BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF040J22

Length=600
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACN40426.1|  unknown                                                 303   2e-99   Picea sitchensis
gb|ACU18775.1|  unknown                                                 298   2e-99   Glycine max [soybeans]
emb|CBI29424.3|  unnamed protein product                                301   4e-99   Vitis vinifera
ref|XP_002263822.2|  PREDICTED: tubulin alpha chain                     301   5e-99   
gb|AAN33000.1|  alpha-tubulin 4                                         300   1e-98   Gossypium hirsutum [American cotton]
ref|XP_008236253.1|  PREDICTED: tubulin alpha chain isoform X2          304   2e-98   
gb|ABE66388.1|  alpha-tubulin                                           296   2e-98   Striga asiatica [witchweed]
ref|XP_009124557.1|  PREDICTED: tubulin alpha-6 chain-like isofor...    303   3e-98   Brassica rapa
gb|KDO78780.1|  hypothetical protein CISIN_1g037616mg                   301   4e-98   Citrus sinensis [apfelsine]
ref|XP_008440460.1|  PREDICTED: tubulin alpha chain-like isoform X2     303   4e-98   
ref|XP_010466127.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    302   5e-98   
ref|XP_006433709.1|  hypothetical protein CICLE_v100015521mg            293   6e-98   
tpg|DAA51110.1|  TPA: alpha-tubulin                                     296   6e-98   
emb|CBI25125.3|  unnamed protein product                                301   6e-98   Vitis vinifera
ref|XP_006486879.1|  PREDICTED: tubulin alpha chain-like isoform X2     303   7e-98   
emb|CBI19330.3|  unnamed protein product                                301   7e-98   Vitis vinifera
ref|XP_006578253.1|  PREDICTED: tubulin alpha-4 chain isoform X2        302   8e-98   
ref|XP_006466395.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    303   1e-97   
ref|XP_009107245.1|  PREDICTED: tubulin alpha-2 chain isoform X2        303   1e-97   Brassica rapa
gb|AHJ80818.1|  Tua1                                                    297   1e-97   Eragrostis tef [tef]
gb|EYU34086.1|  hypothetical protein MIMGU_mgv1a0196711mg               293   1e-97   Erythranthe guttata [common monkey flower]
emb|CDY66630.1|  BnaCnng51680D                                          302   1e-97   Brassica napus [oilseed rape]
emb|CDY25017.1|  BnaC02g39910D                                          301   1e-97   Brassica napus [oilseed rape]
ref|XP_010531322.1|  PREDICTED: tubulin alpha-4 chain isoform X2        302   1e-97   Tarenaya hassleriana [spider flower]
emb|CBI22190.3|  unnamed protein product                                300   2e-97   Vitis vinifera
ref|WP_039310890.1|  hypothetical protein                               302   2e-97   
gb|AGG37285.1|  alpha-tubulin 3                                         302   2e-97   Salix arbutifolia
ref|XP_002313194.1|  hypothetical protein POPTR_0009s08850g             302   2e-97   Populus trichocarpa [western balsam poplar]
gb|ABK92552.1|  unknown                                                 302   2e-97   Populus trichocarpa [western balsam poplar]
ref|XP_011030289.1|  PREDICTED: tubulin alpha-4 chain                   302   2e-97   Populus euphratica
gb|AGG37287.1|  alpha-tubulin 5                                         302   2e-97   Salix arbutifolia
ref|XP_007042689.1|  Tubulin alpha-2 chain                              302   2e-97   Theobroma cacao [chocolate]
gb|ABX57816.1|  alpha tubulin                                           302   2e-97   Picea wilsonii
ref|XP_006422747.1|  hypothetical protein CICLE_v10028426mg             301   2e-97   Citrus clementina [clementine]
gb|KDP44552.1|  hypothetical protein JCGZ_16385                         301   2e-97   Jatropha curcas
gb|ACJ60905.1|  alpha tubulin                                           301   2e-97   Betula pendula [white birch]
ref|XP_007199840.1|  hypothetical protein PRUPE_ppa005633mg             301   2e-97   Prunus persica
ref|NP_849388.1|  tubulin alpha-6 chain                                 301   2e-97   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010065856.1|  PREDICTED: tubulin alpha chain                     301   2e-97   Eucalyptus grandis [rose gum]
ref|XP_002510010.1|  tubulin alpha chain, putative                      301   3e-97   Ricinus communis
ref|XP_009335355.1|  PREDICTED: tubulin alpha chain-like                301   3e-97   Pyrus x bretschneideri [bai li]
gb|AAV92352.1|  alpha tubulin 1                                         301   3e-97   Pseudotsuga menziesii var. menziesii
ref|XP_002522104.1|  tubulin alpha chain, putative                      301   3e-97   Ricinus communis
ref|XP_007018369.1|  Tubulin alpha-2 chain                              301   3e-97   Theobroma cacao [chocolate]
ref|XP_008236966.1|  PREDICTED: tubulin alpha chain-like isoform X2     301   3e-97   
ref|XP_004288297.1|  PREDICTED: tubulin alpha-3 chain                   301   3e-97   Fragaria vesca subsp. vesca
emb|CDY29334.1|  BnaA05g16010D                                          301   3e-97   Brassica napus [oilseed rape]
gb|KJB58757.1|  hypothetical protein B456_009G224800                    300   3e-97   Gossypium raimondii
ref|NP_171974.1|  tubulin alpha-4 chain                                 301   3e-97   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010531321.1|  PREDICTED: tubulin alpha chain isoform X1          301   3e-97   Tarenaya hassleriana [spider flower]
ref|XP_006404742.1|  hypothetical protein EUTSA_v10000161mg             301   3e-97   Eutrema salsugineum [saltwater cress]
ref|XP_006307493.1|  hypothetical protein CARUB_v10009117mg             301   4e-97   Capsella rubella
gb|AID52921.1|  tubulin alpha chain                                     301   4e-97   Carthamus tinctorius
ref|XP_010555432.1|  PREDICTED: tubulin alpha chain-like                301   4e-97   Tarenaya hassleriana [spider flower]
dbj|BAE99023.1|  tubulin alpha-2/alpha-4 chain                          301   4e-97   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011457777.1|  PREDICTED: tubulin alpha chain                     301   4e-97   Fragaria vesca subsp. vesca
ref|XP_009335354.1|  PREDICTED: tubulin alpha chain                     301   4e-97   Pyrus x bretschneideri [bai li]
ref|XP_009407690.1|  PREDICTED: tubulin alpha chain-like                301   4e-97   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010526692.1|  PREDICTED: tubulin alpha chain-like                301   4e-97   Tarenaya hassleriana [spider flower]
ref|XP_010093625.1|  Tubulin alpha chain                                301   4e-97   Morus notabilis
ref|XP_008372962.1|  PREDICTED: tubulin alpha chain isoform X2          301   4e-97   
ref|XP_004143417.1|  PREDICTED: tubulin alpha chain-like                301   4e-97   Cucumis sativus [cucumbers]
gb|ABO47736.1|  alpha-tubulin                                           301   4e-97   Gossypium hirsutum [American cotton]
ref|XP_010943272.1|  PREDICTED: tubulin alpha chain-like                301   4e-97   Elaeis guineensis
ref|XP_006581475.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    301   5e-97   
ref|XP_009124556.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    301   5e-97   Brassica rapa
gb|AGG37283.1|  alpha-tubulin 1                                         301   5e-97   Salix arbutifolia
gb|KHG18997.1|  Tubulin alpha chain                                     301   5e-97   Gossypium arboreum [tree cotton]
ref|XP_006426173.1|  hypothetical protein CICLE_v10025588mg             301   5e-97   Citrus clementina [clementine]
ref|XP_006466394.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    301   5e-97   Citrus sinensis [apfelsine]
ref|XP_008440459.1|  PREDICTED: tubulin alpha chain-like isoform X1     301   5e-97   Cucumis melo [Oriental melon]
ref|XP_010507910.1|  PREDICTED: tubulin alpha-2 chain-like              301   5e-97   Camelina sativa [gold-of-pleasure]
dbj|BAP59012.1|  alpha tubulin                                          301   5e-97   Taxus cuspidata [ichii]
gb|AAO73546.1|  alpha-tubulin                                           301   6e-97   Ceratopteris richardii
ref|XP_007047652.1|  Tubulin alpha-2 chain                              302   7e-97   
gb|ABQ59634.1|  alpha-tubulin 5                                         300   7e-97   Populus tremuloides
gb|ABO47740.1|  alpha-tubulin                                           300   7e-97   Gossypium hirsutum [American cotton]
ref|XP_010500556.1|  PREDICTED: tubulin alpha-2 chain isoform X2        301   7e-97   
gb|AAX21196.1|  putative alpha-tubulin                                  292   7e-97   Solanum betaceum [tamarillo]
gb|AIX10966.1|  tubulin                                                 300   8e-97   Ornithogalum longebracteatum [sea-onion]
gb|KDP32140.1|  hypothetical protein JCGZ_12601                         300   9e-97   Jatropha curcas
ref|XP_011002356.1|  PREDICTED: tubulin alpha chain-like                300   9e-97   Populus euphratica
gb|ACU24494.1|  unknown                                                 290   9e-97   Glycine max [soybeans]
ref|XP_002981542.1|  hypothetical protein SELMODRAFT_178975             300   1e-96   Selaginella moellendorffii
gb|ABO47739.1|  alpha-tubulin                                           300   1e-96   Gossypium hirsutum [American cotton]
ref|XP_002298794.2|  TUBULIN ALPHA CHAIN family protein                 300   1e-96   Populus trichocarpa [western balsam poplar]
gb|ABK92520.1|  unknown                                                 300   1e-96   Populus trichocarpa [western balsam poplar]
sp|Q6VAG0.1|TBA2_GOSHI  RecName: Full=Tubulin alpha-2 chain; AltN...    300   1e-96   Gossypium hirsutum [American cotton]
ref|XP_011088040.1|  PREDICTED: tubulin alpha chain                     300   1e-96   Sesamum indicum [beniseed]
gb|EYU37544.1|  hypothetical protein MIMGU_mgv1a007145mg                299   1e-96   Erythranthe guttata [common monkey flower]
ref|XP_010664458.1|  PREDICTED: tubulin alpha-4 chain                   300   1e-96   Vitis vinifera
ref|XP_009402887.1|  PREDICTED: tubulin alpha chain                     300   1e-96   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010557536.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    300   1e-96   
ref|XP_010557535.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    300   1e-96   Tarenaya hassleriana [spider flower]
sp|P33629.1|TBA_PRUDU  RecName: Full=Tubulin alpha chain                300   1e-96   Prunus dulcis [sweet almond]
ref|XP_010266793.1|  PREDICTED: tubulin alpha chain                     300   1e-96   Nelumbo nucifera [Indian lotus]
gb|KFK32793.1|  hypothetical protein AALP_AA6G289100                    300   1e-96   Arabis alpina [alpine rockcress]
ref|XP_004136930.1|  PREDICTED: tubulin alpha-4 chain-like              300   1e-96   Cucumis sativus [cucumbers]
ref|XP_006601463.1|  PREDICTED: tubulin alpha-3 chain-like              299   1e-96   
sp|Q6VAF9.1|TBA4_GOSHI  RecName: Full=Tubulin alpha-4 chain; AltN...    300   1e-96   Gossypium hirsutum [American cotton]
gb|ABQ59633.1|  alpha-tubulin 3                                         300   2e-96   Populus tremuloides
emb|CAD13176.1|  alpha-tubulin                                          300   2e-96   Nicotiana tabacum [American tobacco]
gb|ADW66593.1|  alpha tubulin                                           296   2e-96   Hirschfeldia incana [buchanweed]
ref|XP_010104543.1|  Tubulin alpha chain                                300   2e-96   
gb|ABB02631.1|  unknown                                                 300   2e-96   Solanum tuberosum [potatoes]
ref|XP_009790136.1|  PREDICTED: tubulin alpha chain                     300   2e-96   Nicotiana sylvestris
gb|ABO47737.1|  alpha-tubulin                                           300   2e-96   Gossypium hirsutum [American cotton]
ref|XP_009620798.1|  PREDICTED: tubulin alpha chain                     300   2e-96   Nicotiana tomentosiformis
gb|AAO23139.1|  alpha tubulin                                           300   2e-96   Populus tremuloides
ref|XP_003522731.1|  PREDICTED: tubulin alpha-4 chain isoform X1        300   2e-96   Glycine max [soybeans]
gb|KJB29387.1|  hypothetical protein B456_005G097800                    300   2e-96   Gossypium raimondii
ref|XP_001764722.1|  predicted protein                                  300   2e-96   
ref|XP_006581474.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    300   2e-96   
ref|XP_008455056.1|  PREDICTED: tubulin alpha-4 chain isoform X2        298   2e-96   
ref|XP_004238046.1|  PREDICTED: tubulin alpha chain                     299   2e-96   
ref|XP_006606007.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    299   2e-96   
ref|XP_010500555.1|  PREDICTED: tubulin alpha-6 chain isoform X1        299   2e-96   Camelina sativa [gold-of-pleasure]
ref|XP_006362511.1|  PREDICTED: tubulin alpha-1 chain-like              299   2e-96   
ref|XP_002275973.1|  PREDICTED: tubulin alpha chain                     299   2e-96   Vitis vinifera
gb|KHG20487.1|  Tubulin alpha chain                                     299   2e-96   Gossypium arboreum [tree cotton]
ref|XP_011014531.1|  PREDICTED: tubulin alpha-4 chain-like              299   2e-96   Populus euphratica
ref|XP_010245599.1|  PREDICTED: tubulin alpha chain-like                299   2e-96   Nelumbo nucifera [Indian lotus]
ref|XP_004244533.1|  PREDICTED: tubulin alpha-3 chain-like              299   2e-96   Solanum lycopersicum
dbj|BAC24800.1|  alpha tubulin                                          299   2e-96   Physcomitrella patens
ref|XP_009605705.1|  PREDICTED: tubulin alpha-2 chain-like              299   2e-96   Nicotiana tomentosiformis
ref|XP_009147859.1|  PREDICTED: tubulin alpha-6 chain                   299   2e-96   Brassica rapa
ref|NP_193232.1|  tubulin alpha-6 chain                                 299   2e-96   Arabidopsis thaliana [mouse-ear cress]
gb|KHN01709.1|  Tubulin alpha chain                                     299   2e-96   Glycine soja [wild soybean]
ref|XP_010461854.1|  PREDICTED: tubulin alpha-6 chain-like              299   2e-96   Camelina sativa [gold-of-pleasure]
ref|XP_006356798.1|  PREDICTED: tubulin alpha chain-like                299   2e-96   Solanum tuberosum [potatoes]
ref|XP_006589612.1|  PREDICTED: tubulin alpha chain-like isoform X2     299   2e-96   
ref|XP_008787760.1|  PREDICTED: tubulin alpha chain-like                299   2e-96   Phoenix dactylifera
ref|XP_008787237.1|  PREDICTED: tubulin alpha chain                     299   2e-96   Phoenix dactylifera
ref|XP_006662856.1|  PREDICTED: tubulin alpha-3 chain-like              299   2e-96   Oryza brachyantha
sp|Q9ZRR5.1|TBA3_HORVU  RecName: Full=Tubulin alpha-3 chain             299   2e-96   Hordeum vulgare [barley]
ref|XP_002301128.1|  hypothetical protein POPTR_0002s11250g             299   2e-96   Populus trichocarpa [western balsam poplar]
gb|AGE09583.1|  TUA1-like protein                                       298   2e-96   Eucalyptus cladocalyx
ref|XP_003524707.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    299   3e-96   Glycine max [soybeans]
ref|XP_002989721.1|  hypothetical protein SELMODRAFT_235864             299   3e-96   
ref|XP_010096739.1|  Tubulin alpha chain                                299   3e-96   
gb|KDP41548.1|  hypothetical protein JCGZ_15955                         299   3e-96   Jatropha curcas
ref|XP_002989731.1|  hypothetical protein SELMODRAFT_130285             299   3e-96   Selaginella moellendorffii
ref|XP_007205183.1|  hypothetical protein PRUPE_ppa005613mg             299   3e-96   Prunus persica
ref|XP_007215369.1|  hypothetical protein PRUPE_ppa005626mg             299   3e-96   Prunus persica
ref|XP_009614122.1|  PREDICTED: tubulin alpha-3 chain                   299   4e-96   Nicotiana tomentosiformis
gb|ACN40181.1|  unknown                                                 298   4e-96   Picea sitchensis
ref|XP_002283198.1|  PREDICTED: tubulin alpha chain                     298   4e-96   Vitis vinifera
ref|XP_003556001.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    298   4e-96   Glycine max [soybeans]
ref|XP_006573681.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    298   4e-96   
ref|XP_010936237.1|  PREDICTED: tubulin alpha chain-like                298   4e-96   Elaeis guineensis
gb|ACU19580.1|  unknown                                                 298   4e-96   Glycine max [soybeans]
ref|XP_002964078.1|  hypothetical protein SELMODRAFT_405729             298   4e-96   Selaginella moellendorffii
