  TPA: calmodulin                                      61.6    8e-09   
ref|XP_005772534.1|  Centrin-like protein                             61.6    8e-09   
ref|XP_001994187.1|  GH23405                                          61.2    8e-09   
ref|XP_002016663.1|  GL11701                                          61.2    8e-09   
ref|XP_006909678.1|  PREDICTED: calmodulin isoform X1                 61.6    8e-09   
gb|AIL24126.1|  calmodulin 2                                          61.6    8e-09   
emb|CAD41532.1|  OSJNBb0091E11.1                                      62.0    8e-09   
ref|XP_009116605.1|  PREDICTED: calmodulin-like protein 4             62.0    8e-09   
emb|CAH67730.1|  H0522A01.1                                           62.0    8e-09   
gb|EUC61805.1|  calmodulin                                            61.6    8e-09   
ref|NP_001127790.1|  calmodulin-like                                  63.9    8e-09   
gb|ELR61731.1|  hypothetical protein M91_07940                        61.6    8e-09   
gb|ACG37753.1|  calmodulin                                            62.4    8e-09   
dbj|BAB32439.1|  calmodulin                                           61.2    8e-09   
emb|CDQ92434.1|  unnamed protein product                              61.6    9e-09   
gb|ACG31559.1|  calmodulin                                            61.2    9e-09   
dbj|BAE89379.1|  unnamed protein product                              61.2    9e-09   
ref|XP_011265206.1|  PREDICTED: calmodulin isoform X3                 62.8    9e-09   
ref|XP_006357771.1|  PREDICTED: calcium-binding protein CML24-like    61.2    9e-09   
gb|ABU97105.1|  calmodulin                                            60.8    9e-09   
dbj|GAA95920.1|  hypothetical protein E5Q_02578                       61.2    9e-09   
emb|CAB95710.1|  calmodulin-like protein 3                            60.5    9e-09   
ref|XP_009061568.1|  hypothetical protein LOTGIDRAFT_219848           61.2    9e-09   
ref|XP_002881895.1|  hypothetical protein ARALYDRAFT_903714           62.0    1e-08   
ref|XP_002593251.1|  hypothetical protein BRAFLDRAFT_115029           61.2    1e-08   
ref|XP_006664172.1|  PREDICTED: calmodulin-like protein 5-like        61.2    1e-08   
ref|XP_003770562.1|  PREDICTED: calmodulin-like                       61.6    1e-08   
gb|KIJ98372.1|  hypothetical protein K443DRAFT_680798                 61.2    1e-08   
gb|AEE62155.1|  unknown                                               61.2    1e-08   
ref|XP_003748509.1|  PREDICTED: calmodulin-like                       61.6    1e-08   
gb|ADP36946.1|  hypothetical protein                                  61.2    1e-08   
prf||0409298A  troponin C-like protein                                60.8    1e-08
ref|XP_008810798.1|  PREDICTED: calmodulin-7-like                     61.2    1e-08   
ref|XP_003903394.1|  PREDICTED: calmodulin-like protein 3             61.2    1e-08   
gb|AAD34259.1|AF084411_1  calmodulin mutant SYNCAM57A                 60.8    1e-08   
ref|XP_005242003.1|  PREDICTED: calmodulin                            62.8    1e-08   
prf||1206346A  calmodulin                                             61.2    1e-08
ref|NP_565996.1|  calmodulin-like protein MSS3                        62.0    1e-08   
ref|XP_001177619.1|  PREDICTED: calmodulin-1-like isoform 1           61.2    1e-08   
gb|EFA81078.1|  calmodulin                                            60.8    1e-08   
ref|XP_007532277.1|  PREDICTED: calmodulin                            61.2    1e-08   
dbj|BAK64547.1|  calmodulin                                           60.1    1e-08   
ref|XP_002593257.1|  hypothetical protein BRAFLDRAFT_59748            60.8    1e-08   
gb|KFK39574.1|  hypothetical protein AALP_AA3G262000                  60.8    1e-08   
ref|XP_009398373.1|  PREDICTED: calmodulin-like isoform X2            60.8    1e-08   
gb|KFH46306.1|  Calmodulin-like protein                               60.8    1e-08   
ref|XP_001703420.1|  calmodulin                                       61.2    1e-08   
ref|XP_005648308.1|  EF-hand                                          60.8    1e-08   
ref|XP_005535553.1|  similar to calmodulin                            61.2    1e-08   
gb|ESA24296.1|  hypothetical protein GLOINDRAFT_341734                60.8    1e-08   
ref|XP_011436588.1|  PREDICTED: calmodulin-like                       60.8    1e-08   
ref|XP_010986526.1|  PREDICTED: calmodulin                            62.4    1e-08   
gb|ABA01113.1|  calmodulin                                            61.2    1e-08   
ref|XP_008557059.1|  PREDICTED: uncharacterized protein LOC103577...  63.5    1e-08   
ref|XP_009057083.1|  hypothetical protein LOTGIDRAFT_121213           60.5    1e-08   
sp|O97341.3|CALM_SUBDO  RecName: Full=Calmodulin; Short=CaM           60.8    1e-08   
emb|CCQ18612.1|  Calmodulin and related proteins                      60.8    1e-08   
ref|XP_004145834.1|  PREDICTED: probable calcium-binding protein ...  60.8    1e-08   
ref|XP_009398372.1|  PREDICTED: calmodulin-like isoform X1            60.8    1e-08   
ref|XP_002984822.1|  hypothetical protein SELMODRAFT_181303           60.8    1e-08   
ref|XP_009054739.1|  hypothetical protein LOTGIDRAFT_215397           60.8    1e-08   
ref|XP_011436589.1|  PREDICTED: calmodulin-like                       60.8    1e-08   
gb|KFB35355.1|  hypothetical protein ZHAS_00001843                    63.5    1e-08   
ref|XP_004806636.1|  PREDICTED: calmodulin-like protein 3             60.8    1e-08   
gb|KIK57445.1|  hypothetical protein GYMLUDRAFT_46327                 60.8    1e-08   
ref|XP_003622346.1|  Calmodulin-like protein                          60.8    1e-08   
ref|XP_005099688.1|  PREDICTED: calmodulin-like isoform X2            60.8    1e-08   
gb|AFK34900.1|  unknown                                               61.6    1e-08   
ref|XP_008516751.1|  PREDICTED: LOW QUALITY PROTEIN: calmodulin       61.2    1e-08   
ref|XP_006868502.1|  PREDICTED: calmodulin                            60.8    1e-08   
ref|XP_007599517.1|  calmodulin                                       61.2    1e-08   
ref|XP_007255845.1|  PREDICTED: calmodulin isoform X2                 60.8    1e-08   
ref|XP_003799587.1|  PREDICTED: calmodulin-like                       60.8    1e-08   
gb|AFK45794.1|  unknown                                               60.8    1e-08   
gb|ADK23955.1|  calmodulin                                            60.8    1e-08   
gb|AAH05457.1|  Calmodulin-like 3                                     60.8    1e-08   
ref|XP_004757981.1|  PREDICTED: calmodulin-like protein 3             60.8    1e-08   
ref|XP_001760060.1|  predicted protein                                60.8    1e-08   



>ref|XP_009789240.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
sylvestris]
Length=219

 Score =   180 bits (456),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 101/123 (82%), Gaps = 4/123 (3%)
 Frame = +2

Query  251  GYKKPGGESTPTSVLPALNDEISPDELSGL----YAELVQAFKLIDRDDDGKIRKEELEA  418
            G+KKP G +TPTSVLP L++EIS DE S +    YAELVQAF +ID D DGKIRKEELEA
Sbjct  44   GFKKPNGLATPTSVLPTLSNEISADEWSEISAEVYAELVQAFHVIDTDGDGKIRKEELEA  103

Query  419  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDT  598
            +LS+VG EPPS+EEL L+L EVDRDGDGCISLEEF  + SAF PPSCD ELRDAFDFFD 
Sbjct  104  ILSRVGTEPPSKEELTLLLDEVDRDGDGCISLEEFGAIRSAFGPPSCDGELRDAFDFFDA  163

Query  599  DHD  607
            DHD
Sbjct  164  DHD  166



>ref|XP_009601106.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
tomentosiformis]
Length=219

 Score =   177 bits (448),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 100/123 (81%), Gaps = 4/123 (3%)
 Frame = +2

Query  251  GYKKPGGESTPTSVLPALNDEISPDELSGL----YAELVQAFKLIDRDDDGKIRKEELEA  418
            G+KKP G +TPTSVLP L++EIS D+ S +    YAELVQAF +ID D DGKI KEELEA
Sbjct  44   GFKKPNGLATPTSVLPTLSNEISADKWSEISAEVYAELVQAFHMIDTDGDGKIMKEELEA  103

Query  419  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDT  598
            +LS+VG EPPS+EEL L+L EVDRDGDGCISLEEF  +SSAF PPSCD ELRD FDFFD 
Sbjct  104  ILSRVGTEPPSKEELTLLLDEVDRDGDGCISLEEFGAISSAFGPPSCDGELRDVFDFFDA  163

Query  599  DHD  607
            DHD
Sbjct  164  DHD  166



>ref|XP_011075386.1| PREDICTED: probable calcium-binding protein CML36 [Sesamum indicum]
Length=221

 Score =   167 bits (422),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 101/123 (82%), Gaps = 4/123 (3%)
 Frame = +2

Query  251  GYKKPGGESTPTSVLPALNDEISPDELSGL----YAELVQAFKLIDRDDDGKIRKEELEA  418
            G KKP G STPTSVLP L+ +IS +E S +    Y EL QAF++IDRD DGKI+KEELEA
Sbjct  44   GSKKPNGLSTPTSVLPTLSADISAEEWSEISADVYFELKQAFEMIDRDGDGKIKKEELEA  103

Query  419  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDT  598
            LL ++GAEPP++EEL+LMLS+VDRDGDGCI+LEEF  + SAFAPP+CD ELRD FDFFD+
Sbjct  104  LLCRLGAEPPNQEELQLMLSDVDRDGDGCITLEEFYAIGSAFAPPTCDMELRDTFDFFDS  163

Query  599  DHD  607
            D D
Sbjct  164  DRD  166



>ref|XP_011078930.1| PREDICTED: probable calcium-binding protein CML36 [Sesamum indicum]
Length=220

 Score =   166 bits (420),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 101/123 (82%), Gaps = 4/123 (3%)
 Frame = +2

Query  251  GYKKPGGESTPTSVLPALNDEISPDEL----SGLYAELVQAFKLIDRDDDGKIRKEELEA  418
            G+KKP G STPTSVLP+L+ EISP+E     + +Y EL QAF++IDRD DGKI+KEELE 
Sbjct  44   GFKKPTGLSTPTSVLPSLSAEISPNEWPEIPADIYFELKQAFEMIDRDGDGKIKKEELEG  103

Query  419  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDT  598
            LL ++G EPP +EEL+LML+EVDRDGDGCISLEEF  + SAFAPP+ D ELRDAFDFFD+
Sbjct  104  LLCRLGPEPPCQEELKLMLTEVDRDGDGCISLEEFYAIGSAFAPPARDGELRDAFDFFDS  163

Query  599  DHD  607
            D D
Sbjct  164  DRD  166



>emb|CDP14208.1| unnamed protein product [Coffea canephora]
Length=238

 Score =   163 bits (413),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 98/119 (82%), Gaps = 5/119 (4%)
 Frame = +2

Query  266  GGESTPTSVLP-ALNDEISPDELS----GLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  430
            G  +TPTSVLP  L+ EI+ DE S    G+Y ++ +AFK+IDRD DGKI ++ELEALLS+
Sbjct  66   GSPATPTSVLPPTLSSEITSDEWSEISGGVYEDVKEAFKMIDRDGDGKITRDELEALLSR  125

Query  431  VGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            VGAEPPS EEL ++LSEVDRDGDGCISLEEF  + SAF PPSCDSE+RDAFDFFDTDHD
Sbjct  126  VGAEPPSAEELNMLLSEVDRDGDGCISLEEFEAIGSAFGPPSCDSEMRDAFDFFDTDHD  184



>gb|EYU18659.1| hypothetical protein MIMGU_mgv1a026895mg [Erythranthe guttata]
Length=224

 Score =   157 bits (396),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 98/123 (80%), Gaps = 5/123 (4%)
 Frame = +2

Query  254  YKKPGGESTPTSVLP-ALNDEISPDELSGL----YAELVQAFKLIDRDDDGKIRKEELEA  418
            +KKP G STPTSVLP A + EIS +E S +    Y +L QAF++IDRD DGK+ K ELE 
Sbjct  47   FKKPNGLSTPTSVLPTASSAEISTEEWSEISADVYFDLKQAFEMIDRDGDGKVTKAELED  106

Query  419  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDT  598
            LL  +GA+PPSREELRLMLSEVDRDGDGCI+LEEF  + SAFAPP+CD+E+R+ FDFFD+
Sbjct  107  LLCGLGADPPSREELRLMLSEVDRDGDGCITLEEFHSIGSAFAPPTCDTEMRETFDFFDS  166

Query  599  DHD  607
            D D
Sbjct  167  DRD  169


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
             E+ + F   D D DGKI  EEL  +   +G    + E+ R M+  VDR+GDG +  E+F
Sbjct  155  TEMRETFDFFDSDRDGKITAEELFGVFRTIGDAKCTLEDCRRMIRGVDRNGDGFVCFEDF  214

Query  524  SVL  532
            S++
Sbjct  215  SLM  217



>ref|XP_009595400.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
tomentosiformis]
Length=209

 Score =   155 bits (393),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 96/119 (81%), Gaps = 6/119 (5%)
 Frame = +2

Query  251  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  430
            G+KKP G +TPTSVLP    EIS DE    ++E++QAF +ID D DGKIRKE+LEA+L++
Sbjct  44   GFKKPNGLATPTSVLPP--SEISADE----WSEILQAFHMIDSDGDGKIRKEQLEAILTR  97

Query  431  VGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            VG +PPS EEL  +L+EVDR+GDGCISLEEF  +SSAF PP+CD ELR+AFDFFD DHD
Sbjct  98   VGPDPPSEEELISLLNEVDRNGDGCISLEEFGAISSAFGPPACDDELRNAFDFFDADHD  156



>gb|EYU20776.1| hypothetical protein MIMGU_mgv1a020784mg [Erythranthe guttata]
Length=209

 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 92/114 (81%), Gaps = 9/114 (8%)
 Frame = +2

Query  266  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  445
            GG STPTSVLP+ +D         L +EL QAF++IDRD DGKI+KEELE LLS++GAEP
Sbjct  44   GGLSTPTSVLPSADD---------LCSELKQAFEMIDRDGDGKIKKEELEGLLSRLGAEP  94

Query  446  PSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            PS+EEL+LM+SEVDRDGDGCISLEEF  + SAFAPP+CD ELR  FDFFD+D D
Sbjct  95   PSQEELKLMVSEVDRDGDGCISLEEFYAIGSAFAPPTCDGELRSTFDFFDSDRD  148


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
             EL   F   D D DGKI  EEL  +   +G    + E+ R M+  VDR+GDG +  E+F
Sbjct  134  GELRSTFDFFDSDRDGKITAEELFRVFETIGDARCTLEDCRRMIKGVDRNGDGFVCFEDF  193

Query  524  SVL  532
            S++
Sbjct  194  SLM  196



>ref|XP_004249247.1| PREDICTED: probable calcium-binding protein CML36 [Solanum lycopersicum]
Length=209

 Score =   153 bits (387),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 98/119 (82%), Gaps = 5/119 (4%)
 Frame = +2

Query  251  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  430
            G++KP G STPTSVLP   +EIS  E+  +YAEL+ AF ++D D DGKIRKEELEA+LS+
Sbjct  41   GFRKPTGSSTPTSVLP---NEISAAEV--VYAELIHAFHMMDTDGDGKIRKEELEAILSR  95

Query  431  VGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            VG EPPS+EEL L+L EVD DGDGCISL+EF  +SSAF PP+CDSELRDAFDFFD DHD
Sbjct  96   VGTEPPSKEELMLLLEEVDVDGDGCISLQEFGAISSAFGPPACDSELRDAFDFFDADHD  154


 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            +EL  AF   D D DGKI  +EL ++  Q+G    + EE R M+  VD++GDG +  E+F
Sbjct  140  SELRDAFDFFDADHDGKITADELFSVFRQIGDSRCTLEECRRMIRGVDKNGDGFVCFEDF  199

Query  524  SVL  532
             ++
Sbjct  200  CIM  202



>ref|XP_009765839.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
sylvestris]
Length=209

 Score =   150 bits (380),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 96/119 (81%), Gaps = 6/119 (5%)
 Frame = +2

Query  251  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  430
            G++KP G +TPTSVLP   ++IS DE    ++E++QAF +ID   DGKIRKE+LEA+L++
Sbjct  44   GFQKPNGLATPTSVLPP--NDISADE----WSEILQAFHMIDSGGDGKIRKEQLEAILTR  97

Query  431  VGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            VG +PPS EEL  +L+EVDR+GDGCISLEEF  +SSAF PP+CD ELR+AFDFFD +HD
Sbjct  98   VGPDPPSEEELISLLNEVDRNGDGCISLEEFGAISSAFGPPACDDELRNAFDFFDANHD  156



>ref|XP_006351283.1| PREDICTED: probable calcium-binding protein CML36-like [Solanum 
tuberosum]
Length=211

 Score =   150 bits (380),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 96/119 (81%), Gaps = 5/119 (4%)
 Frame = +2

Query  251  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  430
            G+ KP G STPTSVLP   +EIS  E+   YAEL+ AF ++D D DGKIRKEELEA+LS+
Sbjct  43   GFSKPTGSSTPTSVLP---NEISAAEVG--YAELIHAFHMMDTDGDGKIRKEELEAILSR  97

Query  431  VGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            VG EPPS+EEL L+L EVD +GDGCISL+EF  +SSAF PP+CDSELRDAFDFFD DHD
Sbjct  98   VGTEPPSKEELMLLLEEVDVNGDGCISLQEFGAISSAFGPPACDSELRDAFDFFDADHD  156


 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            +EL  AF   D D DGKI  +EL ++  Q+G    + EE R M+  VD++GDG +  E+F
Sbjct  142  SELRDAFDFFDADHDGKITADELFSVFRQIGDSRCTLEECRRMIRGVDKNGDGFVCFEDF  201

Query  524  SVL  532
             V+
Sbjct  202  CVM  204



>ref|XP_002276334.1| PREDICTED: probable calcium-binding protein CML35 [Vitis vinifera]
Length=222

 Score =   144 bits (364),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 87/112 (78%), Gaps = 4/112 (4%)
 Frame = +2

Query  281  PTSVLPALNDEISPDEL---SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPS  451
            PTSVLP  + EIS D     S +  ELV AFK+IDRD DGKI K ELEALLS+VG EPPS
Sbjct  59   PTSVLPMHSYEISGDWSDFSSDIQTELVHAFKMIDRDGDGKITKRELEALLSRVGVEPPS  118

Query  452  REELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
             EE+ +MLSEVDRDGDGCISLEEF  +SSAF  P+CD+ELRDAF FFDTD D
Sbjct  119  EEEIMMMLSEVDRDGDGCISLEEFGAISSAFG-PACDTELRDAFCFFDTDRD  169


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
             EL  AF   D D DGKI  EEL  + + +G +  + E+ + M++ VD++GDG +  E+F
Sbjct  155  TELRDAFCFFDTDRDGKITAEELNQVFAAIGDDRCTLEDCQRMIAGVDKNGDGFVCFEDF  214

Query  524  SVL  532
            S +
Sbjct  215  SRM  217



>ref|XP_004249249.1| PREDICTED: probable calcium-binding protein CML36 [Solanum lycopersicum]
Length=239

 Score =   137 bits (346),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 87/107 (81%), Gaps = 2/107 (2%)
 Frame = +2

Query  290  VLPALNDEISPDELSG-LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELR  466
            VLP+ N +  P E+S  +Y+ELVQAF++ID D DGKI KEEL A+L++VG++PP+ EEL 
Sbjct  81   VLPSTNTQW-PSEISAEVYSELVQAFQMIDGDGDGKIHKEELSAILTRVGSDPPTEEELV  139

Query  467  LMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
             +L+EVD +GDGCISL+EF  +SSAF PPSCDSE+RD F+FFD +HD
Sbjct  140  QLLNEVDVNGDGCISLQEFGAISSAFGPPSCDSEMRDTFEFFDANHD  186



>ref|XP_009622394.1| PREDICTED: probable calcium-binding protein CML35 [Nicotiana 
tomentosiformis]
Length=225

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 97/133 (73%), Gaps = 15/133 (11%)
 Frame = +2

Query  254  YKKPGGESTPTSVLPA-LNDEISPDELS-------GLYAELVQAFKLIDRDDDGKIRKEE  409
            +K   G STPTSVLP  L++EIS ++ S       G+Y++LVQAF LID D DGKIRKE+
Sbjct  40   HKPYNGLSTPTSVLPTTLSNEISAEDWSSEEISNSGVYSDLVQAFSLIDGDGDGKIRKEQ  99

Query  410  LEALLSQVGAE-PPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS------E  568
            LEA+LS+VG + PPS EEL  +L+EVD++GDGCISLE+F ++SSAF      +      E
Sbjct  100  LEAILSRVGGKSPPSEEELISLLNEVDKNGDGCISLEDFGIISSAFELTEATTAEDGGDE  159

Query  569  LRDAFDFFDTDHD  607
            +RDAFDFFDTDHD
Sbjct  160  MRDAFDFFDTDHD  172



>ref|XP_006351257.1| PREDICTED: probable calcium-binding protein CML36-like [Solanum 
tuberosum]
Length=205

 Score =   133 bits (334),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +2

Query  290  VLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRL  469
            VLP+   +   +  + +Y+ELVQAF++ID D DGKI KEE+ A+L++VG++PP+ EEL  
Sbjct  47   VLPSTTTQWPSEIPAEVYSELVQAFQMIDVDGDGKIHKEEISAILTRVGSDPPTEEELVQ  106

Query  470  MLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            +L+EVD +GDGCISL+EF  +SSAF PPSCDSE+RD F+FFD +HD
Sbjct  107  LLNEVDVNGDGCISLQEFGAISSAFGPPSCDSEMRDTFEFFDANHD  152



>ref|XP_009763879.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
sylvestris]
Length=225

 Score =   133 bits (335),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 94/128 (73%), Gaps = 15/128 (12%)
 Frame = +2

Query  269  GESTPTSVLPA-LNDEISPDELS-------GLYAELVQAFKLIDRDDDGKIRKEELEALL  424
            G STPTSVLP  L++EIS D+ S       G+Y++LVQAF LID D DGKIRKE+LEA+L
Sbjct  45   GISTPTSVLPTTLSNEISADDWSSEEISNSGVYSDLVQAFSLIDGDGDGKIRKEQLEAIL  104

Query  425  SQVGAE-PPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPS------CDSELRDAF  583
            S+VG + PPS EEL  +L+EVD++GDGCISLE+F ++SSAF  P          E+RDAF
Sbjct  105  SRVGGKSPPSEEELISLLNEVDKNGDGCISLEDFGIISSAFELPEEMTAEDGGDEMRDAF  164

Query  584  DFFDTDHD  607
            DFFD DHD
Sbjct  165  DFFDADHD  172



>ref|XP_010277607.1| PREDICTED: probable calcium-binding protein CML36 [Nelumbo nucifera]
Length=219

 Score =   126 bits (316),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 86/120 (72%), Gaps = 5/120 (4%)
 Frame = +2

Query  260  KPGGESTPTSVLPALNDEISPD----ELSGLYAELVQAFKLIDRDDDGKIRKEELEALLS  427
            K GG +TP SVL + + EIS D      +  + E +QAFKLIDRD DGK+   ELE LLS
Sbjct  47   KGGGGATPKSVLRSCSQEISGDWSDLSAANTHLEHLQAFKLIDRDGDGKVTIHELEGLLS  106

Query  428  QVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            ++G EPPS+EE+ LML+E+D+DGDGCISLEEF  +SS+  P +  S+LR+AF+ FD D D
Sbjct  107  RIGGEPPSKEEMLLMLTEIDQDGDGCISLEEFEAISSSLVPAAL-SDLREAFNVFDADRD  165


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 44/76 (58%), Gaps = 4/76 (5%)
 Frame = +2

Query  299  ALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLS  478
            A++  + P  LS    +L +AF + D D DGKI  EEL  + S +G +  + E+ R M+ 
Sbjct  140  AISSSLVPAALS----DLREAFNVFDADRDGKISAEELLGVFSAIGDDRCTLEDCRRMIR  195

Query  479  EVDRDGDGCISLEEFS  526
             VD +GDG +  E+FS
Sbjct  196  SVDTNGDGFVCFEDFS  211



>gb|KDP26218.1| hypothetical protein JCGZ_22464 [Jatropha curcas]
Length=219

 Score =   117 bits (294),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 80/110 (73%), Gaps = 1/110 (1%)
 Frame = +2

Query  278  TPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  457
            TPTSVLP ++ + S D  +  Y++LVQAFKLIDRD+DG + + ELEALLS++GAEPPS+E
Sbjct  58   TPTSVLPEISGDWS-DISTDFYSDLVQAFKLIDRDNDGIVSRRELEALLSRLGAEPPSQE  116

Query  458  ELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            E+  MLSEVD  GDGCIS+E       +   P+ D ELR AF+FFD D D
Sbjct  117  EVATMLSEVDHVGDGCISVEALMNRIGSACEPAGDDELRVAFEFFDADQD  166



>ref|XP_008240735.1| PREDICTED: probable calcium-binding protein CML36 [Prunus mume]
Length=229

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = +2

Query  266  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  445
            GG  TPTSVLP  + + S D  + L  ++ QAFKLIDRD+DG + ++ELEALLS++GA+P
Sbjct  64   GGIRTPTSVLPERSGDWS-DFSTDLQLDMAQAFKLIDRDNDGVVSRKELEALLSRLGADP  122

Query  446  PSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            PS+EE+ LMLSEVDR+G+G I+L+           P+ DSELRDAF  FD+DHD
Sbjct  123  PSQEEVMLMLSEVDREGNGSITLDALLNRVGPVCGPAADSELRDAFKVFDSDHD  176


 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 49/87 (56%), Gaps = 0/87 (0%)
 Frame = +2

Query  272  ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPS  451
            E   +  L AL + + P       +EL  AFK+ D D DGKI  EEL  + + +G +  +
Sbjct  138  EGNGSITLDALLNRVGPVCGPAADSELRDAFKVFDSDHDGKISAEELFNVFTAIGDDRCT  197

Query  452  REELRLMLSEVDRDGDGCISLEEFSVL  532
             E+ R M++ VD++GDG +  E+F+ +
Sbjct  198  LEDCRRMIAGVDKNGDGFVCFEDFARM  224



>emb|CBI30075.3| unnamed protein product [Vitis vinifera]
Length=175

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = +2

Query  380  DDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSC  559
            D DGKI K ELEALLS+VG EPPS EE+ +MLSEVDRDGDGCISLEEF  +SSAF  P+C
Sbjct  48   DGDGKITKRELEALLSRVGVEPPSEEEIMMMLSEVDRDGDGCISLEEFGAISSAFG-PAC  106

Query  560  DSELRDAFDFFDTDHD  607
            D+ELRDAF FFDTD D
Sbjct  107  DTELRDAFCFFDTDRD  122


 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
             EL  AF   D D DGKI  EEL  + + +G +  + E+ + M++ VD++GDG +  E+F
Sbjct  108  TELRDAFCFFDTDRDGKITAEELNQVFAAIGDDRCTLEDCQRMIAGVDKNGDGFVCFEDF  167

