BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF040J11

Length=566
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009786662.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    197   1e-57   Nicotiana sylvestris
ref|XP_009601249.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    196   4e-57   Nicotiana tomentosiformis
emb|CAA06925.1|  Avr9 elicitor response protein                         196   4e-57   Nicotiana tabacum [American tobacco]
emb|CDP18301.1|  unnamed protein product                                180   4e-51   Coffea canephora [robusta coffee]
ref|XP_004250351.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    166   9e-46   Solanum lycopersicum
ref|XP_006364960.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    166   1e-45   Solanum tuberosum [potatoes]
ref|XP_010245068.1|  PREDICTED: beta-1,3-galactosyltransferase 7        159   3e-43   Nelumbo nucifera [Indian lotus]
ref|XP_002285826.1|  PREDICTED: beta-1,3-galactosyltransferase 7        156   5e-42   Vitis vinifera
gb|EYU23928.1|  hypothetical protein MIMGU_mgv1a007764mg                155   2e-41   Erythranthe guttata [common monkey flower]
ref|XP_007018920.1|  Galactosyltransferase family protein               155   4e-41   
ref|XP_007222961.1|  hypothetical protein PRUPE_ppa006755mg             153   7e-41   
ref|XP_008233935.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    151   5e-40   Prunus mume [ume]
gb|KHN06134.1|  Beta-1,3-galactosyltransferase 7                        150   1e-39   Glycine soja [wild soybean]
ref|XP_006596309.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    150   1e-39   Glycine max [soybeans]
gb|ACU18574.1|  unknown                                                 143   4e-39   Glycine max [soybeans]
gb|KJB64379.1|  hypothetical protein B456_010G046600                    147   8e-39   Gossypium raimondii
ref|XP_004300420.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    147   9e-39   Fragaria vesca subsp. vesca
ref|XP_009367326.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    147   1e-38   Pyrus x bretschneideri [bai li]
ref|XP_010095510.1|  Beta-1,3-galactosyltransferase 7                   147   1e-38   Morus notabilis
ref|XP_008338811.1|  PREDICTED: beta-1,3-galactosyltransferase 7        146   2e-38   
ref|XP_008233934.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    146   3e-38   Prunus mume [ume]
ref|XP_010672363.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    146   3e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006846610.1|  hypothetical protein AMTR_s00156p00023720          146   4e-38   Amborella trichopoda
ref|XP_008233933.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    145   5e-38   Prunus mume [ume]
ref|XP_008378526.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    145   1e-37   Malus domestica [apple tree]
gb|KHG03200.1|  Beta-1,3-galactosyltransferase 7 -like protein          144   1e-37   Gossypium arboreum [tree cotton]
ref|XP_003542690.1|  PREDICTED: beta-1,3-galactosyltransferase 7        144   2e-37   Glycine max [soybeans]
ref|XP_008352694.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    144   2e-37   
ref|XP_009367325.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    143   5e-37   Pyrus x bretschneideri [bai li]
gb|KJB64381.1|  hypothetical protein B456_010G046600                    142   8e-37   Gossypium raimondii
ref|XP_011465327.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    142   9e-37   Fragaria vesca subsp. vesca
ref|XP_009367324.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    142   1e-36   Pyrus x bretschneideri [bai li]
ref|XP_008802092.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    142   1e-36   Phoenix dactylifera
ref|XP_011097468.1|  PREDICTED: beta-1,3-galactosyltransferase 7        141   2e-36   Sesamum indicum [beniseed]
ref|XP_008233932.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    141   2e-36   Prunus mume [ume]
ref|XP_010916559.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    140   3e-36   Elaeis guineensis
ref|XP_010672316.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    140   4e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004515661.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    140   5e-36   Cicer arietinum [garbanzo]
ref|XP_008378524.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    140   5e-36   Malus domestica [apple tree]
ref|XP_008378523.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    139   1e-35   Malus domestica [apple tree]
ref|XP_010063328.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    138   3e-35   Eucalyptus grandis [rose gum]
ref|XP_009367010.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    138   4e-35   Pyrus x bretschneideri [bai li]
gb|KDP32735.1|  hypothetical protein JCGZ_12027                         137   5e-35   Jatropha curcas
ref|XP_009367323.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    137   5e-35   Pyrus x bretschneideri [bai li]
gb|ACJ83270.1|  unknown                                                 132   6e-35   Medicago truncatula
ref|XP_002513842.1|  Beta-1,3-galactosyltransferase sqv-2, putative     136   2e-34   Ricinus communis
gb|AGV54547.1|  beta-1,3-galactosyltransferase 7-like protein           132   2e-34   Phaseolus vulgaris [French bean]
ref|XP_004515660.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    135   2e-34   Cicer arietinum [garbanzo]
ref|XP_008378522.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    134   6e-34   Malus domestica [apple tree]
ref|XP_008776410.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    129   7e-34   
ref|XP_010063329.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    134   9e-34   Eucalyptus grandis [rose gum]
ref|XP_002269415.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    134   1e-33   Vitis vinifera
gb|EYU22897.1|  hypothetical protein MIMGU_mgv1a007777mg                133   2e-33   Erythranthe guttata [common monkey flower]
ref|XP_010063326.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    132   3e-33   Eucalyptus grandis [rose gum]
ref|XP_007136194.1|  hypothetical protein PHAVU_009G026100g             131   1e-32   Phaseolus vulgaris [French bean]
ref|XP_003601133.1|  Avr9 elicitor response protein                     130   2e-32   Medicago truncatula
ref|XP_010652984.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    129   4e-32   Vitis vinifera
ref|XP_010063327.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    129   8e-32   Eucalyptus grandis [rose gum]
ref|XP_011074895.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    127   3e-31   Sesamum indicum [beniseed]
ref|XP_004952712.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    126   5e-31   Setaria italica
ref|XP_010416738.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    126   7e-31   Camelina sativa [gold-of-pleasure]
gb|AFK48973.1|  unknown                                                 126   7e-31   Lotus japonicus
gb|ACF79671.1|  unknown                                                 126   7e-31   Zea mays [maize]
ref|XP_003601132.1|  Avr9 elicitor response protein                     126   9e-31   Medicago truncatula
ref|XP_010943123.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    125   2e-30   Elaeis guineensis
ref|XP_010471981.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    125   2e-30   Camelina sativa [gold-of-pleasure]
ref|NP_001131318.1|  uncharacterized protein LOC100192632               124   2e-30   
ref|XP_010471978.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    125   3e-30   Camelina sativa [gold-of-pleasure]
ref|XP_006390051.1|  hypothetical protein EUTSA_v10018693mg             124   3e-30   Eutrema salsugineum [saltwater cress]
ref|XP_006647402.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    124   3e-30   Oryza brachyantha
ref|XP_006301157.1|  hypothetical protein CARUB_v10021555mg             124   5e-30   Capsella rubella
dbj|BAD17751.1|  putative avr9 elicitor response protein                124   6e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010428866.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    122   1e-29   Camelina sativa [gold-of-pleasure]
ref|XP_002454032.1|  hypothetical protein SORBIDRAFT_04g023470          122   1e-29   
ref|XP_010534616.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    121   4e-29   Tarenaya hassleriana [spider flower]
ref|XP_010416737.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    121   6e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010277678.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    120   1e-28   Nelumbo nucifera [Indian lotus]
ref|XP_010471979.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    119   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_008782246.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    119   2e-28   Phoenix dactylifera
ref|XP_010471980.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    119   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010471977.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    119   2e-28   Camelina sativa [gold-of-pleasure]
ref|NP_974164.2|  beta-1,3-galactosyltransferase 7                      119   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006304002.1|  hypothetical protein CARUB_v10011446mg             118   5e-28   Capsella rubella
ref|XP_007141114.1|  hypothetical protein PHAVU_008G168500g             118   6e-28   Phaseolus vulgaris [French bean]
ref|XP_008681428.1|  PREDICTED: hypothetical protein isoform X1         117   7e-28   
ref|XP_010428865.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    117   1e-27   Camelina sativa [gold-of-pleasure]
gb|EPS64555.1|  hypothetical protein M569_10226                         117   1e-27   Genlisea aurea
gb|ACG41551.1|  avr9 elicitor response protein                          117   2e-27   Zea mays [maize]
ref|XP_009414059.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    116   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003575190.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    116   2e-27   Brachypodium distachyon [annual false brome]
ref|XP_010477453.1|  PREDICTED: probable beta-1,3-galactosyltrans...    116   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_002889162.1|  galactosyltransferase family protein               116   3e-27   
ref|XP_010498661.1|  PREDICTED: probable beta-1,3-galactosyltrans...    116   3e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010459924.1|  PREDICTED: probable beta-1,3-galactosyltrans...    116   3e-27   Camelina sativa [gold-of-pleasure]
dbj|BAK03918.1|  predicted protein                                      116   3e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009401434.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    115   6e-27   Musa acuminata subsp. malaccensis [pisang utan]
gb|AHL38868.1|  glycosyltransferase                                     113   3e-26   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177904.3|  beta-1,3-galactosyltransferase 7                      113   3e-26   
ref|NP_564154.1|  putative beta-1,3-galactosyltransferase 5             110   2e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008444117.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    110   3e-25   Cucumis melo [Oriental melon]
ref|XP_003523469.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    110   3e-25   Glycine max [soybeans]
gb|AAG51626.1|AC012193_8  putative (Avr9) elicitor response prote...    109   7e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893206.1|  hypothetical protein ARALYDRAFT_472435             108   1e-24   
gb|KGN54610.1|  hypothetical protein Csa_4G377730                       107   2e-24   Cucumis sativus [cucumbers]
ref|XP_002306601.2|  galactosyltransferase family protein               107   2e-24   
ref|XP_010539626.1|  PREDICTED: beta-1,3-galactosyltransferase 7        107   3e-24   Tarenaya hassleriana [spider flower]
ref|XP_006416240.1|  hypothetical protein EUTSA_v10009382mg             107   5e-24   
ref|XP_010911041.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    107   5e-24   Elaeis guineensis
ref|XP_002302264.1|  galactosyltransferase family protein               106   6e-24   Populus trichocarpa [western balsam poplar]
ref|XP_008444116.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    106   1e-23   Cucumis melo [Oriental melon]