ref|NP_001289660.1|  tubulin alpha chain-like                           298   4e-96   Eucalyptus grandis [rose gum]
ref|XP_004304311.1|  PREDICTED: tubulin alpha-2 chain-like              298   4e-96   Fragaria vesca subsp. vesca
ref|XP_003536570.1|  PREDICTED: tubulin alpha chain-like isoform X1     298   4e-96   Glycine max [soybeans]
sp|Q9FT36.1|TBA_DAUCA  RecName: Full=Tubulin alpha chain                298   4e-96   Daucus carota [carrots]
ref|XP_008379344.1|  PREDICTED: tubulin alpha-2 chain                   298   4e-96   Malus domestica [apple tree]
ref|XP_004496862.1|  PREDICTED: tubulin alpha chain-like                298   4e-96   Cicer arietinum [garbanzo]
ref|XP_008341563.1|  PREDICTED: tubulin alpha-2 chain-like              298   4e-96   
emb|CAB66336.1|  alpha-tubulin                                          298   5e-96   Betula pendula [white birch]
ref|XP_010939312.1|  PREDICTED: tubulin alpha chain-like                298   5e-96   Elaeis guineensis
ref|XP_008372961.1|  PREDICTED: tubulin alpha chain isoform X1          298   5e-96   Malus domestica [apple tree]
ref|XP_006579968.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    299   5e-96   
ref|XP_004299843.1|  PREDICTED: tubulin alpha chain-like                298   6e-96   Fragaria vesca subsp. vesca
ref|XP_003635553.2|  PREDICTED: tubulin alpha chain-like                298   6e-96   Vitis vinifera
ref|XP_010060142.1|  PREDICTED: tubulin alpha chain-like                298   6e-96   Eucalyptus grandis [rose gum]
gb|AFV46219.1|  hypothetical protein                                    298   7e-96   Scutellaria baicalensis [Baikal skullcap]
ref|XP_009388502.1|  PREDICTED: tubulin alpha-2 chain isoform X1        298   8e-96   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004501073.1|  PREDICTED: tubulin alpha chain-like                298   8e-96   Cicer arietinum [garbanzo]
sp|P46259.1|TBA1_PEA  RecName: Full=Tubulin alpha-1 chain               298   9e-96   Pisum sativum [garden pea]
ref|XP_007137281.1|  hypothetical protein PHAVU_009G114100g             298   9e-96   Phaseolus vulgaris [French bean]
ref|XP_006472373.1|  PREDICTED: tubulin alpha chain isoform X2          298   9e-96   
ref|XP_003603670.1|  Tubulin alpha-7 chain                              298   1e-95   Medicago truncatula
emb|CDP02221.1|  unnamed protein product                                297   1e-95   Coffea canephora [robusta coffee]
ref|XP_003608582.1|  Tubulin alpha-5 chain                              297   1e-95   Medicago truncatula
gb|AHZ58482.1|  alpha-tubulin                                           291   1e-95   Syntrichia caninervis
gb|KEH43997.1|  tubulin beta-1 chain                                    297   1e-95   Medicago truncatula
ref|XP_002976230.1|  hypothetical protein SELMODRAFT_105136             297   1e-95   Selaginella moellendorffii
gb|AAL16174.1|AF428406_1  AT4g14960/dl3520c                             297   1e-95   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008219157.1|  PREDICTED: tubulin alpha chain-like isoform X2     297   1e-95   
ref|NP_001067613.1|  Os11g0247300                                       297   1e-95   
ref|XP_009388503.1|  PREDICTED: tubulin alpha chain isoform X2          298   1e-95   
ref|XP_002972670.1|  hypothetical protein SELMODRAFT_231979             297   2e-95   Selaginella moellendorffii
gb|KIY93466.1|  Tubulin alpha-1 chain                                   288   2e-95   Monoraphidium neglectum
gb|KDO81347.1|  hypothetical protein CISIN_1g013037mg                   297   2e-95   Citrus sinensis [apfelsine]
ref|XP_006472372.1|  PREDICTED: tubulin alpha chain isoform X1          297   2e-95   Citrus sinensis [apfelsine]
ref|XP_002962209.1|  hypothetical protein SELMODRAFT_230058             297   2e-95   Selaginella moellendorffii
ref|XP_008804464.1|  PREDICTED: tubulin alpha chain-like                297   2e-95   Phoenix dactylifera
ref|XP_008352751.1|  PREDICTED: tubulin alpha chain isoform X2          297   2e-95   
gb|ACH68563.1|  alpha-tubulin                                           297   2e-95   Solanum tuberosum [potatoes]
ref|XP_008455054.1|  PREDICTED: tubulin alpha-4 chain isoform X1        297   2e-95   Cucumis melo [Oriental melon]
dbj|BAB19779.1|  alpha tubulin                                          296   2e-95   Nicotiana tabacum [American tobacco]
ref|XP_009357231.1|  PREDICTED: tubulin alpha chain-like isoform X2     296   2e-95   
ref|XP_002963092.1|  hypothetical protein SELMODRAFT_78469              296   2e-95   Selaginella moellendorffii
ref|XP_007155784.1|  hypothetical protein PHAVU_003G231500g             296   2e-95   Phaseolus vulgaris [French bean]
ref|XP_002962630.1|  hypothetical protein SELMODRAFT_230143             296   2e-95   
gb|ABP65320.1|  alpha tubulin                                           296   2e-95   Capsicum annuum
sp|Q6VAG1.1|TBA1_GOSHI  RecName: Full=Tubulin alpha-1 chain; AltN...    296   3e-95   Gossypium hirsutum [American cotton]
ref|XP_002517492.1|  tubulin alpha chain, putative                      296   3e-95   Ricinus communis
dbj|BAJ98211.1|  predicted protein                                      296   3e-95   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABD92930.1|  alpha tubulin-2A                                        296   3e-95   Triticum aestivum [Canadian hard winter wheat]
sp|Q96460.1|TBA2_HORVU  RecName: Full=Tubulin alpha-2 chain             296   3e-95   Hordeum vulgare [barley]
ref|XP_010680774.1|  PREDICTED: tubulin alpha-2 chain                   296   3e-95   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004981922.1|  PREDICTED: tubulin alpha-1 chain-like              296   3e-95   Setaria italica
gb|AAB08791.1|  alpha tubulin                                           296   3e-95   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007156677.1|  hypothetical protein PHAVU_002G007900g             296   3e-95   Phaseolus vulgaris [French bean]
sp|Q9ZRB7.1|TBA_WHEAT  RecName: Full=Tubulin alpha chain                296   3e-95   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001291325.1|  tubulin alpha chain-like                           296   4e-95   Sesamum indicum [beniseed]
gb|AIX10773.1|  alpha tubulin                                           296   4e-95   Panax notoginseng [san-qi]
ref|XP_004150268.1|  PREDICTED: tubulin alpha chain-like                296   4e-95   Cucumis sativus [cucumbers]
dbj|BAJ06362.1|  alpha-tubulin                                          296   4e-95   Alopecurus aequalis
ref|XP_003560377.1|  PREDICTED: tubulin alpha-1 chain                   296   4e-95   Brachypodium distachyon [annual false brome]
ref|XP_001427644.1|  hypothetical protein                               287   4e-95   Paramecium tetraurelia strain d4-2
ref|XP_009618479.1|  PREDICTED: tubulin alpha-3 chain-like              296   5e-95   Nicotiana tomentosiformis
emb|CAA06619.1|  alpha-tubulin 1                                        296   5e-95   Eleusine indica [crabgrass]
ref|XP_005851144.1|  alpha-tubulin                                      296   5e-95   Chlorella variabilis
ref|XP_003517369.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    296   5e-95   Glycine max [soybeans]
sp|O22347.1|TBA1_ELEIN  RecName: Full=Tubulin alpha-1 chain; AltN...    296   5e-95   Eleusine indica [crabgrass]
gb|AFC88832.1|  putative tubulin alpha-3 chain                          296   5e-95   Miscanthus sinensis
gb|AHJ80817.1|  Tua1                                                    296   5e-95   Eragrostis tef [tef]
gb|AHJ80822.1|  Tua1                                                    296   5e-95   Eragrostis tef [tef]
gb|AHJ80815.1|  Tua1                                                    296   5e-95   Eragrostis tef [tef]
ref|XP_009779180.1|  PREDICTED: tubulin alpha-3 chain-like              296   6e-95   Nicotiana sylvestris
ref|NP_001167663.1|  tubulin alpha-3 chain                              296   6e-95   Zea mays [maize]
ref|XP_008665337.1|  PREDICTED: tubulin alpha-1 chain-like              296   6e-95   
ref|XP_008665339.1|  PREDICTED: tubulin alpha-2 chain                   296   6e-95   Zea mays [maize]
ref|XP_007143142.1|  hypothetical protein PHAVU_007G047300g             295   6e-95   Phaseolus vulgaris [French bean]
ref|XP_003539228.1|  PREDICTED: tubulin alpha-2 chain-like              295   6e-95   Glycine max [soybeans]
ref|XP_011098608.1|  PREDICTED: tubulin alpha chain                     295   7e-95   Sesamum indicum [beniseed]
ref|XP_002963093.1|  hypothetical protein SELMODRAFT_404672             295   7e-95   Selaginella moellendorffii
gb|ABV55999.1|  alpha-tubulin 7                                         295   7e-95   Populus tremuloides
gb|AHJ80816.1|  Tua1                                                    295   8e-95   Eragrostis tef [tef]
ref|XP_006650518.1|  PREDICTED: tubulin alpha-1 chain-like              295   8e-95   Oryza brachyantha
ref|XP_007223365.1|  hypothetical protein PRUPE_ppa005617mg             295   9e-95   Prunus persica
gb|AGV54441.1|  tubulin alpha-2 chain-like protein                      295   9e-95   Phaseolus vulgaris [French bean]
ref|XP_006482577.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    294   1e-94   Citrus sinensis [apfelsine]
ref|XP_008347837.1|  PREDICTED: tubulin alpha-4 chain isoform X2        295   1e-94   
ref|XP_002980239.1|  hypothetical protein SELMODRAFT_233509             295   1e-94   Selaginella moellendorffii
gb|AGG37289.1|  alpha-tubulin 7                                         295   1e-94   Salix arbutifolia
ref|XP_011008936.1|  PREDICTED: tubulin alpha chain                     295   1e-94   Populus euphratica
emb|CAA62917.1|  alfa-tubulin                                           295   1e-94   Oryza sativa Japonica Group [Japonica rice]
gb|AAQ81585.1|  putative tubulin alpha-2/alpha-4 chain                  295   1e-94   Brassica napus [oilseed rape]
ref|XP_002508010.1|  alpha tubulin 2                                    295   1e-94   Micromonas commoda
ref|XP_005643073.1|  tubulin alpha chain                                295   1e-94   Coccomyxa subellipsoidea C-169
ref|XP_005651460.1|  tubulin alpha chain                                295   2e-94   Coccomyxa subellipsoidea C-169
ref|XP_006338461.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    294   2e-94   
sp|P33623.1|TBA1_ANEPH  RecName: Full=Tubulin alpha-1 chain             294   2e-94   Anemia phyllitidis
gb|ABG78593.1|  alpha-tubulin                                           294   2e-94   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002973792.1|  hypothetical protein SELMODRAFT_100162             294   2e-94   Selaginella moellendorffii
gb|KHN42598.1|  Tubulin alpha-2 chain                                   294   2e-94   Glycine soja [wild soybean]
gb|ABO47742.1|  alpha-tubulin                                           294   3e-94   Gossypium hirsutum [American cotton]
gb|AFW67748.1|  alpha tubulin4                                          291   3e-94   
ref|XP_007032501.1|  Tubulin alpha-2 chain                              294   3e-94   
ref|XP_010256937.1|  PREDICTED: tubulin alpha chain-like                294   3e-94   Nelumbo nucifera [Indian lotus]
gb|ABF98643.1|  Tubulin alpha-1 chain, putative, expressed              293   3e-94   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001051132.1|  Os03g0726100                                       293   4e-94   
gb|ACY05960.1|  alpha-tubulin                                           291   4e-94   Haematococcus lacustris
ref|XP_006650524.1|  PREDICTED: tubulin alpha-1 chain-like              293   4e-94   Oryza brachyantha
gb|AIA82437.1|  alpha-tubulin-like protein 06                           290   4e-94   Stentor coeruleus
ref|XP_010242419.1|  PREDICTED: tubulin alpha-1 chain                   293   5e-94   Nelumbo nucifera [Indian lotus]
gb|AIA82433.1|  alpha-tubulin-like protein 01                           293   6e-94   Stentor coeruleus
ref|XP_006431130.1|  hypothetical protein CICLE_v10011709mg             293   6e-94   Citrus clementina [clementine]
ref|XP_001777081.1|  predicted protein                                  293   6e-94   
ref|XP_002783368.1|  alpha tubulin, putative                            283   6e-94   Perkinsus marinus ATCC 50983
gb|AAB84298.1|  tubulin                                                 293   7e-94   Oryza sativa Indica Group [Indian rice]
emb|CDO97305.1|  unnamed protein product                                293   7e-94   Coffea canephora [robusta coffee]
ref|XP_001782790.1|  predicted protein                                  293   7e-94   
sp|P10872.1|TBA_TETPY  RecName: Full=Tubulin alpha chain                293   7e-94   Tetrahymena pyriformis
ref|XP_009626810.1|  PREDICTED: tubulin alpha chain-like                293   8e-94   Nicotiana tomentosiformis
ref|XP_001022424.1|  Tubulin/FtsZ family, GTPase domain containin...    293   8e-94   Tetrahymena thermophila SB210
ref|XP_003058621.1|  alpha tubulin                                      293   8e-94   Micromonas pusilla CCMP1545
ref|XP_004232226.1|  PREDICTED: tubulin alpha chain-like                293   9e-94   Solanum lycopersicum
ref|XP_004231960.1|  PREDICTED: tubulin alpha-3 chain-like              292   1e-93   Solanum lycopersicum
gb|AHJ80823.1|  Tua1                                                    292   1e-93   Eragrostis tef [tef]
gb|AAW30622.1|  unknown                                                 283   1e-93   Sus scrofa [pigs]
ref|XP_004034900.1|  hypothetical protein IMG5_110300                   293   1e-93   Ichthyophthirius multifiliis
ref|XP_002766433.1|  tubulin alpha chain, putative                      283   2e-93   Perkinsus marinus ATCC 50983
gb|AAW30623.1|  unknown                                                 283   2e-93   Sus scrofa [pigs]
gb|AAX63396.1|  alpha-tubulin                                           291   2e-93   Haematococcus lacustris
ref|XP_006357741.1|  PREDICTED: tubulin alpha-3 chain-like              291   2e-93   
ref|XP_008294350.1|  PREDICTED: tubulin alpha chain                     283   2e-93   
gb|ACK76232.1|  alpha-tubulin                                           291   2e-93   
ref|XP_673091.1|  hypothetical protein                                  285   3e-93   
gb|AAB86649.1|  alpha-tubulin                                           291   3e-93   
ref|XP_002781275.1|  Tubulin alpha chain, putative                      284   3e-93   
dbj|BAE01779.1|  unnamed protein product                                284   3e-93   
ref|XP_002785264.1|  Tubulin alpha chain, putative                      283   3e-93   
ref|XP_004599399.1|  PREDICTED: tubulin alpha-1B chain                  283   3e-93   
gb|KIZ03400.1|  Tubulin alpha chain                                     291   4e-93   
ref|XP_005932717.1|  PREDICTED: tubulin alpha-1B chain-like             284   4e-93   
ref|XP_004778983.1|  PREDICTED: tubulin alpha-1C chain                  284   4e-93   
ref|XP_674476.1|  hypothetical protein                                  282   4e-93   
gb|KIZ01406.1|  Tubulin alpha-1 chain                                   291   4e-93   
ref|XP_002767974.1|  Tubulin alpha chain, putative                      285   5e-93   
gb|AAG49533.3|  alpha tubulin                                           285   5e-93   
ref|XP_005801996.1|  PREDICTED: tubulin alpha-1B chain-like             284   5e-93   
ref|XP_009409992.1|  PREDICTED: tubulin alpha chain-like                290   5e-93   
sp|P09205.1|TBA2_CHLRE  RecName: Full=Tubulin alpha-2 chain             290   6e-93   
ref|XP_006895063.1|  PREDICTED: tubulin alpha-1B chain-like             283   6e-93   
gb|AIA82435.1|  alpha-tubulin-like protein 03                           290   6e-93   
ref|XP_001691876.1|  alpha tubulin 1                                    290   6e-93   
ref|XP_002779347.1|  Tubulin alpha chain, putative                      287   6e-93   
ref|XP_007426287.1|  PREDICTED: tubulin alpha-1C chain                  284   6e-93   
ref|XP_010099392.1|  Tubulin alpha chain                                291   6e-93   
gb|AEW46684.1|  beta-tubulin                                            290   6e-93   
ref|XP_011366648.1|  PREDICTED: tubulin alpha-1C chain-like             285   6e-93   
ref|XP_002951007.1|  alpha tubulin                                      290   7e-93   
gb|AAZ23863.1|  alpha-tubulin                                           290   7e-93   
gb|ACH70610.1|  alpha tubulin                                           290   7e-93   