Query  524  SVL  532
            S +
Sbjct  168  SRM  170



>emb|CDY14768.1| BnaC04g47650D [Brassica napus]
Length=217

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 82/121 (68%), Gaps = 16/121 (13%)
 Frame = +2

Query  260  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  439
            KPG  +TP SVLP  +D        G Y+EL+QAFKLIDRDDDG + + +L ALLS++  
Sbjct  51   KPGPAATPISVLPGDHD--------GFYSELIQAFKLIDRDDDGVVSRRDLAALLSRLSP  102

Query  440  EPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS-----ELRDAFDFFDTDH  604
            EPPS+EE+ LML EVD  GDGCISLEE   L+S  A  S DS     E+R+ F+FFD DH
Sbjct  103  EPPSQEEVTLMLQEVDGGGDGCISLEE---LASRVAGTSSDSDEGSVEMREVFEFFDVDH  159

Query  605  D  607
            D
Sbjct  160  D  160



>ref|XP_007202521.1| hypothetical protein PRUPE_ppa010940mg [Prunus persica]
 gb|EMJ03720.1| hypothetical protein PRUPE_ppa010940mg [Prunus persica]
Length=229

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 84/116 (72%), Gaps = 1/116 (1%)
 Frame = +2

Query  260  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  439
            + GG  TPTSVL   + + S D  + L  ++ QAFKLIDRD+DG + ++ELEALLS++GA
Sbjct  62   EAGGIGTPTSVLLERSGDWS-DFSTDLQLDMAQAFKLIDRDNDGVVSRKELEALLSRLGA  120

Query  440  EPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            +PPS+EE+ LMLSEVDR+G+G ISLE           P+ DSELRDAF+ FD+DHD
Sbjct  121  DPPSQEEVMLMLSEVDREGNGSISLEALLSRVGPVCGPAADSELRDAFEVFDSDHD  176


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 0/85 (0%)
 Frame = +2

Query  272  ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPS  451
            E   +  L AL   + P       +EL  AF++ D D DGKI  EEL  + + +G +  +
Sbjct  138  EGNGSISLEALLSRVGPVCGPAADSELRDAFEVFDSDHDGKISAEELLNVFTAIGDDRCT  197

Query  452  REELRLMLSEVDRDGDGCISLEEFS  526
             E+ R M++ VD++GDG +  E+F+
Sbjct  198  LEDCRRMIAGVDKNGDGFVCFEDFA  222



>gb|KJB16379.1| hypothetical protein B456_002G227200 [Gossypium raimondii]
Length=223

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 78/116 (67%), Gaps = 10/116 (9%)
 Frame = +2

Query  269  GESTPTSVLPALNDEISPDEL---SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  439
            G  TPTSVLP    E S D L   +  Y EL QAFK +D+D+DG I + E+EALLS+   
Sbjct  61   GTGTPTSVLP----ETSVDWLDFSANFYVELCQAFKTMDKDNDGVITRSEVEALLSKFAR  116

Query  440  EPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            +PPS+EE+  ML EVD DGDGCISLE    L +  A P+C+ ELR+ FD FDTDHD
Sbjct  117  QPPSQEEISSMLGEVDGDGDGCISLE---TLINQVAGPACEPELRETFDIFDTDHD  169


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQ-VGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            EL + F + D D DGKI  EEL A   + +G E  + E+ RLM++ VD++GDG +  ++F
Sbjct  156  ELRETFDIFDTDHDGKITAEELMAFYKEKLGDERCTLEDCRLMIASVDKNGDGFVCFDDF  215

Query  524  S  526
            S
Sbjct  216  S  216



>ref|XP_009141989.1| PREDICTED: probable calcium-binding protein CML35 [Brassica rapa]
Length=215

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 80/121 (66%), Gaps = 17/121 (14%)
 Frame = +2

Query  260  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  439
            KPG  +TP SVLP   D          Y+EL+QAFKLIDRDDDG + ++EL ALLS +  
Sbjct  50   KPGPAATPVSVLPGEQD---------FYSELIQAFKLIDRDDDGVVSRKELAALLSGLSP  100

Query  440  EPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS-----ELRDAFDFFDTDH  604
            EPPS+EE+ LML EVD  GDGCISLEE   L+S  A  S DS     E+R+ F+FFD DH
Sbjct  101  EPPSQEEVTLMLQEVDGGGDGCISLEE---LASRVAGTSSDSDEGSVEMREVFEFFDLDH  157

Query  605  D  607
            D
Sbjct  158  D  158



>gb|KJB35924.1| hypothetical protein B456_006G133800 [Gossypium raimondii]
Length=229

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 83/125 (66%), Gaps = 7/125 (6%)
 Frame = +2

Query  251  GYKKP----GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEA  418
            G++ P     G  TPTSVLP  + + S D  +  Y EL QAFK++D+D+DG I + ELEA
Sbjct  52   GHQYPSAATAGFVTPTSVLPQTSGDWS-DFPANFYLELCQAFKMLDKDNDGVISRSELEA  110

Query  419  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF--SVLSSAFAPPSCDSELRDAFDFF  592
            LL +V  +PPSR E+ LMLSEVD DGDG I+LE     V+  A   P+C+ ELR+ FD F
Sbjct  111  LLGKVARQPPSRIEVSLMLSEVDGDGDGYINLETLMNQVVGPACDEPACEPELRETFDIF  170

Query  593  DTDHD  607
            DTDHD
Sbjct  171  DTDHD  175



>ref|XP_006364430.1| PREDICTED: probable calcium-binding protein CML35-like [Solanum 
tuberosum]
Length=216

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 92/121 (76%), Gaps = 12/121 (10%)
 Frame = +2

Query  278  TPTSVLPALNDEISPDELS-----GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAE  442
            TPTSVLP L++EIS D+ S     G+Y++LVQAF +ID + DGKIRKE+LEA+LS+VG +
Sbjct  44   TPTSVLPTLSNEISADDWSEISTAGVYSDLVQAFSVID-NGDGKIRKEQLEAILSRVGGK  102

Query  443  -PPSREELRLMLSEVDRDGDGCISLEEFSVLSSAF--APPSC---DSELRDAFDFFDTDH  604
             PP+ EEL L+L E+D++GDGCISLE F  ++SAF   PPS      E+RDAFDFFD DH
Sbjct  103  SPPTEEELVLLLDELDKNGDGCISLENFETITSAFEPTPPSAAEDAGEMRDAFDFFDEDH  162

Query  605  D  607
            D
Sbjct  163  D  163


 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
             E+  AF   D D DGKI  EEL  +   +G E  + EE + M++ VD++GDG +  E+F
Sbjct  149  GEMRDAFDFFDEDHDGKITGEELFNVFRMIGDERCTLEECKRMITSVDKNGDGFVCFEDF  208

Query  524  SVL  532
             ++
Sbjct  209  CLM  211



>ref|XP_004303614.1| PREDICTED: probable calcium-binding protein CML36 [Fragaria vesca 
subsp. vesca]
Length=210

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 83/121 (69%), Gaps = 15/121 (12%)
 Frame = +2

Query  260  KPGG-ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV-  433
            KPGG  +TPTSVLP    E S         ++ QAF+LIDRD+DG + + ELEALL ++ 
Sbjct  47   KPGGPAATPTSVLPGDWSEFS-------SVDMAQAFRLIDRDNDGVVSRTELEALLKRLL  99

Query  434  GAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAP---PSCDSELRDAFDFFDTDH  604
            GAEPP++EE+ +MLSEVD DGDGCI LE    L   F P   P+ DSELR+AF+ FDTDH
Sbjct  100  GAEPPTQEEVAMMLSEVDGDGDGCIPLE---ALLHRFGPGCEPAADSELREAFEVFDTDH  156

Query  605  D  607
            D
Sbjct  157  D  157


 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            +EL +AF++ D D DGKI  EEL ++ + +G E  + EE R M++EVD++GDG +  ++F
Sbjct  143  SELREAFEVFDTDHDGKISAEELLSVFTAIGDERCTLEECRRMIAEVDKNGDGFVCFQDF  202

Query  524  SVL  532
            + +
Sbjct  203  ARM  205



>ref|XP_008392376.1| PREDICTED: LOW QUALITY PROTEIN: probable calcium-binding protein 
CML36 [Malus domestica]
Length=220

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 83/120 (69%), Gaps = 15/120 (13%)
 Frame = +2

Query  266  GGESTPTSVLPALNDEISPDELSGLYAE------LVQAFKLIDRDDDGKIRKEELEALLS  427
            GG +TPTSVLP         E SG +++      + QAFKLIDRD+DG + ++ELEALLS
Sbjct  57   GGIATPTSVLP---------EKSGDWSDFSADLDMAQAFKLIDRDNDGVVSRKELEALLS  107

Query  428  QVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            ++G +PPS+EE+ LMLSEVDRDG+G I+LE         + P+ DSELRDAF+  DTD+D
Sbjct  108  RLGNDPPSQEEVTLMLSEVDRDGNGSITLEALLNQVGPVSGPAADSELRDAFEVXDTDND  167


 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +2

Query  290  VLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRL  469
             L AL +++ P       +EL  AF++ D D+DGKI  EEL  + + +G E  + EE R 
Sbjct  135  TLEALLNQVGPVSGPAADSELRDAFEVXDTDNDGKISAEELLRVFTAIGDERCTLEECRR  194

Query  470  MLSEVDRDGDGCISLEEF  523
            M+  VD+DGDG +  EEF
Sbjct  195  MIDGVDKDGDGFVCFEEF  212



>emb|CDY06925.1| BnaA04g23900D [Brassica napus]
Length=217

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 79/118 (67%), Gaps = 10/118 (8%)
 Frame = +2

Query  260  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  439
            KPG  +TP SVLP  + +         Y+EL+QAFKLIDRDDDG + ++EL ALLS++  
Sbjct  51   KPGPAATPVSVLPGGDQD--------FYSELIQAFKLIDRDDDGVVSRKELAALLSRLSP  102

Query  440  EPPSREELRLMLSEVDRDGDGCISLEEFS--VLSSAFAPPSCDSELRDAFDFFDTDHD  607
            EPPS+EE+ LML EVD  GDGCISLEE +  V  S+        E+R+ F+FFD DHD
Sbjct  103  EPPSQEEVTLMLQEVDGGGDGCISLEELASRVAGSSSDSDESSVEMREVFEFFDVDHD  160



>ref|XP_009341958.1| PREDICTED: LOW QUALITY PROTEIN: probable calcium-binding protein 
CML36, partial [Pyrus x bretschneideri]
Length=291

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 82/120 (68%), Gaps = 15/120 (13%)
 Frame = +2

Query  266  GGESTPTSVLPALNDEISPDELSGLYAE------LVQAFKLIDRDDDGKIRKEELEALLS  427
            GG +TPTSVLP         E SG +++      + QAFKLIDRD+DG + ++ELEALL 
Sbjct  128  GGITTPTSVLP---------EKSGDWSDFSADLDMAQAFKLIDRDNDGVVSRKELEALLC  178

Query  428  QVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            ++G  PPS+EE+ LMLSEVDRDG+G I+LE         + P+ DSELRDAF+ FDTD+D
Sbjct  179  RLGNAPPSQEEVTLMLSEVDRDGNGSITLEALLNQVGPVSGPAADSELRDAFEVFDTDND  238


 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +2

Query  290  VLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRL  469
             L AL +++ P       +EL  AF++ D D+DGKI  EEL  + + +G E  + EE R 
Sbjct  206  TLEALLNQVGPVSGPAADSELRDAFEVFDTDNDGKISAEELLRVFTAIGDERCTLEECRR  265

Query  470  MLSEVDRDGDGCISLEEF  523
            M+  VD+DGDG +  EEF
Sbjct  266  MIDGVDKDGDGFVCFEEF  283



>ref|NP_001265939.1| Hop-interacting protein THI026 [Solanum lycopersicum]
 gb|AEW69790.1| Hop-interacting protein THI026 [Solanum lycopersicum]
Length=214

 Score =   110 bits (274),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 91/122 (75%), Gaps = 12/122 (10%)
 Frame = +2

Query  275  STPTSVLPALNDEISPDELS-----GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  439
            STPTSVLP L++EIS DE S     G+Y++LV+AF +ID + DGKI+KE+LEA+LS+VG 
Sbjct  41   STPTSVLPTLSNEISADEWSDISTAGVYSDLVRAFSVID-NGDGKIKKEKLEAILSRVGG  99

Query  440  E-PPSREELRLMLSEVDRDGDGCISLEEFSVLSSAF--APPSC---DSELRDAFDFFDTD  601
            + PPS EEL L+L E+D +GDGCISLE F  ++SAF   P S      E+RDAFDFFD D
Sbjct  100  KSPPSEEELVLLLDELDENGDGCISLENFETITSAFESTPTSAAGDAGEMRDAFDFFDED  159

Query  602  HD  607
            HD
Sbjct  160  HD  161


 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +2

Query  311  EISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDR  490
            E +P   +G   E+  AF   D D DGKI  EEL  +   +G E  + EE + M++ VD+
Sbjct  136  ESTPTSAAGDAGEMRDAFDFFDEDHDGKITGEELFNVFRMIGDERCTLEECKRMITSVDK  195

Query  491  DGDGCISLEEFSVL  532
            +GDG +  ++F ++
Sbjct  196  NGDGFVCFDDFCLM  209



>ref|XP_008376081.1| PREDICTED: probable calcium-binding protein CML36 [Malus domestica]
Length=281

 Score =   111 bits (277),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 80/115 (70%), Gaps = 3/115 (3%)
 Frame = +2

Query  266  GGESTPTSVLPALNDEISPDELSG-LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAE  442
            GG +TPTSVL   + + S  E S  L  ++ +AFKLIDRD+DG + ++ELEALL Q+G  
Sbjct  116  GGVTTPTSVLAERSGDWS--EFSADLQLDMAKAFKLIDRDNDGVVSRKELEALLCQLGNN  173

Query  443  PPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            PPS+EE+ LMLSEVDRDG G I+LE         + P  DSELRDAF+ FDTD+D
Sbjct  174  PPSQEEVTLMLSEVDRDGSGSITLEALLNQVGPVSGPPADSELRDAFEVFDTDND  228


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +2

Query  290  VLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRL  469
             L AL +++ P       +EL  AF++ D D+DGKI  EEL  + + +G E  + EE R 
Sbjct  196  TLEALLNQVGPVSGPPADSELRDAFEVFDTDNDGKISAEELLRVFTAIGDERCTLEECRR  255

Query  470  MLSEVDRDGDGCISLEEF  523
            M++EVD++GDG +  EEF
Sbjct  256  MIAEVDKNGDGFVCFEEF  273



>ref|XP_003625055.1| hypothetical protein MTR_7g090450 [Medicago truncatula]
 gb|AES81273.1| EF hand calcium-binding family protein [Medicago truncatula]
 gb|AFK35504.1| unknown [Medicago truncatula]
Length=216

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 82/118 (69%), Gaps = 5/118 (4%)
 Frame = +2

Query  266  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  445
             G  TPTSVLP ++ E S D    +  EL QAF+LIDRD+DG + +EELEA+L+++GA P
Sbjct  47   AGSQTPTSVLPEVSGEWS-DITVDVQCELAQAFRLIDRDNDGVVSREELEAVLTRLGARP  105

Query  446  PSREELRLMLSEVDRDGDGCISLEEF----SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            P+ EE+ LMLSEVD DG GCIS+E         SS+ + P+ + ELR+AF+ FDTD D
Sbjct  106  PTPEEIALMLSEVDSDGKGCISVETIMNRVGSGSSSGSDPNPEEELREAFEVFDTDRD  163


 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  526
            EL +AF++ D D DG+I  EEL  +   +G E  + EE + M++ VD++GDG +  +EFS
Sbjct  150  ELREAFEVFDTDRDGRISAEELLRVFRAIGDERCTLEECKRMIAGVDKNGDGFVCFQEFS  209

Query  527  VL  532
            ++
Sbjct  210  LM  211



>gb|AFK42347.1| unknown [Medicago truncatula]
Length=216

 Score =   108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 82/118 (69%), Gaps = 5/118 (4%)
 Frame = +2

Query  266  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  445
             G  TPTSVLP ++ E S D    +  EL QAF+LIDRD+DG + +EELEA+L+++GA P
Sbjct  47   AGSQTPTSVLPEVSGEWS-DITVDVQCELAQAFRLIDRDNDGVVSREELEAVLTRLGARP  105

Query  446  PSREELRLMLSEVDRDGDGCISLEEF----SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            P+ EE+ LMLSEVD DG GCIS+E         SS+ + P+ + ELR+AF+ FDTD D
Sbjct  106  PTPEEIALMLSEVDSDGKGCISVETIMNRVGSGSSSGSDPNPEEELREAFEVFDTDRD  163


 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  526
            EL +AF++ D D DG+I  EEL  +   +G E  + EE + M++ VD++GDG +  +EFS
Sbjct  150  ELREAFEVFDTDRDGRISAEELLRVFRAIGDERCALEECKRMIAGVDKNGDGFVCFQEFS  209

Query  527  VL  532
            ++
Sbjct  210  LM  211



>ref|XP_010554792.1| PREDICTED: probable calcium-binding protein CML35 [Tarenaya hassleriana]
Length=218

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 79/126 (63%), Gaps = 17/126 (13%)
 Frame = +2

Query  251  GYKKPGGESTPTSVLPALNDEISPDELSG----LYAELVQAFKLIDRDDDGKIRKEELEA  418
            G +KP   STPTSV+P         E+SG     Y ELVQAFKLIDRDDDG + + EL A
Sbjct  50   GDRKPSPASTPTSVIP---------EISGGDRDFYTELVQAFKLIDRDDDGVVSRNELAA  100

Query  419  LLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS---VLSSAFAPPSCDSELRDAFDF  589
            +L ++  EPPS EE+R+ML EVD  GDGCISLEE +     +SA        ELR+ F+F
Sbjct  101  VLRRLSPEPPSEEEVRMMLREVD-GGDGCISLEELASRVAGTSATGSSVEKGELREVFEF  159

Query  590  FDTDHD  607
            FD D D
Sbjct  160  FDADRD  165



>ref|XP_006421261.1| hypothetical protein CICLE_v10005842mg [Citrus clementina]
 gb|ESR34501.1| hypothetical protein CICLE_v10005842mg [Citrus clementina]
 gb|KDO37861.1| hypothetical protein CISIN_1g027592mg [Citrus sinensis]
Length=221

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 83/119 (70%), Gaps = 4/119 (3%)
 Frame = +2

Query  263  PGGESTPTSVLPALN---DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  433
            P    TPTSVL  ++    ++S D    +  ELVQA KL+DRD+DG + + ELEALL ++
Sbjct  50   PDRVGTPTSVLHEISGDWSDMSADISLDMNYELVQACKLLDRDNDGVVLRSELEALLIRL  109

Query  434  GAEPPSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            GA+PP++EE++ MLSEVDR+GDG I LE   S + ++   P+C+ EL++ FDFFD DHD
Sbjct  110  GADPPTQEEVKSMLSEVDREGDGYIPLEALISRVGNSSCEPACEPELKETFDFFDADHD  168



>ref|XP_007028573.1| Calcium-binding EF-hand family protein, putative [Theobroma cacao]
 gb|EOY09075.1| Calcium-binding EF-hand family protein, putative [Theobroma cacao]
Length=180

 Score =   104 bits (260),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 2/90 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            +EL QAFK+ID+D+DG I + ELEALLS+V  +PPSREE+ LMLSEV  DG GCISL+  
Sbjct  35   SELCQAFKIIDKDNDGVITRSELEALLSKVARQPPSREEVSLMLSEVYGDGVGCISLDTL  94

Query  524  --SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
               V+  A   P+C+ ELR+ FD FDTDHD
Sbjct  95   MTQVVVPACDEPACEPELRETFDIFDTDHD  124


 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQ-VGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            EL + F + D D DGKI  EEL A   + +G E  + E+ R M++ VD++GDG +  E+F
Sbjct  111  ELRETFDIFDTDHDGKITAEELMAFFKETIGDERCTLEDCRRMIASVDKNGDGFVCFEDF  170

Query  524  S  526
            +
Sbjct  171  A  171



>ref|XP_006491566.1| PREDICTED: probable calcium-binding protein CML36-like [Citrus 
sinensis]
Length=221

 Score =   105 bits (261),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 82/119 (69%), Gaps = 4/119 (3%)
 Frame = +2

Query  263  PGGESTPTSVLPALN---DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  433
            P    TPTSVL  ++    ++S D    L  ELVQA KL+DRD+DG + + ELEALL ++
Sbjct  50   PDRVGTPTSVLHEISGDWSDMSADISLDLNYELVQACKLLDRDNDGVVLRSELEALLIRL  109

Query  434  GAEPPSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            GA+PP++EE+  MLSEVDR+GDG I LE   S + ++   P+C+ EL++ FDFFD DHD
Sbjct  110  GADPPTQEEVSSMLSEVDREGDGYIPLEALISRVGNSSCEPACEPELKETFDFFDADHD  168



>ref|XP_002534401.1| Calcium-binding allergen Ole e, putative [Ricinus communis]
 gb|EEF27979.1| Calcium-binding allergen Ole e, putative [Ricinus communis]
Length=211

 Score =   104 bits (259),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 79/114 (69%), Gaps = 12/114 (11%)
 Frame = +2

Query  278  TPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  457
            TP SVLP L+ + S D  S  ++ELVQAFKL+D D+DG + + +LE+LL ++GAE    E
Sbjct  53   TPPSVLPDLSGDWS-DVSSDFFSELVQAFKLMDNDNDGIVSRTQLESLLIRLGAE----E  107

Query  458  ELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSC----DSELRDAFDFFDTDHD  607
            E+  MLSEVDRDGDGCIS+E    L S    P+C    D ELR AF+FFDTDHD
Sbjct  108  EVATMLSEVDRDGDGCISVE---ALMSRIGGPACEPAGDDELRVAFEFFDTDHD  158


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  526
            EL  AF+  D D DGKI  EEL  +   +G E  + ++ R M++ VD++GDG +  E+F+
Sbjct  145  ELRVAFEFFDTDHDGKITAEELMGVYKAIGDERCTLDDCRRMIAGVDKNGDGFVCFEDFA  204



>ref|XP_008373033.1| PREDICTED: probable calcium-binding protein CML36 [Malus domestica]
Length=223

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 76/108 (70%), Gaps = 3/108 (3%)
 Frame = +2

Query  287  SVLPALNDEISPDELSG-LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREEL  463
            SVLP  + E S  E S  L  ++ QAFK IDRD+DG + ++ELEALL ++G +P SREE+
Sbjct  65   SVLPERSGEWS--EFSADLQLDMAQAFKXIDRDNDGVVSRKELEALLCRLGNDPQSREEV  122

Query  464  RLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
             LMLSEVDRDG+G ISLE         + P+ DSELRDAF+ FDTD+D
Sbjct  123  TLMLSEVDRDGNGSISLEAVLNRVGPVSGPAADSELRDAFEVFDTDND  170


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +2

Query  293  LPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLM  472
            L A+ + + P       +EL  AF++ D D+DGKI  EEL +    +G E  + EE   M
Sbjct  139  LEAVLNRVGPVSGPAADSELRDAFEVFDTDNDGKISAEELLSFFRAIGDEGCTLEECGRM  198

Query  473  LSEVDRDGDGCISLEEFSVL  532
            ++  D++GDG +  EEF+ +
Sbjct  199  IAGADKNGDGFVCFEEFAHM  218



>ref|XP_010544017.1| PREDICTED: probable calcium-binding protein CML35 [Tarenaya hassleriana]
Length=224

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 80/123 (65%), Gaps = 8/123 (7%)
 Frame = +2

Query  257  KKPGGESTPTSVLPALNDEISPDELSG----LYAELVQAFKLIDRDDDGKIRKEELEALL  424
            +KP   STP SVLP ++ + S  ++S      YAELVQAFKLIDRDDDG + + EL ALL
Sbjct  51   RKPDPASTPISVLPEISGDWS--QISAGDRDFYAELVQAFKLIDRDDDGMVSRSELAALL  108

Query  425  SQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS--VLSSAFAPPSCDSELRDAFDFFDT  598
            S++  +PPS+EE+ +ML  VD   DGCISLEE +  V  S+ A      ELR+ F FFD 
Sbjct  109  SRLSPDPPSQEEVSMMLRVVDGGDDGCISLEELANRVAGSSAAGSMEAGELREVFGFFDA  168

Query  599  DHD  607
            D D
Sbjct  169  DRD  171



>ref|XP_010102734.1| putative calcium-binding protein CML36 [Morus notabilis]
 gb|EXB93986.1| putative calcium-binding protein CML36 [Morus notabilis]
Length=231

 Score =   103 bits (256),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 86/120 (72%), Gaps = 7/120 (6%)
 Frame = +2

Query  266  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ---VG  436
            GG  TPTSVLP ++ ++S D  + +++EL +AFKLIDRD+DG + ++ELEALLS+   VG
Sbjct  58   GGSVTPTSVLPEISGDLS-DFSADIHSELAEAFKLIDRDNDGIVSRKELEALLSRLGGVG  116

Query  437  AEPPSREELRLMLSEVD-RDGDGCISLEEF--SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            +   S + +  MLSEVD  DG+GCIS+E     V S+A   P+ DSELR+AFDFFDTD D
Sbjct  117  SISESEDFVASMLSEVDGGDGEGCISVEALMSRVGSAAACEPAGDSELREAFDFFDTDRD  176



>emb|CDY23852.1| BnaC04g01850D [Brassica napus]
Length=213

 Score =   101 bits (252),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 80/122 (66%), Gaps = 13/122 (11%)
 Frame = +2

Query  251  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  430
            G  KPG  +TP SVLP  + +         Y+ELV+AFKLIDRDDDG + ++EL ALLS+
Sbjct  42   GNLKPGPAATPVSVLPQSSGD--------FYSELVEAFKLIDRDDDGVVSRKELAALLSR  93

Query  431  VGAEPPSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSC--DSELRDAFDFFDTD  601
            +  EPPS+EE+ +ML EV  D DGCISLEE  S ++ + +   C    E+R+ F+FFD D
Sbjct  94   LSPEPPSQEEVSMMLREV--DADGCISLEELASRVAGSTSGEGCVETEEMREVFEFFDAD  151

Query  602  HD  607
             D
Sbjct  152  RD  153



>ref|XP_002882655.1| hypothetical protein ARALYDRAFT_897194 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58914.1| hypothetical protein ARALYDRAFT_897194 [Arabidopsis lyrata subsp. 
lyrata]
Length=206

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 74/114 (65%), Gaps = 7/114 (6%)
 Frame = +2

Query  266  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  445
            GG  TPTS+LP +    S       Y E++QAFKLIDRD+DG + + +LE+LLS++G EP
Sbjct  47   GGSVTPTSILPEVPSPYS-------YIEILQAFKLIDRDNDGAVSRHDLESLLSRLGPEP  99

Query  446  PSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
             + EE+ +M+ EVD DGDG I LEE +    +  P    +EL++ F+FFD D D
Sbjct  100  LTEEEINVMIKEVDGDGDGTIRLEELASRVVSLDPARDSTELKETFEFFDADRD  153



>ref|XP_010273279.1| PREDICTED: probable calcium-binding protein CML36 [Nelumbo nucifera]
Length=221

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +2

Query  260  KPGGESTPTSVLPALNDEISPDE---LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  430
            K GG +TP SVL + + EIS D     +  + +LV+AFK IDRD DGKI + ELE +LS+
Sbjct  48   KEGGATTPRSVLHSHSHEISGDWSDLQADFHFQLVEAFKFIDRDGDGKITRRELENILSR  107

Query  431  VGAEPPS--REELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDH  604
            +GA+ PS   + + + L EVDRDGDGCI+L+E    S AF P    SELRDAFDFFD   
Sbjct  108  LGADTPSEEMQMMLMELMEVDRDGDGCINLKETGATSPAFGPYD-GSELRDAFDFFDAGR  166