ref|XP_003526605.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    105   1e-23   Glycine max [soybeans]
ref|XP_004142613.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    105   2e-23   
ref|XP_006578989.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    105   3e-23   Glycine max [soybeans]
ref|XP_011027637.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    103   9e-23   Populus euphratica
gb|EMT29795.1|  hypothetical protein F775_06766                         100   9e-23   
ref|XP_002894028.1|  hypothetical protein ARALYDRAFT_891474             100   2e-22   
ref|XP_011027638.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    101   5e-22   Populus euphratica
gb|AGZ15279.1|  putative Avr9 elicitor response protein                 100   7e-22   Taraxacum brevicorniculatum
ref|XP_006581562.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    100   9e-22   Glycine max [soybeans]
gb|KCW70544.1|  hypothetical protein EUGRSUZ_F03738                     100   1e-21   Eucalyptus grandis [rose gum]
ref|XP_009106424.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...  99.4    2e-21   Brassica rapa
ref|XP_011027635.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...  97.8    7e-21   Populus euphratica
gb|KFK42175.1|  hypothetical protein AALP_AA2G220800                  96.7    2e-20   Arabis alpina [alpine rockcress]
gb|KFK44305.1|  hypothetical protein AALP_AA1G240600                  96.7    2e-20   Arabis alpina [alpine rockcress]
ref|XP_011027636.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...  95.9    4e-20   Populus euphratica
dbj|BAJ94062.1|  predicted protein                                    95.9    4e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT26667.1|  Beta-1,3-galactosyltransferase 7                      95.9    4e-20   
ref|XP_009106423.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...  93.6    2e-19   Brassica rapa
emb|CDY38836.1|  BnaC08g20100D                                        92.8    5e-19   Brassica napus [oilseed rape]
ref|XP_009110158.1|  PREDICTED: probable beta-1,3-galactosyltrans...  92.8    6e-19   Brassica rapa
ref|XP_004172861.1|  PREDICTED: probable beta-1,3-galactosyltrans...  91.3    6e-19   
ref|XP_010923857.1|  PREDICTED: probable beta-1,3-galactosyltrans...  92.0    7e-19   Elaeis guineensis
ref|XP_010923856.1|  PREDICTED: probable beta-1,3-galactosyltrans...  92.8    7e-19   Elaeis guineensis
ref|XP_010923855.1|  PREDICTED: probable beta-1,3-galactosyltrans...  92.0    1e-18   
ref|XP_009353286.1|  PREDICTED: probable beta-1,3-galactosyltrans...  92.0    1e-18   Pyrus x bretschneideri [bai li]
ref|XP_008379640.1|  PREDICTED: probable beta-1,3-galactosyltrans...  91.7    1e-18   Malus domestica [apple tree]
ref|XP_002279814.2|  PREDICTED: probable beta-1,3-galactosyltrans...  91.7    2e-18   Vitis vinifera
gb|KDO54672.1|  hypothetical protein CISIN_1g015407mg                 91.7    2e-18   Citrus sinensis [apfelsine]
ref|XP_006469680.1|  PREDICTED: probable beta-1,3-galactosyltrans...  91.7    2e-18   Citrus sinensis [apfelsine]
gb|KFK42176.1|  hypothetical protein AALP_AA2G220800                  91.3    2e-18   Arabis alpina [alpine rockcress]
ref|XP_004150699.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...  91.3    2e-18   Cucumis sativus [cucumbers]
ref|XP_004149353.1|  PREDICTED: probable beta-1,3-galactosyltrans...  91.3    2e-18   Cucumis sativus [cucumbers]
ref|XP_008463407.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...  91.3    2e-18   
ref|XP_006434095.1|  hypothetical protein CICLE_v10001364mg           90.9    2e-18   Citrus clementina [clementine]
gb|KDP39142.1|  hypothetical protein JCGZ_00899                       90.9    3e-18   Jatropha curcas
ref|XP_011463344.1|  PREDICTED: probable beta-1,3-galactosyltrans...  90.9    3e-18   Fragaria vesca subsp. vesca
ref|XP_009777689.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...  90.9    3e-18   Nicotiana sylvestris
gb|KDO80824.1|  hypothetical protein CISIN_1g015683mg                 90.5    3e-18   Citrus sinensis [apfelsine]
ref|XP_006472695.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...  90.5    3e-18   Citrus sinensis [apfelsine]
ref|XP_008342011.1|  PREDICTED: probable beta-1,3-galactosyltrans...  90.5    4e-18   Malus domestica [apple tree]
ref|XP_006469679.1|  PREDICTED: probable beta-1,3-galactosyltrans...  90.1    6e-18   Citrus sinensis [apfelsine]
gb|KDO54671.1|  hypothetical protein CISIN_1g015407mg                 90.1    6e-18   Citrus sinensis [apfelsine]
gb|KJB59160.1|  hypothetical protein B456_009G242100                  89.4    8e-18   Gossypium raimondii
ref|XP_008445355.1|  PREDICTED: beta-1,3-galactosyltransferase 7      89.4    1e-17   Cucumis melo [Oriental melon]
ref|XP_009353285.1|  PREDICTED: probable beta-1,3-galactosyltrans...  89.4    1e-17   Pyrus x bretschneideri [bai li]
ref|XP_009610750.1|  PREDICTED: probable beta-1,3-galactosyltrans...  89.0    1e-17   Nicotiana tomentosiformis
ref|XP_007215470.1|  hypothetical protein PRUPE_ppa006530mg           89.0    2e-17   Prunus persica
ref|XP_004287949.1|  PREDICTED: probable beta-1,3-galactosyltrans...  89.0    2e-17   Fragaria vesca subsp. vesca
ref|XP_008379639.1|  PREDICTED: probable beta-1,3-galactosyltrans...  89.0    2e-17   Malus domestica [apple tree]
emb|CDX88390.1|  BnaC06g38340D                                        88.6    2e-17   
gb|AFW71913.1|  hypothetical protein ZEAMMB73_862603                  84.0    2e-17   
ref|XP_006346208.1|  PREDICTED: probable beta-1,3-galactosyltrans...  88.6    2e-17   Solanum tuberosum [potatoes]
ref|XP_007020793.1|  Galactosyltransferase family protein             88.6    2e-17   
gb|KJB80506.1|  hypothetical protein B456_013G101400                  87.4    2e-17   Gossypium raimondii
ref|XP_009774309.1|  PREDICTED: probable beta-1,3-galactosyltrans...  88.2    3e-17   Nicotiana sylvestris
ref|XP_009607565.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...  87.8    3e-17   Nicotiana tomentosiformis
gb|KJB62838.1|  hypothetical protein B456_009G440200                  87.0    3e-17   Gossypium raimondii
ref|XP_010657203.1|  PREDICTED: probable beta-1,3-galactosyltrans...  88.2    3e-17   Vitis vinifera
gb|KDO54670.1|  hypothetical protein CISIN_1g015407mg                 88.2    3e-17   Citrus sinensis [apfelsine]
ref|XP_006447568.1|  hypothetical protein CICLE_v10015443mg           88.2    3e-17   Citrus clementina [clementine]
gb|KJB80508.1|  hypothetical protein B456_013G101400                  87.4    5e-17   Gossypium raimondii
ref|XP_004245304.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...  87.4    6e-17   Solanum lycopersicum
ref|NP_001063339.1|  Os09g0452900                                     87.0    6e-17   
gb|KJB80505.1|  hypothetical protein B456_013G101400                  87.0    7e-17   Gossypium raimondii
gb|KJB80507.1|  hypothetical protein B456_013G101400                  87.0    7e-17   Gossypium raimondii
ref|XP_008342010.1|  PREDICTED: probable beta-1,3-galactosyltrans...  87.0    7e-17   Malus domestica [apple tree]
ref|XP_011047262.1|  PREDICTED: probable beta-1,3-galactosyltrans...  87.0    8e-17   Populus euphratica
gb|KHF99242.1|  putative beta-1,3-galactosyltransferase 2 -like p...  87.0    8e-17   Gossypium arboreum [tree cotton]
ref|XP_006413124.1|  hypothetical protein EUTSA_v10025360mg           87.0    8e-17   Eutrema salsugineum [saltwater cress]
ref|XP_010657202.1|  PREDICTED: probable beta-1,3-galactosyltrans...  87.0    8e-17   Vitis vinifera
ref|XP_006355190.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...  86.7    1e-16   Solanum tuberosum [potatoes]
gb|KJB62836.1|  hypothetical protein B456_009G440200                  86.7    1e-16   Gossypium raimondii
ref|XP_007215471.1|  hypothetical protein PRUPE_ppa006530mg           86.3    1e-16   Prunus persica
ref|XP_008808431.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...  86.3    1e-16   
ref|XP_006452384.1|  hypothetical protein CICLE_v10008439mg           86.3    1e-16   
ref|XP_008229956.1|  PREDICTED: probable beta-1,3-galactosyltrans...  86.3    1e-16   Prunus mume [ume]
emb|CDX97371.1|  BnaC08g12360D                                        86.3    1e-16   
ref|XP_002268282.1|  PREDICTED: probable beta-1,3-galactosyltrans...  86.3    2e-16   Vitis vinifera
ref|XP_008804298.1|  PREDICTED: probable beta-1,3-galactosyltrans...  86.3    2e-16   Phoenix dactylifera
ref|XP_006452382.1|  hypothetical protein CICLE_v10008439mg           86.3    2e-16   Citrus clementina [clementine]
gb|KHG30061.1|  putative beta-1,3-galactosyltransferase 4 -like p...  85.9    2e-16   Gossypium arboreum [tree cotton]
ref|XP_006475057.1|  PREDICTED: probable beta-1,3-galactosyltrans...  85.9    2e-16   Citrus sinensis [apfelsine]
ref|XP_010536663.1|  PREDICTED: probable beta-1,3-galactosyltrans...  85.9    2e-16   Tarenaya hassleriana [spider flower]
ref|XP_004244109.1|  PREDICTED: probable beta-1,3-galactosyltrans...  85.5    3e-16   Solanum lycopersicum
ref|XP_010536662.1|  PREDICTED: probable beta-1,3-galactosyltrans...  85.5    3e-16   
ref|XP_007045661.1|  Galactosyltransferase family protein             85.5    4e-16   
ref|XP_011047261.1|  PREDICTED: probable beta-1,3-galactosyltrans...  85.1    4e-16   Populus euphratica
ref|XP_002320464.1|  galactosyltransferase family protein             85.1    4e-16   Populus trichocarpa [western balsam poplar]
gb|EYU21104.1|  hypothetical protein MIMGU_mgv1a007738mg              84.7    4e-16   Erythranthe guttata [common monkey flower]
emb|CDY01303.1|  BnaA07g10760D                                        84.7    5e-16   
ref|XP_010276120.1|  PREDICTED: probable beta-1,3-galactosyltrans...  84.7    5e-16   Nelumbo nucifera [Indian lotus]
ref|XP_006855892.1|  hypothetical protein AMTR_s00037p00154410        84.3    6e-16   Amborella trichopoda
ref|XP_006284182.1|  hypothetical protein CARUB_v10005329mg           83.2    7e-16   
ref|XP_010278673.1|  PREDICTED: probable beta-1,3-galactosyltrans...  83.6    8e-16   Nelumbo nucifera [Indian lotus]
ref|XP_009777688.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...  83.6    1e-15   Nicotiana sylvestris
emb|CDY00412.1|  BnaC07g14140D                                        83.6    1e-15   
ref|XP_009798738.1|  PREDICTED: uncharacterized protein LOC104244918  84.7    1e-15   Nicotiana sylvestris
gb|KDO80830.1|  hypothetical protein CISIN_1g015683mg                 82.0    1e-15   Citrus sinensis [apfelsine]
ref|XP_010278672.1|  PREDICTED: probable beta-1,3-galactosyltrans...  83.6    1e-15   Nelumbo nucifera [Indian lotus]
ref|XP_006434094.1|  hypothetical protein CICLE_v10001364mg           82.0    2e-15   
gb|KDO80832.1|  hypothetical protein CISIN_1g015683mg                 81.6    2e-15   Citrus sinensis [apfelsine]
ref|XP_007132543.1|  hypothetical protein PHAVU_011G103400g           83.2    2e-15   Phaseolus vulgaris [French bean]
ref|XP_006375532.1|  hypothetical protein POPTR_0014s15200g           83.2    2e-15   Populus trichocarpa [western balsam poplar]
gb|KDO80828.1|  hypothetical protein CISIN_1g015683mg                 81.6    2e-15   Citrus sinensis [apfelsine]
ref|XP_010104592.1|  putative beta-1,3-galactosyltransferase 2        82.8    2e-15   
ref|XP_002867534.1|  galactosyltransferase family protein             82.8    3e-15   Arabidopsis lyrata subsp. lyrata
ref|XP_006434096.1|  hypothetical protein CICLE_v10001364mg           82.0    5e-15   Citrus clementina [clementine]
gb|KDO80827.1|  hypothetical protein CISIN_1g015683mg                 81.6    5e-15   Citrus sinensis [apfelsine]
ref|XP_006472694.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...  81.6    5e-15   Citrus sinensis [apfelsine]
ref|NP_849454.1|  putative beta-1,3-galactosyltransferase 4           80.5    5e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011095407.1|  PREDICTED: probable beta-1,3-galactosyltrans...  82.0    5e-15   Sesamum indicum [beniseed]
gb|KDO80825.1|  hypothetical protein CISIN_1g015683mg                 81.6    6e-15   Citrus sinensis [apfelsine]
emb|CDP04596.1|  unnamed protein product                              81.6    6e-15   Coffea canephora [robusta coffee]
ref|XP_003527496.1|  PREDICTED: probable beta-1,3-galactosyltrans...  81.6    6e-15   Glycine max [soybeans]
ref|XP_010433424.1|  PREDICTED: probable beta-1,3-galactosyltrans...  81.6    6e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010929797.1|  PREDICTED: probable beta-1,3-galactosyltrans...  81.6    6e-15   Elaeis guineensis