emb|CAA62916.1|  alpha-tubulin                                          290   7e-93   
ref|XP_001770881.1|  predicted protein                                  290   7e-93   
ref|XP_739480.1|  hypothetical protein                                  281   7e-93   
emb|CAJ26346.1|  alpha-tubulin                                          281   9e-93   
ref|XP_001454509.1|  hypothetical protein                               290   1e-92   
emb|CAA67848.1|  alpha-tubulin                                          290   1e-92   
ref|XP_001460309.1|  hypothetical protein                               289   1e-92   
gb|AIJ27191.1|  alpha-tubulin 1a                                        283   1e-92   
gb|EDL87015.1|  rCG50513, isoform CRA_a                                 285   1e-92   
ref|XP_005801995.1|  PREDICTED: tubulin alpha-1A chain-like             283   1e-92   
emb|CAI38956.1|  alpha_tubulin,putative                                 290   1e-92   
ref|XP_008172101.1|  PREDICTED: tubulin alpha-1B chain                  284   1e-92   
gb|EJY81124.1|  Alpha tubulin,putative                                  290   1e-92   
emb|CDW82295.1|  alpha tubulin                                          290   1e-92   
gb|KGL81705.1|  Tubulin alpha-1C chain                                  282   2e-92   
ref|XP_002324047.2|  hypothetical protein POPTR_0017s11740g             289   2e-92   
ref|XP_006264719.1|  PREDICTED: tubulin alpha-1A chain                  286   2e-92   
ref|XP_006056311.1|  PREDICTED: tubulin alpha-1B chain-like             282   2e-92   
gb|AIK29207.1|  putative alpha-tubulin                                  283   2e-92   
ref|XP_008969760.1|  PREDICTED: tubulin alpha chain-like                280   2e-92   
ref|XP_008317242.1|  PREDICTED: tubulin alpha-1C chain-like             284   2e-92   
gb|AAB86648.1|  alpha-tubulin                                           289   2e-92   
gb|ETL46656.1|  tubulin alpha chain                                     280   2e-92   
ref|XP_006109205.1|  PREDICTED: tubulin alpha-1D chain-like             281   2e-92   
dbj|BAJ97454.1|  predicted protein                                      286   2e-92   
ref|XP_010995722.1|  PREDICTED: tubulin alpha-1B chain                  285   3e-92   
gb|AII97815.1|  BLTX443                                                 283   3e-92   
gb|AEF59080.1|  alpha tubulin-like protein                              284   3e-92   
emb|CDP00974.1|  unnamed protein product                                289   3e-92   
gb|ETK93242.1|  tubulin alpha chain                                     280   3e-92   
gb|ETL46639.1|  tubulin alpha chain                                     280   3e-92   
gb|ABS57456.1|  alpha-tubulin                                           281   4e-92   
ref|XP_008575749.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    284   4e-92   
ref|XP_008351479.1|  PREDICTED: tubulin alpha-3 chain                   288   4e-92   
ref|XP_005406777.1|  PREDICTED: tubulin alpha-1A chain-like             283   4e-92   
gb|AAM73791.1|  alpha-tubulin                                           278   4e-92   
ref|XP_008412910.1|  PREDICTED: tubulin alpha-1B chain-like             286   4e-92   
gb|ETK93224.1|  tubulin alpha-2 chain                                   279   4e-92   
ref|XP_003979092.1|  PREDICTED: tubulin alpha-1B chain-like             281   5e-92   
ref|XP_001455356.1|  hypothetical protein                               288   5e-92   
gb|ABC59068.2|  alpha tubulin 1                                         288   5e-92   
dbj|BAJ06364.1|  alpha-tubulin                                          288   5e-92   
ref|XP_003558668.1|  PREDICTED: tubulin alpha-2 chain-like              288   5e-92   
ref|XP_003392163.2|  PREDICTED: tubulin alpha chain, testis-speci...    278   6e-92   
gb|AEF79970.1|  alpha-tubulin protein                                   288   6e-92   
gb|EDL87016.1|  rCG50513, isoform CRA_b                                 283   7e-92   
ref|XP_002466376.1|  hypothetical protein SORBIDRAFT_01g006650          288   7e-92   
gb|KDD76276.1|  tubulin/FtsZ GTPase                                     288   8e-92   
ref|XP_008606530.1|  tubulin alpha                                      283   8e-92   
gb|AFC88824.1|  putative tubulin alpha-3 chain                          288   8e-92   
ref|XP_008475351.1|  PREDICTED: tubulin alpha-1 chain-like              283   8e-92   
emb|CBI16534.3|  unnamed protein product                                286   9e-92   
gb|ABD92937.1|  alpha tubulin-4A                                        287   9e-92   
gb|ABD92936.1|  alpha tubulin-4D                                        287   9e-92   
ref|XP_011461685.1|  PREDICTED: tubulin alpha-3 chain isoform X2        286   1e-91   
ref|XP_005324966.1|  PREDICTED: tubulin alpha-1B chain                  282   1e-91   
ref|XP_005452428.1|  PREDICTED: tubulin alpha-1A chain-like             282   1e-91   
ref|XP_005139691.1|  PREDICTED: tubulin alpha-1B chain-like             286   1e-91   
ref|NP_001105440.1|  tubulin alpha-3 chain                              287   1e-91   
gb|EYU34660.1|  hypothetical protein MIMGU_mgv1a006269mg                287   1e-91   
ref|XP_007248487.1|  PREDICTED: tubulin alpha-1B chain-like             285   1e-91   
gb|ABO33166.1|  alpha tubulin a2                                        280   1e-91   
ref|XP_004874971.1|  PREDICTED: tubulin alpha-3 chain-like              282   1e-91   
emb|CDP12358.1|  unnamed protein product                                287   1e-91   
ref|XP_002777471.1|  Tubulin alpha chain, putative                      286   2e-91   
gb|AAW30624.1|  unknown                                                 278   2e-91   
gb|AAM73790.1|  alpha-tubulin                                           276   2e-91   
gb|KJB83376.1|  hypothetical protein B456_013G244600                    281   2e-91   
ref|XP_007606030.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    285   2e-91   
gb|EKC22339.1|  Tubulin alpha chain                                     281   2e-91   
ref|XP_011475942.1|  PREDICTED: tubulin alpha chain-like                282   2e-91   
gb|EGW14703.1|  Tubulin alpha chain, nucleomorph                        285   2e-91   
sp|P07304.2|TBA1_STYLE  RecName: Full=Tubulin alpha-1 chain             286   2e-91   
sp|P28287.1|TBA_OXYGR  RecName: Full=Tubulin alpha chain                286   2e-91   
ref|XP_010751704.1|  PREDICTED: tubulin alpha chain                     283   2e-91   
ref|XP_008349406.1|  PREDICTED: tubulin alpha-3 chain                   286   2e-91   
ref|XP_004863237.1|  PREDICTED: uncharacterized protein LOC101707673    283   2e-91   
ref|XP_002786953.1|  Tubulin alpha chain, putative                      286   3e-91   
gb|EFO61055.1|  Alpha-tubulin                                           277   3e-91   
gb|EHB00536.1|  Tubulin alpha-1C chain                                  286   3e-91   
ref|XP_008223650.1|  PREDICTED: tubulin alpha-3 chain-like              286   3e-91   
ref|XP_003770912.1|  PREDICTED: tubulin alpha-1C chain                  282   3e-91   
ref|XP_006974484.1|  PREDICTED: tubulin alpha-1A chain-like             282   3e-91   
ref|XP_004817225.1|  PREDICTED: tubulin alpha-3 chain-like              283   3e-91   
ref|XP_002599490.1|  hypothetical protein BRAFLDRAFT_81006              282   3e-91   
dbj|BAJ07366.1|  alpha-tubulin                                          276   3e-91   
ref|XP_006916969.1|  PREDICTED: tubulin alpha-1B chain                  285   4e-91   
ref|XP_009375870.1|  PREDICTED: tubulin alpha-3 chain                   286   4e-91   
ref|XP_007634877.1|  PREDICTED: tubulin alpha-1A chain isoform X3       280   4e-91   
ref|XP_002904194.1|  alpha-tubulin                                      286   4e-91   
gb|KJB83377.1|  hypothetical protein B456_013G244600                    282   4e-91   
ref|XP_007179355.1|  PREDICTED: tubulin alpha-1B chain                  285   5e-91   
ref|XP_009554397.1|  PREDICTED: tubulin alpha-1A chain                  280   5e-91   
ref|XP_008702766.1|  PREDICTED: tubulin alpha-1B chain-like             284   5e-91   
gb|AIA82436.1|  alpha-tubulin-like protein 04                           286   5e-91   
ref|XP_004221286.1|  tubulin alpha chain                                285   5e-91   
ref|XP_724313.1|  hypothetical protein                                  285   5e-91   
ref|XP_010852034.1|  PREDICTED: tubulin alpha-1C chain                  285   5e-91   
ref|XP_003976815.1|  PREDICTED: tubulin alpha-1 chain-like              276   6e-91   
ref|XP_007198449.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin, alp...    285   6e-91   
gb|AFX62860.1|  alpha tubulin 84B                                       284   6e-91   
ref|XP_002285721.1|  PREDICTED: tubulin alpha-3 chain                   285   6e-91   
emb|CBN77373.1|  alpha tubulin                                          285   6e-91   
sp|Q40832.1|TBA2_PELFA  RecName: Full=Tubulin alpha-2 chain             285   6e-91   
gb|ETN59126.1|  tubulin alpha chain                                     283   6e-91   
ref|XP_006675832.1|  tubulin, alpha, ubiquitous                         285   6e-91   
ref|XP_001753986.1|  predicted protein                                  285   7e-91   
pdb|3DU7|A  Chain A, Tubulin-Colchicine-Phomopsin A: Stathmin-Lik...    285   7e-91   
ref|XP_004470253.1|  PREDICTED: tubulin alpha-1B chain-like             283   7e-91   
gb|AAC97930.1|  alpha tubulin                                           275   7e-91   
gb|AFX62858.1|  alpha tubulin 84B                                       284   7e-91   
gb|AFX62797.1|  alpha tubulin 84B                                       284   7e-91   
ref|XP_001615123.1|  tubulin alpha chain                                285   7e-91   
gb|ETL99793.1|  tubulin alpha chain                                     282   7e-91   
gb|AFX62862.1|  alpha tubulin 84B                                       284   7e-91   
gb|AFX62804.1|  alpha tubulin 84B                                       284   7e-91   
ref|XP_007205189.1|  hypothetical protein PRUPE_ppa005642mg             285   7e-91   
gb|AFX62784.1|  alpha tubulin 84B                                       284   7e-91   
gb|AFX62789.1|  alpha tubulin 84B                                       284   7e-91   
gb|AFX62787.1|  alpha tubulin 84B                                       284   7e-91   
ref|XP_008625823.1|  tubulin alpha chain                                285   7e-91   
gb|AFX62786.1|  alpha tubulin 84B                                       284   7e-91   
ref|XP_006752422.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin, alp...    285   8e-91   
gb|AFX62790.1|  alpha tubulin 84B                                       284   8e-91   
gb|AFX62798.1|  alpha tubulin 84B                                       284   8e-91   
gb|AFX62788.1|  alpha tubulin 84B                                       284   8e-91   
gb|AFX62861.1|  alpha tubulin 84B                                       284   8e-91   
gb|AFX62791.1|  alpha tubulin 84B                                       284   8e-91   
gb|AFX62864.1|  alpha tubulin 84B                                       284   8e-91   
gb|AFX62805.1|  alpha tubulin 84B                                       284   8e-91   
gb|AFX62799.1|  alpha tubulin 84B                                       284   9e-91   
ref|XP_007936041.1|  PREDICTED: tubulin alpha-1A chain isoform X2       285   9e-91   
ref|XP_002364807.1|  tubulin alpha chain                                285   9e-91   
ref|XP_001790595.1|  PREDICTED: tubulin alpha-1C chain-like isofo...    285   9e-91   
ref|XP_006779408.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin, alp...    282   9e-91   
gb|AAY78955.1|  alpha-tubulin II                                        285   9e-91   
ref|XP_005986293.1|  PREDICTED: tubulin alpha-1A chain-like isofo...    285   9e-91   
ref|XP_009126388.1|  PREDICTED: tubulin alpha-3 chain-like              285   9e-91   
pdb|4DRX|A  Chain A, Gtp-Tubulin In Complex With A Darpin               284   9e-91   
ref|XP_002714140.1|  PREDICTED: tubulin alpha-1B chain-like             285   1e-90   
ref|NP_001029376.1|  tubulin alpha-1C chain                             285   1e-90   
emb|CDQ72000.1|  unnamed protein product                                284   1e-90   
tpg|DAA32343.1|  TPA: tubulin alpha-1C chain-like                       285   1e-90   
ref|XP_004447014.1|  PREDICTED: tubulin alpha-1C chain                  285   1e-90   
ref|XP_010803242.1|  PREDICTED: tubulin alpha-1C chain isoform X1       285   1e-90   
ref|XP_005680058.1|  PREDICTED: tubulin alpha-1C chain                  285   1e-90   
ref|XP_006035257.1|  PREDICTED: tubulin alpha-1B chain                  285   1e-90   
ref|XP_001351526.1|  alpha-tubulin ii                                   285   1e-90   
sp|P36220.1|TBA_TORMA  RecName: Full=Tubulin alpha chain; AltName...    285   1e-90   
ref|XP_004863093.1|  PREDICTED: tubulin alpha-1B chain-like             285   1e-90   
ref|XP_004400918.1|  PREDICTED: tubulin alpha-1B chain-like             285   1e-90   
ref|XP_006650667.1|  PREDICTED: tubulin alpha-2 chain-like              285   1e-90   
ref|XP_007107561.1|  PREDICTED: tubulin alpha-1C chain isoform X1       285   1e-90   
ref|XP_004880762.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    285   1e-90   
dbj|BAK03519.1|  predicted protein                                      285   1e-90   
ref|NP_524264.1|  alpha-Tubulin at 84D                                  285   1e-90   
ref|XP_008069065.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    285   1e-90   
ref|XP_004429038.1|  PREDICTED: tubulin alpha-1B chain                  285   1e-90   
ref|XP_004295008.1|  PREDICTED: tubulin alpha-3 chain isoform X1        285   1e-90   
gb|AAI51892.1|  MGC171407 protein                                       285   1e-90   
ref|NP_989078.1|  tubulin, alpha 1c                                     285   1e-90   
ref|NP_001095253.1|  tubulin alpha chain                                285   1e-90   
ref|NP_001165669.1|  tubulin, alpha 3e                                  285   1e-90   
ref|NP_035784.1|  tubulin alpha-1B chain                                285   1e-90   
gb|AAH42319.1|  Tuba1 protein                                           285   1e-90   
ref|XP_004400917.1|  PREDICTED: tubulin alpha-1B chain-like             285   1e-90   
ref|NP_001029267.1|  tubulin alpha-1B chain                             285   1e-90   
ref|XP_010348074.1|  PREDICTED: tubulin alpha-1B chain                  285   1e-90   
ref|XP_006916875.1|  PREDICTED: tubulin alpha-1C chain                  285   1e-90   
ref|XP_003355423.1|  PREDICTED: tubulin alpha-1C chain isoformX1        285   1e-90   
ref|XP_008831082.1|  PREDICTED: tubulin alpha-1B chain                  285   1e-90   
ref|XP_005986295.1|  PREDICTED: tubulin alpha-1A chain-like             285   1e-90   
ref|XP_004274417.1|  PREDICTED: tubulin alpha-1C chain-like             285   1e-90   
ref|XP_005745106.1|  PREDICTED: tubulin alpha-1B chain-like             284   1e-90   
ref|XP_002038709.1|  GM10965                                            285   1e-90   
ref|XP_010348076.1|  PREDICTED: tubulin alpha-1C chain                  285   1e-90   
ref|XP_005532035.1|  PREDICTED: tubulin alpha-1C chain isoform X2       285   1e-90   
ref|NP_001098596.2|  tubulin alpha-1B chain                             285   1e-90   
ref|XP_006286664.1|  hypothetical protein CARUB_v10002583mg             285   1e-90   
gb|AFX62859.1|  alpha tubulin 84B                                       283   1e-90   
dbj|BAF82043.1|  unnamed protein product                                285   1e-90   
ref|XP_010594690.1|  PREDICTED: tubulin alpha-1C chain                  284   1e-90   
ref|XP_003223237.1|  PREDICTED: tubulin alpha-1C chain                  284   1e-90   
ref|XP_004880760.1|  PREDICTED: tubulin alpha-1C chain isoform X1       284   1e-90   
ref|XP_003793653.1|  PREDICTED: tubulin alpha-1C chain isoform 2        285   1e-90   
ref|XP_005532034.1|  PREDICTED: tubulin alpha-1C chain isoform X1       284   1e-90   
ref|XP_005061430.1|  PREDICTED: tubulin alpha-1C chain-like isofo...    284   1e-90   
ref|XP_006054596.1|  PREDICTED: tubulin alpha-1B chain                  285   1e-90   
gb|AAH83344.1|  Tubulin, alpha 1A                                       285   1e-90   
gb|AAT09064.1|  alpha tubulin 2                                         285   1e-90   
ref|XP_005324965.1|  PREDICTED: tubulin alpha-1A chain                  284   1e-90   