Query  605  D  607
            D
Sbjct  167  D  167



>ref|XP_002323262.1| Calmodulin-like family protein [Populus trichocarpa]
 gb|EEF05023.1| Calmodulin-like family protein [Populus trichocarpa]
Length=216

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 78/115 (68%), Gaps = 8/115 (7%)
 Frame = +2

Query  266  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  445
             G  TPTSVLP ++ + S D  +  Y EL QAFK+IDRD+DG + + ELEALL+++GAEP
Sbjct  56   AGFRTPTSVLPQISGDWS-DMSTDFYFELTQAFKVIDRDNDGLVSRNELEALLTRLGAEP  114

Query  446  PSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            PS +E+ +ML EVD      IS+EE  S L SA  P   D ELRDAF FFD+D D
Sbjct  115  PSSQEMAVMLGEVD-----LISVEELASRLGSACEPAGGD-ELRDAFVFFDSDRD  163



>ref|XP_002308908.1| Calmodulin-like family protein [Populus trichocarpa]
 gb|ABK96152.1| unknown [Populus trichocarpa]
 gb|EEE92431.1| Calmodulin-like family protein [Populus trichocarpa]
Length=213

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 76/113 (67%), Gaps = 6/113 (5%)
 Frame = +2

Query  269  GESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP  448
            G  TPTS+LP ++ + + D  + LY EL QAFKLIDRD+DG + + ELEALL+++GAEPP
Sbjct  54   GFRTPTSILPQVSGDWT-DISADLYFELTQAFKLIDRDNDGLVSRNELEALLTRLGAEPP  112

Query  449  SREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            S EE+ ++L EVD      IS+E  +        P+ D ELRDAF FFD+D D
Sbjct  113  SSEEMAVILGEVDH-----ISVEALASRLGTACEPAGDDELRDAFVFFDSDRD  160



>ref|XP_010543513.1| PREDICTED: probable calcium-binding protein CML36 [Tarenaya hassleriana]
Length=215

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 81/117 (69%), Gaps = 3/117 (3%)
 Frame = +2

Query  266  GGESTPTSVLPALNDEISPDELSGLYA--ELVQAFKLIDRDDDGKIRKEELEALLSQVGA  439
             G  TPTSVLP ++ + +  + S  Y+  ELVQAFKLID+D+DG + +++LEALLS++G 
Sbjct  46   AGTVTPTSVLPEVSGDFAAVDASYPYSYLELVQAFKLIDKDNDGAVSRQDLEALLSRLGP  105

Query  440  EPPSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            +P S+EE+ +ML ++DRDGDG I LE   S + SA       +ELR+ F+FFD D D
Sbjct  106  DPLSQEEIDVMLGDLDRDGDGAIRLEALASRVVSAGDLSRHSAELRETFEFFDADRD  162


 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 41/71 (58%), Gaps = 0/71 (0%)
 Frame = +2

Query  314  ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRD  493
            +S  +LS   AEL + F+  D D DG I  EEL  + + +G E  + E+ R M++ VD D
Sbjct  138  VSAGDLSRHSAELRETFEFFDADRDGLISAEELLRVFASIGDEQCTLEDCRRMIAAVDED  197

Query  494  GDGCISLEEFS  526
            GDG +   EFS
Sbjct  198  GDGFVCFGEFS  208



>ref|XP_011033138.1| PREDICTED: probable calcium-binding protein CML36 [Populus euphratica]
Length=216

 Score = 99.4 bits (246),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 75/114 (66%), Gaps = 6/114 (5%)
 Frame = +2

Query  266  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  445
             G  TPTSVLP ++ + S D  +  Y EL QAFK+IDRD+DG + + ELEALL+++GAEP
Sbjct  56   AGFRTPTSVLPQISGDWS-DMSTDFYFELTQAFKVIDRDNDGLVSRNELEALLTRLGAEP  114

Query  446  PSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            PS EE+ +ML E D      +S+E  +    +   P+ D ELRDAF FFD+D D
Sbjct  115  PSSEEMAVMLGERDH-----VSVEALASRLGSACEPAGDDELRDAFVFFDSDRD  163



>gb|KDO37863.1| hypothetical protein CISIN_1g027592mg [Citrus sinensis]
Length=212

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 79/118 (67%), Gaps = 11/118 (9%)
 Frame = +2

Query  263  PGGESTPTSVLPALN---DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  433
            P    TPTSVL  ++    ++S D    +  ELVQA KL+DRD+DG + + ELEALL ++
Sbjct  50   PDRVGTPTSVLHEISGDWSDMSADISLDMNYELVQACKLLDRDNDGVVLRSELEALLIRL  109

Query  434  GAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            GA+PP++EE++ MLSEVDR+GDG +         ++   P+C+ EL++ FDFFD DHD
Sbjct  110  GADPPTQEEVKSMLSEVDREGDGRV--------GNSSCEPACEPELKETFDFFDADHD  159



>ref|XP_004493430.1| PREDICTED: probable calcium-binding protein CML36-like [Cicer 
arietinum]
Length=214

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 76/114 (67%), Gaps = 4/114 (4%)
 Frame = +2

Query  266  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  445
            GG  TPTSVLP ++ + S D    +  EL QAF+LIDRD+DG + +EELE +L+++GA  
Sbjct  52   GGSQTPTSVLPEISGDWS-DVTVDVQWELSQAFRLIDRDNDGVVSREELELVLTRLGARA  110

Query  446  PSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
               EE+ +ML+EVD DG GCIS+E         + P+ + ELR+AF+ FDTD D
Sbjct  111  ---EEIAIMLTEVDGDGRGCISVEAIMNRVGTGSDPNPEEELREAFEVFDTDRD  161



>ref|XP_009142741.1| PREDICTED: probable calcium-binding protein CML35 [Brassica rapa]
Length=213

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 78/122 (64%), Gaps = 13/122 (11%)
 Frame = +2

Query  251  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  430
            G  KPG  +TP SVLP  + +         Y+ELV+AFKLIDRDDDG + +++L ALLS+
Sbjct  42   GKLKPGPAATPVSVLPQSSGD--------FYSELVEAFKLIDRDDDGVVSRKDLAALLSR  93

Query  431  VGAEPPSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSC--DSELRDAFDFFDTD  601
            +  EPPS EE+ +ML EV  D DGCISLEE  S ++   +   C    E+R+ F+FFD D
Sbjct  94   LSPEPPSPEEVSMMLREV--DADGCISLEELASRVAGTSSGEGCIETEEMREVFEFFDAD  151

Query  602  HD  607
             D
Sbjct  152  RD  153



>emb|CDX79938.1| BnaA05g02180D [Brassica napus]
Length=213

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 78/122 (64%), Gaps = 13/122 (11%)
 Frame = +2

Query  251  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  430
            G  KPG  +TP SVLP  + +         Y+ELV+AFKLIDRDDDG + +++L ALLS+
Sbjct  42   GKLKPGPAATPVSVLPQSSGD--------FYSELVEAFKLIDRDDDGVVSRKDLAALLSR  93

Query  431  VGAEPPSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSC--DSELRDAFDFFDTD  601
            +  EPPS EE+ +ML EV  D DGCISLEE  S ++   +   C    E+R+ F+FFD D
Sbjct  94   LSPEPPSPEEVSMMLREV--DADGCISLEELASRVAGTSSGEGCIETEEMREVFEFFDAD  151

Query  602  HD  607
             D
Sbjct  152  RD  153



>gb|KFK38406.1| hypothetical protein AALP_AA3G109000 [Arabis alpina]
Length=196

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 74/109 (68%), Gaps = 6/109 (6%)
 Frame = +2

Query  281  PTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREE  460
            PTS+LP    EISP   S  Y E++++F LIDR++DG I K +LE+LLS++G EP + EE
Sbjct  41   PTSILP----EISPSPYS--YVEILKSFSLIDRNNDGAISKHDLESLLSKLGPEPLTEEE  94

Query  461  LRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            + +M+ EVDRDGDG I LEE +    +  P    +EL++ F+FFD D D
Sbjct  95   IDVMIKEVDRDGDGTIRLEELASRVVSLDPCRDSTELKETFEFFDADRD  143



>emb|CDY00910.1| BnaC05g42900D [Brassica napus]
Length=218

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 79/120 (66%), Gaps = 10/120 (8%)
 Frame = +2

Query  266  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  445
            GG  TPTS+LP ++   SP      Y E++QAFKLIDRD+DG + + +LE+LL+++G +P
Sbjct  50   GGSVTPTSILPEVSAVHSPYS----YVEILQAFKLIDRDNDGAVSRHDLESLLTRLGPDP  105

Query  446  PSREELRLMLSEVDRDGDGCISLEEFS----VLSSAFAPPS--CDSELRDAFDFFDTDHD  607
            P+ EE+ +ML EVD DGDG I LEE +    V+SS     S     EL++ F+FFD D D
Sbjct  106  PTEEEIDVMLKEVDCDGDGTIRLEELASRCVVVSSEDDNKSRGGSDELKETFEFFDADRD  165


 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  526
            EL + F+  D D DGKI  EEL  + S +G E  + EE   M++ VD DG+G +   EFS
Sbjct  152  ELKETFEFFDADRDGKISAEELLRVFSAIGDERCTLEECERMIAAVDDDGNGFVCFAEFS  211



>ref|XP_006411405.1| hypothetical protein EUTSA_v10017207mg [Eutrema salsugineum]
 gb|ESQ52858.1| hypothetical protein EUTSA_v10017207mg [Eutrema salsugineum]
Length=226

 Score = 97.1 bits (240),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 84/123 (68%), Gaps = 9/123 (7%)
 Frame = +2

Query  260  KPGGESTPTSVLPALNDEISPDELSG---LYAELVQAFKLIDRDDDGKIRKEELEALLSQ  430
            KPG  +TP SVLP  + + S  ++SG    Y++L+QAFKLIDRDDDG + + +L ALLS+
Sbjct  50   KPGPAATPVSVLPENSGDWS--QISGDRDFYSDLIQAFKLIDRDDDGVVSRGDLAALLSR  107

Query  431  VGAEPPSREELRLMLSEVD-RDGDGCISLEEFS--VLSSAFAPPSCDS-ELRDAFDFFDT  598
            +  +PPS+EE+ LML EVD  +  GCISLEE +  V  S+    S ++ E+R+ F+FFD 
Sbjct  108  LSPDPPSQEEVSLMLREVDGGEESGCISLEELASRVAGSSSGEGSVETEEMREVFEFFDA  167

Query  599  DHD  607
            D D
Sbjct  168  DRD  170


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 49/98 (50%), Gaps = 3/98 (3%)
 Frame = +2

Query  266  GGESTPTSVLPALNDEI---SPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  436
            GGE +    L  L   +   S  E S    E+ + F+  D D DGKI  EEL  +   +G
Sbjct  127  GGEESGCISLEELASRVAGSSSGEGSVETEEMREVFEFFDADRDGKISAEELYRVFGVIG  186

Query  437  AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAP  550
             E  + +E R M++ V R+GDG +  E+FS +    AP
Sbjct  187  DERCTIDECRRMIATVGRNGDGFVCFEDFSRMMELQAP  224



>ref|NP_187630.1| putative calcium-binding protein CML36 [Arabidopsis thaliana]
 sp|Q9SS31.1|CML36_ARATH RecName: Full=Probable calcium-binding protein CML36; AltName: 
Full=Calmodulin-like protein 36 [Arabidopsis thaliana]
 gb|AAF02827.1|AC009400_23 calmodulin-like protein [Arabidopsis thaliana]
 gb|AAO24546.1| At3g10190 [Arabidopsis thaliana]
 dbj|BAF00087.1| calmodulin like protein [Arabidopsis thaliana]
 gb|AEE74869.1| putative calcium-binding protein CML36 [Arabidopsis thaliana]
Length=209

 Score = 96.3 bits (238),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 72/110 (65%), Gaps = 7/110 (6%)
 Frame = +2

Query  278  TPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  457
            TPTS+LP +    S       Y E++QAFKLIDRD+DG + + +LE+LLS++G +P + E
Sbjct  54   TPTSILPEVPSPYS-------YVEILQAFKLIDRDNDGAVSRHDLESLLSRLGPDPLTEE  106

Query  458  ELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            E+ +ML EVD DGDG I LEE +    +  P    +EL++ F+FFD D D
Sbjct  107  EINVMLKEVDCDGDGTIRLEELASRVVSLDPARDSTELKETFEFFDADRD  156



>ref|XP_006407598.1| hypothetical protein EUTSA_v10021512mg [Eutrema salsugineum]
 gb|ESQ49051.1| hypothetical protein EUTSA_v10021512mg [Eutrema salsugineum]
Length=211

 Score = 96.3 bits (238),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 80/116 (69%), Gaps = 8/116 (7%)
 Frame = +2

Query  266  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  445
            GG  TPTS+LP ++ + SP      Y E++ AF+LIDRD+DG + + +L +LLS++G +P
Sbjct  49   GGSVTPTSILPEVSGDPSPYS----YVEILHAFQLIDRDNDGAVTRRDLSSLLSRLGPDP  104

Query  446  PSREELRLMLSEVDRDGDGCISLEEFS--VLSSAFAPPSCDSELRDAFDFFDTDHD  607
            PS EE+ +ML EVD DG+G I +EE +  V+SS  +  S  +EL++ F+FFD D D
Sbjct  105  PSEEEIDVMLREVDCDGEGTIRIEELASRVVSSDQSRDS--TELKETFEFFDADRD  158



>ref|XP_011027298.1| PREDICTED: probable calcium-binding protein CML35 [Populus euphratica]
Length=208

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 75/113 (66%), Gaps = 6/113 (5%)
 Frame = +2

Query  269  GESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP  448
            G  TPTS+LP ++ + + D  + LY EL QAFKLID D+DG + + ELEALL+++GAEPP
Sbjct  49   GFRTPTSILPQVSGDWT-DISNDLYFELTQAFKLIDGDNDGLVSRSELEALLTRLGAEPP  107

Query  449  SREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            S EE+ ++L EVD      IS+E  +        P+ + ELRDAF FFD+D D
Sbjct  108  SSEEMAVILGEVDH-----ISVEALASRLGTACEPAGNDELRDAFVFFDSDRD  155



>ref|XP_010508721.1| PREDICTED: probable calcium-binding protein CML35 [Camelina sativa]
Length=224

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 77/121 (64%), Gaps = 12/121 (10%)
 Frame = +2

Query  260  KPGG-ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  436
            KP G  +TP SVLP       P      Y ELVQAFKLIDRDDDG + + +L ALLS++ 
Sbjct  51   KPAGPTATPISVLP-------PQSSGDFYTELVQAFKLIDRDDDGVVSRGDLAALLSRLS  103

Query  437  AEPPSREELRLMLSEVDRDGD--GCISLEEF-SVLSSAFAPPSCDS-ELRDAFDFFDTDH  604
             EPPS+EE+ LML EVD D D  GCISLE+  S ++      S ++ ELR+ F++FD D 
Sbjct  104  PEPPSQEEVSLMLKEVDGDNDDGGCISLEDLASRVAGTSGQGSVETEELREVFEYFDADR  163

Query  605  D  607
            +
Sbjct  164  N  164



>ref|XP_002881773.1| hypothetical protein ARALYDRAFT_903457 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58032.1| hypothetical protein ARALYDRAFT_903457 [Arabidopsis lyrata subsp. 
lyrata]
Length=216

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 76/124 (61%), Gaps = 16/124 (13%)
 Frame = +2

Query  251  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  430
            G  K G  +TP SVLP  + +         YAEL+QAFKLIDRDDDG + + +L AL+S+
Sbjct  46   GNLKQGPTATPISVLPQNSGD--------FYAELIQAFKLIDRDDDGVVSRGDLAALISR  97

Query  431  VGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS-----ELRDAFDFFD  595
            +  EPPS+EE+ LML EVD    GCISLEE   L+S  A  S +      ELR+ F+ FD
Sbjct  98   LSPEPPSQEEVSLMLREVDGGDGGCISLEE---LASRVAGTSGEGSVETEELREVFEIFD  154

Query  596  TDHD  607
             D +
Sbjct  155  VDRN  158



>ref|XP_008800223.1| PREDICTED: calmodulin-like [Phoenix dactylifera]
Length=227

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 81/134 (60%), Gaps = 16/134 (12%)
 Frame = +2

Query  251  GYKKPGGESTPTSVLPA---LNDEISPDELSG---LYAEL--------VQAFKLIDRDDD  388
            G+   G  STP SVLPA   L     P   +G   L+  L         + F + D D D
Sbjct  42   GFISSGLHSTPRSVLPASPGLRPAEKPPSAAGSNDLWLFLPASSSSSVSELFAVFDCDGD  101

Query  389  GKIRKEELEALLSQVG-AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS  565
            GKI ++ELEA+L ++G A+PP+ EE+  M++EVDRDGDGCISLEEF  + SAF PP+  +
Sbjct  102  GKITRQELEAVLRRLGGADPPTEEEVASMVAEVDRDGDGCISLEEFGAIGSAFGPPA-GA  160

Query  566  ELRDAFDFFDTDHD  607
            ELR+ F  FD D D
Sbjct  161  ELREVFAVFDDDGD  174


 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AEL + F + D D DGKI  EEL+ +   +G +  + E+ R M+  VD DGDG +  E+F
Sbjct  160  AELREVFAVFDDDGDGKISAEELQRVFVMLGDDGCTLEDCRRMIGGVDTDGDGFVCFEDF  219



>gb|AGV22098.1| calmodulin-like protein [Brassica juncea]
Length=208

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 74/115 (64%), Gaps = 5/115 (4%)
 Frame = +2

Query  266  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  445
            GG  TPTS+LP ++   SP      Y E++QAFKLIDRD+DG + + +LE+LL+++G +P
Sbjct  45   GGSVTPTSILPEVSAVHSPYS----YVEILQAFKLIDRDNDGAVSRHDLESLLTRLGPDP  100

Query  446  PSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            P+ EE+ +ML EVD DGDG + LEE  S             EL++ F+FFD D D
Sbjct  101  PTEEEIDVMLREVDCDGDGTVRLEELASRCVDDDQSRGGSDELKETFEFFDADRD  155


 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 40/73 (55%), Gaps = 0/73 (0%)
 Frame = +2

Query  314  ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRD  493
            +  D+  G   EL + F+  D D DGKI  EEL  + S +G E  + EE   M++ VD D
Sbjct  131  VDDDQSRGGSDELKETFEFFDADRDGKISAEELLRVFSAIGDERCTLEECERMIAAVDDD  190

Query  494  GDGCISLEEFSVL  532
            G+G +   EFS +
Sbjct  191  GNGFVCFTEFSRM  203



>gb|KDO37862.1| hypothetical protein CISIN_1g027592mg [Citrus sinensis]
Length=208

 Score = 94.4 bits (233),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 75/118 (64%), Gaps = 15/118 (13%)
 Frame = +2

Query  263  PGGESTPTSVLPALN---DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  433
            P    TPTSVL  ++    ++S D    +  ELVQA KL+DRD+DG + + ELEALL ++
Sbjct  50   PDRVGTPTSVLHEISGDWSDMSADISLDMNYELVQACKLLDRDNDGVVLRSELEALLIRL  109

Query  434  GAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            GA+PP++EE++ MLSEVDR+GDG I LE               S L++ FDFFD DHD
Sbjct  110  GADPPTQEEVKSMLSEVDREGDGYIPLEALI------------SRLKETFDFFDADHD  155


 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = +2

Query  329  LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  508
            L  L + L + F   D D DGKI  EEL  + +++G E  + ++ R M++ VD++GDG +
Sbjct  136  LEALISRLKETFDFFDADHDGKITAEELFGVFTKLGDELCTLDDCRGMIALVDKNGDGFV  195

Query  509  SLEEFS  526
              E+FS
Sbjct  196  CFEDFS  201



>emb|CDY60169.1| BnaAnng16630D [Brassica napus]
Length=208

 Score = 94.0 bits (232),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 74/115 (64%), Gaps = 5/115 (4%)
 Frame = +2

Query  266  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  445
            GG  TPTS+LP ++   SP      Y E++QAFKLIDRD+DG + + +LE+LL+++G +P
Sbjct  45   GGSVTPTSILPEVSAVHSPYS----YVEILQAFKLIDRDNDGAVSRHDLESLLTRLGPDP  100

Query  446  PSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            P+ EE+ +ML EV+ DGDG + LEE  S             EL++ F+FFD D D
Sbjct  101  PTEEEIDVMLKEVNCDGDGTVRLEELASRCVDDDQSRGGSDELKETFEFFDADRD  155


 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 40/73 (55%), Gaps = 0/73 (0%)
 Frame = +2

Query  314  ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRD  493
            +  D+  G   EL + F+  D D DGKI  EEL  + S +G E  + EE   M++ VD D
Sbjct  131  VDDDQSRGGSDELKETFEFFDADRDGKISAEELLRVFSAIGDERCTLEECERMIAAVDDD  190

Query  494  GDGCISLEEFSVL  532
            G+G +   EFS +
Sbjct  191  GNGFVCFTEFSRM  203



>ref|XP_008790571.1| PREDICTED: probable calcium-binding protein CML17 [Phoenix dactylifera]
Length=216

 Score = 94.0 bits (232),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 63/83 (76%), Gaps = 2/83 (2%)
 Frame = +2

Query  362  FKLIDRDDDGKIRKEELEALLSQVG-AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSS  538
            F + DRD DGKI + EL+A+L ++G A+PP+ EE+  M++EVDRDGDGCISLEEF  + S
Sbjct  82   FAVFDRDGDGKITRHELQAVLRRLGGADPPTEEEVASMVAEVDRDGDGCISLEEFGAIGS  141

Query  539  AFAPPSCDSELRDAFDFFDTDHD  607
            AF PP+  ++LR+AF  FD D D
Sbjct  142  AFGPPA-GADLREAFAVFDADGD  163


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            A+L +AF + D D DGKI  EEL  +   +G E  + E+ R M+  VD DGDG +  E+F
Sbjct  149  ADLREAFAVFDADGDGKISAEELLGVFITLGDEGCTLEDCRRMIGGVDTDGDGFVCFEDF  208



>ref|NP_181672.1| putative calcium-binding protein CML35 [Arabidopsis thaliana]
 sp|P30188.2|CML35_ARATH RecName: Full=Probable calcium-binding protein CML35; AltName: 
Full=Calmodulin-like protein 1; AltName: Full=Calmodulin-like 
protein 35 [Arabidopsis thaliana]
 gb|AAK26017.1|AF360307_1 putative calmodulin protein [Arabidopsis thaliana]
 gb|AAC78532.1| calmodulin-like protein [Arabidopsis thaliana]
 gb|AAL07243.1| putative calmodulin protein [Arabidopsis thaliana]
 gb|AEC09970.1| putative calcium-binding protein CML35 [Arabidopsis thaliana]
Length=216

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 75/124 (60%), Gaps = 16/124 (13%)
 Frame = +2

Query  251  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  430
            G  K G  +TP SVLP  + +         Y ELVQAFKLIDRDDDG + + +L AL+S+
Sbjct  46   GNLKQGPTATPISVLPQNSGD--------FYTELVQAFKLIDRDDDGVVSRGDLAALISR  97

Query  431  VGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS-----ELRDAFDFFD  595
            +  EPPS+EE+ LML EVD    GCISLE+   L+S  A  S +      ELR+ F+ FD
Sbjct  98   LSHEPPSQEEVSLMLREVDGGDGGCISLED---LASRVAGTSGEGSVETEELREVFEIFD  154

Query  596  TDHD  607
             D +
Sbjct  155  VDRN  158



>gb|AAM61257.1| calmodulin-like protein [Arabidopsis thaliana]
Length=216

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 75/124 (60%), Gaps = 16/124 (13%)
 Frame = +2

Query  251  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  430
            G  K G  +TP SVLP  + +         Y ELVQAFKLIDRDDDG + + +L AL+S+
Sbjct  46   GNLKQGPTATPISVLPQNSGD--------FYTELVQAFKLIDRDDDGVVSRGDLAALISR  97

Query  431  VGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS-----ELRDAFDFFD  595
            +  EPPS+EE+ LML EVD    GCISLE+   L+S  A  S +      ELR+ F+ FD
Sbjct  98   LSHEPPSQEEVSLMLREVDGGDGGCISLED---LASRVAGTSGEGSVETEELREVFEIFD  154

Query  596  TDHD  607
             D +
Sbjct  155  VDRN  158



>ref|XP_010938625.1| PREDICTED: calmodulin-like protein 3 [Elaeis guineensis]
Length=218

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 75/122 (61%), Gaps = 15/122 (12%)
 Frame = +2

Query  272  ESTPTSVLPALNDEISPDELSG---------LYAELVQAFKLIDRDDDGKIRKEELEALL  424
             STP S+LPA      P  ++G           + +   F + DRD DGKI ++ELEA+L
Sbjct  49   HSTPRSILPAGK----PPSVAGSGEFWLLSPASSSVSDLFAVFDRDRDGKITRQELEAVL  104

Query  425  SQVG-AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTD  601
              +G A+PP+ EE+  M++EVD DGDGCISLEEF  + SAF PP+   +LR+AF  FD D
Sbjct  105  RGLGGADPPTEEEVASMVAEVDLDGDGCISLEEFGAIGSAFGPPA-GGDLREAFAVFDAD  163

Query  602  HD  607
             D
Sbjct  164  GD  165


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
             +L +AF + D D DGKI  EEL  +   +G +  + E+ R M+ EVD DGDG +  E+F
Sbjct  151  GDLREAFAVFDADGDGKISAEELLGVFVTLGDDGWTLEDCRRMIGEVDTDGDGFVCFEDF  210



>ref|XP_006296622.1| hypothetical protein CARUB_v10014618mg [Capsella rubella]
 gb|EOA29520.1| hypothetical protein CARUB_v10014618mg [Capsella rubella]
Length=212

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 73/110 (66%), Gaps = 7/110 (6%)
 Frame = +2

Query  278  TPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  457
            TPTS+LP ++   S       Y E++QAFKLIDRD+DG + + +LE+LLS++G +P + +
Sbjct  57   TPTSILPDVSSPYS-------YVEILQAFKLIDRDNDGAVSRHDLESLLSRLGPDPLTED  109

Query  458  ELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            E+ +M+ EVD DGDG I LEE +    +  P    +EL++ F+FFD D D
Sbjct  110  EISVMIQEVDCDGDGAIRLEELASRLVSSDPSRDSAELKETFEFFDADRD  159



>ref|XP_010924236.1| PREDICTED: probable calcium-binding protein CML36 [Elaeis guineensis]
Length=218

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 73/119 (61%), Gaps = 9/119 (8%)
 Frame = +2

Query  275  STPTSVLPALNDEISPDE-------LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  433
            STP SVLP    +            LS   + +   F + DRD DGKI   ELEA+L ++
Sbjct  48   STPRSVLPPPAGKTPSSSGSDDLWLLSPASSSVSDLFAVFDRDGDGKITPHELEAVLRRL  107

Query  434  GA-EPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            G  +PP+ EE+  M++EVDRDGDGCISLEEF  + +AF PP+  +ELR+AF  FD + D
Sbjct  108  GGVDPPTEEEVASMVAEVDRDGDGCISLEEFGAIGTAFGPPA-GAELREAFAVFDANGD  165


 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AEL +AF + D + DGKI  EEL  + S +G E  + E+ R M+  VD DGDG +  ++F
Sbjct  151  AELREAFAVFDANGDGKISAEELLGVFSTLGDEGCTLEDCRRMIGGVDTDGDGFVCFDDF  210



>ref|XP_006295474.1| hypothetical protein CARUB_v10024577mg [Capsella rubella]
 gb|EOA28372.1| hypothetical protein CARUB_v10024577mg [Capsella rubella]
Length=215