ref|XP_002974972.1|  glycosyltransferase-like protein                 81.6    6e-15   Selaginella moellendorffii
ref|XP_007211967.1|  hypothetical protein PRUPE_ppa006589mg           81.3    9e-15   
ref|XP_003576598.1|  PREDICTED: probable beta-1,3-galactosyltrans...  81.3    9e-15   Brachypodium distachyon [annual false brome]
ref|XP_008802930.1|  PREDICTED: probable beta-1,3-galactosyltrans...  81.3    9e-15   
ref|XP_002988781.1|  glycosyltransferase-like protein                 80.9    1e-14   Selaginella moellendorffii
ref|XP_004515096.1|  PREDICTED: probable beta-1,3-galactosyltrans...  80.9    1e-14   Cicer arietinum [garbanzo]
ref|XP_002977391.1|  glycosyltransferase-like protein                 80.5    1e-14   Selaginella moellendorffii
emb|CDX92791.1|  BnaC07g40490D                                        80.5    1e-14   
ref|XP_010448194.1|  PREDICTED: probable beta-1,3-galactosyltrans...  80.5    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010448195.1|  PREDICTED: probable beta-1,3-galactosyltrans...  80.5    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010438679.1|  PREDICTED: probable beta-1,3-galactosyltrans...  80.5    2e-14   Camelina sativa [gold-of-pleasure]
ref|NP_567762.1|  putative beta-1,3-galactosyltransferase 4           80.5    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010438680.1|  PREDICTED: probable beta-1,3-galactosyltrans...  80.5    2e-14   Camelina sativa [gold-of-pleasure]
emb|CAB36540.1|  Avr9 elicitor response like protein                  80.5    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011048789.1|  PREDICTED: probable beta-1,3-galactosyltrans...  80.1    2e-14   Populus euphratica
ref|XP_011097870.1|  PREDICTED: probable beta-1,3-galactosyltrans...  80.1    2e-14   Sesamum indicum [beniseed]
ref|XP_008455443.1|  PREDICTED: probable beta-1,3-galactosyltrans...  79.7    3e-14   Cucumis melo [Oriental melon]
ref|XP_010063019.1|  PREDICTED: probable beta-1,3-galactosyltrans...  79.7    3e-14   Eucalyptus grandis [rose gum]
ref|XP_004144497.1|  PREDICTED: probable beta-1,3-galactosyltrans...  79.7    3e-14   Cucumis sativus [cucumbers]
ref|XP_009109161.1|  PREDICTED: probable beta-1,3-galactosyltrans...  79.7    3e-14   Brassica rapa
gb|KHN21228.1|  Putative beta-1,3-galactosyltransferase 2             79.3    4e-14   Glycine soja [wild soybean]
ref|XP_003539862.1|  PREDICTED: probable beta-1,3-galactosyltrans...  79.3    4e-14   Glycine max [soybeans]
gb|KJB13702.1|  hypothetical protein B456_002G089700                  79.0    6e-14   Gossypium raimondii
ref|XP_009137625.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...  79.0    6e-14   Brassica rapa
ref|XP_009361000.1|  PREDICTED: probable beta-1,3-galactosyltrans...  79.0    6e-14   Pyrus x bretschneideri [bai li]
ref|XP_006650268.1|  PREDICTED: probable beta-1,3-galactosyltrans...  79.0    6e-14   Oryza brachyantha
ref|XP_004956987.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...  78.6    7e-14   Setaria italica
gb|KJB13703.1|  hypothetical protein B456_002G089700                  78.6    7e-14   Gossypium raimondii
gb|EMS57380.1|  Beta-1,3-galactosyltransferase 7                      78.6    7e-14   Triticum urartu
ref|XP_011048788.1|  PREDICTED: probable beta-1,3-galactosyltrans...  78.6    7e-14   Populus euphratica
ref|XP_004159203.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...  78.6    7e-14   
ref|XP_011097092.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...  78.6    7e-14   Sesamum indicum [beniseed]
ref|XP_009770915.1|  PREDICTED: probable beta-1,3-galactosyltrans...  78.6    7e-14   Nicotiana sylvestris
ref|XP_009624797.1|  PREDICTED: probable beta-1,3-galactosyltrans...  78.6    8e-14   Nicotiana tomentosiformis
ref|XP_003543389.1|  PREDICTED: probable beta-1,3-galactosyltrans...  78.6    9e-14   Glycine max [soybeans]
ref|XP_006366587.1|  PREDICTED: probable beta-1,3-galactosyltrans...  78.2    9e-14   Solanum tuberosum [potatoes]
ref|XP_004172360.1|  PREDICTED: probable beta-1,3-galactosyltrans...  78.2    1e-13   
ref|XP_002302876.1|  hypothetical protein POPTR_0002s21280g           77.8    1e-13   Populus trichocarpa [western balsam poplar]
emb|CDY46675.1|  BnaA03g48330D                                        77.8    2e-13   Brassica napus [oilseed rape]
ref|NP_001050543.1|  Os03g0577500                                     77.8    2e-13   
gb|KGN63249.1|  hypothetical protein Csa_2G418850                     77.4    2e-13   Cucumis sativus [cucumbers]
emb|CDP05735.1|  unnamed protein product                              77.4    2e-13   Coffea canephora [robusta coffee]
ref|XP_008455884.1|  PREDICTED: probable beta-1,3-galactosyltrans...  77.4    2e-13   Cucumis melo [Oriental melon]
ref|XP_006366586.1|  PREDICTED: probable beta-1,3-galactosyltrans...  77.4    2e-13   Solanum tuberosum [potatoes]
ref|XP_010469586.1|  PREDICTED: probable beta-1,3-galactosyltrans...  77.0    2e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010469587.1|  PREDICTED: probable beta-1,3-galactosyltrans...  77.0    2e-13   Camelina sativa [gold-of-pleasure]
ref|XP_008226885.1|  PREDICTED: probable beta-1,3-galactosyltrans...  77.0    3e-13   Prunus mume [ume]
ref|XP_004487414.1|  PREDICTED: probable beta-1,3-galactosyltrans...  77.0    3e-13   Cicer arietinum [garbanzo]
ref|XP_004151891.1|  PREDICTED: probable beta-1,3-galactosyltrans...  77.0    3e-13   
emb|CDY48266.1|  BnaA05g10880D                                        77.0    3e-13   Brassica napus [oilseed rape]
tpg|DAA61736.1|  TPA: hypothetical protein ZEAMMB73_056797            75.5    3e-13   
ref|XP_009143988.1|  PREDICTED: probable beta-1,3-galactosyltrans...  77.0    3e-13   Brassica rapa
ref|XP_006410375.1|  hypothetical protein EUTSA_v10016736mg           77.0    3e-13   Eutrema salsugineum [saltwater cress]
ref|XP_009143989.1|  PREDICTED: probable beta-1,3-galactosyltrans...  76.6    3e-13   
ref|XP_010910268.1|  PREDICTED: probable beta-1,3-galactosyltrans...  76.6    3e-13   
gb|EYU27344.1|  hypothetical protein MIMGU_mgv1a007546mg              76.6    4e-13   
gb|ACU17833.1|  unknown                                               74.7    4e-13   
ref|XP_009624796.1|  PREDICTED: probable beta-1,3-galactosyltrans...  76.6    4e-13   
ref|XP_010510018.1|  PREDICTED: probable beta-1,3-galactosyltrans...  76.3    5e-13   
ref|XP_010063020.1|  PREDICTED: probable beta-1,3-galactosyltrans...  76.3    6e-13   
ref|XP_003540300.1|  PREDICTED: probable beta-1,3-galactosyltrans...  76.3    6e-13   
gb|EMS64796.1|  putative beta-1,3-galactosyltransferase 2             75.9    6e-13   
ref|XP_002462477.1|  hypothetical protein SORBIDRAFT_02g026360        75.9    6e-13   
ref|XP_010413995.1|  PREDICTED: probable beta-1,3-galactosyltrans...  75.9    6e-13   
ref|XP_008359264.1|  PREDICTED: probable beta-1,3-galactosyltrans...  75.9    6e-13   
ref|XP_006294322.1|  hypothetical protein CARUB_v10023330mg           75.9    6e-13   
ref|XP_010413996.1|  PREDICTED: probable beta-1,3-galactosyltrans...  75.9    7e-13   
gb|KCW88781.1|  hypothetical protein EUGRSUZ_A01123                   75.1    7e-13   
ref|XP_008651120.1|  PREDICTED: hypothetical protein isoform X1       75.5    7e-13   
ref|XP_009598546.1|  PREDICTED: probable beta-1,3-galactosyltrans...  75.9    8e-13   
emb|CDY12206.1|  BnaC04g12360D                                        75.9    8e-13   
emb|CDP10795.1|  unnamed protein product                              75.5    8e-13   
ref|XP_008226884.1|  PREDICTED: probable beta-1,3-galactosyltrans...  75.5    9e-13   
ref|XP_003596979.1|  hypothetical protein MTR_2g088270                75.5    9e-13   
ref|NP_001141890.1|  hypothetical protein                             75.1    1e-12   
ref|XP_010323831.1|  PREDICTED: probable beta-1,3-galactosyltrans...  75.5    1e-12   
ref|NP_172009.1|  putative beta-1,3-galactosyltransferase 2           75.1    1e-12   
gb|KEH29683.1|  beta-1,3-galactosyltransferase-like protein           75.1    1e-12   
ref|XP_006476264.1|  PREDICTED: probable beta-1,3-galactosyltrans...  75.1    1e-12   
ref|XP_009103271.1|  PREDICTED: probable beta-1,3-galactosyltrans...  75.1    1e-12   
ref|XP_006476263.1|  PREDICTED: probable beta-1,3-galactosyltrans...  75.1    1e-12   
ref|XP_008359262.1|  PREDICTED: probable beta-1,3-galactosyltrans...  75.1    1e-12   
gb|AFW68302.1|  hypothetical protein ZEAMMB73_372854                  73.6    2e-12   
ref|XP_008385877.1|  PREDICTED: probable beta-1,3-galactosyltrans...  74.7    2e-12   
ref|XP_009775718.1|  PREDICTED: probable beta-1,3-galactosyltrans...  74.7    2e-12   
ref|XP_010046417.1|  PREDICTED: probable beta-1,3-galactosyltrans...  74.7    2e-12   
emb|CAN63417.1|  hypothetical protein VITISV_007689                   74.3    2e-12   
ref|XP_009338707.1|  PREDICTED: probable beta-1,3-galactosyltrans...  74.3    2e-12   
ref|XP_007209207.1|  hypothetical protein PRUPE_ppa006612mg           74.3    2e-12   
ref|XP_004243473.1|  PREDICTED: probable beta-1,3-galactosyltrans...  74.3    2e-12   
ref|XP_011470881.1|  PREDICTED: probable beta-1,3-galactosyltrans...  74.3    3e-12   
ref|XP_004294404.1|  PREDICTED: probable beta-1,3-galactosyltrans...  74.3    3e-12   
ref|XP_009338706.1|  PREDICTED: probable beta-1,3-galactosyltrans...  73.9    3e-12   
ref|XP_009103272.1|  PREDICTED: probable beta-1,3-galactosyltrans...  73.9    3e-12   
ref|XP_011461040.1|  PREDICTED: probable beta-1,3-galactosyltrans...  73.9    3e-12   
ref|XP_004966215.1|  PREDICTED: probable beta-1,3-galactosyltrans...  73.9    4e-12   
ref|XP_002892271.1|  galactosyltransferase family protein             73.6    4e-12   
ref|XP_011100272.1|  PREDICTED: probable beta-1,3-galactosyltrans...  73.6    4e-12   
ref|XP_002464309.1|  hypothetical protein SORBIDRAFT_01g015960        73.6    4e-12   
ref|XP_008681412.1|  PREDICTED: hypothetical protein isoform X1       73.6    4e-12   
ref|XP_006418057.1|  hypothetical protein EUTSA_v10007787mg           73.6    4e-12   
ref|NP_180802.1|  putative beta-1,3-galactosyltransferase 3           73.6    5e-12   
emb|CDY68943.1|  BnaAnng28870D                                        72.8    5e-12   
ref|XP_009757632.1|  PREDICTED: probable beta-1,3-galactosyltrans...  73.6    5e-12   
ref|XP_004506364.1|  PREDICTED: probable beta-1,3-galactosyltrans...  73.2    5e-12   
ref|XP_002968104.1|  glycosyltransferase-like protein                 73.2    5e-12   
ref|XP_009757629.1|  PREDICTED: probable beta-1,3-galactosyltrans...  73.6    5e-12   
ref|NP_001077462.1|  putative beta-1,3-galactosyltransferase 2        73.2    6e-12   
ref|XP_008392652.1|  PREDICTED: probable beta-1,3-galactosyltrans...  73.2    6e-12   
ref|XP_009757630.1|  PREDICTED: probable beta-1,3-galactosyltrans...  73.6    6e-12   
ref|XP_002879388.1|  galactosyltransferase family protein             73.2    6e-12   
gb|EEC81181.1|  hypothetical protein OsI_24180                        72.8    6e-12   
ref|XP_009398227.1|  PREDICTED: probable beta-1,3-galactosyltrans...  73.2    7e-12   
ref|NP_001058369.1|  Os06g0679500                                     72.8    7e-12   
ref|XP_004506362.1|  PREDICTED: probable beta-1,3-galactosyltrans...  72.8    7e-12   
ref|XP_008245629.1|  PREDICTED: probable beta-1,3-galactosyltrans...  72.8    8e-12   
gb|KHN47065.1|  Beta-1,3-galactosyltransferase 7                      72.4    8e-12   
ref|XP_006656380.1|  PREDICTED: probable beta-1,3-galactosyltrans...  72.8    8e-12   
ref|XP_009775717.1|  PREDICTED: probable beta-1,3-galactosyltrans...  72.4    9e-12   
ref|XP_010557003.1|  PREDICTED: probable beta-1,3-galactosyltrans...  72.4    1e-11   
ref|XP_010089999.1|  putative beta-1,3-galactosyltransferase 2        72.0    2e-11   
emb|CDX96559.1|  BnaA08g21020D                                        71.2    2e-11   
ref|XP_002970340.1|  glycosyltransferase-like protein                 71.6    2e-11   
ref|XP_003562342.1|  PREDICTED: probable beta-1,3-galactosyltrans...  71.6    2e-11   
gb|EMT25658.1|  Putative beta-1,3-galactosyltransferase 2             71.6    2e-11   
ref|XP_010675728.1|  PREDICTED: probable beta-1,3-galactosyltrans...  71.6    2e-11   
emb|CDY11037.1|  BnaA03g46960D                                        71.2    2e-11   
ref|XP_010557001.1|  PREDICTED: probable beta-1,3-galactosyltrans...  71.2    2e-11   
ref|XP_004250812.1|  PREDICTED: probable beta-1,3-galactosyltrans...  71.2    3e-11   
gb|EEC79262.1|  hypothetical protein OsI_20042                        71.2    3e-11   