>gb|ACN40426.1| unknown [Picea sitchensis]
Length=319

 Score =   303 bits (775),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|ACU18775.1| unknown [Glycine max]
Length=202

 Score =   298 bits (764),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>emb|CBI29424.3| unnamed protein product [Vitis vinifera]
Length=287

 Score =   301 bits (770),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_002263822.2| PREDICTED: tubulin alpha chain, partial [Vitis vinifera]
Length=322

 Score =   301 bits (772),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|AAN33000.1| alpha-tubulin 4, partial [Gossypium hirsutum]
Length=311

 Score =   300 bits (769),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_008236253.1| PREDICTED: tubulin alpha chain isoform X2 [Prunus mume]
Length=427

 Score =   304 bits (778),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|ABE66388.1| alpha-tubulin [Striga asiatica]
Length=206

 Score =   296 bits (757),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVF+AV
Sbjct  121  RIRKLADNCTGLQGFLVFHAV  141



>ref|XP_009124557.1| PREDICTED: tubulin alpha-6 chain-like isoform X2 [Brassica rapa]
Length=431

 Score =   303 bits (777),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|KDO78780.1| hypothetical protein CISIN_1g037616mg, partial [Citrus sinensis]
Length=383

 Score =   301 bits (772),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_008440460.1| PREDICTED: tubulin alpha chain-like isoform X2 [Cucumis melo]
Length=437

 Score =   303 bits (776),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_010466127.1| PREDICTED: tubulin alpha-2 chain-like isoform X2 [Camelina sativa]
Length=423

 Score =   302 bits (774),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_006433709.1| hypothetical protein CICLE_v100015521mg, partial [Citrus clementina]
 gb|ESR46949.1| hypothetical protein CICLE_v100015521mg, partial [Citrus clementina]
Length=153

 Score =   293 bits (749),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>tpg|DAA51110.1| TPA: alpha-tubulin, partial [Zea mays]
 tpg|DAA51116.1| TPA: alpha-tubulin, partial [Zea mays]
Length=240

 Score =   296 bits (758),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>emb|CBI25125.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   301 bits (770),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTPGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_006486879.1| PREDICTED: tubulin alpha chain-like isoform X2 [Citrus sinensis]
Length=433

 Score =   303 bits (775),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>emb|CBI19330.3| unnamed protein product [Vitis vinifera]
Length=395

 Score =   301 bits (771),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_006578253.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Glycine max]
Length=432

 Score =   302 bits (774),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_006466395.1| PREDICTED: tubulin alpha-3 chain-like isoform X2 [Citrus sinensis]
Length=447

 Score =   303 bits (775),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_009107245.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Brassica rapa]
Length=459

 Score =   303 bits (775),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|AHJ80818.1| Tua1, partial [Eragrostis tef]
Length=291

 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|EYU34086.1| hypothetical protein MIMGU_mgv1a0196711mg, partial [Erythranthe 
guttata]
Length=199