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 76/125 (61%), Gaps = 17/125 (14%)
 Frame = +2

Query  251  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  430
            G  KPG  +TP SVLP  + +         Y ELVQAFKLIDRD DG + + +L ALLS+
Sbjct  46   GNLKPGPTATPISVLPHNSGD--------FYTELVQAFKLIDRDHDGVVSRGDLAALLSR  97

Query  431  VGAEPPSREELRLMLSEVDRDGDG-CISLEEFSVLSSAFAPPSCDS-----ELRDAFDFF  592
            +  EPPS+EE+ LML EVD D DG  I LEE   L+S  A  S +      ELR+ F+FF
Sbjct  98   LSPEPPSQEEVSLMLKEVDGDDDGDSIRLEE---LASRVAGTSGEGSVETEELREVFEFF  154

Query  593  DTDHD  607
            D D +
Sbjct  155  DADRN  159



>ref|XP_009146864.1| PREDICTED: probable calcium-binding protein CML36 [Brassica rapa]
Length=245

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 73/115 (63%), Gaps = 5/115 (4%)
 Frame = +2

Query  266  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  445
            GG  TPTS+LP ++   SP      Y E++QAFKLIDRD+DG + + +LE+LL+++G +P
Sbjct  82   GGSVTPTSILPEVSAVHSPYS----YVEILQAFKLIDRDNDGAVSRHDLESLLTRLGPDP  137

Query  446  PSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
             + EE+ +ML EVD DGDG + LEE  S             EL++ F+FFD D D
Sbjct  138  LTEEEIDVMLKEVDCDGDGTVRLEELASRCVDDDQSRGGSDELKETFEFFDADRD  192


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (55%), Gaps = 0/71 (0%)
 Frame = +2

Query  314  ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRD  493
            +  D+  G   EL + F+  D D DGKI  EEL  + S +G E  + EE   M++ VD D
Sbjct  168  VDDDQSRGGSDELKETFEFFDADRDGKISAEELLRVFSAIGDERCTLEECERMIAAVDDD  227

Query  494  GDGCISLEEFS  526
            G+G +   EFS
Sbjct  228  GNGFVCFTEFS  238



>ref|XP_010486615.1| PREDICTED: probable calcium-binding protein CML36 [Camelina sativa]
Length=218

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 77/116 (66%), Gaps = 4/116 (3%)
 Frame = +2

Query  266  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  445
            GG  TPTS+LP ++   SP   S  Y E++QAFKLIDRD+DG I + +LE+LL+++G +P
Sbjct  51   GGSVTPTSILPEVSCNPSPPPYS--YVEILQAFKLIDRDNDGAISRHDLESLLTRLGPDP  108

Query  446  PSREELRLMLSEVDRDG-DGCISLEEFSVLSSAFAPPSCDS-ELRDAFDFFDTDHD  607
             + +E+ +M+ EV  +G DG I LEE +        PS DS E+++ F+FFD D D
Sbjct  109  LTEDEINVMIKEVGCEGDDGTIRLEELASRVVLSLDPSRDSAEMKETFEFFDADRD  164



>ref|XP_009412818.1| PREDICTED: probable calcium-binding protein CML18 [Musa acuminata 
subsp. malaccensis]
Length=225

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 77/121 (64%), Gaps = 11/121 (9%)
 Frame = +2

Query  263  PGGESTPTSVLPALNDE----ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  430
             G ++TP SVL A + +    + PDE+S     L+  F + D D DGKI K ELEA+L +
Sbjct  55   TGLQTTPRSVLQAAHGKTPLFLFPDEVS-----LLDLFNMFDCDGDGKITKRELEAVLRR  109

Query  431  VGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPS--CDSELRDAFDFFDTDH  604
            +  + P+ EE+  M++E+DRDGDGCISL+EF+ L  A A  +   +SELR+AF  FD D 
Sbjct  110  LVPDAPTAEEVASMVAEMDRDGDGCISLDEFAALGPALAASAGGGESELREAFAVFDADG  169

Query  605  D  607
            D
Sbjct  170  D  170


 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 37/64 (58%), Gaps = 0/64 (0%)
 Frame = +2

Query  332  SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCIS  511
             G  +EL +AF + D D DGKI  EEL  + + +G    + E+ R M+  VD DGDG + 
Sbjct  152  GGGESELREAFAVFDADGDGKISAEELLGVFATLGDCGCTLEDCRRMIGGVDADGDGFVG  211

Query  512  LEEF  523
             E+F
Sbjct  212  FEDF  215



>emb|CAA48190.1| calmodulin like protein [Arabidopsis thaliana]
Length=215

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 72/124 (58%), Gaps = 17/124 (14%)
 Frame = +2

Query  251  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  430
            G  K G  +TP SV     D          Y ELVQAFKLIDRDDDG + + +L AL+S+
Sbjct  46   GNLKQGPTATPISVSSNSGD---------FYTELVQAFKLIDRDDDGVVSRGDLAALISR  96

Query  431  VGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS-----ELRDAFDFFD  595
            +  EPPS+EE+ LML EVD    GCISLE+   L+S  A  S +      ELR+ F+ FD
Sbjct  97   LSHEPPSQEEVSLMLREVDGGDGGCISLED---LASRVAGTSGEGSVETEELREVFEIFD  153

Query  596  TDHD  607
             D +
Sbjct  154  VDRN  157



>gb|KFK36989.1| hypothetical protein AALP_AA4G198000 [Arabis alpina]
Length=225

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 75/122 (61%), Gaps = 12/122 (10%)
 Frame = +2

Query  251  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  430
             +K     +TP SVLP           S  ++EL+QAFKLIDRDDDG + + +L  L+S+
Sbjct  51   NHKPNPSSTTPISVLPWSG--------SDFHSELIQAFKLIDRDDDGVVSRRDLANLISK  102

Query  431  VGAEPPSREELRLMLSEVDRDG--DGCISLEEFSV-LSSAFAPPSCDSELRDAFDFFDTD  601
            +  EPPS EE+ LML EVD DG  DGCISLE+ +  +  A +    + E+R+ F++FD D
Sbjct  103  LSPEPPSHEEVSLMLREVD-DGEEDGCISLEDLANRVVVASSGDGSEEEMREVFEYFDVD  161

Query  602  HD  607
             D
Sbjct  162  RD  163


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 42/77 (55%), Gaps = 1/77 (1%)
 Frame = +2

Query  335  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  514
            G   E+ + F+  D D DG+I  EEL  +   +G E  + +E R M++ VD++GDG +  
Sbjct  146  GSEEEMREVFEYFDVDRDGRISAEELYRVFGVIGDERCTLDECRRMIATVDKNGDGFVCF  205

Query  515  EEFSVLSSAFAPPSCDS  565
             +FS +     PPS  S
Sbjct  206  HDFSCM-MEIQPPSSSS  221



>ref|XP_010464685.1| PREDICTED: probable calcium-binding protein CML36 [Camelina sativa]
Length=221

 Score = 88.2 bits (217),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 76/117 (65%), Gaps = 5/117 (4%)
 Frame = +2

Query  266  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  445
            GG  TPTS+LP ++   SP   S  Y E++QAFKLIDRD+DG I + +LE+LL+++G +P
Sbjct  53   GGSVTPTSILPEVSCNPSPPPYS--YVEILQAFKLIDRDNDGAISRHDLESLLTRLGPDP  110

Query  446  PSREELRLMLSEV--DRDGDGCISLEEFSVLSSAFAPPSCDS-ELRDAFDFFDTDHD  607
             + +E+ +M+ EV  +   DG I LEE +        PS DS E+++ F+FFD D D
Sbjct  111  LTEDEINVMIKEVGCEEGDDGTIRLEELASRVVLSLDPSRDSAEMKETFEFFDADRD  167



>ref|XP_010525531.1| PREDICTED: probable calcium-binding protein CML35 [Tarenaya hassleriana]
Length=211

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 73/119 (61%), Gaps = 13/119 (11%)
 Frame = +2

Query  257  KKPGGESTPTSVLPALNDEISPDEL--SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  430
             KPG  +TP SVLP ++ + S      S LY+ELVQAFKLIDRDDDG + + EL ALL++
Sbjct  51   HKPGPAATPISVLPEISGDWSQVSAGDSDLYSELVQAFKLIDRDDDGAVSRSELAALLTR  110

Query  431  VGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            +  EPPS++E+ +ML    R+ DG        V  ++ A      ELR+ F+FFD D D
Sbjct  111  LSPEPPSQDEVSMML----READG-------GVAGTSAAGSVEAEELREVFEFFDADRD  158



>ref|XP_010481256.1| PREDICTED: probable calcium-binding protein CML36 [Camelina sativa]
Length=220

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 76/117 (65%), Gaps = 4/117 (3%)
 Frame = +2

Query  266  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  445
            GG  TPTS+LP ++ + SP      Y E++QAFKLIDRD+DG I + +LE+LLS++G +P
Sbjct  51   GGSVTPTSILPEVSCDTSPPPPYS-YVEILQAFKLIDRDNDGAISRHDLESLLSRLGPDP  109

Query  446  PSREELRLMLSEV--DRDGDGCISLEEFSVLSSAFAPPSCDS-ELRDAFDFFDTDHD  607
             + +E+ +M+ EV  +   DG I LEE +        PS DS EL++ F+FFD D D
Sbjct  110  LTEDEINVMIKEVGCEEGDDGTIRLEELASRVVLSLDPSRDSAELKETFEFFDADRD  166



>ref|XP_010505921.1| PREDICTED: probable calcium-binding protein CML35 [Camelina sativa]
Length=220

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 76/121 (63%), Gaps = 13/121 (11%)
 Frame = +2

Query  260  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  439
            KPG  +TP SVLP  + +         Y ELVQAFKLIDRDDDG + + +L ALLS++  
Sbjct  50   KPGPTATPISVLPQSSGD--------FYTELVQAFKLIDRDDDGVVSRGDLAALLSRLSP  101

Query  440  EPPSREELRLMLSEV---DRDGDGCISLEEF-SVLSSAFAPPSCDS-ELRDAFDFFDTDH  604
            EPPS+EE+ LML EV     D  GCISLE+  S ++      S ++ ELR+ F++FD D 
Sbjct  102  EPPSQEEVSLMLKEVDGDGDDDGGCISLEDLASRVAGTSGQGSVETEELREVFEYFDADR  161

Query  605  D  607
            +
Sbjct  162  N  162



>ref|XP_010517632.1| PREDICTED: probable calcium-binding protein CML35 isoform X1 
[Camelina sativa]
 ref|XP_010517633.1| PREDICTED: probable calcium-binding protein CML35 isoform X2 
[Camelina sativa]
Length=224

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 76/121 (63%), Gaps = 13/121 (11%)
 Frame = +2

Query  260  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  439
            KPG  +TP SVLP  + +         Y ELVQAFKLIDRDDDG + + +L ALLS++  
Sbjct  50   KPGPTATPISVLPQSSGD--------FYTELVQAFKLIDRDDDGVVSRGDLAALLSKLSP  101

Query  440  EPPSREELRLMLSEV---DRDGDGCISLEEF-SVLSSAFAPPSCDS-ELRDAFDFFDTDH  604
            EPPS+EE+ LML EV     D  GCISLE+  S ++      S ++ ELR+ F++FD D 
Sbjct  102  EPPSQEEVSLMLKEVDGDGDDDGGCISLEDLASRVAGTSGQGSVETEELREVFEYFDADR  161

Query  605  D  607
            +
Sbjct  162  N  162



>ref|XP_003554140.1| PREDICTED: probable calcium-binding protein CML36-like [Glycine 
max]
Length=218

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 75/120 (63%), Gaps = 5/120 (4%)
 Frame = +2

Query  251  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  430
             +K   G  TPTSVLP ++ + S      +  +L QAF+LIDRD+DG + +++LEALL+ 
Sbjct  48   NHKPSAGNQTPTSVLPGVSGDWSDVAAVDVRWDLAQAFRLIDRDNDGVVTRQDLEALLTC  107

Query  431  VGAEPPSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            +GA  P  +++ +ML EVD DG   I++E   S + S   P S   EL++AF+ FDTD D
Sbjct  108  LGAS-PCPDDVAVMLGEVDGDG---ITVERLMSYVGSGLKPGSDPDELKEAFEVFDTDRD  163


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  526
            EL +AF++ D D DG+I  EEL  +   +G E  + EE R M+  VDR+GDG +  E+FS
Sbjct  150  ELKEAFEVFDTDRDGRISAEELLRVFKAIGDERCTLEECRRMIEGVDRNGDGFVCFEDFS  209



>ref|XP_009399974.1| PREDICTED: probable calcium-binding protein CML17 [Musa acuminata 
subsp. malaccensis]
Length=225

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 72/117 (62%), Gaps = 10/117 (9%)
 Frame = +2

Query  272  ESTPTSVLPALNDE----ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  439
            ++TP SVLP  + +      PDE     A  +  F + D D DGKI K ELEA+L ++  
Sbjct  59   QATPRSVLPPDHGKAPVVFLPDE-----AAWLDLFNVFDCDGDGKITKRELEAVLRRLVP  113

Query  440  EPPSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            +PP+ EE+  M++EVDRDGDGCISL+EF ++ +        +SELRDAF  FD D D
Sbjct  114  DPPTAEEVASMVAEVDRDGDGCISLDEFGALGALLGGGRGGESELRDAFAVFDADGD  170



>ref|XP_010056433.1| PREDICTED: probable calcium-binding protein CML36 [Eucalyptus 
grandis]
 gb|KCW90088.1| hypothetical protein EUGRSUZ_A02286 [Eucalyptus grandis]
Length=224

 Score = 80.1 bits (196),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 73/120 (61%), Gaps = 11/120 (9%)
 Frame = +2

Query  269  GES-TPTSVLPALNDEISPDE--LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  439
            GES TPTSVL              +G   EL +AF LIDRD DG + ++ELEALLS++G 
Sbjct  56   GESLTPTSVLGRGGGGGGGGGGVWAGSNLELARAFGLIDRDGDGILSRKELEALLSRLG-  114

Query  440  EPPSREELRLMLSEVDRDGDG---CISLEE-FSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
               SR+E+ +MLSEV   G+G    +S+EE  S +  A  P   D+ELR+ F+FFD DHD
Sbjct  115  ---SRDEVAVMLSEVGCHGEGEDAAVSIEELLSRVGPACGPACDDAELRETFEFFDADHD  171


 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AEL + F+  D D DGKI  EEL  + +  G E  + EE R M+SEVD++GDG +  E+F
Sbjct  157  AELRETFEFFDADHDGKITAEELLGVFAAFGDERCTLEECRRMISEVDKNGDGFVCFEDF  216

Query  524  S  526
            +
Sbjct  217  T  217



>ref|XP_010036330.1| PREDICTED: probable calcium-binding protein CML36 [Eucalyptus 
grandis]
Length=224

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 77/128 (60%), Gaps = 17/128 (13%)
 Frame = +2

Query  266  GGES-TPTSVLP-----ALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLS  427
            GGE+ TPTSVLP       +D  S  E++G   ELV+AF  ID D+DG + +E+LEALLS
Sbjct  47   GGEARTPTSVLPPQLSGEWSDVASSSEMNG---ELVRAFTYIDGDNDGVLSREDLEALLS  103

Query  428  QVGAEPPSREELRLMLSEV---DRDGDGCISLEEF-SVLSSAF----APPSCDSELRDAF  583
            ++GAEP S +E  LML EV   D  G   + +E+  S + SA     A   CD E+R  F
Sbjct  104  RLGAEPLSADEKALMLREVGCADEGGAAGVRIEDLVSRVGSAGGDEEADAGCDVEMRRTF  163

Query  584  DFFDTDHD  607
            +FFD + D
Sbjct  164  EFFDRNGD  171


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +2

Query  332  SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCIS  511
            +G   E+ + F+  DR+ DG+I  EEL      +G    +  E R M++EVDR+GDG + 
Sbjct  153  AGCDVEMRRTFEFFDRNGDGRITAEELLGAFEAMGDGRCTLGECRRMIAEVDRNGDGFVC  212

Query  512  LEEFS  526
             E+FS
Sbjct  213  FEDFS  217



>ref|XP_006288691.1| hypothetical protein CARUB_v10002001mg [Capsella rubella]
 gb|EOA21589.1| hypothetical protein CARUB_v10002001mg [Capsella rubella]
Length=199

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 64/93 (69%), Gaps = 4/93 (4%)
 Frame = +2

Query  341  YAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEE  520
            + EL++AF LID+D+DG + + +LEALL+Q+G  PP+++E+ +ML EVDRDG G IS++ 
Sbjct  54   HLELLKAFTLIDKDNDGAVSRHDLEALLTQLGPNPPNKDEINVMLREVDRDGHGTISIDT  113

Query  521  FSV----LSSAFAPPSCDSELRDAFDFFDTDHD  607
             +       S+ +     +EL++ F+ FD+D +
Sbjct  114  LATRVVSSVSSDSSHGSSTELKETFELFDSDRN  146



>ref|XP_007162132.1| hypothetical protein PHAVU_001G126700g [Phaseolus vulgaris]
 gb|ESW34126.1| hypothetical protein PHAVU_001G126700g [Phaseolus vulgaris]
Length=215

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 75/116 (65%), Gaps = 11/116 (9%)
 Frame = +2

Query  269  GESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP  448
            G  TPTSVLP ++ + S D    +  +L QAF+LIDRD+DG + +++LEA+L+++GA   
Sbjct  55   GSLTPTSVLPGVSGDWS-DVTVDVRWDLAQAFRLIDRDNDGVVSRQDLEAVLTRLGA---  110

Query  449  SREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS---ELRDAFDFFDTDHD  607
               ++ LMLSEV+    GCI++E  ++++   + P   S   EL++AF  FDTD D
Sbjct  111  --SDVALMLSEVEGGAGGCITVE--ALMNHIGSGPESGSDPEELKEAFAVFDTDRD  162


 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  526
            EL +AF + D D DG+I  EEL  +   +G E  + EE R M+  VDR+GDG +  E+FS
Sbjct  149  ELKEAFAVFDTDRDGRISAEELLRVFRAIGDERCTLEECRRMIEGVDRNGDGFVCFEDFS  208



>ref|XP_003521150.1| PREDICTED: probable calcium-binding protein CML36-like [Glycine 
max]
Length=219

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 73/120 (61%), Gaps = 5/120 (4%)
 Frame = +2

Query  254  YKKPGGESTPTSVLPALNDEISPDELSGL--YAELVQAFKLIDRDDDGKIRKEELEALLS  427
            +K   G  TPTSVLP ++ E S    + +    +L QA +LIDRD+DG + +++LE+LL+
Sbjct  50   HKPSPGNQTPTSVLPDVSGEWSEVAAAAVDVRWDLAQALRLIDRDNDGVVTRQDLESLLT  109

Query  428  QVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            ++GA  PS  ++ LML EVD DG    SL   S + S     S   EL++AF+ FDTD D
Sbjct  110  RLGAS-PSPGDVALMLGEVDGDGITVESL--MSYVGSGLETGSDPDELKEAFEVFDTDRD  166


 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  526
            EL +AF++ D D DG+I  EEL  +   +G E  + EE R M+  VDR+GDG +  E+FS
Sbjct  153  ELKEAFEVFDTDRDGRISAEELLRVFKAIGDERCTLEECRRMIEGVDRNGDGFVCFEDFS  212



>ref|XP_010672963.1| PREDICTED: probable calcium-binding protein CML35 [Beta vulgaris 
subsp. vulgaris]
Length=209

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 55/87 (63%), Gaps = 3/87 (3%)
 Frame = +2

Query  356  QAFKLIDRDDDGKIRKEELEALLSQVGAEPPS--REELRLMLSEVDRDGDGCISLEEFSV  529
            +AFK++D D DGKI + EL +L  +V    PS   EE+  M+ ++D DGDGCISLEE   
Sbjct  70   EAFKMMDLDGDGKITRVELHSLFKRVRVNAPSLSEEEVAEMIKDIDTDGDGCISLEELEA  129

Query  530  LSSAFAPPSCDS-ELRDAFDFFDTDHD  607
            + SA  P   D  +L+DAF FFD + D
Sbjct  130  VGSALDPTGADEDDLKDAFGFFDVNKD  156



>ref|XP_011070577.1| PREDICTED: probable calcium-binding protein CML25 [Sesamum indicum]
Length=195

 Score = 73.9 bits (180),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 66/118 (56%), Gaps = 6/118 (5%)
 Frame = +2

Query  269  GESTPTSV---LPALNDEISP-DELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  436
            G+++PT+     P +N   S  +  S L  EL Q FK  D + DGKI   EL ++L  VG
Sbjct  18   GDTSPTTAPVQAPMINSRSSSLNGRSRLEEELEQVFKKFDVNGDGKISASELGSILGSVG  77

Query  437  AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSA-FAPPSCDSELRDAFDFFDTDHD  607
             +P + EELR+M+ EVD DGDG I L+EF  L++           L+DAF  FD D +
Sbjct  78   -QPATEEELRIMIQEVDADGDGFIDLQEFIALNTTDVGHEEVMENLKDAFKVFDIDKN  134



>ref|XP_010931583.1| PREDICTED: probable calcium-binding protein CML36 [Elaeis guineensis]
Length=215

 Score = 73.9 bits (180),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = +2

Query  374  DRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPP  553
            +++ DG+I + ELE +L ++G +PP+ EE+  ML+E DR GDG I LEE   L SAF PP
Sbjct  86   EKEGDGRITRRELEVVLRRLGPDPPTEEEVVAMLAEADRAGDGSIRLEEIVALGSAFGPP  145

Query  554  SCDSELRDAFDFFDTDHD  607
                ELR+ F  FD D D
Sbjct  146  VV-PELRETFAVFDGDGD  162



>ref|XP_010062249.1| PREDICTED: calcium-binding protein CML24-like [Eucalyptus grandis]
Length=184

 Score = 73.6 bits (179),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 61/100 (61%), Gaps = 3/100 (3%)
 Frame = +2

Query  311  EISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDR  490
            +  P +  G   ++ Q F   D++ DGKI  +EL  +LS +G+ P +REE +  ++E+D+
Sbjct  26   QAKPADSLGNVDQVRQVFAQYDKNGDGKISCDELREVLSALGSSPTTREEAQAAMAEIDK  85

Query  491  DGDGCISLEEFS--VLSSAFAPPSCDS-ELRDAFDFFDTD  601
            DGDG I L+EF+  +L      P C + ELRDAFD +D D
Sbjct  86   DGDGFIDLDEFAELILGGGDGGPECGAKELRDAFDLYDLD  125


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 40/65 (62%), Gaps = 1/65 (2%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  526
            EL  AF L D D +G I   EL A++ ++G +  S  + R M+S VDRDGDG ++ EEF 
Sbjct  114  ELRDAFDLYDLDGNGVISVSELHAVMKKLG-QKCSLRDCRKMISSVDRDGDGNVNFEEFK  172

Query  527  VLSSA  541
             + +A
Sbjct  173  KMMTA  177



>gb|EYU46532.1| hypothetical protein MIMGU_mgv1a021796mg [Erythranthe guttata]
Length=150

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF LID+D DG I  EEL AL  Q   E P+ EE++ M++E D DGDG +  EEF
Sbjct  11   AEFREAFSLIDKDSDGVITVEEL-ALAIQSLNEHPTSEEIQEMVNEADSDGDGTVDFEEF  69

Query  524  SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
             ++ S+    +   E++DAF  FD D D
Sbjct  70   LIVMSSKMKENVVEEIKDAFKVFDRDQD  97



>ref|XP_009037109.1| hypothetical protein AURANDRAFT_26147 [Aureococcus anophagefferens]
 gb|EGB08391.1| hypothetical protein AURANDRAFT_26147 [Aureococcus anophagefferens]
Length=229

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 58/97 (60%), Gaps = 7/97 (7%)
 Frame = +2

Query  311  EISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDR  490
            EI  DEL    AEL +AFK+ D+D +G + KEEL  ++  +G E  + E L L+ + VD 
Sbjct  53   EIPEDEL----AELAEAFKMFDQDGNGTMNKEELGTVMRSLGQEI-THENLDLIFASVDN  107

Query  491  DGDGCISLEEFSVLSSAFAPP--SCDSELRDAFDFFD  595
            D  GCI  +EF VL S F PP  + + EL  AF +FD
Sbjct  108  DKSGCICFDEFLVLMSRFMPPEGNTEDELMAAFQYFD  144



>ref|XP_009770094.1| PREDICTED: calmodulin-like [Nicotiana sylvestris]
Length=147

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 64/102 (63%), Gaps = 5/102 (5%)
 Frame = +2

Query  302  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  481
            + D +S D++S    EL +AF +ID+D DG IR EEL A++  +  E P++EE++ M++E
Sbjct  1    MADALSEDQIS----ELREAFWVIDKDCDGVIRMEELAAVIQSLN-EHPTKEEIQEMVNE  55

Query  482  VDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            VD DGDG I  E+F  + +     +   EL++AF  FD D D
Sbjct  56   VDPDGDGTIDFEDFLNIMARKLKDNVSEELKEAFKVFDRDQD  97


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            EL +AFK+ DRD DG I   EL  ++  +G E  + EE + M+ E D DGDG +S EEF
Sbjct  84   ELKEAFKVFDRDQDGFISANELRNVMMNLG-ERLTDEEAQQMIREADLDGDGLVSYEEF  141



>gb|EYC14046.1| hypothetical protein Y032_0042g679 [Ancylostoma ceylanicum]
Length=156

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 55/89 (62%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            +EL + FK  D++ DGKI KEELE  L Q+G E PS  ++  ++S+ D DG+GCI ++EF
Sbjct  17   SELREVFKEFDKNGDGKITKEELELALVQLG-EKPSNSKIDAIISQADTDGNGCIEIDEF  75

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              VL      P  + ELR+ F  FD D D
Sbjct  76   LQVLRQQLLNPREERELREVFGVFDKDDD  104



>gb|EYC14045.1| hypothetical protein Y032_0042g679 [Ancylostoma ceylanicum]
Length=146

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 55/89 (62%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            +EL + FK  D++ DGKI KEELE  L Q+G E PS  ++  ++S+ D DG+GCI ++EF
Sbjct  7    SELREVFKEFDKNGDGKITKEELELALVQLG-EKPSNSKIDAIISQADTDGNGCIEIDEF  65

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              VL      P  + ELR+ F  FD D D
Sbjct  66   LQVLRQQLLNPREERELREVFGVFDKDDD  94



>ref|XP_004230637.1| PREDICTED: calmodulin-like [Solanum lycopersicum]
Length=147

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 63/102 (62%), Gaps = 5/102 (5%)
 Frame = +2

Query  302  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  481
            + D ++ D++S    E  QAF +ID+D DG IR EEL +++  +  E P+REE++ M++E
Sbjct  1    MADALTEDQIS----EFRQAFWVIDKDCDGVIRIEELASVIQSL-HENPTREEMQEMMNE  55

Query  482  VDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            VD DGDG I  E+F  + +     +   EL++AF  FD D D
Sbjct  56   VDPDGDGTIDFEDFLNIMAKKLKDNVTEELKEAFKVFDRDQD  97


 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            EL +AFK+ DRD DG I   EL  ++  +G E  + EE + M+ E D DGDG +S EEF
Sbjct  84   ELKEAFKVFDRDQDGFISANELRNVMMNLG-ERLTEEEAQQMIREADLDGDGLVSYEEF  141



>ref|XP_002671503.1| predicted protein [Naegleria gruberi]
 gb|EFC38759.1| predicted protein [Naegleria gruberi]
Length=156

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 57/91 (63%), Gaps = 2/91 (2%)
 Frame = +2