ref|XP_004982530.1|  PREDICTED: probable beta-1,3-galactosyltrans...  71.2    3e-11   
ref|XP_002278708.1|  PREDICTED: probable beta-1,3-galactosyltrans...  71.2    3e-11   
ref|XP_011040606.1|  PREDICTED: probable beta-1,3-galactosyltrans...  71.2    3e-11   
ref|XP_002518935.1|  Beta-1,3-galactosyltransferase sqv-2, putative   71.2    3e-11   
ref|XP_010522344.1|  PREDICTED: probable beta-1,3-galactosyltrans...  71.2    3e-11   
emb|CDX89291.1|  BnaA01g16020D                                        67.4    3e-11   
gb|KJB52406.1|  hypothetical protein B456_008G260300                  69.7    3e-11   
ref|XP_006371369.1|  hypothetical protein POPTR_0019s09520g           70.9    4e-11   
ref|NP_001055606.1|  Os05g0427200                                     70.5    4e-11   
ref|XP_006371368.1|  hypothetical protein POPTR_0019s09520g           70.5    5e-11   
gb|AAV25017.1|  putative galactosyltransferase                        70.5    5e-11   
gb|KJB52407.1|  hypothetical protein B456_008G260300                  69.7    5e-11   
ref|XP_009782228.1|  PREDICTED: probable beta-1,3-galactosyltrans...  70.1    5e-11   
ref|XP_009782227.1|  PREDICTED: probable beta-1,3-galactosyltrans...  70.1    6e-11   
ref|XP_009344054.1|  PREDICTED: probable beta-1,3-galactosyltrans...  70.1    6e-11   
ref|XP_010522341.1|  PREDICTED: probable beta-1,3-galactosyltrans...  70.1    6e-11   
ref|XP_010655390.1|  PREDICTED: probable beta-1,3-galactosyltrans...  70.1    6e-11   
gb|AAS90659.1|  putative galactosyltransferase                        70.5    7e-11   
ref|XP_006840618.1|  hypothetical protein AMTR_s00084p00079370        69.7    9e-11   
ref|XP_010053045.1|  PREDICTED: probable beta-1,3-galactosyltrans...  69.7    9e-11   
gb|KJB30545.1|  hypothetical protein B456_005G149400                  69.3    9e-11   
dbj|BAJ89822.1|  predicted protein                                    69.7    9e-11   
dbj|BAJ89733.1|  predicted protein                                    69.7    1e-10   
ref|XP_002437448.1|  hypothetical protein SORBIDRAFT_10g027290        69.7    1e-10   
gb|KJB52405.1|  hypothetical protein B456_008G260300                  69.3    1e-10   
gb|KFK45039.1|  hypothetical protein AALP_AA1G336200                  69.3    1e-10   
gb|KJB62840.1|  hypothetical protein B456_009G440200                  69.3    1e-10   
ref|XP_004506363.1|  PREDICTED: probable beta-1,3-galactosyltrans...  69.3    1e-10   
ref|XP_002317052.2|  galactosyltransferase family protein             69.3    1e-10   
gb|EMS52307.1|  putative beta-1,3-galactosyltransferase 2             69.3    1e-10   
ref|XP_002524194.1|  Beta-1,3-galactosyltransferase sqv-2, putative   68.9    1e-10   
ref|XP_006415137.1|  hypothetical protein EUTSA_v10007803mg           68.9    2e-10   
ref|XP_006587723.1|  PREDICTED: probable beta-1,3-galactosyltrans...  68.9    2e-10   
gb|AES87856.2|  beta-1,3-galactosyltransferase-like protein           68.6    2e-10   
gb|KHN11643.1|  Putative beta-1,3-galactosyltransferase 8             68.6    2e-10   
ref|XP_003533526.1|  PREDICTED: probable beta-1,3-galactosyltrans...  68.6    2e-10   
ref|XP_009602082.1|  PREDICTED: probable beta-1,3-galactosyltrans...  68.9    2e-10   
gb|EMT12895.1|  Putative beta-1,3-galactosyltransferase 2             68.6    2e-10   
ref|XP_006654433.1|  PREDICTED: probable beta-1,3-galactosyltrans...  68.9    2e-10   
gb|EPS64736.1|  hypothetical protein M569_10045                       66.2    2e-10   
ref|XP_011013418.1|  PREDICTED: probable beta-1,3-galactosyltrans...  68.6    2e-10   
ref|XP_003605659.1|  Avr9 elicitor response protein                   68.6    2e-10   
ref|XP_010475189.1|  PREDICTED: probable beta-1,3-galactosyltrans...  68.2    3e-10   
ref|XP_006304992.1|  hypothetical protein CARUB_v10009358mg           68.2    3e-10   
emb|CDY46836.1|  BnaA10g03200D                                        68.2    3e-10   
gb|KJB62839.1|  hypothetical protein B456_009G440200                  67.4    4e-10   
ref|XP_010252349.1|  PREDICTED: probable beta-1,3-galactosyltrans...  67.4    5e-10   
ref|XP_006370727.1|  hypothetical protein POPTR_0001s45420g           67.4    5e-10   
gb|EAY84604.1|  hypothetical protein OsI_05972                        67.4    6e-10   
gb|KFK42855.1|  hypothetical protein AALP_AA1G047700                  67.0    6e-10   
ref|XP_009408655.1|  PREDICTED: probable beta-1,3-galactosyltrans...  67.0    7e-10   
ref|XP_010251481.1|  PREDICTED: probable beta-1,3-galactosyltrans...  66.6    9e-10   
emb|CDY49507.1|  BnaC05g03190D                                        66.6    9e-10   
gb|EYU34029.1|  hypothetical protein MIMGU_mgv1a007633mg              66.6    9e-10   
ref|XP_010475190.1|  PREDICTED: probable beta-1,3-galactosyltrans...  66.6    1e-09   
ref|XP_010484738.1|  PREDICTED: probable beta-1,3-galactosyltrans...  66.2    1e-09   
ref|XP_010240796.1|  PREDICTED: probable beta-1,3-galactosyltrans...  66.2    1e-09   
dbj|BAD25162.1|  putative Avr9 elicitor response protein              66.2    1e-09   
ref|XP_010092200.1|  putative beta-1,3-galactosyltransferase 2        66.2    1e-09   
ref|XP_011038007.1|  PREDICTED: probable beta-1,3-galactosyltrans...  66.2    1e-09   
gb|AFW66427.1|  hypothetical protein ZEAMMB73_715676                  63.5    2e-09   
ref|NP_174569.1|  putative beta-1,3-galactosyltransferase             65.9    2e-09   
ref|NP_001136834.1|  beta-1,3-galactosyltransferase sqv-2             65.9    2e-09   
gb|ACG42389.1|  beta-1,3-galactosyltransferase sqv-2                  65.5    2e-09   
ref|XP_009782081.1|  PREDICTED: probable beta-1,3-galactosyltrans...  65.5    2e-09   
gb|KDP25226.1|  hypothetical protein JCGZ_20382                       65.5    2e-09   
ref|XP_010478679.1|  PREDICTED: probable beta-1,3-galactosyltrans...  65.5    2e-09   
ref|XP_010233857.1|  PREDICTED: probable beta-1,3-galactosyltrans...  65.5    2e-09   
ref|XP_006342694.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...  65.1    2e-09   
ref|XP_010484744.1|  PREDICTED: probable beta-1,3-galactosyltrans...  65.5    3e-09   
ref|XP_008374141.1|  PREDICTED: probable beta-1,3-galactosyltrans...  65.5    3e-09   
ref|XP_006646915.1|  PREDICTED: probable beta-1,3-galactosyltrans...  65.1    3e-09   
gb|EYU22688.1|  hypothetical protein MIMGU_mgv1a007366mg              65.1    3e-09   
gb|EYU22690.1|  hypothetical protein MIMGU_mgv1a007366mg              65.1    3e-09   
ref|XP_004165512.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...  63.5    5e-09   
ref|XP_002893747.1|  galactosyltransferase family protein             64.7    5e-09   
ref|XP_011095109.1|  PREDICTED: probable beta-1,3-galactosyltrans...  64.3    5e-09   
ref|XP_010457596.1|  PREDICTED: probable beta-1,3-galactosyltrans...  64.3    5e-09   
ref|XP_008437460.1|  PREDICTED: probable beta-1,3-galactosyltrans...  64.3    5e-09   
ref|XP_010457598.1|  PREDICTED: probable beta-1,3-galactosyltrans...  64.3    6e-09   
emb|CDX99409.1|  BnaC01g11430D                                        60.5    6e-09   
ref|XP_004951866.1|  PREDICTED: probable beta-1,3-galactosyltrans...  64.3    6e-09   
ref|XP_009360212.1|  PREDICTED: probable beta-1,3-galactosyltrans...  63.9    8e-09   
gb|KHG17244.1|  putative beta-1,3-galactosyltransferase 6 -like p...  63.9    8e-09   
ref|XP_007131321.1|  hypothetical protein PHAVU_011G003800g           63.5    8e-09   
ref|XP_008677265.1|  PREDICTED: beta-1,3-galactosyltransferase sq...  63.5    1e-08   
ref|XP_009119198.1|  PREDICTED: probable beta-1,3-galactosyltrans...  63.5    1e-08   
ref|XP_007019715.1|  Galactosyltransferase family protein isoform 3   63.5    1e-08   
ref|XP_010457597.1|  PREDICTED: probable beta-1,3-galactosyltrans...  63.5    1e-08   
ref|XP_007019713.1|  Galactosyltransferase family protein isoform 1   63.5    1e-08   
ref|XP_010457599.1|  PREDICTED: probable beta-1,3-galactosyltrans...  63.2    1e-08   
ref|XP_009399227.1|  PREDICTED: probable beta-1,3-galactosyltrans...  63.2    1e-08   
gb|KGN49967.1|  hypothetical protein Csa_5G146900                     63.2    1e-08   
ref|XP_001779676.1|  predicted protein                                62.8    2e-08   
ref|XP_004145877.1|  PREDICTED: probable beta-1,3-galactosyltrans...  62.8    2e-08   
gb|KHN26051.1|  Beta-1,3-galactosyltransferase 7                      62.4    2e-08   
ref|XP_003540564.1|  PREDICTED: probable beta-1,3-galactosyltrans...  62.4    2e-08   
gb|KHN32455.1|  Putative beta-1,3-galactosyltransferase 8             62.4    2e-08   
ref|XP_002513511.1|  transferase, transferring glycosyl groups, p...  62.4    2e-08   
ref|XP_006475058.1|  PREDICTED: probable beta-1,3-galactosyltrans...  62.0    3e-08   
ref|XP_002451594.1|  hypothetical protein SORBIDRAFT_04g004400        62.0    3e-08   
ref|XP_006836897.1|  hypothetical protein AMTR_s00099p00123290        62.0    4e-08   
gb|KDP22107.1|  hypothetical protein JCGZ_25938                       61.6    5e-08   
ref|XP_007149975.1|  hypothetical protein PHAVU_005G115300g           61.6    5e-08   
ref|XP_010461115.1|  PREDICTED: probable beta-1,3-galactosyltrans...  61.6    5e-08   
ref|XP_010461116.1|  PREDICTED: probable beta-1,3-galactosyltrans...  61.6    5e-08   
ref|XP_010542088.1|  PREDICTED: probable beta-1,3-galactosyltrans...  61.6    5e-08   
ref|XP_010927833.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...  61.2    6e-08   
ref|XP_009119197.1|  PREDICTED: probable beta-1,3-galactosyltrans...  60.8    8e-08   
ref|XP_010499840.1|  PREDICTED: probable beta-1,3-galactosyltrans...  60.5    1e-07   
gb|KJB26942.1|  hypothetical protein B456_004G268200                  60.5    1e-07   
gb|KJB13705.1|  hypothetical protein B456_002G089700                  60.5    1e-07   
ref|XP_009589155.1|  PREDICTED: probable beta-1,3-galactosyltrans...  60.5    1e-07   
ref|XP_006344003.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...  60.1    1e-07   
ref|XP_011097866.1|  PREDICTED: probable beta-1,3-galactosyltrans...  59.7    2e-07   
ref|XP_009612460.1|  PREDICTED: probable beta-1,3-galactosyltrans...  59.7    2e-07   
ref|XP_009612461.1|  PREDICTED: probable beta-1,3-galactosyltrans...  59.3    2e-07   
ref|XP_010677269.1|  PREDICTED: probable beta-1,3-galactosyltrans...  58.5    4e-07   
ref|XP_009145552.1|  PREDICTED: probable beta-1,3-galactosyltrans...  57.4    5e-07   
ref|XP_009786663.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...  58.2    5e-07   
ref|XP_010677261.1|  PREDICTED: probable beta-1,3-galactosyltrans...  58.2    6e-07   
ref|XP_008237813.1|  PREDICTED: probable beta-1,3-galactosyltrans...  58.2    6e-07   
ref|XP_004962000.1|  PREDICTED: probable beta-1,3-galactosyltrans...  58.2    6e-07   
gb|EMS45879.1|  putative beta-1,3-galactosyltransferase 8             58.2    7e-07   
emb|CBI16979.3|  unnamed protein product                              57.8    7e-07   
emb|CDY04694.1|  BnaC05g17320D                                        57.8    8e-07   
emb|CDY30641.1|  BnaAnng04160D                                        57.8    9e-07   
ref|XP_002265159.2|  PREDICTED: probable beta-1,3-galactosyltrans...  57.8    9e-07   
ref|XP_010231346.1|  PREDICTED: probable beta-1,3-galactosyltrans...  57.8    9e-07   
ref|XP_009114848.1|  PREDICTED: probable beta-1,3-galactosyltrans...  57.4    1e-06   
ref|XP_006365959.1|  PREDICTED: probable beta-1,3-galactosyltrans...  57.4    1e-06   
gb|KJB81796.1|  hypothetical protein B456_013G161800                  53.9    1e-06   
ref|XP_009601250.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...  57.0    1e-06   
ref|XP_002518474.1|  Beta-1,3-galactosyltransferase sqv-2, putative   57.0    2e-06   
ref|XP_009419577.1|  PREDICTED: probable beta-1,3-galactosyltrans...  57.0    2e-06   
ref|XP_007039334.1|  Beta-1,3-galactosyltransferase 6 isoform 3       56.6    2e-06   
ref|XP_007039333.1|  Galactosyltransferase family protein isoform 2   56.6    2e-06   
emb|CDX93812.1|  BnaA09g24120D                                        56.2    2e-06   
ref|XP_002456730.1|  hypothetical protein SORBIDRAFT_03g041540        56.6    3e-06   
gb|KJB13704.1|  hypothetical protein B456_002G089700                  55.8    3e-06   
ref|XP_007039335.1|  Beta-1,3-galactosyltransferase 6 isoform 4       56.2    3e-06   
gb|KJB37442.1|  hypothetical protein B456_006G204700                  55.8    4e-06   
ref|XP_007039332.1|  Galactosyltransferase family protein isoform 1   55.5    4e-06   
gb|KJB37443.1|  hypothetical protein B456_006G204700                  55.5    5e-06   