 Score =   293 bits (751),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVF+AV
Sbjct  121  RIRKLADNCTGLQGFLVFHAV  141



>emb|CDY66630.1| BnaCnng51680D [Brassica napus]
Length=435

 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>emb|CDY25017.1| BnaC02g39910D [Brassica napus]
Length=410

 Score =   301 bits (771),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_010531322.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Tarenaya hassleriana]
Length=454

 Score =   302 bits (774),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>emb|CBI22190.3| unnamed protein product [Vitis vinifera]
Length=393

 Score =   300 bits (769),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVF+AV
Sbjct  121  RIRKLADNCTGLQGFLVFHAV  141



>ref|WP_039310890.1| hypothetical protein, partial [Paenibacillus sp. IHB B 3415]
 gb|KHL91192.1| hypothetical protein QW71_36085, partial [Paenibacillus sp. IHB 
B 3415]
Length=453

 Score =   302 bits (774),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/143 (99%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = +2

Query  110  AKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGA  289
            +KMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGA
Sbjct  3    SKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGA  62

Query  290  GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLC  469
            GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLC
Sbjct  63   GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLC  122

Query  470  LDRIRKLADNCTGLQGFLVFNAV  538
            LDRIRKLADNCTGLQGFLVF+AV
Sbjct  123  LDRIRKLADNCTGLQGFLVFHAV  145



>gb|AGG37285.1| alpha-tubulin 3 [Salix arbutifolia]
Length=451

 Score =   302 bits (773),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_002313194.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
 gb|EEE87149.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
Length=451

 Score =   302 bits (773),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|ABK92552.1| unknown [Populus trichocarpa]
Length=451

 Score =   302 bits (773),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_011030289.1| PREDICTED: tubulin alpha-4 chain [Populus euphratica]
Length=451

 Score =   302 bits (773),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|AGG37287.1| alpha-tubulin 5 [Salix arbutifolia]
Length=451

 Score =   302 bits (773),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_007042689.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX98520.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   302 bits (773),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|ABX57816.1| alpha tubulin [Picea wilsonii]
Length=451

 Score =   302 bits (773),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_006422747.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 ref|XP_006486878.1| PREDICTED: tubulin alpha chain-like isoform X1 [Citrus sinensis]
 gb|ESR35987.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 gb|KDO49534.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=450

 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|KDP44552.1| hypothetical protein JCGZ_16385 [Jatropha curcas]
Length=450

 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|ACJ60905.1| alpha tubulin [Betula pendula]
Length=450

 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_007199840.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
 ref|XP_008236252.1| PREDICTED: tubulin alpha chain isoform X1 [Prunus mume]
 gb|EMJ01039.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
Length=450

 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|NP_849388.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 dbj|BAH19475.1| AT4G14960 [Arabidopsis thaliana]
 gb|AEE83529.1| tubulin alpha-6 chain [Arabidopsis thaliana]
Length=427

 Score =   301 bits (770),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_010065856.1| PREDICTED: tubulin alpha chain [Eucalyptus grandis]
 gb|KCW63554.1| hypothetical protein EUGRSUZ_G01186 [Eucalyptus grandis]
Length=450

 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_002510010.1| tubulin alpha chain, putative [Ricinus communis]
 ref|XP_006852746.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
 gb|EEF52197.1| tubulin alpha chain, putative [Ricinus communis]
 gb|ERN14213.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
Length=451

 Score =   301 bits (772),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_009335355.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
Length=450

 Score =   301 bits (772),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|AAV92352.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92353.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92354.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92355.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92356.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92357.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92358.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92359.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92360.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92361.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92362.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92363.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92364.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92365.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92366.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92367.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92368.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92369.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92370.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92371.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92372.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92373.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92374.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92375.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92376.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92377.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92378.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92379.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|ACN40661.1| unknown [Picea sitchensis]
 gb|ACN40854.1| unknown [Picea sitchensis]
 gb|ACN40972.1| unknown [Picea sitchensis]
 gb|ACN41102.1| unknown [Picea sitchensis]
 gb|AIZ74331.1| alpha-tubulin [Pinus massoniana]
Length=451

 Score =   301 bits (772),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_002522104.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF40304.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   301 bits (772),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_007018369.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY15594.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=451

 Score =   301 bits (772),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_008236966.1| PREDICTED: tubulin alpha chain-like isoform X2 [Prunus mume]
Length=427

 Score =   301 bits (770),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIHPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_004288297.1| PREDICTED: tubulin alpha-3 chain [Fragaria vesca subsp. vesca]
Length=451

 Score =   301 bits (772),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>emb|CDY29334.1| BnaA05g16010D [Brassica napus]
Length=431

 Score =   301 bits (770),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|KJB58757.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=403

 Score =   300 bits (767),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|NP_171974.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 ref|NP_175423.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 ref|XP_002863595.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002891551.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006279139.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 ref|XP_006393188.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 ref|XP_006406473.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 ref|XP_009107244.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Brassica rapa]
 sp|B9DGT7.2|TBA2_ARATH RecName: Full=Tubulin alpha-2 chain [Arabidopsis thaliana]
 sp|Q0WV25.2|TBA4_ARATH RecName: Full=Tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AAF40454.1|AC004809_12 Identical to the alpha-4 tubulin (TUA4) gene from A. thaliana 
gb|M84697. ESTs gb|T46564. gb|T04381, gb|T76028, gb|T21602, 
gb|H37154 gb|H37663 and gb|T21719 come from this gene [Arabidopsis 
thaliana]
 gb|AAF76449.1|AC015445_16 Identical to Tubulin Alpha-6 Chain from Arabidopsis thaliana 
gi|267070 and contains a Tubulin PF|00091 domain. ESTs gb|N37387, 
gb|N37805, gb|R90497, gb|T44684, gb|H36144, gb|N38686, 
gb|AI994844, gb|R90689, gb|T04725, gb|H36928, gb|N96479, gb|H36922, 
gb|R90670, gb|Z17980, gb|T4428, gb|H36248, gb|N65408, 
gb|T46222 come from this gene [Arabidopsis thaliana]
 gb|AAK95316.1|AF410330_1 At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|AAA32889.1| apha-2 tubulin [Arabidopsis thaliana]
 gb|AAA32890.1| alpha-4 tubulin [Arabidopsis thaliana]
 gb|AAL25612.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAL38293.1| Tubulin Alpha-6 Chain [Arabidopsis thaliana]
 gb|AAM98269.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAN31076.1| At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|ABQ01730.1| TUA2 [Eutrema halophilum]
 gb|ABQ01731.1| TUA2-2 [Eutrema halophilum]
 gb|EFH39854.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67810.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|AEE27747.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AEE32507.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 gb|EOA12037.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 gb|ESQ30474.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 gb|ESQ47926.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 gb|KFK35954.1| hypothetical protein AALP_AA4G059800 [Arabis alpina]
 gb|KFK39296.1| alpha tubulin 1 [Arabis alpina]
 emb|CDY45043.1| BnaA08g02320D [Brassica napus]
 emb|CDY03583.1| BnaC03g68420D [Brassica napus]
Length=450

 Score =   301 bits (771),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_010531321.1| PREDICTED: tubulin alpha chain isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   301 bits (771),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_006404742.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
 gb|ESQ46195.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
Length=451

 Score =   301 bits (771),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_006307493.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
 ref|XP_010418156.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 ref|XP_010430201.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Camelina sativa]
 ref|XP_010430202.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Camelina sativa]
 ref|XP_010473400.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 gb|EOA40391.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
Length=450

 Score =   301 bits (771),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|AID52921.1| tubulin alpha chain [Carthamus tinctorius]
Length=450

 Score =   301 bits (771),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_010555432.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   301 bits (771),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>dbj|BAE99023.1| tubulin alpha-2/alpha-4 chain [Arabidopsis thaliana]
Length=450

 Score =   301 bits (771),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_011457777.1| PREDICTED: tubulin alpha chain [Fragaria vesca subsp. vesca]
Length=450

 Score =   301 bits (771),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_009335354.1| PREDICTED: tubulin alpha chain [Pyrus x bretschneideri]
Length=450

 Score =   301 bits (771),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_009407690.1| PREDICTED: tubulin alpha chain-like [Musa acuminata subsp. malaccensis]
Length=452

 Score =   301 bits (771),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_010526692.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   301 bits (771),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_010093625.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB54386.1| Tubulin alpha chain [Morus notabilis]
Length=451

 Score =   301 bits (771),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_008372962.1| PREDICTED: tubulin alpha chain isoform X2 [Malus domestica]
Length=438

 Score =   301 bits (770),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECIS+HIGQAGIQVGNACWELYCLEHG+QPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGLQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_004143417.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_004160931.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
Length=450

 Score =   301 bits (771),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|ABO47736.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89778.1| alpha-tubulin 6 [Gossypium hirsutum]
Length=450

 Score =   301 bits (771),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_010943272.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   301 bits (771),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_006581475.1| PREDICTED: tubulin alpha-4 chain-like isoform X2 [Glycine max]
Length=466

 Score =   301 bits (772),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_009124556.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Brassica rapa]
Length=450

 Score =   301 bits (770),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|AGG37283.1| alpha-tubulin 1 [Salix arbutifolia]
Length=451

 Score =   301 bits (770),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|KHG18997.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB32210.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=450

 Score =   301 bits (770),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_006426173.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
 gb|ESR39413.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
Length=451

 Score =   301 bits (770),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_006466394.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Citrus sinensis]
Length=451

 Score =   301 bits (770),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_008440459.1| PREDICTED: tubulin alpha chain-like isoform X1 [Cucumis melo]
Length=450

 Score =   301 bits (770),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_010507910.1| PREDICTED: tubulin alpha-2 chain-like [Camelina sativa]
 ref|XP_010466126.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Camelina sativa]
 ref|XP_010487911.1| PREDICTED: tubulin alpha-2 chain-like [Camelina sativa]
Length=451

 Score =   301 bits (770),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>dbj|BAP59012.1| alpha tubulin [Taxus cuspidata]
Length=451

 Score =   301 bits (770),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVD+CLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDICLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|AAO73546.1| alpha-tubulin [Ceratopteris richardii]
 gb|AAW57307.1| alpha-tubulin [Ceratopteris richardii]
Length=450

 Score =   301 bits (770),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_007047652.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX91809.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=501

 Score =   302 bits (774),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  98   NSSFAKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFS  277
             S+  KMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD TVGGGDDAFNTFFS
Sbjct  45   QSNHEKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTFFS  104

Query  278  ETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEI  457
            ETG+GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEI
Sbjct  105  ETGSGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEI  164

Query  458  VDLCLDRIRKLADNCTGLQGFLVFNAV  538
            VDLCLDRIRKLADNCTGLQGFLVFNAV
Sbjct  165  VDLCLDRIRKLADNCTGLQGFLVFNAV  191



>gb|ABQ59634.1| alpha-tubulin 5 [Populus tremuloides]
Length=451

 Score =   300 bits (769),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVF DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFADLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|ABO47740.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89777.1| alpha-tubulin 10 [Gossypium hirsutum]
 gb|KHG24734.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB58758.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=450

 Score =   300 bits (769),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_010500556.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Camelina sativa]
Length=462

 Score =   301 bits (770),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|AAX21196.1| putative alpha-tubulin [Solanum betaceum]
Length=204

 Score =   292 bits (747),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 137/141 (97%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGI+PDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPGDVTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVF+AV
Sbjct  121  RIRKLADNCTGLQGFLVFHAV  141



>gb|AIX10966.1| tubulin [Ornithogalum saundersiae]
Length=451

 Score =   300 bits (769),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGI+PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|KDP32140.1| hypothetical protein JCGZ_12601 [Jatropha curcas]
Length=450

 Score =   300 bits (769),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDK+VGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKSVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_011002356.1| PREDICTED: tubulin alpha chain-like [Populus euphratica]
Length=451

 Score =   300 bits (769),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP+DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPNDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|ACU24494.1| unknown [Glycine max]
Length=173

 Score =   290 bits (743),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 136/141 (96%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQG LVFN +
Sbjct  121  RIRKLADNCTGLQGSLVFNLL  141



>ref|XP_002981542.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
 gb|EFJ17357.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
Length=449

 Score =   300 bits (768),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVF+AV
Sbjct  121  RIRKLADNCTGLQGFLVFHAV  141



>gb|ABO47739.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG18532.1| Tubulin alpha-2 chain [Gossypium arboreum]
Length=450

 Score =   300 bits (768),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_002298794.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
 gb|EEE83599.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
Length=451

 Score =   300 bits (768),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|ABK92520.1| unknown [Populus trichocarpa]
Length=451

 Score =   300 bits (768),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>sp|Q6VAG0.1|TBA2_GOSHI RecName: Full=Tubulin alpha-2 chain; AltName: Full=Alpha-2-tubulin 
[Gossypium hirsutum]
 gb|AAQ92662.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|ACM89776.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|KJB77616.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
 gb|KJB77617.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
Length=450

 Score =   300 bits (768),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_011088040.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   300 bits (768),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETG+GK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGSGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|EYU37544.1| hypothetical protein MIMGU_mgv1a007145mg [Erythranthe guttata]
Length=417

 Score =   299 bits (765),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECIS+HIGQAGIQVGN+CWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_010664458.1| PREDICTED: tubulin alpha-4 chain [Vitis vinifera]
 emb|CAN77412.1| hypothetical protein VITISV_000470 [Vitis vinifera]
Length=451

 Score =   300 bits (767),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_009402887.1| PREDICTED: tubulin alpha chain [Musa acuminata subsp. malaccensis]
Length=451