Query  338  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  517
            L  EL  AF L D+D DGKI  EEL A+L ++G + PS EEL+LM S+VD+D +G I  E
Sbjct  10   LVNELKDAFSLFDQDGDGKISIEELGAVLKKLG-QCPSAEELQLMFSDVDQDNNGTIEFE  68

Query  518  EF-SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            EF  ++         + E+R+AF  FD ++D
Sbjct  69   EFMKMMEGGRNNVDTEDEIREAFRVFDKNND  99


 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  526
            E+ +AF++ D+++DG I  EEL++++S +G E  + +EL  M+ + DRDG+G +  EEF 
Sbjct  86   EIREAFRVFDKNNDGFISYEELKSMMSSLG-ETLTDKELNEMIRQADRDGNGVVDFEEFK  144

Query  527  VL  532
             +
Sbjct  145  SI  146



>ref|XP_010924246.1| PREDICTED: probable calcium-binding protein CML35 [Elaeis guineensis]
Length=320

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 66/119 (55%), Gaps = 10/119 (8%)
 Frame = +2

Query  275  STPTSVLPALNDEISPDE-------LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  433
            STP SVLP    +            LS   + +   F + +RD DGKI   ELEA+L  +
Sbjct  67   STPCSVLPPPTGKTPSSSRSDDLWLLSPASSSISNLFIIFNRDGDGKIMPHELEAILCHL  126

Query  434  -GAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
             GA PP++EEL  M+ EV+RD +GCISL EF  + + F      +EL +AF  FD ++D
Sbjct  127  HGANPPTKEELASMVVEVNRDDNGCISL-EFGAIETTFRLLE-GAELWEAFAIFDANND  183



>ref|XP_006351748.1| PREDICTED: calmodulin-5/6/7/8-like [Solanum tuberosum]
Length=147

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 63/102 (62%), Gaps = 5/102 (5%)
 Frame = +2

Query  302  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  481
            + D ++ D++S    E  QAF +ID+D DG IR EEL +++  +  E P+REE++ M++E
Sbjct  1    MADALTEDQIS----EFRQAFWVIDKDCDGVIRMEELASVIQSL-HEHPTREEIQEMINE  55

Query  482  VDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            VD DGDG I  E+F  + +     +   EL++AF  FD D D
Sbjct  56   VDPDGDGSIDFEDFLNIMAKKLKDNVTEELKEAFKVFDRDQD  97


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            EL +AFK+ DRD DG I   EL  ++  +G E  + EE + M+ E D DGDG +S +EF
Sbjct  84   ELKEAFKVFDRDQDGFISANELRNVMMNLG-ERLTEEEAQQMIREADLDGDGLVSYDEF  141



>gb|EYC14044.1| hypothetical protein Y032_0042g679 [Ancylostoma ceylanicum]
Length=180

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 55/89 (62%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            +EL + FK  D++ DGKI KEELE  L Q+G E PS  ++  ++S+ D DG+GCI ++EF
Sbjct  41   SELREVFKEFDKNGDGKITKEELELALVQLG-EKPSNSKIDAIISQADTDGNGCIEIDEF  99

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              VL      P  + ELR+ F  FD D D
Sbjct  100  LQVLRQQLLNPREERELREVFGVFDKDDD  128



>ref|XP_003536119.1| PREDICTED: calmodulin-like protein 11-like [Glycine max]
 gb|KHN16197.1| Calmodulin-like protein 8 [Glycine soja]
Length=149

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 53/91 (58%), Gaps = 1/91 (1%)
 Frame = +2

Query  338  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  517
            L  E ++AF L DRD DG I  EEL + L  +    P +EEL++M++EVD DG G I   
Sbjct  9    LIVEFLEAFCLFDRDGDGCITMEELASALRTLNQNNPRKEELQIMMNEVDMDGSGTIEFG  68

Query  518  EF-SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            +F ++++        + EL++AF  FD D D
Sbjct  69   QFLNLMARKMKQSEAEEELKEAFKLFDKDQD  99



>emb|CDW53538.1| Calmodulin [Trichuris trichiura]
Length=188

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D DGKI  +EL  ++  +G + P+  ELR M++EVD DG+G I  +EF
Sbjct  21   AEFQEAFNLFDKDGDGKITSQELGVVMRSLG-QRPTESELRDMVNEVDEDGNGTIEFDEF  79

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD D D
Sbjct  80   LQMMSRKMKDSDSEQELREAFQVFDKDKD  108



>ref|XP_011079925.1| PREDICTED: calmodulin-like [Sesamum indicum]
Length=150

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF LID+D DG I  EEL +++  +  E P+ EE++ M+SEVD DGDG +  EEF
Sbjct  11   AEFREAFSLIDKDSDGVITVEELTSVMQSLN-EHPTMEEIQEMVSEVDGDGDGTVDFEEF  69

Query  524  SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              + +     +   EL++AF  FD D D
Sbjct  70   LGIMARKMKENVGEELKEAFKVFDRDQD  97


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            EL +AFK+ DRD DG I   EL+ ++  +G E  S EE   M+ E D DGDG +S EEF
Sbjct  84   ELKEAFKVFDRDQDGFISAIELKNVMINLG-ERVSDEEAEQMIREADVDGDGVVSYEEF  141



>gb|KDP21392.1| hypothetical protein JCGZ_21863 [Jatropha curcas]
Length=229

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF +ID+D DG I  EEL A++  +    P++EE+R M+SEVD DG+G I  +EF
Sbjct  11   AEFHEAFSMIDKDSDGFITMEELAAIIQSLDG-HPTKEEVREMISEVDFDGNGTIDFQEF  69

Query  524  SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            S +       +   EL++AF  FD + D
Sbjct  70   SNIMGRKMKENVAEELKEAFKVFDRNQD  97


 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 55/90 (61%), Gaps = 5/90 (6%)
 Frame = +2

Query  314  ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRD  493
            IS +E+    AE  +AF +ID+D DG I  EEL A++  +    P++EE+R M+SEVD D
Sbjct  100  ISANEI----AEFHEAFSMIDKDSDGFITMEELAAIIQSLDG-HPTKEEVREMISEVDFD  154

Query  494  GDGCISLEEFSVLSSAFAPPSCDSELRDAF  583
            G+G I  +EFS +       +   EL++AF
Sbjct  155  GNGTIDFQEFSNIMGRKMKENVAEELKEAF  184



>gb|KHN04934.1| Calmodulin-like protein 8 [Glycine soja]
Length=149

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 54/91 (59%), Gaps = 1/91 (1%)
 Frame = +2

Query  338  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  517
            L  E ++AF L DRD DG I  EEL + L  +    P +EEL++M++EVD +G G I   
Sbjct  9    LIVEFLEAFCLFDRDGDGCITMEELASALRTLNQNNPRKEELQIMMNEVDMNGSGTIEFG  68

Query  518  EF-SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            +F ++++        + EL++AF+ FD D D
Sbjct  69   QFLNLMARKMKQSEAEEELKEAFELFDKDQD  99



>ref|XP_011082591.1| PREDICTED: calmodulin-like [Sesamum indicum]
Length=150

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF +ID+D DG I  EEL +++  +  E P++EE+R M+ EVD DGDG +  EEF
Sbjct  11   AEFREAFCVIDKDSDGVITVEELASVIQSLN-EHPTKEEIREMMHEVDADGDGTVDFEEF  69

Query  524  SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              + +     +   EL++AF  FD D D
Sbjct  70   LSIMARKMKENVAEELKEAFKVFDRDQD  97


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 40/71 (56%), Gaps = 4/71 (6%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  526
            EL +AFK+ DRD DG I   EL  ++  +G E  S EE   M+ E D DGDG +S EEF 
Sbjct  84   ELKEAFKVFDRDQDGFISAIELRNVMMNLG-ERLSDEEAEQMIREADLDGDGVVSYEEFV  142

Query  527  VLSSAFAPPSC  559
             +  A    SC
Sbjct  143  RMMMA---SSC  150



>ref|XP_008789596.1| PREDICTED: probable calcium-binding protein CML36 [Phoenix dactylifera]
Length=209

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 64/119 (54%), Gaps = 10/119 (8%)
 Frame = +2

Query  272  ESTPTSVLP-------ALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  430
            +STP SVLP       A +  I   E    ++         +R+ + ++ + ELE +L +
Sbjct  41   QSTPKSVLPPSPRRRVAKSASIGGGE--ECWSSSSTDHSPAEREGEERVTRRELEVVLQR  98

Query  431  VGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            +G +PP+ EE+  ML+E DR GDG I L+E   L SAF PP    ELR+ F  FD D D
Sbjct  99   LGPDPPTEEEVAAMLAEADRGGDGSIRLQEIVALGSAFGPP-VAPELRETFAVFDVDGD  156



>ref|XP_003556466.1| PREDICTED: calmodulin-like protein 8-like isoform X1 [Glycine 
max]
 ref|XP_006606459.1| PREDICTED: calmodulin-like protein 8-like isoform X2 [Glycine 
max]
Length=149

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 53/91 (58%), Gaps = 1/91 (1%)
 Frame = +2

Query  338  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  517
            L  E ++AF L DRD DG I  EEL + L  +    P +EEL++M++EVD +G G I   
Sbjct  9    LIVEFLEAFCLFDRDGDGCITMEELASALRTLNQNNPRKEELQIMMNEVDMNGSGTIEFG  68

Query  518  EF-SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            +F ++++        + EL++AF  FD D D
Sbjct  69   QFLNLMARKMKQSEAEEELKEAFKLFDKDQD  99



>gb|KFD49502.1| hypothetical protein M513_09613 [Trichuris suis]
 gb|KFD65676.1| hypothetical protein M514_09613 [Trichuris suis]
Length=243

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D DGKI  +EL  ++  +G + P+  ELR M++EVD DG+G I  +EF
Sbjct  69   AEFQEAFNLFDKDGDGKITSQELGVVMRSLG-QRPTESELRDMVNEVDEDGNGTIEFDEF  127

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD D D
Sbjct  128  LQMMSRKMKDSDSEQELREAFQVFDKDKD  156



>ref|XP_008786895.1| PREDICTED: probable calcium-binding protein CML36 [Phoenix dactylifera]
Length=205

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 60/112 (54%), Gaps = 1/112 (1%)
 Frame = +2

Query  272  ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPS  451
            + TP +VLP L         +   +     +   +R+ +G+I + ELE +L ++G +PP+
Sbjct  42   QCTPKTVLPRLPGCHLAAPAAKSASSSSTDYPSAEREGEGRITRRELEVVLRRLGPDPPT  101

Query  452  REELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
             EE+  ML+E DR GDG I LEE   L S   PP    ELR+ F  FD D D
Sbjct  102  EEEVVAMLAEADRAGDGSIRLEEIVELGSVVGPPVV-PELRETFAVFDADGD  152


 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            EL + F + D D DGKI  EEL A+   +G E  + E+ R M+  VD DGDG +  ++F
Sbjct  139  ELRETFAVFDADGDGKISAEELLAMFVTLGDEQCTLEDCRRMIGVVDSDGDGFVCFQDF  197



>ref|XP_010922185.1| PREDICTED: probable calcium-binding protein CML36 [Elaeis guineensis]
Length=209

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = +2

Query  371  IDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAP  550
            ++RD + ++ + ELE +L ++G +PP+ EE+  ML+E DR G+G I L+E   L SAF P
Sbjct  79   VERDGEERVTRRELEVVLRRLGPDPPTEEEVVAMLAEADRGGEGSIRLQEIVALGSAFGP  138

Query  551  PSCDSELRDAFDFFDTDHD  607
            P    EL+  F  FD D D
Sbjct  139  PVA-PELQQTFAVFDVDGD  156


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            EL Q F + D D DGKI  EEL A+   +G E  + E+ R M+  VD DGDG +  E+F
Sbjct  143  ELQQTFAVFDVDGDGKISAEELLAMFVTLGDERCTLEDCRRMIGVVDSDGDGFVCFEDF  201



>ref|XP_011084270.1| PREDICTED: calcium-binding allergen Ole e 8-like [Sesamum indicum]
Length=160

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 56/91 (62%), Gaps = 5/91 (5%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  526
            E+ + F   D + DGKI  +EL  ++  +G+E  + E  R+M  E+D D DG ISLEEF+
Sbjct  20   EVKRVFDRFDANGDGKISSDELGGVIEALGSETSADEVARMM-EEIDTDKDGFISLEEFA  78

Query  527  VLSSAFAPPS----CDSELRDAFDFFDTDHD  607
            V  SA + PS     + ELR+AFD +D DHD
Sbjct  79   VFCSADSDPSGGGNSEKELREAFDLYDQDHD  109


 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            EL +AF L D+D DG+I K EL  +L+++G E  S  +   M+  VD DGDG +S +EF
Sbjct  96   ELREAFDLYDQDHDGQISKTELHLILTRLG-ERCSVNDCSEMIRSVDSDGDGFVSFDEF  153



>ref|XP_009617304.1| PREDICTED: calmodulin-like [Nicotiana tomentosiformis]
Length=147

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 63/102 (62%), Gaps = 5/102 (5%)
 Frame = +2

Query  302  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  481
            + D +S +++S    E  +AF +ID+D DG IR EEL A++  +  E P++EE++ M++E
Sbjct  1    MADALSEEQIS----EFREAFWVIDKDCDGVIRMEELAAVIQSLN-EHPTKEEIQEMVNE  55

Query  482  VDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            VD DGDG I  E+F  + +     +   EL++AF  FD D D
Sbjct  56   VDPDGDGTIDFEDFLNIMARKLKDNVSEELKEAFKVFDRDQD  97


 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            EL +AFK+ DRD DG I   EL  ++  +G E  + EE + M+ E D DGDG +S EEF
Sbjct  84   ELKEAFKVFDRDQDGFISANELRNVMMNLG-ERLTDEEAQQMIREADLDGDGLVSYEEF  141



>ref|XP_008550049.1| PREDICTED: calmodulin-A-like [Microplitis demolitor]
Length=260

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 55/89 (62%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I   EF
Sbjct  121  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEFNEF  179

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        ++ELR+AF  FD ++D
Sbjct  180  LQMMSKKMKGADGEAELREAFRVFDKNND  208


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AEL +AF++ D+++DG I   EL  +++ +G E  S EE+  M+ E D +GDG ++ EEF
Sbjct  194  AELREAFRVFDKNNDGLISSMELRHVMTNLG-EKLSEEEVDDMIKEADLNGDGMVNYEEF  252

Query  524  SVLSSA  541
              + +A
Sbjct  253  VTILTA  258



>ref|XP_011072994.1| PREDICTED: calcium-binding allergen Ole e 8-like [Sesamum indicum]
Length=166

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 57/90 (63%), Gaps = 3/90 (3%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE+ + F   D ++DGKI   EL  +L  +G+E  S +E+  M+ E+D D DG I+L+EF
Sbjct  19   AEVQKVFDRFDTNNDGKISPGELGGVLKALGSES-SPDEVARMMGEIDTDKDGNINLQEF  77

Query  524  SVLSSAFAPP--SCDSELRDAFDFFDTDHD  607
            +   SA A P  S + ELR+AF+ +D +HD
Sbjct  78   AAFCSAEADPYHSAEKELREAFELYDQNHD  107



>ref|XP_011066820.1| PREDICTED: neo-calmodulin-like [Acromyrmex echinatior]
Length=244

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I   EF
Sbjct  105  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEFNEF  163

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD ++D
Sbjct  164  LQMMSKKMKSADGEDELREAFRVFDKNND  192


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 44/65 (68%), Gaps = 2/65 (3%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            EL +AF++ D+++DG I  +EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  179  ELREAFRVFDKNNDGLISSKELRHVMTNLG-EKLSEEEVDDMIKEADLDGDGMVNYEEFV  237

Query  524  SVLSS  538
            S+L S
Sbjct  238  SILMS  242



>gb|EZA54087.1| Calmodulin, partial [Cerapachys biroi]
Length=231

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I   EF
Sbjct  92   AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEFNEF  150

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD ++D
Sbjct  151  LQMMSKKMKGADGEDELREAFRVFDKNND  179


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 45/65 (69%), Gaps = 2/65 (3%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            EL +AF++ D+++DG I  +EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  166  ELREAFRVFDKNNDGLISSKELRHVMTNLG-EKLSEEEVDDMIKEADLDGDGMVNYEEFV  224

Query  524  SVLSS  538
            ++L+S
Sbjct  225  TILTS  229



>ref|XP_011150176.1| PREDICTED: neo-calmodulin-like isoform X3 [Harpegnathos saltator]
Length=244

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I   EF
Sbjct  105  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEFNEF  163

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD ++D
Sbjct  164  LQMMSKKMKGADGEDELREAFRVFDKNND  192


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 45/65 (69%), Gaps = 2/65 (3%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            EL +AF++ D+++DG I  +EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  179  ELREAFRVFDKNNDGLISSKELRHVMTNLG-EKLSEEEVDDMIKEADLDGDGMVNYEEFV  237

Query  524  SVLSS  538
            ++L+S
Sbjct  238  TILTS  242



>gb|EFN67816.1| Calmodulin [Camponotus floridanus]
Length=231

 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I   EF
Sbjct  92   AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEFNEF  150

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD ++D
Sbjct  151  LQMMSKKMKGADGEDELREAFRVFDKNND  179


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 45/65 (69%), Gaps = 2/65 (3%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            EL +AF++ D+++DG I  +EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  166  ELREAFRVFDKNNDGLISSKELRHVMTNLG-EKLSEEEVDDMIKEADLDGDGMVNYEEFV  224

Query  524  SVLSS  538
            ++L+S
Sbjct  225  TILTS  229



>ref|XP_011307674.1| PREDICTED: neo-calmodulin-like isoform X3 [Fopius arisanus]
Length=245

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I   EF
Sbjct  106  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEFNEF  164

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD ++D
Sbjct  165  LQMMSKKMKGADGEDELREAFRVFDKNND  193


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 42/65 (65%), Gaps = 1/65 (2%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  526
            EL +AF++ D+++DG I   EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  180  ELREAFRVFDKNNDGLISSMELRHVMTNLG-EKLSEEEVDDMIKEADLDGDGMVNYEEFV  238

Query  527  VLSSA  541
             + +A
Sbjct  239  TILTA  243



>ref|NP_495043.1| Protein CAL-8 [Caenorhabditis elegans]
 emb|CCD69292.1| CAL-8 [Caenorhabditis elegans]
Length=145

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 55/89 (62%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE+ + F+  D++ DG+I ++ELE  L Q+G E  S  ++  M+ + D DG+GCI ++EF
Sbjct  7    AEIREVFREFDKNGDGRITRQELEVALLQLG-EKASNSKIETMIEQADLDGNGCIDIDEF  65

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
             +VL      P  + ELRD F+ FD + D
Sbjct  66   LNVLRRQICDPKEERELRDVFNVFDKNGD  94



>gb|ELU13700.1| hypothetical protein CAPTEDRAFT_169155 [Capitella teleta]
Length=184

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 65/118 (55%), Gaps = 13/118 (11%)
 Frame = +2

Query  290  VLPALNDE----------ISPDELSG-LYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  436
            VLP+L D+             D+L+     E  +AF L D+D DG I   EL++++  +G
Sbjct  16   VLPSLRDQNGFSDSFIRDTQADQLTQEQIEEFKEAFALFDKDGDGTITLHELDSVMRGLG  75

Query  437  AEPPSREELRLMLSEVDRDGDGCISLEEFSVL-SSAFAPPSCDSELRDAFDFFDTDHD  607
             + P+REEL  M++EVD DG+G I   EF +L +S         E+RDAF  FD ++D
Sbjct  76   -QNPTREELTQMIAEVDSDGNGSIEFSEFLILIASRLKMEDMREEIRDAFGVFDKNND  132



>ref|XP_011339099.1| PREDICTED: neo-calmodulin-like isoform X3 [Cerapachys biroi]
Length=244

 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I   EF
Sbjct  105  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEFNEF  163

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD ++D
Sbjct  164  LQMMSKKMKGADGEDELREAFRVFDKNND  192


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 45/65 (69%), Gaps = 2/65 (3%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            EL +AF++ D+++DG I  +EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  179  ELREAFRVFDKNNDGLISSKELRHVMTNLG-EKLSEEEVDDMIKEADLDGDGMVNYEEFV  237

Query  524  SVLSS  538
            ++L+S
Sbjct  238  TILTS  242



>ref|XP_011257081.1| PREDICTED: neo-calmodulin-like isoform X3 [Camponotus floridanus]
Length=244

 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I   EF
Sbjct  105  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEFNEF  163

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD ++D
Sbjct  164  LQMMSKKMKGADGEDELREAFRVFDKNND  192


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 45/65 (69%), Gaps = 2/65 (3%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            EL +AF++ D+++DG I  +EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  179  ELREAFRVFDKNNDGLISSKELRHVMTNLG-EKLSEEEVDDMIKEADLDGDGMVNYEEFV  237

Query  524  SVLSS  538
            ++L+S
Sbjct  238  TILTS  242



>ref|XP_003108906.1| hypothetical protein CRE_11951 [Caenorhabditis remanei]
 gb|EFO91415.1| hypothetical protein CRE_11951 [Caenorhabditis remanei]
Length=145

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 55/89 (62%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE+ + F+  D++ DG+I ++ELE  L Q+G E  S  ++  M+ + D DG+GCI ++EF
Sbjct  7    AEIREVFREFDKNGDGRITRQELEVALLQLG-EKASNTKIETMIEQADLDGNGCIDIDEF  65

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
             +VL      P  + ELRD F+ FD + D
Sbjct  66   LNVLRRQICDPKEERELRDVFNVFDKNGD  94



>ref|XP_011171909.1| PREDICTED: neo-calmodulin-like [Solenopsis invicta]
Length=261

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I   EF
Sbjct  122  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEFNEF  180

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD ++D
Sbjct  181  LQMMSKKMKSADGEDELREAFRVFDKNND  209


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 44/65 (68%), Gaps = 2/65 (3%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            EL +AF++ D+++DG I  +EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  196  ELREAFRVFDKNNDGLISSKELRHVMTNLG-EKLSEEEVDDMIKEADLDGDGMVNYEEFV  254

Query  524  SVLSS  538
            S+L S
Sbjct  255  SILMS  259



>ref|XP_010526084.1| PREDICTED: calmodulin-like protein 4 [Tarenaya hassleriana]
Length=208

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
             EL + F++ D++ DG+I KEEL   L  +G   P R EL  M+ ++D +GDGC+ ++EF
Sbjct  66   VELKRVFQMFDKNGDGRITKEELNDSLENLGLFLPDR-ELAQMIQKIDANGDGCVDMDEF  124

Query  524  SVLSSAFAPPS-CDSELRDAFDFFDTDHD  607
              L  +    S  D ++RDAFD FD D D
Sbjct  125  ESLYKSIVDQSDKDDDMRDAFDVFDQDGD  153



>ref|XP_006402687.1| hypothetical protein EUTSA_v10006367mg [Eutrema salsugineum]
 gb|ESQ44140.1| hypothetical protein EUTSA_v10006367mg [Eutrema salsugineum]
Length=201

 Score = 67.8 bits (164),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
             +L + F++ D++ DG+I KEEL   L  +G   P ++ ++ M+ ++D +GDGC+ + EF
Sbjct  52   VDLKRVFQMFDKNGDGRITKEELNDSLENLGIFMPEKDLIQ-MIQKMDANGDGCVDIHEF  110

Query  524  SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              L S+      D ++RDAF+ FD D D
Sbjct  111  ESLYSSIVEEKVDEDMRDAFNVFDQDGD  138



>ref|XP_008381330.1| PREDICTED: probable calcium-binding protein CML23 [Malus domestica]
Length=154

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 60/104 (58%), Gaps = 7/104 (7%)
 Frame = +2

Query  305  NDEISPDE---LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLML  475
            ND IS       SG   EL + F   D++ DG+I  +EL  +  ++G+E  S EE++ ++
Sbjct  4    NDSISKGSGIGASGSMEELKKIFNKFDKNGDGRISCDELRGIFGELGSETASLEEVQRIM  63

Query  476  SEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            +E D+DGDG I + EF+ + +  +      ELRDAFD +D D +
Sbjct  64   AEFDKDGDGHIDIAEFAEIINGGSTK----ELRDAFDLYDLDKN  103



>ref|XP_011498410.1| PREDICTED: neo-calmodulin-like isoform X2 [Ceratosolen solmsi 
marchali]
Length=235

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I   EF
Sbjct  96   AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEFNEF  154

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD ++D
Sbjct  155  LQMMSKKMKGADGEDELREAFRVFDKNND  183


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 44/65 (68%), Gaps = 2/65 (3%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            EL +AF++ D+++DG I   EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  170  ELREAFRVFDKNNDGLISSVELRHVMTNLG-EKLSEEEVDDMIKEADLDGDGMVNYEEFV  228

Query  524  SVLSS  538
            ++L+S
Sbjct  229  TILTS  233



>gb|EAY86614.1| hypothetical protein OsI_07995 [Oryza sativa Indica Group]
Length=161

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 10/97 (10%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AEL + F+L DRD DG+I +EEL   L ++G  P  REEL   ++ +D +GDGC+ ++EF
Sbjct  7    AELRRVFELFDRDGDGRITREELTESLERLGM-PVHREELAATIARIDANGDGCVDMDEF  65

Query  524  SVLSSAF------APPSCD---SELRDAFDFFDTDHD  607
            + L             +CD   + +R+AFD FD + D
Sbjct  66   TQLYETVMRVDGGGGGACDVDEASMREAFDVFDRNGD  102



>ref|XP_008378130.1| PREDICTED: probable calcium-binding protein CML23 [Malus domestica]
Length=154

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 58/97 (60%), Gaps = 4/97 (4%)
 Frame = +2

Query  317  SPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDG  496
            S D  +G   EL + F   D++ DG+I  +EL  +   +G+E  S EE++ +++E D+DG
Sbjct  11   SGDGAAGSMEELKKVFDKFDKNGDGRISCDELRGVFGDLGSETASLEEVQRIMAEFDKDG  70

Query  497  DGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            DG I +EEF+ + +  +      ELRDAFD +D D +
Sbjct  71   DGHIDIEEFAEIINGGSTK----ELRDAFDLYDLDKN  103



>dbj|GAA42135.2| calmodulin-like protein 1 [Clonorchis sinensis]
Length=153

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 57/89 (64%), Gaps = 3/89 (3%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  526
            EL +AF L D+D DG+I  +EL +++ ++   P + +E R +++EVD++ DG I   EF 
Sbjct  13   ELREAFGLFDKDHDGQITLQELRSMM-KLFNRPCTADEAREIMAEVDKNNDGVIDFREFV  71

Query  527  VLSSAFAPP--SCDSELRDAFDFFDTDHD  607
             L +    P  S DS+L+ AFDFFD DHD
Sbjct  72   ELMTPVMTPDRSDDSDLKAAFDFFDKDHD  100



>ref|XP_011150177.1| PREDICTED: neo-calmodulin-like isoform X4 [Harpegnathos saltator]
Length=180

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I   EF
Sbjct  41   AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEFNEF  99

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD ++D
Sbjct  100  LQMMSKKMKGADGEDELREAFRVFDKNND  128


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 45/65 (69%), Gaps = 2/65 (3%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            EL +AF++ D+++DG I  +EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  115  ELREAFRVFDKNNDGLISSKELRHVMTNLG-EKLSEEEVDDMIKEADLDGDGMVNYEEFV  173

Query  524  SVLSS  538
            ++L+S
Sbjct  174  TILTS  178



>ref|XP_011257080.1| PREDICTED: calmodulin-A-like isoform X2 [Camponotus floridanus]
Length=260

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I   EF
Sbjct  121  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEFNEF  179

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD ++D
Sbjct  180  LQMMSKKMKGADGEDELREAFRVFDKNND  208