>ref|XP_009786662.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Nicotiana 
sylvestris]
Length=396

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 111/122 (91%), Gaps = 1/122 (1%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDC-  379
            M++RH+ KVS KWIP+FSIAFFF+GML++NR+W+P ES++QLIAQHRRDQELQV+SEDC 
Sbjct  1    MKNRHSVKVSVKWIPIFSIAFFFIGMLFSNRLWSPTESSSQLIAQHRRDQELQVVSEDCN  60

Query  380  TTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
            +T KK GQ+KDVMQEVYKTHEAIQSLDKSI+ML+MELAATRSTQEMK +D S  S +S+D
Sbjct  61   STKKKQGQDKDVMQEVYKTHEAIQSLDKSIAMLQMELAATRSTQEMKVADQSSNSSRSQD  120

Query  560  GP  565
            GP
Sbjct  121  GP  122



>ref|XP_009601249.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Nicotiana 
tomentosiformis]
Length=396

 Score =   196 bits (498),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 110/122 (90%), Gaps = 1/122 (1%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDC-  379
            M++RH  KVS KWIP+FSIAFFF+GML++NR+W+P ES++QLIAQHRRDQELQV+SEDC 
Sbjct  1    MKNRHTVKVSVKWIPIFSIAFFFIGMLFSNRLWSPTESSSQLIAQHRRDQELQVVSEDCN  60