 Score =   300 bits (767),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_010557536.1| PREDICTED: tubulin alpha-4 chain-like isoform X2 [Tarenaya hassleriana]
Length=455

 Score =   300 bits (768),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVF+AV
Sbjct  121  RIRKLADNCTGLQGFLVFHAV  141



>ref|XP_010557535.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   300 bits (767),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVF+AV
Sbjct  121  RIRKLADNCTGLQGFLVFHAV  141



>sp|P33629.1|TBA_PRUDU RecName: Full=Tubulin alpha chain [Prunus dulcis]
 emb|CAA47635.1| alpha-tubulin [Prunus dulcis]
Length=450

 Score =   300 bits (767),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_010266793.1| PREDICTED: tubulin alpha chain [Nelumbo nucifera]
Length=451

 Score =   300 bits (767),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|KFK32793.1| hypothetical protein AALP_AA6G289100 [Arabis alpina]
Length=450

 Score =   300 bits (767),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGN+CWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDE+RTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEIRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_004136930.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 ref|XP_004155416.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 gb|KGN43837.1| Tubulin alpha chain [Cucumis sativus]
Length=450

 Score =   300 bits (767),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGMYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_006601463.1| PREDICTED: tubulin alpha-3 chain-like [Glycine max]
Length=432

 Score =   299 bits (766),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>sp|Q6VAF9.1|TBA4_GOSHI RecName: Full=Tubulin alpha-4 chain; AltName: Full=Alpha-4-tubulin 
[Gossypium hirsutum]
 gb|AAQ92663.1| alpha-tubulin 4 [Gossypium hirsutum]
Length=450

 Score =   300 bits (767),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|ABQ59633.1| alpha-tubulin 3 [Populus tremuloides]
Length=451

 Score =   300 bits (767),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            +VPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   YVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>emb|CAD13176.1| alpha-tubulin [Nicotiana tabacum]
Length=450

 Score =   300 bits (767),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|ADW66593.1| alpha tubulin [Hirschfeldia incana]
Length=355

 Score =   296 bits (759),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/139 (100%), Positives = 139/139 (100%), Gaps = 0/139 (0%)
 Frame = +2

Query  122  ECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHV  301
            ECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHV
Sbjct  1    ECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHV  60

Query  302  PRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRI  481
            PRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRI
Sbjct  61   PRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRI  120

Query  482  RKLADNCTGLQGFLVFNAV  538
            RKLADNCTGLQGFLVFNAV
Sbjct  121  RKLADNCTGLQGFLVFNAV  139



>ref|XP_010104543.1| Tubulin alpha chain [Morus notabilis]
 gb|EXC01144.1| Tubulin alpha chain [Morus notabilis]
Length=448

 Score =   300 bits (767),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|ABB02631.1| unknown [Solanum tuberosum]
Length=450

 Score =   300 bits (767),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_009790136.1| PREDICTED: tubulin alpha chain [Nicotiana sylvestris]
Length=450

 Score =   300 bits (767),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|ABO47737.1| alpha-tubulin [Gossypium hirsutum]
Length=451

 Score =   300 bits (767),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVF+AV
Sbjct  121  RIRKLADNCTGLQGFLVFSAV  141



>ref|XP_009620798.1| PREDICTED: tubulin alpha chain [Nicotiana tomentosiformis]
Length=450

 Score =   300 bits (767),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|AAO23139.1| alpha tubulin [Populus tremuloides]
Length=451

 Score =   300 bits (767),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_003522731.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Glycine max]
Length=452

 Score =   300 bits (767),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|KJB29387.1| hypothetical protein B456_005G097800 [Gossypium raimondii]
Length=451

 Score =   300 bits (767),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVF+AV
Sbjct  121  RIRKLADNCTGLQGFLVFSAV  141



>ref|XP_001764722.1| predicted protein [Physcomitrella patens]
 gb|EDQ70421.1| predicted protein [Physcomitrella patens]
Length=451

 Score =   300 bits (767),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP+DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPADKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_006581474.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
Length=452

 Score =   300 bits (767),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_008455056.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Cucumis melo]
Length=406

 Score =   298 bits (763),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGMYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_004238046.1| PREDICTED: tubulin alpha chain [Solanum lycopersicum]
Length=450

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_006606007.1| PREDICTED: tubulin alpha-4 chain-like isoform X2 [Glycine max]
Length=437

 Score =   299 bits (765),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_010500555.1| PREDICTED: tubulin alpha-6 chain isoform X1 [Camelina sativa]
 ref|XP_010479400.1| PREDICTED: tubulin alpha-6 chain [Camelina sativa]
Length=450

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_006362511.1| PREDICTED: tubulin alpha-1 chain-like [Solanum tuberosum]
Length=450

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_002275973.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
Length=450

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTPGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|KHG20487.1| Tubulin alpha chain [Gossypium arboreum]
Length=451

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVF+AV
Sbjct  121  RIRKLADNCTGLQGFLVFSAV  141



>ref|XP_011014531.1| PREDICTED: tubulin alpha-4 chain-like [Populus euphratica]
Length=451

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVR GTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRPGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_010245599.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=451

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGQYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_004244533.1| PREDICTED: tubulin alpha-3 chain-like [Solanum lycopersicum]
Length=451

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>dbj|BAC24800.1| alpha tubulin [Physcomitrella patens]
Length=451

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDK+VGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKSVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_009605705.1| PREDICTED: tubulin alpha-2 chain-like [Nicotiana tomentosiformis]
 ref|XP_009761158.1| PREDICTED: tubulin alpha-2 chain-like [Nicotiana sylvestris]
 emb|CAD13178.1| alpha-tubulin [Nicotiana tabacum]
Length=451

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_009147859.1| PREDICTED: tubulin alpha-6 chain [Brassica rapa]
Length=450

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|NP_193232.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 sp|P29511.1|TBA6_ARATH RecName: Full=Tubulin alpha-6 chain [Arabidopsis thaliana]
 gb|AAA32892.1| TUA6 [Arabidopsis thaliana]
 emb|CAB10275.1| tubulin alpha-6 chain (TUA6) [Arabidopsis thaliana]
 emb|CAB78538.1| tubulin alpha-6 chain (TUA6) [Arabidopsis thaliana]
 gb|AAL24246.1| AT4g14960/dl3520c [Arabidopsis thaliana]
 gb|AAL38788.1| putative tubulin alpha-6 chain TUA6 [Arabidopsis thaliana]
 gb|AAL79586.1| AT4g14960/dl3520c [Arabidopsis thaliana]
 gb|AAM51249.1| putative tubulin alpha-6 chain TUA6 [Arabidopsis thaliana]
 gb|ABD75335.1| tubulin alpha-1 chain [Brassica rapa subsp. oleifera]
 gb|AEE83530.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 emb|CDY50974.1| BnaA06g37700D [Brassica napus]
 emb|CDY28123.1| BnaC06g03040D [Brassica napus]
Length=450

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|KHN01709.1| Tubulin alpha chain [Glycine soja]
Length=450

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_010461854.1| PREDICTED: tubulin alpha-6 chain-like [Camelina sativa]
Length=450

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_006356798.1| PREDICTED: tubulin alpha chain-like [Solanum tuberosum]
Length=450

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_006589612.1| PREDICTED: tubulin alpha chain-like isoform X2 [Glycine max]
Length=449

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_008787760.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=451

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_008787237.1| PREDICTED: tubulin alpha chain [Phoenix dactylifera]
 ref|XP_010941981.1| PREDICTED: tubulin alpha chain [Elaeis guineensis]
Length=451

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_006662856.1| PREDICTED: tubulin alpha-3 chain-like [Oryza brachyantha]
Length=451

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>sp|Q9ZRR5.1|TBA3_HORVU RecName: Full=Tubulin alpha-3 chain [Hordeum vulgare]
 emb|CAA10663.1| alpha-tubulin 3 [Hordeum vulgare subsp. vulgare]
 gb|ABD92933.1| alpha tubulin-3B [Triticum aestivum]
 gb|ABD92934.1| alpha tubulin-3A [Triticum aestivum]
 gb|ABD92935.1| alpha tubulin-3D [Triticum aestivum]
 dbj|BAJ87680.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS48260.1| Tubulin alpha-3 chain [Triticum urartu]
 gb|EMT18537.1| Tubulin alpha-3 chain [Aegilops tauschii]
Length=451

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_002301128.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
 ref|XP_011017025.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017026.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017027.1| PREDICTED: tubulin alpha chain-like isoform X2 [Populus euphratica]
 gb|AAO63781.1| alpha-tubulin 1 [Populus tremuloides]
 gb|ABK96001.1| unknown [Populus trichocarpa]
 gb|EEE80401.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
Length=451

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|AGE09583.1| TUA1-like protein [Eucalyptus cladocalyx]
 gb|KCW68570.1| hypothetical protein EUGRSUZ_F02183 [Eucalyptus grandis]
Length=420

 Score =   298 bits (763),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFN+V
Sbjct  121  RIRKLADNCTGLQGFLVFNSV  141



>ref|XP_003524707.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Glycine max]
 gb|KHN47565.1| Tubulin alpha chain [Glycine soja]
Length=450

 Score =   299 bits (765),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_002989721.1| hypothetical protein SELMODRAFT_235864 [Selaginella moellendorffii]
 ref|XP_002993678.1| hypothetical protein SELMODRAFT_236787 [Selaginella moellendorffii]
 gb|EFJ05267.1| hypothetical protein SELMODRAFT_236787 [Selaginella moellendorffii]
 gb|EFJ09198.1| hypothetical protein SELMODRAFT_235864 [Selaginella moellendorffii]
Length=451

 Score =   299 bits (765),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPR+VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRSVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            R+RKLADNCTGLQGFLVFNAV
Sbjct  121  RVRKLADNCTGLQGFLVFNAV  141



>ref|XP_010096739.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB65591.1| Tubulin alpha chain [Morus notabilis]
Length=449

 Score =   299 bits (765),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|KDP41548.1| hypothetical protein JCGZ_15955 [Jatropha curcas]
Length=451

 Score =   299 bits (765),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_002989731.1| hypothetical protein SELMODRAFT_130285 [Selaginella moellendorffii]
 ref|XP_002991763.1| hypothetical protein SELMODRAFT_236391 [Selaginella moellendorffii]
 gb|EFJ07167.1| hypothetical protein SELMODRAFT_236391 [Selaginella moellendorffii]
 gb|EFJ09208.1| hypothetical protein SELMODRAFT_130285 [Selaginella moellendorffii]
Length=451

 Score =   299 bits (765),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPR+VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRSVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            R+RKLADNCTGLQGFLVFNAV
Sbjct  121  RVRKLADNCTGLQGFLVFNAV  141



>ref|XP_007205183.1| hypothetical protein PRUPE_ppa005613mg [Prunus persica]
 ref|XP_008236958.1| PREDICTED: tubulin alpha chain-like isoform X1 [Prunus mume]
 gb|EMJ06382.1| hypothetical protein PRUPE_ppa005613mg [Prunus persica]
Length=451

 Score =   299 bits (765),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIHPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_007215369.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
 ref|XP_008230754.1| PREDICTED: tubulin alpha chain-like [Prunus mume]
 gb|EMJ16568.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
Length=450

 Score =   299 bits (765),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVF+AV
Sbjct  121  RIRKLADNCTGLQGFLVFHAV  141



>ref|XP_009614122.1| PREDICTED: tubulin alpha-3 chain [Nicotiana tomentosiformis]
 ref|XP_009787472.1| PREDICTED: tubulin alpha-3 chain [Nicotiana sylvestris]
 emb|CAD13177.1| alpha-tubulin [Nicotiana tabacum]
Length=451

 Score =   299 bits (765),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|ACN40181.1| unknown [Picea sitchensis]
 gb|ACN40840.1| unknown [Picea sitchensis]
Length=450

 Score =   298 bits (764),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVF+AV
Sbjct  121  RIRKLADNCTGLQGFLVFHAV  141



>ref|XP_002283198.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
 ref|XP_006827169.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
 ref|XP_010939541.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
 gb|ERM94406.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
Length=450

 Score =   298 bits (764),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVF+AV
Sbjct  121  RIRKLADNCTGLQGFLVFHAV  141



>ref|XP_003556001.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
 gb|KHN01573.1| Tubulin alpha-4 chain [Glycine soja]
Length=449

 Score =   298 bits (764),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_006573681.1| PREDICTED: tubulin alpha-2 chain-like isoform X2 [Glycine max]
Length=424

 Score =   298 bits (762),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEH IQ DGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHAIQADGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_010936237.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   298 bits (764),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGT+RQLFHPEQLI+GKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTFRQLFHPEQLINGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|ACU19580.1| unknown [Glycine max]
Length=449

 Score =   298 bits (764),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_002964078.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
 ref|XP_002975442.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ23643.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ34411.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
Length=451

 Score =   298 bits (764),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVF+AV
Sbjct  121  RIRKLADNCTGLQGFLVFHAV  141



>ref|NP_001289660.1| tubulin alpha chain-like [Eucalyptus grandis]
 gb|ABS50670.1| alpha-tubulin [Eucalyptus grandis]
Length=451

 Score =   298 bits (764),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFN+V
Sbjct  121  RIRKLADNCTGLQGFLVFNSV  141



>ref|XP_004304311.1| PREDICTED: tubulin alpha-2 chain-like [Fragaria vesca subsp. 
vesca]
Length=450

 Score =   298 bits (764),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVF+AV
Sbjct  121  RIRKLADNCTGLQGFLVFHAV  141



>ref|XP_003536570.1| PREDICTED: tubulin alpha chain-like isoform X1 [Glycine max]
 gb|KHN23177.1| Tubulin alpha chain [Glycine soja]
Length=449