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 45/65 (69%), Gaps = 2/65 (3%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            EL +AF++ D+++DG I  +EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  195  ELREAFRVFDKNNDGLISSKELRHVMTNLG-EKLSEEEVDDMIKEADLDGDGMVNYEEFV  253

Query  524  SVLSS  538
            ++L+S
Sbjct  254  TILTS  258



>ref|XP_011150175.1| PREDICTED: calmodulin-A-like isoform X2 [Harpegnathos saltator]
Length=260

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I   EF
Sbjct  121  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEFNEF  179

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD ++D
Sbjct  180  LQMMSKKMKGADGEDELREAFRVFDKNND  208


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 45/65 (69%), Gaps = 2/65 (3%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            EL +AF++ D+++DG I  +EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  195  ELREAFRVFDKNNDGLISSKELRHVMTNLG-EKLSEEEVDDMIKEADLDGDGMVNYEEFV  253

Query  524  SVLSS  538
            ++L+S
Sbjct  254  TILTS  258



>ref|XP_009370750.1| PREDICTED: calmodulin-like protein 11 [Pyrus x bretschneideri]
Length=148

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 55/91 (60%), Gaps = 1/91 (1%)
 Frame = +2

Query  335  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  514
            G  +E  +AF LID+D DG IR EEL  ++  +  + P++EE++ M+SE+  DG+G I  
Sbjct  8    GQISEFQEAFCLIDKDSDGLIRLEELATVIQSLD-QRPTKEEIQDMISEIGADGNGTIDF  66

Query  515  EEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            EEF  + S     +   EL++AF  FD D D
Sbjct  67   EEFLNIMSRKMKENVAEELKEAFKVFDRDQD  97


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  526
            EL +AFK+ DRD DG I   EL  ++  +G E  + EE   M+ E D DGDG +S EEF+
Sbjct  84   ELKEAFKVFDRDQDGYISASELRQVMINLG-ERLTDEEAEQMIKEADLDGDGLVSYEEFA  142



>ref|XP_011307673.1| PREDICTED: calmodulin-A-like isoform X2 [Fopius arisanus]
Length=261

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I   EF
Sbjct  122  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEFNEF  180

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD ++D
Sbjct  181  LQMMSKKMKGADGEDELREAFRVFDKNND  209


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 42/65 (65%), Gaps = 1/65 (2%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  526
            EL +AF++ D+++DG I   EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  196  ELREAFRVFDKNNDGLISSMELRHVMTNLG-EKLSEEEVDDMIKEADLDGDGMVNYEEFV  254

Query  527  VLSSA  541
             + +A
Sbjct  255  TILTA  259



>gb|EGI57712.1| Calmodulin [Acromyrmex echinatior]
Length=186

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I   EF
Sbjct  41   AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEFNEF  99

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD ++D
Sbjct  100  LQMMSKKMKSADGEDELREAFRVFDKNND  128



>ref|XP_004503360.1| PREDICTED: probable calcium-binding protein CML25-like [Cicer 
arietinum]
Length=190

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 66/123 (54%), Gaps = 10/123 (8%)
 Frame = +2

Query  254  YKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  433
            + +P       S  P+ +  +S    + L  EL Q FK  D + DGKI   EL +++  +
Sbjct  7    FNRPKDMIPSASSTPSRSTSLSVHSRARLAGELEQVFKKFDVNGDGKISASELGSIMGSL  66

Query  434  GAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSE-----LRDAFDFFDT  598
            G +P + +EL  M+ EVD DGDGCISL+EF  L++       DS+     L+DAF  FD 
Sbjct  67   G-QPATEQELDNMIREVDGDGDGCISLQEFIELNT----KGVDSDEILENLKDAFAVFDM  121

Query  599  DHD  607
            D +
Sbjct  122  DGN  124



>ref|XP_011339098.1| PREDICTED: calmodulin-A-like isoform X2 [Cerapachys biroi]
Length=260

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I   EF
Sbjct  121  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEFNEF  179

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD ++D
Sbjct  180  LQMMSKKMKGADGEDELREAFRVFDKNND  208


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 45/65 (69%), Gaps = 2/65 (3%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            EL +AF++ D+++DG I  +EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  195  ELREAFRVFDKNNDGLISSKELRHVMTNLG-EKLSEEEVDDMIKEADLDGDGMVNYEEFV  253

Query  524  SVLSS  538
            ++L+S
Sbjct  254  TILTS  258



>gb|KEH26932.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=174

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 54/97 (56%), Gaps = 0/97 (0%)
 Frame = +2

Query  317  SPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDG  496
            +P  L G   EL + F   D + DGKI   ELE +L  + ++ P +EELR ++ E+  D 
Sbjct  16   TPSPLLGDMDELKKVFNNFDANGDGKISVNELETVLRTLRSDVPQQEELRRVMEELSTDR  75

Query  497  DGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            DG I+L EF+    +      DS LRDAFD +D D +
Sbjct  76   DGFINLSEFAAFCRSDTTDGGDSALRDAFDLYDKDKN  112



>ref|XP_008216621.1| PREDICTED: calmodulin-A-like [Nasonia vitripennis]
Length=259

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I   EF
Sbjct  120  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEFNEF  178

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD ++D
Sbjct  179  LQMMSKKMKGAEGEDELREAFRVFDKNND  207


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 44/65 (68%), Gaps = 2/65 (3%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            EL +AF++ D+++DG I   EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  194  ELREAFRVFDKNNDGLISSVELRHVMTNLG-EKLSEEEVDDMIKEADLDGDGMVNYEEFV  252

Query  524  SVLSS  538
            ++L+S
Sbjct  253  TILTS  257



>ref|XP_007144825.1| hypothetical protein PHAVU_007G187200g [Phaseolus vulgaris]
 gb|ESW16819.1| hypothetical protein PHAVU_007G187200g [Phaseolus vulgaris]
Length=149

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 54/92 (59%), Gaps = 1/92 (1%)
 Frame = +2

Query  335  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  514
             L  + ++AF L DRD DG I  EEL + +  +    P +EEL++M+SEVD +G+G I  
Sbjct  8    NLIGDFLEAFCLFDRDGDGCITMEELASAIRVLNQNNPRKEELQVMMSEVDMNGNGMIDF  67

Query  515  EEF-SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
             +F ++++        + EL++AF  FD D D
Sbjct  68   GQFLNLMARKMKQSETEEELKEAFRLFDQDQD  99



>ref|XP_011307672.1| PREDICTED: calmodulin-beta-like isoform X1 [Fopius arisanus]
Length=275

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I   EF
Sbjct  136  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEFNEF  194

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD ++D
Sbjct  195  LQMMSKKMKGADGEDELREAFRVFDKNND  223


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 42/65 (65%), Gaps = 1/65 (2%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  526
            EL +AF++ D+++DG I   EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  210  ELREAFRVFDKNNDGLISSMELRHVMTNLG-EKLSEEEVDDMIKEADLDGDGMVNYEEFV  268

Query  527  VLSSA  541
             + +A
Sbjct  269  TILTA  273



>gb|KGG50401.1| calmodulin [Microsporidia sp. UGP3]
Length=170

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 69/121 (57%), Gaps = 6/121 (5%)
 Frame = +2

Query  251  GYKKPGGESTPTSVLPALNDEISPDELSG-LYAELVQAFKLIDRDDDGKIRKEELEALLS  427
            G+ + G    P S   A+N      +LS    AEL +AF L D+++DG+I  +EL  ++ 
Sbjct  3    GHARHGRHLGPPS---AVNRSTGQHQLSEEQIAELKEAFSLFDKNNDGRITIQELGRVMH  59

Query  428  QVGAEPPSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDH  604
             +G + PS  E+  ML+EVD DGDG I   EF ++++        ++EL++AFD FD + 
Sbjct  60   ALG-QHPSESEISDMLNEVDADGDGTIDFFEFLTMMARKVKDVDAEAELKEAFDVFDKNG  118

Query  605  D  607
            D
Sbjct  119  D  119



>ref|XP_011150174.1| PREDICTED: calmodulin-beta-like isoform X1 [Harpegnathos saltator]
Length=274

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I   EF
Sbjct  135  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEFNEF  193

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD ++D
Sbjct  194  LQMMSKKMKGADGEDELREAFRVFDKNND  222


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 45/65 (69%), Gaps = 2/65 (3%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            EL +AF++ D+++DG I  +EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  209  ELREAFRVFDKNNDGLISSKELRHVMTNLG-EKLSEEEVDDMIKEADLDGDGMVNYEEFV  267

Query  524  SVLSS  538
            ++L+S
Sbjct  268  TILTS  272



>ref|XP_011427007.1| PREDICTED: calmodulin-A-like [Crassostrea gigas]
Length=148

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AFKL D+D DG I  +EL  ++  +G + P+  EL+ M++EVD DG+G I   EF
Sbjct  10   AEFKEAFKLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMVNEVDEDGNGTIDFGEF  68

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        ++ELR+AF  FD D D
Sbjct  69   VQMMSRKVQDADTEAELREAFAVFDKDGD  97


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 44/65 (68%), Gaps = 1/65 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AEL +AF + D+D DG I   EL++++SQ+G E  + E++  M+ E D+DGDG I+ +EF
Sbjct  83   AELREAFAVFDKDGDGFIGATELQSVMSQLG-ENLTLEDVHSMIREADQDGDGRINYKEF  141

Query  524  SVLSS  538
              + +
Sbjct  142  EAMMT  146



>ref|XP_003695096.1| PREDICTED: calmodulin-like [Apis florea]
Length=162

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I   EF
Sbjct  23   AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEFNEF  81

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD ++D
Sbjct  82   LQMMSKKMKGADGEDELREAFRVFDKNND  110


 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 45/65 (69%), Gaps = 2/65 (3%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            EL +AF++ D+++DG I  +EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  97   ELREAFRVFDKNNDGLISSKELRHVMTNLG-EKLSEEEVDDMIKEADLDGDGMVNYEEFV  155

Query  524  SVLSS  538
            ++L+S
Sbjct  156  TILTS  160



>ref|XP_011339096.1| PREDICTED: calmodulin-beta-like isoform X1 [Cerapachys biroi]
 ref|XP_011339097.1| PREDICTED: calmodulin-beta-like isoform X1 [Cerapachys biroi]
Length=274

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I   EF
Sbjct  135  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEFNEF  193

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD ++D
Sbjct  194  LQMMSKKMKGADGEDELREAFRVFDKNND  222


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 45/65 (69%), Gaps = 2/65 (3%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            EL +AF++ D+++DG I  +EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  209  ELREAFRVFDKNNDGLISSKELRHVMTNLG-EKLSEEEVDDMIKEADLDGDGMVNYEEFV  267

Query  524  SVLSS  538
            ++L+S
Sbjct  268  TILTS  272



>ref|XP_011416014.1| PREDICTED: calmodulin-A-like isoform X2 [Crassostrea gigas]
Length=149

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 52/86 (60%), Gaps = 3/86 (3%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AEL + F L D+D DG +  +EL  ++ Q+G EP S EELR M++EVD DG G I  EEF
Sbjct  10   AELRETFLLFDKDGDGTVNSDELGTVMRQLGQEP-SEEELRQMIAEVDEDGSGEIEFEEF  68

Query  524  SVLSSAFAPPSCDS--ELRDAFDFFD  595
              + +       DS  EL +AF+ FD
Sbjct  69   CAMMANRMNQPIDSPQELIEAFEIFD  94



>ref|XP_011416012.1| PREDICTED: calmodulin-A-like isoform X1 [Crassostrea gigas]
Length=162

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 52/86 (60%), Gaps = 3/86 (3%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AEL + F L D+D DG +  +EL  ++ Q+G EP S EELR M++EVD DG G I  EEF
Sbjct  23   AELRETFLLFDKDGDGTVNSDELGTVMRQLGQEP-SEEELRQMIAEVDEDGSGEIEFEEF  81

Query  524  SVLSSAFAPPSCDS--ELRDAFDFFD  595
              + +       DS  EL +AF+ FD
Sbjct  82   CAMMANRMNQPIDSPQELIEAFEIFD  107



>ref|XP_002630726.1| Hypothetical protein CBG02410 [Caenorhabditis briggsae]
Length=145

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 55/89 (62%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE+ + F+  D++ DG+I ++ELE  L Q+G E  +  ++  M+ + D DG+GCI ++EF
Sbjct  7    AEIREVFREFDKNGDGRITRQELEVALLQLG-EKATNSKIETMIEQADLDGNGCIDIDEF  65

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
             +VL      P  + ELRD F+ FD + D
Sbjct  66   LNVLRRQICDPKEERELRDVFNVFDKNGD  94



>ref|XP_003400211.1| PREDICTED: calmodulin-like [Bombus terrestris]
 ref|XP_003494411.1| PREDICTED: calmodulin-like [Bombus impatiens]
Length=275

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I   EF
Sbjct  136  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEFNEF  194

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD ++D
Sbjct  195  LQMMSKKMKGADGEDELREAFRVFDKNND  223


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 45/65 (69%), Gaps = 2/65 (3%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            EL +AF++ D+++DG I  +EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  210  ELREAFRVFDKNNDGLISSKELRHVMTNLG-EKLSEEEVDDMIKEADLDGDGMVNYEEFV  268

Query  524  SVLSS  538
            ++L+S
Sbjct  269  TILTS  273



>gb|EPS63975.1| hypothetical protein M569_10810, partial [Genlisea aurea]
Length=170

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 59/118 (50%), Gaps = 7/118 (6%)
 Frame = +2

Query  257  KKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  436
            +K    S   +  P++N     +E      EL Q FK  D + DGKI   EL A+   +G
Sbjct  4    RKAKASSGAMNSTPSMNSRAQIEE------ELEQVFKKFDVNGDGKISGSELGAIFRSLG  57

Query  437  AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSA-FAPPSCDSELRDAFDFFDTDHD  607
             E  + EEL+ M+ EVD DGDG I L+EF  L++           L+DAF  FD D D
Sbjct  58   GEAMAEEELKSMIREVDSDGDGFIDLKEFVELNTKDIDYDETVENLKDAFQVFDIDGD  115



>ref|XP_006558598.1| PREDICTED: calmodulin-like isoform X5 [Apis mellifera]
Length=245

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 53/89 (60%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I   EF
Sbjct  106  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEFNEF  164

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD + D
Sbjct  165  LQMMSKKMKGADGEDELREAFRVFDKNKD  193


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 44/65 (68%), Gaps = 2/65 (3%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            EL +AF++ D++ DG I  +EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  180  ELREAFRVFDKNKDGLISSKELRHVMTNLG-EKLSEEEVDDMIKEADLDGDGMVNYEEFV  238

Query  524  SVLSS  538
            ++L+S
Sbjct  239  TILTS  243



>ref|XP_011498409.1| PREDICTED: neo-calmodulin-like isoform X1 [Ceratosolen solmsi 
marchali]
Length=261

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I   EF
Sbjct  122  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEFNEF  180

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD ++D
Sbjct  181  LQMMSKKMKGADGEDELREAFRVFDKNND  209


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 44/65 (68%), Gaps = 2/65 (3%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            EL +AF++ D+++DG I   EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  196  ELREAFRVFDKNNDGLISSVELRHVMTNLG-EKLSEEEVDDMIKEADLDGDGMVNYEEFV  254

Query  524  SVLSS  538
            ++L+S
Sbjct  255  TILTS  259



>ref|XP_011257079.1| PREDICTED: calmodulin-beta-like isoform X1 [Camponotus floridanus]
Length=274

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I   EF
Sbjct  135  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEFNEF  193

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD ++D
Sbjct  194  LQMMSKKMKGADGEDELREAFRVFDKNND  222


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 45/65 (69%), Gaps = 2/65 (3%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            EL +AF++ D+++DG I  +EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  209  ELREAFRVFDKNNDGLISSKELRHVMTNLG-EKLSEEEVDDMIKEADLDGDGMVNYEEFV  267

Query  524  SVLSS  538
            ++L+S
Sbjct  268  TILTS  272



>ref|XP_006616491.1| PREDICTED: calmodulin-like isoform X5 [Apis dorsata]
Length=245

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 53/89 (60%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I   EF
Sbjct  106  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEFNEF  164

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD + D
Sbjct  165  LQMMSKKMKGADGEDELREAFRVFDKNKD  193


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 44/65 (68%), Gaps = 2/65 (3%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            EL +AF++ D++ DG I  +EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  180  ELREAFRVFDKNKDGLISSKELRHVMTNLG-EKLSEEEVDDMIKEADLDGDGMVNYEEFV  238

Query  524  SVLSS  538
            ++L+S
Sbjct  239  TILTS  243



>ref|XP_008801290.1| PREDICTED: probable calcium-binding protein CML10 [Phoenix dactylifera]
Length=180

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  526
            EL + F+L D + DGKI   EL  +++++G  P    EL +M+ E D DGDG I+L EF 
Sbjct  38   ELERVFRLYDTNGDGKISAAELRDMMAKLGRPPADDHELEMMMKEADADGDGFINLAEFK  97

Query  527  VLSSAFAPPSCDSELRDAFDFFDTDHD  607
             ++ A      +++LR+AF  FD DHD
Sbjct  98   DINRA-GEGVQEADLREAFAVFDEDHD  123


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 41/70 (59%), Gaps = 1/70 (1%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            A+L +AF + D D DGKI   EL  +L  +G E  +  + R M+  VDRDGDG +S +EF
Sbjct  109  ADLREAFAVFDEDHDGKISASELRGVLKGLGEEVTT-AQCRKMIRGVDRDGDGMVSFQEF  167

Query  524  SVLSSAFAPP  553
             V+ +    P
Sbjct  168  KVMMTGGGRP  177



>ref|XP_011257082.1| PREDICTED: neo-calmodulin-like isoform X4 [Camponotus floridanus]
Length=180

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I   EF
Sbjct  41   AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEFNEF  99

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD ++D
Sbjct  100  LQMMSKKMKGADGEDELREAFRVFDKNND  128


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 45/65 (69%), Gaps = 2/65 (3%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            EL +AF++ D+++DG I  +EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  115  ELREAFRVFDKNNDGLISSKELRHVMTNLG-EKLSEEEVDDMIKEADLDGDGMVNYEEFV  173

Query  524  SVLSS  538
            ++L+S
Sbjct  174  TILTS  178



>ref|XP_008389977.1| PREDICTED: probable calcium-binding protein CML25 [Malus domestica]
Length=269

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AEL Q FK  D + DGKI   EL A++S +G +P S EEL  M+SEVD DGDG I+ +EF
Sbjct  122  AELDQVFKKFDVNGDGKISSSELGAIMSSLG-QPASDEELNGMISEVDSDGDGFINFKEF  180

Query  524  SVLSS-AFAPPSCDSELRDAFDFFDTDHD  607
              L++    P      L+DAF  +D D +
Sbjct  181  VELNTKGIDPDEALENLKDAFSVYDIDGN  209



>ref|XP_011498411.1| PREDICTED: neo-calmodulin-like isoform X3 [Ceratosolen solmsi 
marchali]
Length=180

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I   EF
Sbjct  41   AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEFNEF  99

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD ++D
Sbjct  100  LQMMSKKMKGADGEDELREAFRVFDKNND  128


 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 44/65 (68%), Gaps = 2/65 (3%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            EL +AF++ D+++DG I   EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  115  ELREAFRVFDKNNDGLISSVELRHVMTNLG-EKLSEEEVDDMIKEADLDGDGMVNYEEFV  173

Query  524  SVLSS  538
            ++L+S
Sbjct  174  TILTS  178



>ref|XP_006558597.1| PREDICTED: calmodulin-like isoform X4 [Apis mellifera]
Length=254

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 53/89 (60%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I   EF
Sbjct  115  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEFNEF  173

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD + D
Sbjct  174  LQMMSKKMKGADGEDELREAFRVFDKNKD  202


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 44/65 (68%), Gaps = 2/65 (3%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            EL +AF++ D++ DG I  +EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  189  ELREAFRVFDKNKDGLISSKELRHVMTNLG-EKLSEEEVDDMIKEADLDGDGMVNYEEFV  247

Query  524  SVLSS  538
            ++L+S
Sbjct  248  TILTS  252



>ref|XP_006616490.1| PREDICTED: calmodulin-like isoform X4 [Apis dorsata]
Length=254

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 53/89 (60%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I   EF
Sbjct  115  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEFNEF  173

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD + D
Sbjct  174  LQMMSKKMKGADGEDELREAFRVFDKNKD  202


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 44/65 (68%), Gaps = 2/65 (3%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            EL +AF++ D++ DG I  +EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  189  ELREAFRVFDKNKDGLISSKELRHVMTNLG-EKLSEEEVDDMIKEADLDGDGMVNYEEFV  247

Query  524  SVLSS  538
            ++L+S
Sbjct  248  TILTS  252



>ref|XP_009334418.1| PREDICTED: probable calcium-binding protein CML23 [Pyrus x bretschneideri]
Length=154

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 60/102 (59%), Gaps = 4/102 (4%)
 Frame = +2

Query  302  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  481
            L+ + S D  +G   EL + F   D++ DG+I  EEL  +   +G+E  S EE++ +++E
Sbjct  6    LDSKGSGDGAAGSMEELKKVFDKFDKNGDGRISCEELRGVFGDLGSETASLEEVQRIMAE  65

Query  482  VDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
             D+DGDG I + EF+ + +  +      ELRDAFD +D D +
Sbjct  66   FDKDGDGHIDIVEFAEIINGGSTK----ELRDAFDLYDLDKN  103



>ref|XP_006558596.1| PREDICTED: calmodulin-like isoform X3 [Apis mellifera]
Length=262

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 53/89 (60%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I   EF
Sbjct  123  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEFNEF  181

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD + D
Sbjct  182  LQMMSKKMKGADGEDELREAFRVFDKNKD  210


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 44/65 (68%), Gaps = 2/65 (3%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            EL +AF++ D++ DG I  +EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  197  ELREAFRVFDKNKDGLISSKELRHVMTNLG-EKLSEEEVDDMIKEADLDGDGMVNYEEFV  255

Query  524  SVLSS  538
            ++L+S
Sbjct  256  TILTS  260



>ref|XP_006616489.1| PREDICTED: calmodulin-like isoform X3 [Apis dorsata]
Length=262

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 53/89 (60%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I   EF
Sbjct  123  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEFNEF  181

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD + D
Sbjct  182  LQMMSKKMKGADGEDELREAFRVFDKNKD  210


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 44/65 (68%), Gaps = 2/65 (3%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            EL +AF++ D++ DG I  +EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  197  ELREAFRVFDKNKDGLISSKELRHVMTNLG-EKLSEEEVDDMIKEADLDGDGMVNYEEFV  255

Query  524  SVLSS  538
            ++L+S
Sbjct  256  TILTS  260



>emb|CAP24100.2| Protein CBG02410 [Caenorhabditis briggsae]
Length=150

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 55/89 (62%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE+ + F+  D++ DG+I ++ELE  L Q+G E  +  ++  M+ + D DG+GCI ++EF
Sbjct  7    AEIREVFREFDKNGDGRITRQELEVALLQLG-EKATNSKIETMIEQADLDGNGCIDIDEF  65

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
             +VL      P  + ELRD F+ FD + D
Sbjct  66   LNVLRRQICDPKEERELRDVFNVFDKNGD  94



>gb|AFK83800.1| calmodulin [Mnemiopsis leidyi]
Length=149

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 51/87 (59%), Gaps = 2/87 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D DG I   EL  ++  +G + P   +L+ M++EVD DG+G I  +EF
Sbjct  11   AEFREAFSLFDKDGDGTITTTELGTVMKSLG-QSPCESDLQDMINEVDADGNGTIDFKEF  69

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTD  601
              +++       CD ELR+AF  FD D
Sbjct  70   LEMMTKHMKEADCDQELREAFKVFDKD  96


 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            EL +AFK+ D+D +GKI ++EL+ ++  +G E  + EE+  M+ E D +GDG +  EEF
Sbjct  85   ELREAFKVFDKDGNGKISQQELKLVMKNLG-ENLTDEEINEMIREADDNGDGEVDYEEF  142



>ref|XP_009371792.1| PREDICTED: probable calcium-binding protein CML23 [Pyrus x bretschneideri]
Length=154

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 60/104 (58%), Gaps = 7/104 (7%)
 Frame = +2

Query  305  NDEISPDE---LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLML  475
            ND IS       +G   EL + F   D++ DG+I  +EL  +  ++G+E  S EE++ ++
Sbjct  4    NDSISKGSGIGAAGSMEELKKIFNKFDKNGDGRISCDELRGIFGELGSETASLEEVQRIM  63

Query  476  SEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            +E D+DGDG I + EF+ + +  +      ELRDAFD +D D +
Sbjct  64   AEFDKDGDGHIDIAEFAEIINGGSTK----ELRDAFDLYDLDKN  103



>ref|XP_006616488.1| PREDICTED: calmodulin-like isoform X2 [Apis dorsata]
Length=268

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 53/89 (60%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I   EF
Sbjct  129  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEFNEF  187

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD + D
Sbjct  188  LQMMSKKMKGADGEDELREAFRVFDKNKD  216


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 44/65 (68%), Gaps = 2/65 (3%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            EL +AF++ D++ DG I  +EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  203  ELREAFRVFDKNKDGLISSKELRHVMTNLG-EKLSEEEVDDMIKEADLDGDGMVNYEEFV  261

Query  524  SVLSS  538
            ++L+S
Sbjct  262  TILTS  266



>gb|KCW78265.1| hypothetical protein EUGRSUZ_D02448, partial [Eucalyptus grandis]
Length=142

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 56/94 (60%), Gaps = 7/94 (7%)
 Frame = +2

Query  332  SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG--AEPPSREELRLMLSEVDRDGDGC  505
            S + A+L Q F+LID D DGKI   EL  +LS +G      + EE R+M+ E+DRDGDG 
Sbjct  1    SEVSAQLRQVFELIDADGDGKISPTELSRVLSGLGHVGAAAADEEARVMVKEIDRDGDGR  60

Query  506  ISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            + L+EF V     A  S D +L DAF  FD + D
Sbjct  61   VDLDEFLV-----AVLSGDDDLMDAFLIFDANKD  89



>ref|XP_624589.2| PREDICTED: calmodulin-like isoformX2 [Apis mellifera]
Length=276

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 53/89 (60%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I   EF
Sbjct  137  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEFNEF  195

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD + D
Sbjct  196  LQMMSKKMKGADGEDELREAFRVFDKNKD  224


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 44/65 (68%), Gaps = 2/65 (3%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            EL +AF++ D++ DG I  +EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  211  ELREAFRVFDKNKDGLISSKELRHVMTNLG-EKLSEEEVDDMIKEADLDGDGMVNYEEFV  269

Query  524  SVLSS  538
            ++L+S
Sbjct  270  TILTS  274



>ref|XP_011498412.1| PREDICTED: neo-calmodulin-like isoform X4 [Ceratosolen solmsi 
marchali]
Length=179

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I   EF
Sbjct  40   AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEFNEF  98

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD ++D
Sbjct  99   LQMMSKKMKGADGEDELREAFRVFDKNND  127


 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 44/65 (68%), Gaps = 2/65 (3%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            EL +AF++ D+++DG I   EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  114  ELREAFRVFDKNNDGLISSVELRHVMTNLG-EKLSEEEVDDMIKEADLDGDGMVNYEEFV  172

Query  524  SVLSS  538
            ++L+S
Sbjct  173  TILTS  177



>ref|XP_006616487.1| PREDICTED: calmodulin-like isoform X1 [Apis dorsata]
Length=276

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 53/89 (60%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I   EF
Sbjct  137  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIEFNEF  195

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD + D
Sbjct  196  LQMMSKKMKGADGEDELREAFRVFDKNKD  224