Query  380  TTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
            +T KK GQ+KDVMQEVYKTHEAIQSLDKSI+ML+MELAATRSTQE+K +D S  S +S+D
Sbjct  61   STKKKQGQDKDVMQEVYKTHEAIQSLDKSIAMLQMELAATRSTQEIKAADQSSNSSRSQD  120

Query  560  GP  565
            GP
Sbjct  121  GP  122



>emb|CAA06925.1| Avr9 elicitor response protein [Nicotiana tabacum]
Length=396

 Score =   196 bits (497),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 110/122 (90%), Gaps = 1/122 (1%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDC-  379
            M++RH+ KVS KWIP+FSIAFFF GML++NR+W+P ES++QLIAQHRRDQELQV+SEDC 
Sbjct  1    MKNRHSVKVSVKWIPIFSIAFFFTGMLFSNRLWSPTESSSQLIAQHRRDQELQVVSEDCN  60

Query  380  TTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
            +T KK GQ+KDVMQEVYKTHEAIQSLDKSI+ML+MELAATRSTQEMK +D S  S +S+D
Sbjct  61   STKKKQGQDKDVMQEVYKTHEAIQSLDKSIAMLQMELAATRSTQEMKVADQSSNSSRSQD  120

Query  560  GP  565
            GP
Sbjct  121  GP  122



>emb|CDP18301.1| unnamed protein product [Coffea canephora]
Length=395

 Score =   180 bits (457),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 101/122 (83%), Gaps = 1/122 (1%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            M+SR + KVS KWIP+FSI+FFF+GML+TNR W PPES  QLI+QHRR+QELQ+ISEDCT
Sbjct  1    MKSRSSGKVSVKWIPIFSISFFFIGMLFTNRFWVPPESGGQLISQHRREQELQIISEDCT  60

Query  383  TMKKPG-QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
            T KK G Q+KDVM EVYKTHEAIQ+LDKSISML+MELAA+RS++EM K D S  +   E 
Sbjct  61   TKKKSGEQDKDVMDEVYKTHEAIQTLDKSISMLQMELAASRSSKEMGKPDRSSSASSKEG  120

Query  560  GP  565
             P
Sbjct  121  AP  122



>ref|XP_004250351.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Solanum 
lycopersicum]
Length=396

 Score =   166 bits (420),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 105/122 (86%), Gaps = 1/122 (1%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            M++RH  KVS KWIP+FSIAFFF+GML++NR W+P ES +QLIAQHRRDQELQV+SEDC 
Sbjct  1    MKNRHTVKVSVKWIPIFSIAFFFIGMLFSNRWWSPTESGSQLIAQHRRDQELQVVSEDCN  60

Query  383  T-MKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
            +  KK GQ+KDVMQEVYKTHEAIQSLDKSI+ L+MELAATRSTQEMK +D S  S  S++
Sbjct  61   SKKKKQGQDKDVMQEVYKTHEAIQSLDKSIATLQMELAATRSTQEMKVADQSSNSSHSQN  120

Query  560  GP  565
            GP
Sbjct  121  GP  122



>ref|XP_006364960.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Solanum 
tuberosum]
Length=396

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 105/122 (86%), Gaps = 1/122 (1%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            M++RH  KVS KWIP+FSIAFFF+GML++NR W+P ES +QLIAQHRRDQELQV+SEDC 
Sbjct  1    MKNRHTIKVSVKWIPIFSIAFFFIGMLFSNRWWSPTESGSQLIAQHRRDQELQVVSEDCN  60

Query  383  T-MKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
            +  KK GQ+KDVMQEVYKTHEAIQSLDKSI+ L+MELAATRSTQEMK +D S  S  S++
Sbjct  61   SKKKKQGQDKDVMQEVYKTHEAIQSLDKSIATLQMELAATRSTQEMKVADQSSNSSHSQN  120

Query  560  GP  565
            GP
Sbjct  121  GP  122



>ref|XP_010245068.1| PREDICTED: beta-1,3-galactosyltransferase 7 [Nelumbo nucifera]
Length=396

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            M++R   KVSAKWI +  I+ F LGML+TNR+WAPPES  Q+I++ R +QELQV+SEDCT
Sbjct  1    MKNRSTVKVSAKWIIILCISSFALGMLFTNRLWAPPESNGQIISRQRHEQELQVVSEDCT  60

Query  383  TMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGS  535
            T +K GQ+KD+M EVY+THEAIQSLDK+IS L+MELAATRS+QE+   DGS
Sbjct  61   TKRKRGQDKDIMGEVYRTHEAIQSLDKTISTLQMELAATRSSQELGNHDGS  111



>ref|XP_002285826.1| PREDICTED: beta-1,3-galactosyltransferase 7 [Vitis vinifera]
 emb|CBI19088.3| unnamed protein product [Vitis vinifera]
Length=397

 Score =   156 bits (394),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            M++R + K SAKWIP+  +  F  GML TNR+W PPES +QLI++ + +QELQ+ISE CT
Sbjct  1    MKNRSSKKFSAKWIPIICVLCFCFGMLLTNRLWTPPESNSQLISRRQHEQELQIISEGCT  60

Query  383  TMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSEDG  562
            T KKP QE+DVM+EV KTHEAIQ LDKSISML+MEL+ATR++QEM+ SDGS     S  G
Sbjct  61   TKKKPTQERDVMEEVQKTHEAIQYLDKSISMLQMELSATRNSQEMRSSDGSGAISTSSSG  120



>gb|EYU23928.1| hypothetical protein MIMGU_mgv1a007764mg [Erythranthe guttata]
Length=396

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 93/123 (76%), Gaps = 7/123 (6%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            M+S+   KVSAKWIP+FSI FFFLGM +TN+ WAP ES +QLI + R DQELQ++SEDC 
Sbjct  1    MKSKSGGKVSAKWIPVFSICFFFLGMFFTNKFWAPLESNSQLITKQRLDQELQIVSEDCN  60

Query  383  TMKKPGQE---KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDG----SDE  541
              KK   +   KD M+EVYKTHEAIQSLDKSISML+MEL+ +RS QE  K+DG    SD+
Sbjct  61   NKKKKEGDMDNKDAMKEVYKTHEAIQSLDKSISMLQMELSVSRSVQEKVKTDGSPAISDQ  120

Query  542  SPQ  550
            S Q
Sbjct  121  SSQ  123



>ref|XP_007018920.1| Galactosyltransferase family protein [Theobroma cacao]
 gb|EOY16145.1| Galactosyltransferase family protein [Theobroma cacao]
Length=495

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 91/122 (75%), Gaps = 1/122 (1%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            M+ R   K+S KWIP   I FF LG+L+ NR+W P ES  QLI++HRR+QELQ++SEDC 
Sbjct  1    MKHRSPKKISVKWIPFLCICFFTLGILFCNRLWLPLESNGQLISRHRREQELQIVSEDCD  60

Query  383  TMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDE-SPQSED  559
            T KKP Q+ DVM EV KTHEAIQSLDKS++ML+M+LAA+RS+QEM   D S   S  + D
Sbjct  61   TKKKPAQDNDVMGEVLKTHEAIQSLDKSVAMLQMQLAASRSSQEMGNLDASSAVSTLAHD  120

Query  560  GP  565
            GP
Sbjct  121  GP  122



>ref|XP_007222961.1| hypothetical protein PRUPE_ppa006755mg [Prunus persica]
 gb|EMJ24160.1| hypothetical protein PRUPE_ppa006755mg [Prunus persica]
Length=396

 Score =   153 bits (387),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 94/122 (77%), Gaps = 1/122 (1%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            M++R + K+SA WIP+F I  F LGML T+R+W  PES  QLI+  R++QELQ++SEDC 
Sbjct  1    MKNRSSRKISATWIPIFCIPAFLLGMLITSRMWVAPESNGQLISTRRQEQELQIVSEDCA  60

Query  383  TMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQ-SED  559
            T KKPGQEKDVM E+YKTHE+IQSLDK ++ ++MELAA RS+QEM  S G+  + Q S+D
Sbjct  61   TKKKPGQEKDVMDEIYKTHESIQSLDKQMASIQMELAAARSSQEMGTSSGAGGNSQLSKD  120

Query  560  GP  565
             P
Sbjct  121  SP  122



>ref|XP_008233935.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X4 [Prunus 
mume]
Length=396

 Score =   151 bits (381),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 93/122 (76%), Gaps = 1/122 (1%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            M++R + K+SA WIP+F I  F LGML T+R+W  PES  QLI+  R++QELQ++SEDC 
Sbjct  1    MKNRSSRKISATWIPIFCIPAFLLGMLITSRMWVAPESNGQLISTRRQEQELQIVSEDCA  60

Query  383  TMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQ-SED  559
            T KKPGQEKDVM E+YKTH +IQSLDK ++ ++MELAA RS+QEM  S G+  + Q S+D
Sbjct  61   TKKKPGQEKDVMDEIYKTHASIQSLDKQMASIQMELAAARSSQEMGTSSGAGGNSQLSKD  120

Query  560  GP  565
             P
Sbjct  121  SP  122



>gb|KHN06134.1| Beta-1,3-galactosyltransferase 7 [Glycine soja]
Length=397

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 96/124 (77%), Gaps = 4/124 (3%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            M++R + K+SAKW+P+FS++ F +GML T R+W PPES   L++ HR +QELQV+S DC 
Sbjct  1    MKTRTSKKISAKWVPIFSVSSFLIGMLITTRMWEPPESNGVLLSNHRHEQELQVVSGDCA  60

Query  383  TMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQS---  553
            T KKP Q++DVM +VYKTHEAIQSLDK +SML+MELAA RST+E + SDGS+ +  S   
Sbjct  61   T-KKPVQDEDVMSKVYKTHEAIQSLDKQVSMLQMELAAARSTREPEISDGSNNTLASGVT  119

Query  554  EDGP  565
             +GP
Sbjct  120  TEGP  123



>ref|XP_006596309.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Glycine max]
Length=397

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 96/124 (77%), Gaps = 4/124 (3%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            M++R + K+SAKW+P+FS++ F +GML T R+W PPES   L++ HR +QELQV+S DC 
Sbjct  1    MKTRTSKKISAKWVPIFSVSSFLIGMLITTRMWEPPESNGVLLSNHRHEQELQVVSGDCA  60

Query  383  TMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQS---  553
            T KKP Q++DVM +VYKTHEAIQSLDK +SML+MELAA RST+E + SDGS+ +  S   
Sbjct  61   T-KKPVQDEDVMSKVYKTHEAIQSLDKQVSMLQMELAAARSTREPEISDGSNNTLASGVT  119

Query  554  EDGP  565
             +GP
Sbjct  120  TEGP  123



>gb|ACU18574.1| unknown [Glycine max]
Length=184

 Score =   143 bits (360),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 89/124 (72%), Gaps = 4/124 (3%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            M+ R + K+SAKW+P+FS+  F +GML T RIW PPES    ++ HR +QELQV+S DC 
Sbjct  1    MKIRSSKKISAKWVPVFSVFSFLIGMLITTRIWEPPESNGVFLSNHRHEQELQVVSGDCA  60