 Score =   298 bits (764),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>sp|Q9FT36.1|TBA_DAUCA RecName: Full=Tubulin alpha chain [Daucus carota]
 gb|AAG02564.1| alpha-tubulin [Daucus carota]
Length=451

 Score =   298 bits (764),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 137/141 (97%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECIS+HIGQAGIQ+GNACWELYCLEHGIQP+GQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQIGNACWELYCLEHGIQPNGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_008379344.1| PREDICTED: tubulin alpha-2 chain [Malus domestica]
Length=450

 Score =   298 bits (764),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVF+AV
Sbjct  121  RIRKLADNCTGLQGFLVFHAV  141



>ref|XP_004496862.1| PREDICTED: tubulin alpha chain-like [Cicer arietinum]
Length=450

 Score =   298 bits (764),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_008341563.1| PREDICTED: tubulin alpha-2 chain-like [Malus domestica]
Length=450

 Score =   298 bits (764),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVF+AV
Sbjct  121  RIRKLADNCTGLQGFLVFHAV  141



>emb|CAB66336.1| alpha-tubulin [Betula pendula]
 gb|AJA29683.1| tubulin alpha chain [Betula luminifera]
Length=451

 Score =   298 bits (764),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGI+PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_010939312.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   298 bits (764),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_008372961.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
Length=450

 Score =   298 bits (764),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECIS+HIGQAGIQVGNACWELYCLEHG+QPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGLQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_006579968.1| PREDICTED: tubulin alpha-3 chain-like isoform X2 [Glycine max]
Length=462

 Score =   299 bits (765),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_004299843.1| PREDICTED: tubulin alpha chain-like [Fragaria vesca subsp. vesca]
 gb|AAK81858.1|AF394915_1 alpha tubulin subunit [Rosa hybrid cultivar]
Length=451

 Score =   298 bits (763),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVG GDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_003635553.2| PREDICTED: tubulin alpha chain-like [Vitis vinifera]
Length=451

 Score =   298 bits (763),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFL FNAV
Sbjct  121  RIRKLADNCTGLQGFLGFNAV  141



>ref|XP_010060142.1| PREDICTED: tubulin alpha chain-like [Eucalyptus grandis]
 gb|KCW66706.1| hypothetical protein EUGRSUZ_F00470 [Eucalyptus grandis]
Length=451

 Score =   298 bits (763),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGN+CWELYC+EHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNSCWELYCVEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFN+V
Sbjct  121  RIRKLADNCTGLQGFLVFNSV  141



>gb|AFV46219.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=440

 Score =   298 bits (762),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +2

Query  110  AKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGA  289
            AKMRECISIHIG+AGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGA
Sbjct  36   AKMRECISIHIGRAGIQVGNACWELYCLEHGIQPDGQMPGDHTVGGGDDAFNTFFSETGA  95

Query  290  GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLC  469
            GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLC
Sbjct  96   GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLC  155

Query  470  LDRIRKLADNCTGLQGFLVFNAV  538
            LDRIRKLADNCTGLQGFLVF+AV
Sbjct  156  LDRIRKLADNCTGLQGFLVFHAV  178



>ref|XP_009388502.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=451

 Score =   298 bits (762),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_004501073.1| PREDICTED: tubulin alpha chain-like [Cicer arietinum]
Length=451

 Score =   298 bits (762),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>sp|P46259.1|TBA1_PEA RecName: Full=Tubulin alpha-1 chain [Pisum sativum]
 gb|AAA79910.1| alpha-tubulin [Pisum sativum]
Length=452

 Score =   298 bits (762),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_007137281.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
 gb|ESW09275.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
Length=451

 Score =   298 bits (762),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRA+FVDLEPTVIDEVR+G YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRSGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_006472373.1| PREDICTED: tubulin alpha chain isoform X2 [Citrus sinensis]
Length=460

 Score =   298 bits (763),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_003603670.1| Tubulin alpha-7 chain [Medicago truncatula]
 gb|AES73921.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   298 bits (762),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>emb|CDP02221.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   297 bits (761),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDHTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVF+AV
Sbjct  121  RIRKLADNCTGLQGFLVFHAV  141



>ref|XP_003608582.1| Tubulin alpha-5 chain [Medicago truncatula]
 gb|AES90779.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   297 bits (761),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVD+CLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDVCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|AHZ58482.1| alpha-tubulin, partial [Syntrichia caninervis]
Length=261

 Score =   291 bits (745),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 134/141 (95%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRE ISIHIGQAGIQVGNACWELYCLEHGIQPDG+MPSD + GGGDDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGRMPSDASTGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            R+RKLADNCTGLQGFLVFNAV
Sbjct  121  RVRKLADNCTGLQGFLVFNAV  141



>gb|KEH43997.1| tubulin beta-1 chain [Medicago truncatula]
Length=450

 Score =   297 bits (761),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECIS+HIGQAGIQVGNACWELYCLEHGI PDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_002976230.1| hypothetical protein SELMODRAFT_105136 [Selaginella moellendorffii]
 ref|XP_002987138.1| hypothetical protein SELMODRAFT_125554 [Selaginella moellendorffii]
 gb|EFJ11714.1| hypothetical protein SELMODRAFT_125554 [Selaginella moellendorffii]
 gb|EFJ22490.1| hypothetical protein SELMODRAFT_105136 [Selaginella moellendorffii]
Length=451

 Score =   297 bits (761),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 135/141 (96%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAG+QVGNACWELYCLEHGIQPDGQMP+DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGVQVGNACWELYCLEHGIQPDGQMPTDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPR+VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRSVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFL+FNAV
Sbjct  121  RIRKLADNCTGLQGFLIFNAV  141



>gb|AAL16174.1|AF428406_1 AT4g14960/dl3520c [Arabidopsis thaliana]
Length=450

 Score =   297 bits (761),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DK VGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKIVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_008219157.1| PREDICTED: tubulin alpha chain-like isoform X2 [Prunus mume]
Length=442

 Score =   297 bits (760),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVG GDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|NP_001067613.1| Os11g0247300 [Oryza sativa Japonica Group]
 sp|Q53M52.1|TBA2_ORYSJ RecName: Full=Tubulin alpha-2 chain [Oryza sativa Japonica Group]
 gb|AAX96762.1| Tubulin/FtsZ family, GTPase domain, putative [Oryza sativa Japonica 
Group]
 gb|AAX96764.1| Tubulin/FtsZ family, GTPase domain, putative [Oryza sativa Japonica 
Group]
 gb|ABA92352.1| Tubulin alpha-3 chain, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABA92353.1| Tubulin alpha-3 chain, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27976.1| Os11g0247300 [Oryza sativa Japonica Group]
 gb|EAY80511.1| hypothetical protein OsI_35689 [Oryza sativa Indica Group]
 gb|EAZ17981.1| hypothetical protein OsJ_33527 [Oryza sativa Japonica Group]
 dbj|BAG95614.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH85357.1| alpha-tubulin [Oryza sativa Japonica Group]
 gb|ADM86870.1| alpha-tubulin [Oryza sativa Japonica Group]
 gb|AFI71279.1| alpha-tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   297 bits (761),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGDYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_009388503.1| PREDICTED: tubulin alpha chain isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=465

 Score =   298 bits (762),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_002972670.1| hypothetical protein SELMODRAFT_231979 [Selaginella moellendorffii]
 ref|XP_002988134.1| hypothetical protein SELMODRAFT_235448 [Selaginella moellendorffii]
 gb|EFJ10926.1| hypothetical protein SELMODRAFT_235448 [Selaginella moellendorffii]
 gb|EFJ25891.1| hypothetical protein SELMODRAFT_231979 [Selaginella moellendorffii]
Length=450

 Score =   297 bits (760),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/141 (97%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPR VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRCVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|KIY93466.1| Tubulin alpha-1 chain [Monoraphidium neglectum]
Length=193

 Score =   288 bits (737),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 134/141 (95%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRE ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPR +F+DLEPTV+DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDL LD
Sbjct  61   HVPRCIFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLALD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|KDO81347.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=451

 Score =   297 bits (760),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_006472372.1| PREDICTED: tubulin alpha chain isoform X1 [Citrus sinensis]
Length=451

 Score =   297 bits (760),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_002962209.1| hypothetical protein SELMODRAFT_230058 [Selaginella moellendorffii]
 ref|XP_002965123.1| hypothetical protein SELMODRAFT_230496 [Selaginella moellendorffii]
 gb|EFJ33961.1| hypothetical protein SELMODRAFT_230496 [Selaginella moellendorffii]
 gb|EFJ37469.1| hypothetical protein SELMODRAFT_230058 [Selaginella moellendorffii]
Length=451

 Score =   297 bits (760),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 135/141 (96%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQ+GNACWEL+CLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQIGNACWELFCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPR+VF+DLEPTV+DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRSVFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGF+VFNAV
Sbjct  121  RIRKLADNCTGLQGFMVFNAV  141



>ref|XP_008804464.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=450

 Score =   297 bits (760),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVF+AV
Sbjct  121  RIRKLADNCTGLQGFLVFHAV  141



>ref|XP_008352751.1| PREDICTED: tubulin alpha chain isoform X2 [Malus domestica]
Length=449

 Score =   297 bits (760),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVG GDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|ACH68563.1| alpha-tubulin [Solanum tuberosum]
Length=449

 Score =   297 bits (760),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/140 (99%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  119  RECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKH  298
            RECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGKH
Sbjct  1    RECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGKH  60

Query  299  VPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  478
            VPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR
Sbjct  61   VPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  120

Query  479  IRKLADNCTGLQGFLVFNAV  538
            IRKLADNCTGLQGFLVFNAV
Sbjct  121  IRKLADNCTGLQGFLVFNAV  140



>ref|XP_008455054.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Cucumis melo]
Length=451

 Score =   297 bits (760),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGMYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>dbj|BAB19779.1| alpha tubulin [Nicotiana tabacum]
Length=450

 Score =   296 bits (759),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLF PEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFRPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_009357231.1| PREDICTED: tubulin alpha chain-like isoform X2 [Pyrus x bretschneideri]
Length=446

 Score =   296 bits (759),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVG GDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_002963092.1| hypothetical protein SELMODRAFT_78469 [Selaginella moellendorffii]
 ref|XP_002980241.1| hypothetical protein SELMODRAFT_112368 [Selaginella moellendorffii]
 gb|EFJ18501.1| hypothetical protein SELMODRAFT_112368 [Selaginella moellendorffii]
 gb|EFJ36555.1| hypothetical protein SELMODRAFT_78469 [Selaginella moellendorffii]
Length=451

 Score =   296 bits (759),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 135/141 (96%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQ+GNACWEL+CLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQIGNACWELFCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPR+VF+DLEPTV+DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRSVFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGF+VFNAV
Sbjct  121  RIRKLADNCTGLQGFMVFNAV  141



>ref|XP_007155784.1| hypothetical protein PHAVU_003G231500g [Phaseolus vulgaris]
 gb|ESW27778.1| hypothetical protein PHAVU_003G231500g [Phaseolus vulgaris]
Length=450

 Score =   296 bits (759),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_002962630.1| hypothetical protein SELMODRAFT_230143 [Selaginella moellendorffii]
 ref|XP_002980460.1| hypothetical protein SELMODRAFT_233518 [Selaginella moellendorffii]
 gb|EFJ18720.1| hypothetical protein SELMODRAFT_233518 [Selaginella moellendorffii]
 gb|EFJ36093.1| hypothetical protein SELMODRAFT_230143 [Selaginella moellendorffii]
Length=452

 Score =   296 bits (759),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDG MPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGTMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVF+AV
Sbjct  121  RIRKLADNCTGLQGFLVFHAV  141



>gb|ABP65320.1| alpha tubulin [Capsicum annuum]
Length=450

 Score =   296 bits (759),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFL FNAV
Sbjct  121  RIRKLADNCTGLQGFLDFNAV  141



>sp|Q6VAG1.1|TBA1_GOSHI RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Gossypium hirsutum]
 gb|AAQ92661.1| alpha-tubulin 1 [Gossypium hirsutum]
Length=451

 Score =   296 bits (759),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAF TFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFYTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVF+AV
Sbjct  121  RIRKLADNCTGLQGFLVFSAV  141



>ref|XP_002517492.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF45034.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   296 bits (759),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVF+AV
Sbjct  121  RIRKLADNCTGLQGFLVFHAV  141



>dbj|BAJ98211.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=449

 Score =   296 bits (758),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 135/141 (96%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRE ISIH+GQAGIQ+GNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MREVISIHVGQAGIQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVF+DLEPTV+DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|ABD92930.1| alpha tubulin-2A [Triticum aestivum]
 gb|ABD92931.1| alpha tubulin-2D [Triticum aestivum]
 gb|ABD92932.1| alpha tubulin-2B [Triticum aestivum]
 gb|EMS59370.1| Tubulin alpha chain [Triticum urartu]
 gb|EMT25007.1| Tubulin alpha chain [Aegilops tauschii]
Length=451

 Score =   296 bits (758),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKL+DNCTGLQGFLVFNAV
Sbjct  121  RIRKLSDNCTGLQGFLVFNAV  141



>sp|Q96460.1|TBA2_HORVU RecName: Full=Tubulin alpha-2 chain [Hordeum vulgare]
 emb|CAA69724.1| alpha-tubulin 2 [Hordeum vulgare subsp. vulgare]
Length=451

 Score =   296 bits (758),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKL+DNCTGLQGFLVFNAV
Sbjct  121  RIRKLSDNCTGLQGFLVFNAV  141



>ref|XP_010680774.1| PREDICTED: tubulin alpha-2 chain [Beta vulgaris subsp. vulgaris]
Length=451