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 44/65 (68%), Gaps = 2/65 (3%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            EL +AF++ D++ DG I  +EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  211  ELREAFRVFDKNKDGLISSKELRHVMTNLG-EKLSEEEVDDMIKEADLDGDGMVNYEEFV  269

Query  524  SVLSS  538
            ++L+S
Sbjct  270  TILTS  274



>ref|XP_003372739.1| EF hand domain containing protein [Trichinella spiralis]
 gb|EFV53117.1| EF hand domain containing protein [Trichinella spiralis]
Length=239

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D DGKI  +EL  ++  +G + P+  ELR M++EVD DG+G I  +EF
Sbjct  101  AEFQEAFNLFDKDGDGKITSQELGIVMRSLG-QRPTESELRDMVNEVDEDGNGTIEFDEF  159

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + EL++AF  FD D D
Sbjct  160  LQMMSRKMKDSDSEQELKEAFQVFDKDKD  188



>ref|XP_006647478.1| PREDICTED: probable calcium-binding protein CML17-like [Oryza 
brachyantha]
Length=158

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 56/95 (59%), Gaps = 8/95 (8%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AEL + F+L DRD DG+I +EEL   L ++G  P + EEL   ++ VD +GDGC+ L EF
Sbjct  6    AELRRVFELFDRDGDGRITREELTESLERLGM-PVAGEELAATIARVDANGDGCVDLGEF  64

Query  524  SVLSSAFAPPSCD-------SELRDAFDFFDTDHD  607
            + L ++      D       + +R+AFD FD D D
Sbjct  65   AELYASVMRVDWDGGGDAEEASMREAFDVFDRDGD  99



>ref|XP_001622774.1| predicted protein [Nematostella vectensis]
 gb|EDO30674.1| predicted protein [Nematostella vectensis]
Length=172

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 54/88 (61%), Gaps = 2/88 (2%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            EL +AF L D+D  G I  EELE ++  +G + PS EEL+ M+ EVD DG+G +  EEF 
Sbjct  20   ELQEAFSLFDKDGSGTISNEELEVVMKSLG-QNPSDEELQQMIQEVDADGNGEVDFEEFL  78

Query  524  SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            +++         ++E+R+AF  FD + D
Sbjct  79   AMMKKQMQHRDAEAEMREAFRVFDRNGD  106


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 42/60 (70%), Gaps = 1/60 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE+ +AF++ DR+ DG I + EL ++++ +G E  S +E++ M+ E D DGDG I+ +EF
Sbjct  92   AEMREAFRVFDRNGDGSISEWELRSVMASLG-EKLSDDEIKEMMREADLDGDGVINFQEF  150



>ref|XP_004923690.1| PREDICTED: calmodulin-like [Bombyx mori]
Length=240

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 53/89 (60%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M+ EVD+DG+G I   EF
Sbjct  101  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVKEVDQDGNGTIEFNEF  159

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD ++D
Sbjct  160  LQMMSKKMRGADGEDELREAFRVFDKNND  188



>ref|XP_004308823.1| PREDICTED: calmodulin-5/6/7/8-like [Fragaria vesca subsp. vesca]
Length=195

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 62/104 (60%), Gaps = 6/104 (6%)
 Frame = +2

Query  299  ALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLS  478
            ++ D++SPD+ S    E  +AF L D+D DG I  +EL  ++  +G + P+ EEL+ M++
Sbjct  5    SVADQLSPDQKS----EFKEAFGLFDKDGDGSITTKELGTVMRSLG-QNPTEEELQDMIN  59

Query  479  EVDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            EVD DG G +  +EF  +++        D +L++AF  FD D +
Sbjct  60   EVDADGSGTVECQEFLELMAKKIKGTDSDEQLKEAFRVFDKDQN  103



>gb|EPS64880.1| hypothetical protein M569_09899 [Genlisea aurea]
Length=155

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 56/89 (63%), Gaps = 6/89 (7%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            E  +AF +IDRD DG I  EELE ++  V  E P++E ++ M++ VD DG+G I  +EF 
Sbjct  12   EFREAFAVIDRDSDGFISVEELELVIRSV-IEHPTKEIIQEMMNHVDADGNGTIDFQEFL  70

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++++A    + D ELR+AF  FD D D
Sbjct  71   HMIINTA---KANDVELREAFSVFDRDQD  96



>gb|EFZ10130.1| hypothetical protein SINV_07599 [Solenopsis invicta]
Length=167

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 56/93 (60%), Gaps = 2/93 (2%)
 Frame = +2

Query  332  SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCIS  511
            + + +E  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I 
Sbjct  9    NSIISEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTIE  67

Query  512  LEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              EF  ++S        + ELR+AF  FD ++D
Sbjct  68   FNEFLQMMSKKMKSADGEDELREAFRVFDKNND  100



>ref|XP_010053891.1| PREDICTED: calmodulin-like protein 3 [Eucalyptus grandis]
Length=202

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 56/94 (60%), Gaps = 7/94 (7%)
 Frame = +2

Query  332  SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG--AEPPSREELRLMLSEVDRDGDGC  505
            S + A+L Q F+LID D DGKI   EL  +LS +G      + EE R+M+ E+DRDGDG 
Sbjct  61   SEVSAQLRQVFELIDADGDGKISPTELSRVLSGLGHVGAAAADEEARVMVKEIDRDGDGR  120

Query  506  ISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            + L+EF V     A  S D +L DAF  FD + D
Sbjct  121  VDLDEFLV-----AVLSGDDDLMDAFLIFDANKD  149



>ref|XP_008381742.1| PREDICTED: probable calcium-binding protein CML25 [Malus domestica]
 ref|XP_008348739.1| PREDICTED: probable calcium-binding protein CML25 [Malus domestica]
Length=202

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 52/87 (60%), Gaps = 2/87 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AEL Q FK  D + DGKI   EL A++S +G +P S EEL  M+SEVD DGDG I+ +EF
Sbjct  55   AELDQVFKKFDVNGDGKISSSELGAIMSSLG-QPSSDEELNSMISEVDSDGDGFINFKEF  113

Query  524  SVLSS-AFAPPSCDSELRDAFDFFDTD  601
              L++           L+DAF  +D D
Sbjct  114  VELNTKGVDSAEALENLKDAFSVYDID  140


 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 36/62 (58%), Gaps = 1/62 (2%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  526
             L  AF + D D +G I  EEL  +L  +G E  S +E R M+  VD DGDG IS EEF 
Sbjct  129  NLKDAFSVYDIDGNGSISAEELYEVLRSLGDEC-SIDECRQMIGGVDSDGDGMISFEEFK  187

Query  527  VL  532
            V+
Sbjct  188  VM  189



>ref|XP_007295339.1| calmodulin [Marssonina brunnea f. sp. 'multigermtubi' MB_m1]
 gb|EKD14220.1| calmodulin [Marssonina brunnea f. sp. 'multigermtubi' MB_m1]
Length=170

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 55/92 (60%), Gaps = 2/92 (2%)
 Frame = +2

Query  329  LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  508
            ++   A L +AF L D D+DG I KEE+ A++  +G   P+  E+  M++EVD D  G +
Sbjct  27   ITNEVAALKEAFALFDSDNDGVITKEEMSAVMKSLGLN-PTMSEIEDMINEVDLDQTGTV  85

Query  509  SLEEF-SVLSSAFAPPSCDSELRDAFDFFDTD  601
             LEEF  ++S    P + + E+R AF+ FD D
Sbjct  86   DLEEFIKMMSIKSKPSNVEDEMRSAFNVFDKD  117


 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 39/64 (61%), Gaps = 1/64 (2%)
 Frame = +2

Query  332  SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCIS  511
            S +  E+  AF + D+D  G I  EEL AL+   G E  + ++L+ M+ EVD++GDG I 
Sbjct  101  SNVEDEMRSAFNVFDKDGSGSISVEELGALMKTFG-ENLTDDDLKTMIQEVDKNGDGSID  159

Query  512  LEEF  523
             +EF
Sbjct  160  YQEF  163



>gb|EHJ76967.1| putative calmodulin-A [Danaus plexippus]
Length=181

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 53/89 (60%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M+ EVD+DG+G I   EF
Sbjct  42   AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVKEVDQDGNGTIEFNEF  100

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD ++D
Sbjct  101  LQMMSKKMRGADGEDELREAFRVFDKNND  129



>ref|XP_966558.2| PREDICTED: neo-calmodulin-like [Tribolium castaneum]
 ref|XP_008194563.1| PREDICTED: neo-calmodulin-like [Tribolium castaneum]
Length=206

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 65/118 (55%), Gaps = 15/118 (13%)
 Frame = +2

Query  272  ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPS  451
            E+ P + L A + E+S  ++     E  +AF+L D+D DG I KEEL  ++  +G +   
Sbjct  23   ETKPPTRLSARHSEVSKSQMK----EFREAFRLFDKDGDGSITKEELGRVMRSLG-QFAR  77

Query  452  REELRLMLSEVDRDGDGCISLEEF-SVLSSAFA---PPSC------DSELRDAFDFFD  595
             EEL+ ML EVD DGDG +S EEF  +  SA A   P         + ELRDAF  FD
Sbjct  78   TEELQQMLQEVDVDGDGNVSFEEFVDIAWSAGAGGDPEHVLSREEEEKELRDAFRVFD  135



>gb|ETN58735.1| calmodulin [Anopheles darlingi]
Length=212

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 54/90 (60%), Gaps = 8/90 (9%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            E  +AF+L D+D+DG I KEEL  ++  +G +    EEL+ ML E+D DGDG +S EEF 
Sbjct  45   EFREAFRLFDKDNDGSITKEELGTVMRSLG-QFARVEELQEMLLEIDVDGDGNVSFEEFV  103

Query  524  ---SVLSSAFAPPSCDS---ELRDAFDFFD  595
               S ++   A  S D    ELRDAF  FD
Sbjct  104  DIMSNMTDTVAETSADQEERELRDAFRVFD  133



>ref|NP_001173067.1| Os02g0606501 [Oryza sativa Japonica Group]
 sp|Q0DZP5.1|CML17_ORYSJ RecName: Full=Probable calcium-binding protein CML17; AltName: 
Full=Calmodulin-like protein 17 [Oryza sativa Japonica Group]
 dbj|BAH91796.1| Os02g0606501 [Oryza sativa Japonica Group]
Length=164

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 57/100 (57%), Gaps = 13/100 (13%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AEL + F+L DRD DG+I +EEL   L ++G  P  REEL   ++ +D +GDGC+ ++EF
Sbjct  7    AELRRVFELFDRDGDGRITREELTESLERLGM-PVHREELAATIARIDANGDGCVDMDEF  65

Query  524  SVLSSAF---------APPSCD---SELRDAFDFFDTDHD  607
            + L                +CD   + +R+AFD FD + D
Sbjct  66   TQLYETVMRVDGGGGGGGGACDVDEASMREAFDVFDRNGD  105



>gb|EKC32559.1| Calmodulin [Crassostrea gigas]
Length=338

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 52/86 (60%), Gaps = 3/86 (3%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AEL + F L D+D DG +  +EL  ++ Q+G EP S EELR M++EVD DG G I  EEF
Sbjct  23   AELRETFLLFDKDGDGTVNSDELGTVMRQLGQEP-SEEELRQMIAEVDEDGSGEIEFEEF  81

Query  524  SVLSSAFAPPSCDS--ELRDAFDFFD  595
              + +       DS  EL +AF+ FD
Sbjct  82   CAMMANRMNQPIDSPQELIEAFEIFD  107



>ref|XP_002430223.1| calmodulin-A, putative [Pediculus humanus corporis]
 gb|EEB17485.1| calmodulin-A, putative [Pediculus humanus corporis]
Length=178

 Score = 65.1 bits (157),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG+I   EL  ++  +G + P+  ELR M+ EVD+DG+G I   EF
Sbjct  39   AEFKEAFMLFDKDEDGQITMAELGVVMRSLG-QRPTETELRDMVKEVDQDGNGTIEFNEF  97

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              +++        + ELR+AF  FD ++D
Sbjct  98   LQMMAKKMKGADGEEELREAFRVFDKNND  126



>gb|ABK21927.1| unknown [Picea sitchensis]
Length=149

 Score = 64.3 bits (155),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 52/89 (58%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L DRD DG I  +EL  ++  +G + P+  E++ M++EVD DG+G I   EF
Sbjct  11   AEFREAFSLFDRDGDGSITTKELSTVIRSLG-QNPTEAEIQDMINEVDTDGNGTIDFREF  69

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              +++        D ELR+AF  FD D +
Sbjct  70   LDLMAHKIKDLDSDEELREAFKVFDKDQN  98


 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            EL +AFK+ D+D +G I   EL  ++  +G E  + EE+ LM+ E D DGDG ++ EEF
Sbjct  85   ELREAFKVFDKDQNGYISAAELRHVMINLG-EKLTEEEVELMIKEADTDGDGQVNYEEF  142



>ref|XP_005704341.1| calmodulin isoform 1 [Galdieria sulphuraria]
 gb|EME27821.1| calmodulin isoform 1 [Galdieria sulphuraria]
Length=159

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 52/86 (60%), Gaps = 2/86 (2%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            E  +AF L D+D DG I  +EL  ++  +G + P+  ELR M++EVD+DG+G I  +EF 
Sbjct  22   EFREAFTLFDKDGDGNITVKELGTVVRSLG-QSPTEAELREMIAEVDKDGNGTIDFQEFL  80

Query  524  SVLSSAFAPPSCDSELRDAFDFFDTD  601
             ++S        + E+R+AF  FD D
Sbjct  81   DLMSRHMRQADTEEEIREAFKVFDKD  106



>ref|XP_004136671.1| PREDICTED: probable calcium-binding protein CML35-like [Cucumis 
sativus]
Length=166

 Score = 64.7 bits (156),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 57/110 (52%), Gaps = 39/110 (35%)
 Frame = +2

Query  278  TPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  457
            TPTSVLP+L+           +++            D  + ++EL+ALL  +GAEPPS E
Sbjct  43   TPTSVLPSLD-----------WSDF----------SDPTLSRKELKALLGLIGAEPPSEE  81

Query  458  ELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            E+++M+ E+DR G                  P+C SELRD F+ FD DHD
Sbjct  82   EIKIMMGEMDRVG------------------PTCHSELRDTFEIFDADHD  113



>ref|XP_009786057.1| PREDICTED: calmodulin-like protein 8 [Nicotiana sylvestris]
Length=150

 Score = 64.3 bits (155),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
             EL +AF L DRD DG I  EEL  ++  +  + P++EEL+ M++EVD DG+G I   EF
Sbjct  11   VELQEAFSLFDRDGDGCITVEELATVIRSLD-QNPTKEELQDMITEVDSDGNGTIEFTEF  69

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
             ++++        + EL++AF  FD D +
Sbjct  70   LNLMAKKMKDTDAEEELKEAFKVFDKDQN  98



>ref|XP_004159632.1| PREDICTED: probable calcium-binding protein CML35-like [Cucumis 
sativus]
 gb|KGN59507.1| hypothetical protein Csa_3G823060 [Cucumis sativus]
Length=167

 Score = 64.7 bits (156),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 57/110 (52%), Gaps = 39/110 (35%)
 Frame = +2

Query  278  TPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  457
            TPTSVLP+L+           +++            D  + ++EL+ALL  +GAEPPS E
Sbjct  44   TPTSVLPSLD-----------WSDF----------SDPTLSRKELKALLGLIGAEPPSEE  82

Query  458  ELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            E+++M+ E+DR G                  P+C SELRD F+ FD DHD
Sbjct  83   EIKIMMGEMDRVG------------------PTCHSELRDTFEIFDADHD  114



>gb|EFA08949.1| hypothetical protein TcasGA2_TC006656 [Tribolium castaneum]
Length=177

 Score = 64.7 bits (156),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + P+  ELR M++EVD+DG+G I   EF
Sbjct  38   AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPTETELRDMVNEVDQDGNGTIEFNEF  96

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + EL++AF  FD ++D
Sbjct  97   LQMMSKKLKDADGEEELKEAFRVFDKNND  125


 Score = 48.1 bits (113),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 42/65 (65%), Gaps = 1/65 (2%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  526
            EL +AF++ D+++DG I   EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  112  ELKEAFRVFDKNNDGLISSNELRHVMTSLG-ERLSEEEVDDMIKEADLDGDGQVNYEEFV  170

Query  527  VLSSA  541
             + +A
Sbjct  171  NILTA  175



>gb|EZA53976.1| Calmodulin [Cerapachys biroi]
Length=236

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 51/91 (56%), Gaps = 9/91 (10%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  526
            E  +AF+L D+D DG I KEEL  ++  +G +    EELR ML E+D DGDG +S EEF 
Sbjct  117  EFREAFRLFDKDGDGTITKEELGRVMRSLG-QFARAEELRTMLQEIDIDGDGNVSFEEFV  175

Query  527  VLSSAFAPPSC--------DSELRDAFDFFD  595
             + S     +         + ELRDAF  FD
Sbjct  176  EIVSNIGASTAAASDQHQEEQELRDAFRVFD  206



>ref|XP_008472657.1| PREDICTED: calmodulin-like [Diaphorina citri]
Length=208

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            +E  +AF L D+D+DGK+   EL  ++  +G + P+  ELR M++EVD+DG+G I   EF
Sbjct  55   SEFKEAFMLFDKDEDGKVTVAELGVVMRSLG-QRPTETELRDMVNEVDQDGNGTIEFNEF  113

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + EL++AF  FD D D
Sbjct  114  LQMMSKKMKGADGEDELKEAFMLFDKDED  142


 Score = 59.3 bits (142),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 50/80 (63%), Gaps = 2/80 (3%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            EL +AF L D+D+DGK+   EL  ++  +G + P+  ELR M++EVD+DG+G I   EF 
Sbjct  129  ELKEAFMLFDKDEDGKVTVAELGVVMRSLG-QRPTETELRDMVNEVDQDGNGTIEFNEFL  187

Query  524  SVLSSAFAPPSCDSELRDAF  583
             ++S        + EL++AF
Sbjct  188  QMMSKKMKGADGEDELKEAF  207



>emb|CDP19328.1| unnamed protein product [Coffea canephora]
Length=152

 Score = 64.3 bits (155),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 52/88 (59%), Gaps = 1/88 (1%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF LIDRD DG I   EL A++  +  E P++EE++ M+ EVD DG+G I  E+F
Sbjct  11   AEFREAFCLIDRDSDGFITIAELAAVIQSLH-ERPTKEEIQEMVHEVDADGNGSIDFEDF  69

Query  524  SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              + +     +   EL +AF  FD D D
Sbjct  70   LSIMARKTKENVAKELNEAFKVFDRDQD  97


 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 40/69 (58%), Gaps = 1/69 (1%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  526
            EL +AFK+ DRD DG I   EL  ++  +G E  + EE   M+ E D +GDG +S +EF 
Sbjct  84   ELNEAFKVFDRDQDGFISANELRNVMINLG-ERLTDEEAEQMIREADLNGDGVVSYDEFV  142

Query  527  VLSSAFAPP  553
             +  A +P 
Sbjct  143  RMMVASSPS  151



>ref|XP_006432946.1| hypothetical protein CICLE_v10002774mg [Citrus clementina]
 ref|XP_006471665.1| PREDICTED: calmodulin-like protein 11-like [Citrus sinensis]
 gb|ESR46186.1| hypothetical protein CICLE_v10002774mg [Citrus clementina]
Length=150

 Score = 64.3 bits (155),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L+D+D DG I  +EL A +  +  + P++EELRLM+ EVD +G+G I  EEF
Sbjct  11   AEFQKAFYLLDKDGDGCITIDELAAAIRSLD-QNPTKEELRLMIDEVDANGNGTIEFEEF  69

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              +++          E+++AF  FD + D
Sbjct  70   LDLMAKKMRETKAQEEMKEAFKVFDKNRD  98



>ref|XP_002520954.1| calmodulin, putative [Ricinus communis]
 gb|EEF41371.1| calmodulin, putative [Ricinus communis]
Length=148

 Score = 63.9 bits (154),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 59/102 (58%), Gaps = 5/102 (5%)
 Frame = +2

Query  302  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  481
            + D ++ D++    AE  +AF LID+D DG I  EEL  ++  +    P++EE+R M+SE
Sbjct  1    MADALTEDQI----AEFHEAFCLIDKDSDGFITMEELATVIQSLDG-HPTKEEIRDMISE  55

Query  482  VDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            VD DG+G I  +EF  +       +   EL++AF  FD + D
Sbjct  56   VDFDGNGTIDFQEFLNIMGRKMKENVVEELKEAFKVFDRNQD  97


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 41/70 (59%), Gaps = 1/70 (1%)
 Frame = +2

Query  335  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  514
             +  EL +AFK+ DR+ DG I   EL  ++  +G E  + EE   M+ E D DGDG +S 
Sbjct  80   NVVEELKEAFKVFDRNQDGFISANELRQVMINLG-ERLTEEEAEQMIREADLDGDGLVSY  138

Query  515  EEFSVLSSAF  544
            EEF+ +  AF
Sbjct  139  EEFARMMMAF  148



>ref|XP_003704227.1| PREDICTED: calmodulin-like [Megachile rotundata]
Length=275

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 53/89 (60%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + PS  EL  M++EVD+DG+G I   EF
Sbjct  136  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELEDMVNEVDQDGNGTIEFNEF  194

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + ELR+AF  FD ++D
Sbjct  195  LQMMSKKMKGADGEKELREAFRVFDKNND  223


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 45/65 (69%), Gaps = 2/65 (3%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            EL +AF++ D+++DG I  +EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  210  ELREAFRVFDKNNDGLISSKELRHVMTNLG-EKLSEEEVDDMIKEADLDGDGMVNYEEFV  268

Query  524  SVLSS  538
            ++L+S
Sbjct  269  TILTS  273



>emb|CDX98375.1| BnaC06g17360D [Brassica napus]
Length=204

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
             +L Q F++ D++ DG+I KEEL   L  +G   P ++ ++ M+ ++D +GDGC+ + EF
Sbjct  55   VDLKQVFQMFDKNGDGRITKEELNDSLENLGIFMPDKDLIQ-MIHKMDANGDGCVDIHEF  113

Query  524  SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              L  +      + ++RDAF+ FD D D
Sbjct  114  ESLYGSIVEEKEEEDMRDAFNVFDQDGD  141



>ref|XP_008368689.1| PREDICTED: calmodulin-like protein 11 [Malus domestica]
 ref|XP_008363651.1| PREDICTED: calmodulin-like protein 11 [Malus domestica]
Length=148

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF LID+D DG I  EEL  ++  +  + P++EE++ M+SE+  DG+G I  EEF
Sbjct  11   AEFQEAFCLIDKDSDGLISLEELATVIQSLD-QRPTKEEIQDMISEIXADGNGTIDFEEF  69

Query  524  SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              + S     +   EL++AF  FD D D
Sbjct  70   LNIMSRKMKENVAEELKEAFKVFDRDQD  97


 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  526
            EL +AFK+ DRD DG I   EL  ++  +G E  + EE   M+ E D DGDG +S EEF+
Sbjct  84   ELKEAFKVFDRDQDGYISASELRQVMINLG-ERLTDEEAEQMIREADLDGDGLVSYEEFA  142



>ref|XP_312402.5| AGAP002536-PA [Anopheles gambiae str. PEST]
 gb|EAA07684.5| AGAP002536-PA [Anopheles gambiae str. PEST]
Length=285

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 67/115 (58%), Gaps = 13/115 (11%)
 Frame = +2

Query  275  STPTSVLPALNDE-ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPS  451
            ++ T++  +LN   IS +++     E  +AF+L D+D+DG I KEEL  ++  +G +   
Sbjct  97   TSGTNISYSLNKRFISKNQMK----EFREAFRLFDKDNDGSITKEELGTVMRSLG-QFAR  151

Query  452  REELRLMLSEVDRDGDGCISLEEF----SVLSSAFAPPSCDS---ELRDAFDFFD  595
             EEL+ ML E+D DGDG +S EEF    S ++   A  S D    ELRDAF  FD
Sbjct  152  VEELQEMLLEIDVDGDGNVSFEEFVDIMSNMTDTVAETSADQEERELRDAFRVFD  206



>ref|XP_002721725.1| PREDICTED: calmodulin-like protein 3 [Oryctolagus cuniculus]
Length=149

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 62/103 (60%), Gaps = 6/103 (6%)
 Frame = +2

Query  302  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  481
            + +E+SP+++    AE  QAF   D++ DG I  EEL A++  +G +  S EEL+ +++ 
Sbjct  1    MAEELSPEQV----AEFKQAFSRFDKNGDGTISVEELGAVMQLLG-KKLSEEELKALITR  55

Query  482  VDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            VD+DGDG IS +EF + +         + +LR+AF  FD + D
Sbjct  56   VDKDGDGAISFQEFLAEMVRMMKAGGSEQDLREAFRAFDLNGD  98


 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +2

Query  350  LVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            L +AF+  D + DG I  EEL+ ++S++G E  S EEL  M+ E D D DG ++ EEF
Sbjct  86   LREAFRAFDLNGDGHISVEELKQVMSKLG-EKLSHEELNAMIQEADTDKDGKVNYEEF  142



>ref|XP_003494757.1| PREDICTED: calmodulin-like isoform 1 [Bombus impatiens]
Length=262

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 54/91 (59%), Gaps = 9/91 (10%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            E  +AF+L D+D DG I KEEL  ++  +G +    EELR ML E+D DGDG +S EEF 
Sbjct  100  EFREAFRLFDKDGDGSITKEELGRVMRSLG-QFARAEELRTMLQEIDIDGDGNVSFEEFV  158

Query  524  ----SVLSSAFAPPSCD---SELRDAFDFFD  595
                ++ +S  AP   D    ELRDAF  FD
Sbjct  159  EIVSNIGASETAPTDQDQEEQELRDAFRVFD  189



>gb|EEC68815.1| hypothetical protein OsI_37379 [Oryza sativa Indica Group]
Length=160

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M+ EVD DG G I  EEF
Sbjct  10   AEFREAFNLFDKDGDGTITSKELGTVMGSLG-QSPTEAELKKMVEEVDADGSGSIEFEEF  68

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              +L+        + ++RDAF  FD D +
Sbjct  69   LGLLARKLRDTGAEDDIRDAFRVFDKDQN  97



>gb|ENN77948.1| hypothetical protein YQE_05625, partial [Dendroctonus ponderosae]
 gb|ERL83954.1| hypothetical protein D910_01249 [Dendroctonus ponderosae]
 gb|ERL84009.1| hypothetical protein D910_01328 [Dendroctonus ponderosae]
Length=152

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + P+  ELR M++EVD+DG+G I   EF
Sbjct  13   AEFKEAFMLFDKDEDGMITMAELGVVMRSLG-QRPTETELRDMVNEVDQDGNGTIEFNEF  71

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + EL++AF  FD ++D
Sbjct  72   LQMMSKKMKDADGEEELKEAFRVFDKNND  100



>ref|XP_011140005.1| PREDICTED: calmodulin-like isoform X3 [Harpegnathos saltator]
Length=281

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 55/91 (60%), Gaps = 9/91 (10%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            E  +AF+L D+D DG I KEEL  ++  +G +    EELR ML E+D DGDG +S EEF 
Sbjct  105  EFREAFRLFDKDGDGTITKEELGRVMRSLG-QFARAEELRTMLQEIDIDGDGNVSFEEFV  163

Query  524  ---SVLSSAFAPPS----CDSELRDAFDFFD  595
               S + ++ A P+     + ELRDAF  FD
Sbjct  164  EIVSNIGASTAAPTDQHQEEQELRDAFRVFD  194



>ref|XP_010920375.1| PREDICTED: probable calcium-binding protein CML10 [Elaeis guineensis]
Length=174