Query  383  TMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDE---SPQS  553
              KKP Q+ DVM +VYKT+ AIQSLDK +SML+MELAA RST+E K SDGS     S  S
Sbjct  61   P-KKPVQDNDVMNKVYKTYGAIQSLDKQVSMLQMELAAARSTREHKISDGSANTLASGVS  119

Query  554  EDGP  565
             +GP
Sbjct  120  TEGP  123



>gb|KJB64379.1| hypothetical protein B456_010G046600 [Gossypium raimondii]
Length=397

 Score =   147 bits (372),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 90/123 (73%), Gaps = 1/123 (1%)
 Frame = +2

Query  200  MMRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDC  379
            M   R   K+S  WIP   ++FF LG+L++NR+W PPES  QL++Q RR+QELQ++S DC
Sbjct  1    MKPQRSPKKISLNWIPFICLSFFTLGILFSNRLWVPPESNGQLLSQRRREQELQIVSGDC  60

Query  380  TTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSD-ESPQSE  556
             T K PGQ+ DVM EV KTHEAIQSLDKS++ML+M+LAA+RS+QEM   + S   S  + 
Sbjct  61   DTKKTPGQDNDVMGEVLKTHEAIQSLDKSVAMLEMQLAASRSSQEMDNGEASKVVSTLTR  120

Query  557  DGP  565
            DGP
Sbjct  121  DGP  123



>ref|XP_004300420.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=396

 Score =   147 bits (372),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            M++R + K+SAKWIP+F +  F LGML T+R+WA PES  QLI+  R++QELQ++SEDC 
Sbjct  1    MKNRSSGKISAKWIPIFCVPSFLLGMLITSRMWAVPESNGQLISTRRQEQELQIVSEDCA  60

Query  383  TMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGS  535
            T KK GQEKDVM E+YKTHE+IQSLDK ++ ++MELAA RS+QEM  S  S
Sbjct  61   TKKKLGQEKDVMNEIYKTHESIQSLDKQMASIQMELAAARSSQEMGVSGDS  111



>ref|XP_009367326.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X4 [Pyrus 
x bretschneideri]
Length=396

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            M+SR + K+SA WIP+F I  F LGML T R+WA PE+  QLI+  R++QELQ++SEDC 
Sbjct  1    MKSRSSKKISATWIPIFCIPAFLLGMLITGRMWAAPETNGQLISTRRQEQELQIVSEDCA  60

Query  383  TMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQ  550
            T KK GQ+K+VM E+Y+THE+IQSLDK ++ ++MELAA RS+QEM  S GS  + Q
Sbjct  61   TKKKHGQDKNVMDEIYRTHESIQSLDKQMASIQMELAAARSSQEMGNSGGSTANSQ  116



>ref|XP_010095510.1| Beta-1,3-galactosyltransferase 7 [Morus notabilis]
 gb|EXB60484.1| Beta-1,3-galactosyltransferase 7 [Morus notabilis]
Length=397

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            M+SR + +VS KWIP+  ++ FFLG+L T R+W PPES +QLI+  R +QELQ+++EDC 
Sbjct  1    MKSRSSGRVSTKWIPIVCMSSFFLGVLITIRMWTPPESNSQLISSRRHEQELQIVAEDCA  60

Query  383  TMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDES  544
            T KKP QEKDVM E+YKTHE+IQSLDK ++M++MELAA+RS++E+  S GS ++
Sbjct  61   TKKKPVQEKDVMDEIYKTHESIQSLDKQMAMIQMELAASRSSRELGLSVGSSDA  114



>ref|XP_008338811.1| PREDICTED: beta-1,3-galactosyltransferase 7 [Malus domestica]
Length=396

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            M+SR++ K+SA WIP+F I  F LGML T R+WA PES  QLI+  R++QELQ+++EDC 
Sbjct  1    MKSRNSKKISATWIPIFCIPAFLLGMLITGRMWAAPESNGQLISIRRQEQELQIVAEDCA  60

Query  383  TMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQ  550
            T KK G +K+VM E+YKTHE+IQSLDK ++ ++MELAA RS+QEM+ S GS  + Q
Sbjct  61   TKKKHGHDKNVMDEIYKTHESIQSLDKQMASIQMELAAARSSQEMEDSGGSTSNSQ  116



>ref|XP_008233934.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X3 [Prunus 
mume]
Length=397

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 93/123 (76%), Gaps = 2/123 (2%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTN-RIWAPPESTNQLIAQHRRDQELQVISEDC  379
            M++R + K+SA WIP+F I  F LGML T+ R+W  PES  QLI+  R++QELQ++SEDC
Sbjct  1    MKNRSSRKISATWIPIFCIPAFLLGMLITSSRMWVAPESNGQLISTRRQEQELQIVSEDC  60

Query  380  TTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQ-SE  556
             T KKPGQEKDVM E+YKTH +IQSLDK ++ ++MELAA RS+QEM  S G+  + Q S+
Sbjct  61   ATKKKPGQEKDVMDEIYKTHASIQSLDKQMASIQMELAAARSSQEMGTSSGAGGNSQLSK  120

Query  557  DGP  565
            D P
Sbjct  121  DSP  123



>ref|XP_010672363.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=396

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +2

Query  200  MMRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDC  379
            MM++R + K+S KW+P+F I+FFF+GML+TNR+W PPES ++LI+ H++++EL+VI EDC
Sbjct  1    MMKNRGSGKISTKWVPIFCISFFFIGMLFTNRLWEPPESGSKLISSHQQNEELKVICEDC  60

Query  380  TTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEM  517
             T KK   + +VM+EV KTH+AI+SLDKS+SML+MELAA+RS++E+
Sbjct  61   GTKKKNKDDTNVMEEVQKTHDAIKSLDKSVSMLQMELAASRSSKEL  106



>ref|XP_006846610.1| hypothetical protein AMTR_s00156p00023720 [Amborella trichopoda]
 gb|ERN08285.1| hypothetical protein AMTR_s00156p00023720 [Amborella trichopoda]
Length=396

 Score =   146 bits (368),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            MRSRH+ KVS KWI +  I+ F  GML+TNR+WA PE    +I++ R+DQELQV+SE+CT
Sbjct  1    MRSRHSEKVSVKWILILCISSFAFGMLFTNRMWAAPELNKNIISRRRQDQELQVVSEECT  60

Query  383  TMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEM  517
            T +  GQ+KD+M EV++THEAIQSLDK+IS L+ME+AATRS+QEM
Sbjct  61   TKRTLGQDKDIMGEVFRTHEAIQSLDKTISTLQMEIAATRSSQEM  105



>ref|XP_008233933.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Prunus 
mume]
Length=399

 Score =   145 bits (367),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 93/125 (74%), Gaps = 4/125 (3%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            M++R + K+SA WIP+F I  F LGML T+R+W  PES  QLI+  R++QELQ++SEDC 
Sbjct  1    MKNRSSRKISATWIPIFCIPAFLLGMLITSRMWVAPESNGQLISTRRQEQELQIVSEDCA  60

Query  383  TMKKPGQEKDVMQEVYKTHEAIQ---SLDKSISMLKMELAATRSTQEMKKSDGSDESPQ-  550
            T KKPGQEKDVM E+YKTH +IQ   SLDK ++ ++MELAA RS+QEM  S G+  + Q 
Sbjct  61   TKKKPGQEKDVMDEIYKTHASIQLARSLDKQMASIQMELAAARSSQEMGTSSGAGGNSQL  120

Query  551  SEDGP  565
            S+D P
Sbjct  121  SKDSP  125



>ref|XP_008378526.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X4 [Malus 
domestica]
Length=395

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 91/116 (78%), Gaps = 1/116 (1%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            M+SR ++K+SA WIP+F I  F LGML T R+WA PE+  QLI+  R++QELQ++SEDC 
Sbjct  1    MKSR-SSKISATWIPIFCIPAFLLGMLITGRMWAAPETNGQLISTRRQEQELQIVSEDCE  59

Query  383  TMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQ  550
            T KK GQ+K+VM E+Y+THE+IQSLDK +++++MELAA RS+QEM  S GS  + Q
Sbjct  60   TKKKHGQDKNVMDEIYRTHESIQSLDKQMALIQMELAAARSSQEMGNSGGSTANLQ  115



>gb|KHG03200.1| Beta-1,3-galactosyltransferase 7 -like protein [Gossypium arboreum]
Length=397

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = +2

Query  200  MMRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDC  379
            M   R   K+S  WIP   ++FF LG+L++NR+W PPES  QL++Q RR+QELQ++S DC
Sbjct  1    MKPHRSPKKISLNWIPFICLSFFTLGILFSNRLWVPPESNGQLLSQRRREQELQIVSGDC  60

Query  380  TTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGS  535
             T K PGQ+ DVM EV KTHEAIQSLDKS++ML+M+LAA+R++QEM   + S
Sbjct  61   DTKKTPGQDNDVMGEVLKTHEAIQSLDKSVAMLEMQLAASRNSQEMDNGEAS  112



>ref|XP_003542690.1| PREDICTED: beta-1,3-galactosyltransferase 7 [Glycine max]
Length=397

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 89/124 (72%), Gaps = 4/124 (3%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            M+ R + K+SAKW+P+FS+  F +GML T RIW PPES    ++ HR +QELQV+S DC 
Sbjct  1    MKIRSSKKISAKWVPVFSVFSFLIGMLITTRIWEPPESNGVFLSNHRHEQELQVVSGDCA  60

Query  383  TMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDE---SPQS  553
              KKP Q+ DVM +VYKTH AIQSLDK +SML+MELAA RST+E K SDGS     S  S
Sbjct  61   P-KKPVQDNDVMNKVYKTHGAIQSLDKQVSMLQMELAAARSTREHKISDGSANTLASGVS  119

Query  554  EDGP  565
             +GP
Sbjct  120  TEGP  123



>ref|XP_008352694.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Malus domestica]
Length=435

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = +2

Query  206  RSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTT  385
            +SR++ K+SA WIP+F I  F LGML T R+WA PES  QLI+  R++QELQ+++EDC T
Sbjct  41   KSRNSKKISATWIPIFCIPAFLLGMLITGRMWAAPESNGQLISIRRQEQELQIVAEDCAT  100

Query  386  MKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQ  550
             KK G +K+VM E+YKTHE+IQSLDK ++ ++MELAA RS+QEM+ S GS  + Q
Sbjct  101  KKKHGHDKNVMDEIYKTHESIQSLDKQMASIQMELAAARSSQEMEDSGGSTSNSQ  155



>ref|XP_009367325.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X3 [Pyrus 
x bretschneideri]
Length=397

 Score =   143 bits (360),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 90/117 (77%), Gaps = 1/117 (1%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYT-NRIWAPPESTNQLIAQHRRDQELQVISEDC  379
            M+SR + K+SA WIP+F I  F LGML T +R+WA PE+  QLI+  R++QELQ++SEDC
Sbjct  1    MKSRSSKKISATWIPIFCIPAFLLGMLITGSRMWAAPETNGQLISTRRQEQELQIVSEDC  60

Query  380  TTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQ  550
             T KK GQ+K+VM E+Y+THE+IQSLDK ++ ++MELAA RS+QEM  S GS  + Q
Sbjct  61   ATKKKHGQDKNVMDEIYRTHESIQSLDKQMASIQMELAAARSSQEMGNSGGSTANSQ  117