 Score =   296 bits (758),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_004981922.1| PREDICTED: tubulin alpha-1 chain-like [Setaria italica]
 emb|CAE52515.1| alpha tubulin [Setaria viridis]
Length=451

 Score =   296 bits (758),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|AAB08791.1| alpha tubulin [Hordeum vulgare subsp. vulgare]
Length=451

 Score =   296 bits (758),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKL+DNCTGLQGFLVFNAV
Sbjct  121  RIRKLSDNCTGLQGFLVFNAV  141



>ref|XP_007156677.1| hypothetical protein PHAVU_002G007900g [Phaseolus vulgaris]
 gb|ESW28671.1| hypothetical protein PHAVU_002G007900g [Phaseolus vulgaris]
Length=451

 Score =   296 bits (758),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            R+RKLADNCTGLQGFLVFNAV
Sbjct  121  RVRKLADNCTGLQGFLVFNAV  141



>sp|Q9ZRB7.1|TBA_WHEAT RecName: Full=Tubulin alpha chain [Triticum aestivum]
 gb|AAD10486.1| alpha-tubulin [Triticum aestivum]
Length=451

 Score =   296 bits (758),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKL+DNCTGLQGFLVFNAV
Sbjct  121  RIRKLSDNCTGLQGFLVFNAV  141



>ref|NP_001291325.1| tubulin alpha chain-like [Sesamum indicum]
 gb|AFJ42573.1| alpha-tubulin [Sesamum indicum]
Length=450

 Score =   296 bits (758),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP D+TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDQTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVF+AV
Sbjct  121  RIRKLADNCTGLQGFLVFHAV  141



>gb|AIX10773.1| alpha tubulin [Panax notoginseng]
Length=451

 Score =   296 bits (758),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVR+G YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_004150268.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_004156870.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_008454421.1| PREDICTED: tubulin alpha chain [Cucumis melo]
 gb|ADN33817.1| tubulin alpha chain [Cucumis melo subsp. melo]
 gb|KGN52737.1| Tubulin alpha chain [Cucumis sativus]
Length=450

 Score =   296 bits (757),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 137/141 (97%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP D T+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTLGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>dbj|BAJ06362.1| alpha-tubulin [Alopecurus aequalis]
Length=451

 Score =   296 bits (757),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_003560377.1| PREDICTED: tubulin alpha-1 chain [Brachypodium distachyon]
Length=451

 Score =   296 bits (757),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_001427644.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK60246.1| unnamed protein product [Paramecium tetraurelia]
Length=189

 Score =   287 bits (734),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 133/141 (94%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRE ISIH+GQ GIQVGNACWEL+CLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MREVISIHVGQGGIQVGNACWELFCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVF++V
Sbjct  121  RIRKLADNCTGLQGFLVFHSV  141



>ref|XP_009618479.1| PREDICTED: tubulin alpha-3 chain-like [Nicotiana tomentosiformis]
Length=451

 Score =   296 bits (757),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 137/141 (97%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSET +GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETSSGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIG+EIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGREIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>emb|CAA06619.1| alpha-tubulin 1 [Eleusine indica]
Length=451

 Score =   296 bits (757),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_005851144.1| alpha-tubulin [Chlorella variabilis]
 gb|EFN59042.1| alpha-tubulin [Chlorella variabilis]
Length=450

 Score =   296 bits (757),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRE ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPR VFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRCVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_003517369.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Glycine max]
Length=451

 Score =   296 bits (757),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEH IQ DGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHAIQADGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>sp|O22347.1|TBA1_ELEIN RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Eleusine indica]
 gb|AAC05717.1| alpha tubulin 1 [Eleusine indica]
 emb|CAA06618.1| alpha-tubulin 1 [Eleusine indica]
 gb|AFC88823.1| putative tubulin alpha-1 chain [Miscanthus sinensis]
 gb|AFC88833.1| tubulin alpha-1 chain [Miscanthus sinensis]
Length=451

 Score =   296 bits (757),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|AFC88832.1| putative tubulin alpha-3 chain [Miscanthus sinensis]
Length=451

 Score =   296 bits (757),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|AHJ80817.1| Tua1 [Eragrostis tef]
Length=451

 Score =   296 bits (757),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|AHJ80822.1| Tua1 [Eragrostis tef]
Length=451

 Score =   296 bits (757),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|AHJ80815.1| Tua1 [Eragrostis tef]
Length=451

 Score =   296 bits (757),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_009779180.1| PREDICTED: tubulin alpha-3 chain-like [Nicotiana sylvestris]
Length=451

 Score =   296 bits (757),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 137/141 (97%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSET +GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETSSGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIG+EIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGREIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLAD+CTGLQGFLVFNAV
Sbjct  121  RIRKLADSCTGLQGFLVFNAV  141



>ref|NP_001167663.1| tubulin alpha-3 chain [Zea mays]
 gb|ACG26907.1| tubulin alpha-3 chain [Zea mays]
 gb|AFW67746.1| alpha tubulin4 isoform 1 [Zea mays]
 gb|AFW67747.1| alpha tubulin4 isoform 2 [Zea mays]
Length=451

 Score =   296 bits (757),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_008665337.1| PREDICTED: tubulin alpha-1 chain-like [Zea mays]
 sp|P14640.1|TBA1_MAIZE RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Zea mays]
 emb|CAA33734.1| alpha1-tubulin [Zea mays]
 tpg|DAA51112.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51113.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51114.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51117.1| TPA: tubulin alpha-1 chain [Zea mays]
Length=451

 Score =   296 bits (757),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_008665339.1| PREDICTED: tubulin alpha-2 chain [Zea mays]
 sp|P14641.1|TBA2_MAIZE RecName: Full=Tubulin alpha-2 chain; AltName: Full=Alpha-2-tubulin 
[Zea mays]
 emb|CAA33733.1| alpha2-tubulin [Zea mays]
 tpg|DAA51111.1| TPA: tubulin alpha-2 chain [Zea mays]
Length=451

 Score =   296 bits (757),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_007143142.1| hypothetical protein PHAVU_007G047300g [Phaseolus vulgaris]
 gb|ESW15136.1| hypothetical protein PHAVU_007G047300g [Phaseolus vulgaris]
Length=449

 Score =   295 bits (756),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_003539228.1| PREDICTED: tubulin alpha-2 chain-like [Glycine max]
 gb|KHN13032.1| Tubulin alpha-2 chain [Glycine soja]
Length=451

 Score =   295 bits (756),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 137/141 (97%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEH IQ DGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHAIQADGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDE+RTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEIRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_011098608.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   295 bits (756),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDHTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVF+AV
Sbjct  121  RIRKLADNCTGLQGFLVFHAV  141



>ref|XP_002963093.1| hypothetical protein SELMODRAFT_404672 [Selaginella moellendorffii]
 gb|EFJ36556.1| hypothetical protein SELMODRAFT_404672 [Selaginella moellendorffii]
Length=451

 Score =   295 bits (756),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 134/140 (96%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQ+GNACWEL+CLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQIGNACWELFCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPR+VF+DLEPTV+DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRSVFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNA  535
            RIRKLADNCTGLQGF+VFNA
Sbjct  121  RIRKLADNCTGLQGFMVFNA  140



>gb|ABV55999.1| alpha-tubulin 7 [Populus tremuloides]
Length=451

 Score =   295 bits (756),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 137/141 (97%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKE+AANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKENAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVF+AV
Sbjct  121  RIRKLADNCTGLQGFLVFHAV  141



>gb|AHJ80816.1| Tua1 [Eragrostis tef]
Length=451

 Score =   295 bits (756),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_006650518.1| PREDICTED: tubulin alpha-1 chain-like [Oryza brachyantha]
Length=451

 Score =   295 bits (756),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGGYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_007223365.1| hypothetical protein PRUPE_ppa005617mg [Prunus persica]
 ref|XP_008219156.1| PREDICTED: tubulin alpha chain-like isoform X1 [Prunus mume]
 ref|XP_008347836.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
 ref|XP_008352750.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
 ref|XP_009357230.1| PREDICTED: tubulin alpha chain-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009335481.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
 gb|EMJ24564.1| hypothetical protein PRUPE_ppa005617mg [Prunus persica]
Length=451

 Score =   295 bits (755),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVG GDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|AGV54441.1| tubulin alpha-2 chain-like protein [Phaseolus vulgaris]
Length=448

 Score =   295 bits (755),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_006482577.1| PREDICTED: tubulin alpha-2 chain-like isoform X2 [Citrus sinensis]
Length=425

 Score =   294 bits (753),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/141 (97%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQM SDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMLSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVF+AV
Sbjct  121  RIRKLADNCTGLQGFLVFHAV  141



>ref|XP_008347837.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Malus domestica]
Length=459

 Score =   295 bits (756),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVG GDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_002980239.1| hypothetical protein SELMODRAFT_233509 [Selaginella moellendorffii]
 gb|EFJ18499.1| hypothetical protein SELMODRAFT_233509 [Selaginella moellendorffii]
Length=451

 Score =   295 bits (755),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 134/140 (96%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQ+GNACWEL+CLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQIGNACWELFCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPR+VF+DLEPTV+DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRSVFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNA  535
            RIRKLADNCTGLQGF+VFNA
Sbjct  121  RIRKLADNCTGLQGFMVFNA  140



>gb|AGG37289.1| alpha-tubulin 7 [Salix arbutifolia]
Length=450

 Score =   295 bits (754),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/141 (97%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVF+AV
Sbjct  121  RIRKLADNCTGLQGFLVFHAV  141



>ref|XP_011008936.1| PREDICTED: tubulin alpha chain [Populus euphratica]
Length=451

 Score =   295 bits (755),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/141 (97%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVF+AV
Sbjct  121  RIRKLADNCTGLQGFLVFHAV  141



>emb|CAA62917.1| alfa-tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   295 bits (755),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/141 (97%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPT+IDEVRTG YRQLFHPEQ+ISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTMIDEVRTGDYRQLFHPEQVISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>gb|AAQ81585.1| putative tubulin alpha-2/alpha-4 chain [Brassica napus]
Length=450

 Score =   295 bits (754),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            M ECISIH+GQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MGECISIHMGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_002508010.1| alpha tubulin 2 [Micromonas sp. RCC299]
 ref|XP_002506067.1| alpha tubulin 1 [Micromonas sp. RCC299]
 gb|ACO67325.1| alpha tubulin 1 [Micromonas sp. RCC299]
 gb|ACO69268.1| alpha tubulin 2 [Micromonas sp. RCC299]
Length=449

 Score =   295 bits (754),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 136/141 (96%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRE ISIHIGQAGIQ GNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MREVISIHIGQAGIQTGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGF+VFNAV
Sbjct  121  RIRKLADNCTGLQGFMVFNAV  141



>ref|XP_005643073.1| tubulin alpha chain [Coccomyxa subellipsoidea C-169]
 sp|Q9ZRJ4.1|TBA_CHLVU RecName: Full=Tubulin alpha chain [Chlorella vulgaris]
 dbj|BAA03955.1| alpha-tubulin [Chlorella vulgaris]
 gb|EIE18529.1| tubulin alpha chain [Coccomyxa subellipsoidea C-169]
Length=451

 Score =   295 bits (754),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/141 (97%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRE ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPR VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRCVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_005651460.1| tubulin alpha chain [Coccomyxa subellipsoidea C-169]
 gb|EIE26916.1| tubulin alpha chain [Coccomyxa subellipsoidea C-169]
Length=451

 Score =   295 bits (754),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/141 (97%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRE ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPR VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRCVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_006338461.1| PREDICTED: tubulin alpha-3 chain-like isoform X2 [Solanum tuberosum]
Length=434

 Score =   294 bits (752),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/141 (97%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGI+PDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPGDVTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVF+AV
Sbjct  121  RIRKLADNCTGLQGFLVFHAV  141



>sp|P33623.1|TBA1_ANEPH RecName: Full=Tubulin alpha-1 chain [Anemia phyllitidis]
 emb|CAA48927.1| alpha tubulin [Anemia phyllitidis]
Length=451

 Score =   294 bits (753),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNA WELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNARWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVF+AV
Sbjct  121  RIRKLADNCTGLQGFLVFHAV  141



>gb|ABG78593.1| alpha-tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   294 bits (753),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/141 (97%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEHGIQP+GQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPEGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHY+IGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGDYRQLFHPEQLISGKEDAANNFARGHYSIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



>ref|XP_002973792.1| hypothetical protein SELMODRAFT_100162 [Selaginella moellendorffii]
 ref|XP_002983604.1| hypothetical protein SELMODRAFT_234301 [Selaginella moellendorffii]
 gb|EFJ15505.1| hypothetical protein SELMODRAFT_234301 [Selaginella moellendorffii]
 gb|EFJ24747.1| hypothetical protein SELMODRAFT_100162 [Selaginella moellendorffii]
Length=451

 Score =   294 bits (753),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 134/141 (95%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQ+GNACWEL+CLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQIGNACWELFCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPR VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRCVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            R+RKLADNCTGLQGFLVF+AV
Sbjct  121  RVRKLADNCTGLQGFLVFHAV  141



>gb|KHN42598.1| Tubulin alpha-2 chain [Glycine soja]
Length=451

 Score =   294 bits (753),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/141 (97%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  116  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  295
            MRECISIHIGQAGIQVGNACWELYCLEH IQ DGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHAIQADGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  296  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  475
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVNLCLD  120

Query  476  RIRKLADNCTGLQGFLVFNAV  538
            RIRKLADNCTGLQGFLVFNAV
Sbjct  121  RIRKLADNCTGLQGFLVFNAV  141



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 788578232940