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 52/87 (60%), Gaps = 1/87 (1%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  526
            EL + F+L D + DGKI   EL+  ++++G  P +  EL +M+ E D DGDG ISL EF 
Sbjct  30   ELERVFRLYDTNGDGKISAAELQETMAKLGHHPANDHELEMMMKEADADGDGFISLAEFK  89

Query  527  VLSSAFAPPSCDSELRDAFDFFDTDHD  607
             ++ A      + +L++AF  FD D D
Sbjct  90   DINGA-GEGVEEVDLKEAFAVFDEDRD  115


 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
             +L +AF + D D DGKI  +EL+ +L  +G E  + E+ + M+  VDRDGDG +S +EF
Sbjct  101  VDLKEAFAVFDEDRDGKISAKELQNVLKGLG-EQVTTEQCQEMIRGVDRDGDGMVSFQEF  159

Query  524  SVLSSAFAPPSCDS  565
             V+ +     S  S
Sbjct  160  KVMMTGGGAFSVSS  173



>ref|XP_971297.2| PREDICTED: neo-calmodulin-like isoform X3 [Tribolium castaneum]
Length=246

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + P+  ELR M++EVD+DG+G I   EF
Sbjct  107  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPTETELRDMVNEVDQDGNGTIEFNEF  165

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + EL++AF  FD ++D
Sbjct  166  LQMMSKKLKDADGEEELKEAFRVFDKNND  194


 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 42/65 (65%), Gaps = 1/65 (2%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  526
            EL +AF++ D+++DG I   EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  181  ELKEAFRVFDKNNDGLISSNELRHVMTSLG-ERLSEEEVDDMIKEADLDGDGQVNYEEFV  239

Query  527  VLSSA  541
             + +A
Sbjct  240  NILTA  244



>gb|EEE52718.1| hypothetical protein OsJ_35129 [Oryza sativa Japonica Group]
Length=160

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M+ EVD DG G I  EEF
Sbjct  10   AEFREAFNLFDKDGDGTITSKELGTVMGSLG-QSPTEAELKKMVEEVDADGSGSIEFEEF  68

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              +L+        + ++RDAF  FD D +
Sbjct  69   LGLLARKLRDTGAEDDIRDAFRVFDKDQN  97



>ref|XP_009104207.1| PREDICTED: calmodulin-like protein 4 [Brassica rapa]
Length=203

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
             +L Q F++ D++ DG+I KEEL   L  +G   P ++ ++ M+ ++D +GDGC+ + EF
Sbjct  55   VDLKQVFQMFDKNGDGRITKEELNDSLENLGIFMPDKDLIQ-MIHKMDANGDGCVDIHEF  113

Query  524  SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              L  +      + ++RDAF+ FD D D
Sbjct  114  ESLYGSIVVEKEEEDMRDAFNVFDQDGD  141



>ref|XP_003393814.1| PREDICTED: calmodulin-like [Bombus terrestris]
Length=277

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 54/91 (59%), Gaps = 9/91 (10%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            E  +AF+L D+D DG I KEEL  ++  +G +    EELR ML E+D DGDG +S EEF 
Sbjct  115  EFREAFRLFDKDGDGSITKEELGRVMRSLG-QFARAEELRTMLQEIDIDGDGNVSFEEFV  173

Query  524  ----SVLSSAFAPPSCD---SELRDAFDFFD  595
                ++ +S  AP   D    ELRDAF  FD
Sbjct  174  EIVSNIGASETAPTDQDQEEQELRDAFRVFD  204



>emb|CDX67796.1| BnaA07g18360D [Brassica napus]
Length=203

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
             +L Q F++ D++ DG+I KEEL   L  +G   P ++ ++ M+ ++D +GDGC+ + EF
Sbjct  55   VDLKQVFQMFDKNGDGRITKEELNDSLENLGIFMPDKDLIQ-MIHKMDANGDGCVDIHEF  113

Query  524  SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              L  +      + ++RDAF+ FD D D
Sbjct  114  ESLYGSIVEEKEEEDMRDAFNVFDQDGD  141



>ref|XP_002970730.1| hypothetical protein SELMODRAFT_94292 [Selaginella moellendorffii]
 gb|EFJ28056.1| hypothetical protein SELMODRAFT_94292 [Selaginella moellendorffii]
Length=160

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 52/90 (58%), Gaps = 4/90 (4%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  526
            EL  AF+  D + DGKI   EL  +L  +G E PS E+LR M+ EVD DGDG +  +EF 
Sbjct  12   ELEHAFRYFDANGDGKISVAELGGVLKSLG-ENPSEEDLRTMVREVDADGDGFVDFDEFV  70

Query  527  VLSSAF---APPSCDSELRDAFDFFDTDHD  607
             L++     A  +   EL+ AF  FDTD +
Sbjct  71   HLNTEILGDALAASVEELKAAFYVFDTDKN  100


 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 49/88 (56%), Gaps = 2/88 (2%)
 Frame = +2

Query  302  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  481
            LN EI  D L+    EL  AF + D D +G I  EEL  ++  +G +  + E+   M+  
Sbjct  72   LNTEILGDALAASVEELKAAFYVFDTDKNGYISAEELYKVMFNLGEKGVTMEDCNRMIGG  131

Query  482  VDRDGDGCISLEEFS--VLSSAFAPPSC  559
            VD DGDG ++ EEF   +LSS+ A PS 
Sbjct  132  VDSDGDGFVNFEEFQRMMLSSSNASPST  159



>gb|ERG81872.1| calmodulin-2 [Ascaris suum]
Length=163

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 61/106 (58%), Gaps = 7/106 (7%)
 Frame = +2

Query  296  PALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLML  475
             A  ++I  D L+    E+ +AF + DRD DG+I  +EL A++  +G E PS  ELR M+
Sbjct  7    SATFEQIESDRLT----EIREAFSVFDRDGDGRITVDELGAVMDSLG-EHPSESELRRMI  61

Query  476  SEVDRDGDGCISLEEFSVLSS--AFAPPSCDSELRDAFDFFDTDHD  607
            SE D DG+G I ++EF  L +  A    + + ELR  F  FD D D
Sbjct  62   SEFDEDGNGTIEMDEFLRLMARKARKTEAEEYELRRVFREFDKDSD  107



>emb|CDJ96123.1| EF hand domain containing protein [Haemonchus contortus]
Length=146

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 52/89 (58%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            +EL   FK  D++ DGKI +EELE  L Q+G E PS   +  ++S+ D DG+GCI ++EF
Sbjct  7    SELRDLFKEFDKNGDGKITREELEMALIQLG-ELPSSSRIEAIISQTDIDGNGCIEIDEF  65

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
               L      P  + ELR+ F  FD + D
Sbjct  66   LEALRKTLLNPREERELREVFGVFDKNGD  94



>ref|XP_009392676.1| PREDICTED: probable calcium-binding protein CML10 [Musa acuminata 
subsp. malaccensis]
Length=183

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 50/86 (58%), Gaps = 2/86 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
             +L + F   D + DGKI   EL A+L  +  +PPS EEL  M+ E D DGDG IS  EF
Sbjct  36   GDLERVFNKFDANGDGKISSAELAAVLEILSGQPPSEEELGRMMREADVDGDGFISFAEF  95

Query  524  SVLSSAFAPPSCDSELRDAFDFFDTD  601
              L++  AP + + +LR AF  FD D
Sbjct  96   VDLNT--APAALEEDLRLAFAVFDLD  119


 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 39/70 (56%), Gaps = 1/70 (1%)
 Frame = +2

Query  332  SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCIS  511
            + L  +L  AF + D D  G I  +EL  +L  +G E  S  + R M+  VDRDGDG +S
Sbjct  103  AALEEDLRLAFAVFDLDRSGSISADELAHILGGIG-EGASLAQCRRMIDGVDRDGDGLVS  161

Query  512  LEEFSVLSSA  541
             EEF  + +A
Sbjct  162  FEEFKAMMTA  171



>ref|XP_011140004.1| PREDICTED: calmodulin-like isoform X2 [Harpegnathos saltator]
Length=296

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 55/91 (60%), Gaps = 9/91 (10%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            E  +AF+L D+D DG I KEEL  ++  +G +    EELR ML E+D DGDG +S EEF 
Sbjct  134  EFREAFRLFDKDGDGTITKEELGRVMRSLG-QFARAEELRTMLQEIDIDGDGNVSFEEFV  192

Query  524  ---SVLSSAFAPPS----CDSELRDAFDFFD  595
               S + ++ A P+     + ELRDAF  FD
Sbjct  193  EIVSNIGASTAAPTDQHQEEQELRDAFRVFD  223



>ref|XP_003494758.1| PREDICTED: calmodulin-like isoform 2 [Bombus impatiens]
Length=277

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 54/91 (59%), Gaps = 9/91 (10%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            E  +AF+L D+D DG I KEEL  ++  +G +    EELR ML E+D DGDG +S EEF 
Sbjct  115  EFREAFRLFDKDGDGSITKEELGRVMRSLG-QFARAEELRTMLQEIDIDGDGNVSFEEFV  173

Query  524  ----SVLSSAFAPPSCD---SELRDAFDFFD  595
                ++ +S  AP   D    ELRDAF  FD
Sbjct  174  EIVSNIGASETAPTDQDQEEQELRDAFRVFD  204



>ref|XP_003554273.1| PREDICTED: calmodulin-3-like [Glycine max]
 gb|KHN02547.1| Calmodulin [Glycine soja]
Length=148

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 52/88 (59%), Gaps = 1/88 (1%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF LID+D DG I  +EL  ++  +    P++EE++ M+SEVD DG+G I  EEF
Sbjct  11   AEFHEAFSLIDKDSDGFITVDELTTIIRSLEG-NPTKEEIQNMISEVDIDGNGSIDFEEF  69

Query  524  SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              +       +   EL++AF  FD D +
Sbjct  70   LNIMGRKMKETLAEELKEAFKVFDRDQN  97


 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (62%), Gaps = 1/63 (2%)
 Frame = +2

Query  338  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  517
            L  EL +AFK+ DRD +G I   EL  +++ +G E  + EE   M+ E D DGDG +S E
Sbjct  81   LAEELKEAFKVFDRDQNGYISATELRHVMTNLG-ERLTGEEAEQMIMEADLDGDGQVSFE  139

Query  518  EFS  526
            EF+
Sbjct  140  EFA  142



>ref|XP_001652329.1| AAEL006921-PA [Aedes aegypti]
 gb|EAT41444.1| AAEL006921-PA [Aedes aegypti]
Length=288

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 54/90 (60%), Gaps = 8/90 (9%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            E  +AF+L D+D+DG I KEEL  ++  +G +    EEL+ ML E+D DGDG +S EEF 
Sbjct  121  EFREAFRLFDKDNDGSITKEELGTVMRSLG-QFARVEELQEMLLEIDVDGDGNVSFEEFV  179

Query  524  ---SVLSSAFAPPSCDS---ELRDAFDFFD  595
               S ++   A  S D    ELRDAF  FD
Sbjct  180  DIMSNMTDTVAETSADQEERELRDAFRVFD  209



>gb|AHY86314.1| Y-GECO1 [synthetic construct]
Length=421

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 52/87 (60%), Gaps = 2/87 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D DG +  EEL  +L  +G + PS  ELR M++EVD DGDG I   EF
Sbjct  283  AEFKEAFSLFDKDGDGTMTTEELGTVLRSLG-QNPSEAELRDMINEVDADGDGTIGFPEF  341

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTD  601
             ++++        + E+R+AF  FD D
Sbjct  342  LTMMTRKMNDTDSEEEIREAFRVFDKD  368



>ref|XP_504759.1| YALI0E34111p [Yarrowia lipolytica]
 emb|CAG80365.1| YALI0E34111p [Yarrowia lipolytica CLIB122]
Length=152

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 63/103 (61%), Gaps = 6/103 (6%)
 Frame = +2

Query  302  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  481
            ++D+++ D++    AE  +AF L D+++DGKI  +EL  ++  +G + PS  EL  M++E
Sbjct  1    MSDQLTEDQV----AEFREAFSLFDKNNDGKITTKELGTVMRSLG-QNPSESELADMINE  55

Query  482  VDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            VD + DG I   EF ++++        + E+R+AF  FD D++
Sbjct  56   VDANNDGTIDFAEFLTMMARKMKDTDSEEEIREAFKVFDRDNN  98



>gb|AHY86315.1| Y-GECO1f [synthetic construct]
Length=420

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 52/87 (60%), Gaps = 2/87 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D DG +  EEL  +L  +G + PS  ELR M++EVD DGDG I   EF
Sbjct  282  AEFKEAFSLFDKDGDGTMTTEELGTVLRSLG-QNPSEAELRDMINEVDADGDGTIGFPEF  340

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTD  601
             ++++        + E+R+AF  FD D
Sbjct  341  LTMMTRKMNDTDSEEEIREAFRVFDKD  367



>emb|CEL63589.1| Calmodulin OS=Agaricus bisporus PE=1 SV=2 [Rhizoctonia solani 
AG-1 IB]
Length=147

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 55/100 (55%), Gaps = 5/100 (5%)
 Frame = +2

Query  302  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  481
            +N ++S +ELS        AF L D+D  G I  +EL +++  +G + PSREEL  +++E
Sbjct  1    MNTQLSDEELSAYR----DAFSLFDKDSSGTISVDELGSIMRSLG-QQPSREELYRIMNE  55

Query  482  VDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTD  601
            VD D  G I   EF  + S     + D EL +AF  FD D
Sbjct  56   VDLDHSGTIDFNEFLTMMSKMGGNTIDEELDEAFKVFDRD  95


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            EL +AFK+ DRD  G+I +EEL+A+++ +G E  +  E+  M+ E D +GDG I  +EF
Sbjct  84   ELDEAFKVFDRDGSGQISEEELKAVMNSLG-ERLTDAEVHAMMLEADTNGDGQIDYKEF  141



>ref|XP_008197240.1| PREDICTED: neo-calmodulin-like isoform X2 [Tribolium castaneum]
Length=260

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + P+  ELR M++EVD+DG+G I   EF
Sbjct  121  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPTETELRDMVNEVDQDGNGTIEFNEF  179

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + EL++AF  FD ++D
Sbjct  180  LQMMSKKLKDADGEEELKEAFRVFDKNND  208



>ref|XP_009048149.1| hypothetical protein LOTGIDRAFT_148903 [Lottia gigantea]
 ref|XP_009056062.1| hypothetical protein LOTGIDRAFT_190032 [Lottia gigantea]
 gb|ESO93368.1| hypothetical protein LOTGIDRAFT_190032 [Lottia gigantea]
 gb|ESP01164.1| hypothetical protein LOTGIDRAFT_148903 [Lottia gigantea]
Length=150

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 53/87 (61%), Gaps = 2/87 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD DG+G I   EF
Sbjct  11   AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVDADGNGTIDFPEF  69

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTD  601
             +++SS       D E+R+AF  FD D
Sbjct  70   LTMMSSKVKDGDNDEEIREAFRVFDKD  96



>ref|XP_008197239.1| PREDICTED: neo-calmodulin-like isoform X1 [Tribolium castaneum]
Length=262

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D+DG I   EL  ++  +G + P+  ELR M++EVD+DG+G I   EF
Sbjct  123  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPTETELRDMVNEVDQDGNGTIEFNEF  181

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S        + EL++AF  FD ++D
Sbjct  182  LQMMSKKLKDADGEEELKEAFRVFDKNND  210


 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 42/65 (65%), Gaps = 1/65 (2%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  526
            EL +AF++ D+++DG I   EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct  197  ELKEAFRVFDKNNDGLISSNELRHVMTSLG-ERLSEEEVDDMIKEADLDGDGQVNYEEFV  255

Query  527  VLSSA  541
             + +A
Sbjct  256  NILTA  260



>ref|XP_004867158.1| PREDICTED: calmodulin isoform X3 [Heterocephalus glaber]
Length=158

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 64/109 (59%), Gaps = 7/109 (6%)
 Frame = +2

Query  281  PTSVLPALN-DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  457
              S+LPA   D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  
Sbjct  2    TNSLLPAFQADQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEA  56

Query  458  ELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTD  601
            EL+ M++EVD DG+G I   EF ++++        + E+R+AF  FD D
Sbjct  57   ELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKD  105



>ref|XP_001625680.1| predicted protein [Nematostella vectensis]
 gb|EDO33580.1| predicted protein [Nematostella vectensis]
Length=153

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 50/89 (56%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D DG +   EL  ++  +G + P+ EE+R M+ EVD DG G I  EEF
Sbjct  11   AEYKEAFSLFDKDGDGTVTTAELGTVMRNLG-QNPTDEEIREMIKEVDEDGSGSIGFEEF  69

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              ++S      S + EL  AF  FD D +
Sbjct  70   LQLMSKKTKGKSYEDELMAAFQIFDKDGN  98


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            EL+ AF++ D+D +G I   EL+ +L  +G E  S +E+  M+ E D DGDG +++EEF
Sbjct  85   ELMAAFQIFDKDGNGSITVTELKEVLDSLG-EKLSEDEVGEMIKEADSDGDGTVNIEEF  142



>ref|XP_002969393.1| hypothetical protein SELMODRAFT_91501 [Selaginella moellendorffii]
 gb|EFJ29481.1| hypothetical protein SELMODRAFT_91501 [Selaginella moellendorffii]
Length=162

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 51/88 (58%), Gaps = 4/88 (5%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  526
            EL  AF+  D + DGKI   EL  +L  +G E PS E+LR M+ EVD DGDG +  +EF 
Sbjct  12   ELEHAFRYFDANGDGKISVAELGGVLKSLG-ENPSEEDLRTMVREVDADGDGFVDFDEFV  70

Query  527  VLSSAF---APPSCDSELRDAFDFFDTD  601
             L++     A  +   EL+ AF  FDTD
Sbjct  71   HLNTEILGDALAASVEELKAAFYVFDTD  98


 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 41/75 (55%), Gaps = 0/75 (0%)
 Frame = +2

Query  302  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  481
            LN EI  D L+    EL  AF + D D +G I  EEL  ++  +G +  + E+   M+  
Sbjct  72   LNTEILGDALAASVEELKAAFYVFDTDKNGYISAEELYKVMFNLGEKGVTMEDCNRMIGG  131

Query  482  VDRDGDGCISLEEFS  526
            VD DGDG ++ EEF 
Sbjct  132  VDSDGDGFVNFEEFQ  146



>ref|XP_007298032.1| EF-hand, partial [Stereum hirsutum FP-91666 SS1]
 gb|EIM92830.1| EF-hand, partial [Stereum hirsutum FP-91666 SS1]
Length=177

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 51/87 (59%), Gaps = 2/87 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
             EL +AF L D+D DG I   EL  ++  +G + P+  ELR M+SEVD DG+G +   EF
Sbjct  1    TELKEAFSLFDKDGDGTINSHELGTVMRSLG-QNPTDAELRDMISEVDADGNGTVDFPEF  59

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTD  601
             ++++        D ELR AF+ FD D
Sbjct  60   LTMMARKMGEKDVDEELRAAFEVFDKD  86



>ref|XP_011140003.1| PREDICTED: calmodulin-like protein 11 isoform X1 [Harpegnathos 
saltator]
Length=310

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 55/91 (60%), Gaps = 9/91 (10%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            E  +AF+L D+D DG I KEEL  ++  +G +    EELR ML E+D DGDG +S EEF 
Sbjct  134  EFREAFRLFDKDGDGTITKEELGRVMRSLG-QFARAEELRTMLQEIDIDGDGNVSFEEFV  192

Query  524  ---SVLSSAFAPPS----CDSELRDAFDFFD  595
               S + ++ A P+     + ELRDAF  FD
Sbjct  193  EIVSNIGASTAAPTDQHQEEQELRDAFRVFD  223



>gb|EFA05282.1| hypothetical protein TcasGA2_TC015439 [Tribolium castaneum]
Length=289

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 65/118 (55%), Gaps = 15/118 (13%)
 Frame = +2

Query  272  ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPS  451
            E+ P + L A + E+S  ++     E  +AF+L D+D DG I KEEL  ++  +G +   
Sbjct  106  ETKPPTRLSARHSEVSKSQMK----EFREAFRLFDKDGDGSITKEELGRVMRSLG-QFAR  160

Query  452  REELRLMLSEVDRDGDGCISLEEF-SVLSSAFA---PPSC------DSELRDAFDFFD  595
             EEL+ ML EVD DGDG +S EEF  +  SA A   P         + ELRDAF  FD
Sbjct  161  TEELQQMLQEVDVDGDGNVSFEEFVDIAWSAGAGGDPEHVLSREEEEKELRDAFRVFD  218



>ref|XP_006568278.1| PREDICTED: probable calcium-binding protein CML11-like isoform 
X4 [Apis mellifera]
 ref|XP_006568279.1| PREDICTED: probable calcium-binding protein CML11-like isoform 
X5 [Apis mellifera]
Length=268

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 54/91 (59%), Gaps = 9/91 (10%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  523
            E  +AF+L D+D DG I KEEL  ++  +G +    EELR ML E+D DGDG +S EEF 
Sbjct  106  EFREAFRLFDKDGDGSITKEELGRVMRSLG-QFARAEELRTMLQEIDIDGDGNVSFEEFV  164

Query  524  ----SVLSSAFAPPSCD---SELRDAFDFFD  595
                ++ ++  AP   D    ELRDAF  FD
Sbjct  165  EIVSNIGANETAPTDQDQEEQELRDAFRVFD  195



>gb|KDQ10734.1| hypothetical protein BOTBODRAFT_190368 [Botryobasidium botryosum 
FD-172 SS1]
Length=148

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 47/84 (56%), Gaps = 2/84 (2%)
 Frame = +2

Query  359  AFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSS  538
            AF L D+D DG I KEEL  +L  +G +  +  EL+ M  EVD DG+G I  EEF  + +
Sbjct  17   AFALFDKDGDGTITKEELGTVLESLG-QKRTPAELKKMFEEVDTDGNGTIDFEEFVTMMA  75

Query  539  AFAPPSC-DSELRDAFDFFDTDHD  607
                 S  D E+ DAF  FD D D
Sbjct  76   GHVDDSTFDQEVEDAFKLFDKDGD  99



>ref|XP_006430624.1| hypothetical protein CICLE_v10013012mg [Citrus clementina]
 gb|ESR43864.1| hypothetical protein CICLE_v10013012mg [Citrus clementina]
 gb|KDO63083.1| hypothetical protein CISIN_1g031791mg [Citrus sinensis]
Length=153

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 53/91 (58%), Gaps = 1/91 (1%)
 Frame = +2

Query  335  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL  514
            G   E+ + F   D++ DGKI  +EL+ +L  +G++  S EE++ ++ E+D DGDG I  
Sbjct  13   GSMDEVRKVFNKFDKNGDGKISADELKDVLRSLGSKT-SPEEVKRVMDEIDTDGDGYIDF  71

Query  515  EEFSVLSSAFAPPSCDSELRDAFDFFDTDHD  607
            +EFS    A        EL+DAFD +D D +
Sbjct  72   KEFSTFHLAGGSTDGTKELKDAFDLYDMDQN  102



>emb|CBX24386.1| hypothetical_protein [Oryza glaberrima]
Length=220

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M+ EVD DG G I  EEF
Sbjct  10   AEFREAFNLFDKDGDGTITSKELGTVMGSLG-QSPTEAELKKMVEEVDADGSGSIEFEEF  68

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              +L+        + ++RDAF  FD D +
Sbjct  69   LGLLARKLRDTGAEDDIRDAFRVFDKDQN  97



>ref|NP_001066080.1| Os12g0132300 [Oryza sativa Japonica Group]
 sp|Q0IQB6.1|CML3_ORYSJ RecName: Full=Calmodulin-like protein 3; Flags: Precursor [Oryza 
sativa Japonica Group]
 gb|ABG21867.1| Calmodulin, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF29099.1| Os12g0132300 [Oryza sativa Japonica Group]
 dbj|BAG99440.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99824.1| unnamed protein product [Oryza sativa Japonica Group]
Length=183

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M+ EVD DG G I  EEF
Sbjct  10   AEFREAFNLFDKDGDGTITSKELGTVMGSLG-QSPTEAELKKMVEEVDADGSGSIEFEEF  68

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              +L+        + ++RDAF  FD D +
Sbjct  69   LGLLARKLRDTGAEDDIRDAFRVFDKDQN  97



>ref|XP_010043960.1| PREDICTED: probable calcium-binding protein CML25 [Eucalyptus 
grandis]
 gb|KCW85969.1| hypothetical protein EUGRSUZ_B02672 [Eucalyptus grandis]
Length=194

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 52/88 (59%), Gaps = 2/88 (2%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  526
            EL Q F+  D + DGKI   EL +++S +G  P + EEL  M+ EVD DGDG I  +EF 
Sbjct  43   ELEQVFRKFDANGDGKISASELGSIMSSLG-HPETEEELAKMVREVDSDGDGFIDFDEFV  101

Query  527  VLSSAFAPPSCDSE-LRDAFDFFDTDHD  607
             L++    P+   E LRDAF  +D D D
Sbjct  102  ELNTKGVDPAEAMENLRDAFSVYDIDGD  129


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 35/61 (57%), Gaps = 1/61 (2%)
 Frame = +2

Query  350  LVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSV  529
            L  AF + D D DG I  EEL  ++  +G E  S  E R M+  VD DGDG IS EEF V
Sbjct  117  LRDAFSVYDIDGDGSITAEELHKVMRSLG-EENSLAECRKMIGGVDSDGDGMISFEEFKV  175

Query  530  L  532
            +
Sbjct  176  M  176



>ref|XP_002734090.1| PREDICTED: calmodulin-like [Saccoglossus kowalevskii]
Length=149

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 61/103 (59%), Gaps = 6/103 (6%)
 Frame = +2

Query  302  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  481
            + +E+S ++L     E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++E
Sbjct  1    MAEEVSEEQLK----EFREAFALFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINE  55

Query  482  VDRDGDGCISLEEFSV-LSSAFAPPSCDSELRDAFDFFDTDHD  607
            VD DG+G I  +EF+V ++        + ELR+AF  FD + D
Sbjct  56   VDADGNGTIDFQEFNVMMAKKMKETDQEEELREAFRVFDKNGD  98


 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 41/65 (63%), Gaps = 1/65 (2%)
 Frame = +2

Query  347  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  526
            EL +AF++ D++ DG I  EEL  ++  +G E  + +E+  M+ E D DGDG ++ EEF 
Sbjct  85   ELREAFRVFDKNGDGFISAEELRHVMKNLG-EKLTDDEIEEMIREADVDGDGQVNYEEFV  143

Query  527  VLSSA  541
             + S+
Sbjct  144  TMMSS  148



>ref|XP_007208587.1| hypothetical protein PRUPE_ppa023004mg [Prunus persica]
 gb|EMJ09786.1| hypothetical protein PRUPE_ppa023004mg [Prunus persica]
Length=149

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 52/89 (58%), Gaps = 2/89 (2%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AE  +AF L+D D DG I  EEL   L  +  + P+ EEL+ M+SE+D DG+G I   EF
Sbjct  11   AEFQEAFCLLDMDGDGCITIEELGTALKSLD-QHPTEEELQNMISEIDADGNGTIEFGEF  69

Query  524  -SVLSSAFAPPSCDSELRDAFDFFDTDHD  607
              +++        D+ELR+AF  FD D D
Sbjct  70   LHLMARKIQENEVDAELREAFKVFDKDQD  98


 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +2

Query  344  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  523
            AEL +AFK+ D+D DG I   EL  ++  +G E  + EE+  M+ E D DGDG ++ +EF
Sbjct  84   AELREAFKVFDKDQDGYISPNELRHVMINLG-ERLTDEEVEQMIREADLDGDGLVNYDEF  142

Query  524  SVLSSAF  544
              +  AF
Sbjct  143  VRMMLAF  149



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 815770585800