>gb|KJB64381.1| hypothetical protein B456_010G046600 [Gossypium raimondii]
Length=400

 Score =   142 bits (358),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 90/126 (71%), Gaps = 4/126 (3%)
 Frame = +2

Query  200  MMRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDC  379
            M   R   K+S  WIP   ++FF LG+L++NR+W PPES  QL++Q RR+QELQ++S DC
Sbjct  1    MKPQRSPKKISLNWIPFICLSFFTLGILFSNRLWVPPESNGQLLSQRRREQELQIVSGDC  60

Query  380  TTMKKPGQEKDVMQEVYKTHEAIQ---SLDKSISMLKMELAATRSTQEMKKSDGSD-ESP  547
             T K PGQ+ DVM EV KTHEAIQ   SLDKS++ML+M+LAA+RS+QEM   + S   S 
Sbjct  61   DTKKTPGQDNDVMGEVLKTHEAIQPYRSLDKSVAMLEMQLAASRSSQEMDNGEASKVVST  120

Query  548  QSEDGP  565
             + DGP
Sbjct  121  LTRDGP  126



>ref|XP_011465327.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=399

 Score =   142 bits (358),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 88/114 (77%), Gaps = 3/114 (3%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            M++R + K+SAKWIP+F +  F LGML T+R+WA PES  QLI+  R++QELQ++SEDC 
Sbjct  1    MKNRSSGKISAKWIPIFCVPSFLLGMLITSRMWAVPESNGQLISTRRQEQELQIVSEDCA  60

Query  383  TMKKPGQEKDVMQEVYKTHEAIQ---SLDKSISMLKMELAATRSTQEMKKSDGS  535
            T KK GQEKDVM E+YKTHE+IQ   SLDK ++ ++MELAA RS+QEM  S  S
Sbjct  61   TKKKLGQEKDVMNEIYKTHESIQRIRSLDKQMASIQMELAAARSSQEMGVSGDS  114



>ref|XP_009367324.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Pyrus 
x bretschneideri]
Length=399

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 89/119 (75%), Gaps = 3/119 (3%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            M+SR + K+SA WIP+F I  F LGML T R+WA PE+  QLI+  R++QELQ++SEDC 
Sbjct  1    MKSRSSKKISATWIPIFCIPAFLLGMLITGRMWAAPETNGQLISTRRQEQELQIVSEDCA  60

Query  383  TMKKPGQEKDVMQEVYKTHEAIQ---SLDKSISMLKMELAATRSTQEMKKSDGSDESPQ  550
            T KK GQ+K+VM E+Y+THE+IQ   SLDK ++ ++MELAA RS+QEM  S GS  + Q
Sbjct  61   TKKKHGQDKNVMDEIYRTHESIQRARSLDKQMASIQMELAAARSSQEMGNSGGSTANSQ  119



>ref|XP_008802092.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Phoenix dactylifera]
Length=399

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +2

Query  224  KVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPGQ  403
            +VSA+WI +  +A F LG+L+++R W  P+S +Q+I++ R++QELQVIS DCTT KKPG+
Sbjct  14   RVSARWILIACVAGFGLGVLFSDRFWTAPDSNSQIISRQRQEQELQVISGDCTTKKKPGR  73

Query  404  EKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQS  553
            +KD+M EV KTHEAIQSLDK+I+ L+MELAATRS+QE+ + DGS  +P S
Sbjct  74   DKDIMGEVTKTHEAIQSLDKTIATLQMELAATRSSQELIRLDGSPSTPAS  123



>ref|XP_011097468.1| PREDICTED: beta-1,3-galactosyltransferase 7 [Sesamum indicum]
Length=395

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 85/102 (83%), Gaps = 2/102 (2%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            M+++ +AKVSAKWIP+FSI FFFLGM++TN+ W   ES NQLI Q RR+QELQ+I+EDC 
Sbjct  1    MKTKSSAKVSAKWIPIFSICFFFLGMMFTNKFWGHLESDNQLITQRRREQELQIIAEDCN  60

Query  383  TMKKPG--QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATR  502
            + KK    Q+K+V+ EV+KTHE+IQ LDKSISML+MEL+A+R
Sbjct  61   SEKKKAGHQDKNVINEVHKTHESIQKLDKSISMLQMELSASR  102



>ref|XP_008233932.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Prunus 
mume]
Length=400

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 93/126 (74%), Gaps = 5/126 (4%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTN-RIWAPPESTNQLIAQHRRDQELQVISEDC  379
            M++R + K+SA WIP+F I  F LGML T+ R+W  PES  QLI+  R++QELQ++SEDC
Sbjct  1    MKNRSSRKISATWIPIFCIPAFLLGMLITSSRMWVAPESNGQLISTRRQEQELQIVSEDC  60

Query  380  TTMKKPGQEKDVMQEVYKTHEAIQ---SLDKSISMLKMELAATRSTQEMKKSDGSDESPQ  550
             T KKPGQEKDVM E+YKTH +IQ   SLDK ++ ++MELAA RS+QEM  S G+  + Q
Sbjct  61   ATKKKPGQEKDVMDEIYKTHASIQLARSLDKQMASIQMELAAARSSQEMGTSSGAGGNSQ  120

Query  551  -SEDGP  565
             S+D P
Sbjct  121  LSKDSP  126



>ref|XP_010916559.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Elaeis guineensis]
Length=398

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +2

Query  224  KVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPGQ  403
            +VSA+WI +  +A F LG+L+T+R W  P+S +Q+I++ R++QELQVIS DC+T KKPG+
Sbjct  13   RVSARWILIACVAGFALGVLFTDRFWTAPDSNSQIISRQRQEQELQVISGDCSTKKKPGE  72

Query  404  EKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQS  553
            +KD+M EV KTHEAIQSLDK+I+ L+MELAATRS+QE+ + DGS   P S
Sbjct  73   DKDIMGEVTKTHEAIQSLDKTIATLQMELAATRSSQELMRLDGSPSIPAS  122



>ref|XP_010672316.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=399

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 91/109 (83%), Gaps = 3/109 (3%)
 Frame = +2

Query  200  MMRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDC  379
            MM++R + K+S KW+P+F I+FFF+GML+TNR+W PPES ++LI+ H++++EL+VI EDC
Sbjct  1    MMKNRGSGKISTKWVPIFCISFFFIGMLFTNRLWEPPESGSKLISSHQQNEELKVICEDC  60

Query  380  TTMKKPGQEKDVMQEVYKTHEAIQ---SLDKSISMLKMELAATRSTQEM  517
             T KK   + +VM+EV KTH+AI+   SLDKS+SML+MELAA+RS++E+
Sbjct  61   GTKKKNKDDTNVMEEVQKTHDAIKMIRSLDKSVSMLQMELAASRSSKEL  109



>ref|XP_004515661.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Cicer 
arietinum]
Length=392

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 87/111 (78%), Gaps = 1/111 (1%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            M++R + K+SAKWIP+FS+  F LGML T R+W  PES   +I++H+RDQELQV+SEDC 
Sbjct  1    MKTRASTKISAKWIPIFSLFSFILGMLITTRMWEQPESNGVIISKHQRDQELQVVSEDCA  60

Query  383  TMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGS  535
            T KK  + KD M E+YKTHEAIQ+LDK +SML+MELAA RS++E   S+GS
Sbjct  61   TKKKQEKPKDEMNELYKTHEAIQALDKQVSMLQMELAAARSSRE-NNSNGS  110



>ref|XP_008378524.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X3 [Malus 
domestica]
Length=396

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 92/117 (79%), Gaps = 2/117 (2%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYT-NRIWAPPESTNQLIAQHRRDQELQVISEDC  379
            M+SR ++K+SA WIP+F I  F LGML T +R+WA PE+  QLI+  R++QELQ++SEDC
Sbjct  1    MKSR-SSKISATWIPIFCIPAFLLGMLITGSRMWAAPETNGQLISTRRQEQELQIVSEDC  59

Query  380  TTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQ  550
             T KK GQ+K+VM E+Y+THE+IQSLDK +++++MELAA RS+QEM  S GS  + Q
Sbjct  60   ETKKKHGQDKNVMDEIYRTHESIQSLDKQMALIQMELAAARSSQEMGNSGGSTANLQ  116



>ref|XP_008378523.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Malus 
domestica]
Length=398

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 91/119 (76%), Gaps = 4/119 (3%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            M+SR ++K+SA WIP+F I  F LGML T R+WA PE+  QLI+  R++QELQ++SEDC 
Sbjct  1    MKSR-SSKISATWIPIFCIPAFLLGMLITGRMWAAPETNGQLISTRRQEQELQIVSEDCE  59

Query  383  TMKKPGQEKDVMQEVYKTHEAIQ---SLDKSISMLKMELAATRSTQEMKKSDGSDESPQ  550
            T KK GQ+K+VM E+Y+THE+IQ   SLDK +++++MELAA RS+QEM  S GS  + Q
Sbjct  60   TKKKHGQDKNVMDEIYRTHESIQRARSLDKQMALIQMELAAARSSQEMGNSGGSTANLQ  118



>ref|XP_010063328.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X3 [Eucalyptus 
grandis]
 gb|KCW70542.1| hypothetical protein EUGRSUZ_F03738 [Eucalyptus grandis]
Length=389

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 89/113 (79%), Gaps = 2/113 (2%)
 Frame = +2

Query  203  MRSRHNA--KVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISED  376
            M+SR     ++S KWIP+F I+FF LG+L +NR+W+PPES+ Q +++ RR+QEL+++SED
Sbjct  1    MKSRGGGGNRISTKWIPIFCISFFLLGILISNRMWSPPESSGQFVSRARREQELRMVSED  60

Query  377  CTTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGS  535
            C + KKP  +K+V+++V+KTHEAIQSLDKSI  L+MELAA+RS  E+    G+
Sbjct  61   CDSKKKPEDDKNVLKQVHKTHEAIQSLDKSIESLQMELAASRSAMELGNGSGN  113



>ref|XP_009367010.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Pyrus x bretschneideri]
Length=396

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 86/116 (74%), Gaps = 0/116 (0%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            M+SR + K+SA WIP+F I  F LGML T R+WA PES  QLI+  R++QELQ++SED  
Sbjct  1    MKSRSSKKISATWIPIFCIPAFLLGMLITGRMWAAPESNGQLISIRRQEQELQIVSEDWA  60

Query  383  TMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQ  550
            T KK G +K+VM E+YKTHE+IQSLDK ++ +++ELAA RS+QE   S GS  + Q
Sbjct  61   TKKKHGHDKNVMDEIYKTHESIQSLDKQMASIQLELAAARSSQETGDSGGSTSNSQ  116



>gb|KDP32735.1| hypothetical protein JCGZ_12027 [Jatropha curcas]
Length=398

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 82/108 (76%), Gaps = 3/108 (3%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            M+ R  AKVS KWIP+  +  F LG+L++NR W PPES  QLIAQ R DQELQV+SED T
Sbjct  1    MKPRGPAKVSVKWIPILCVFCFVLGILFSNRAWDPPESNGQLIAQRRHDQELQVVSEDST  60

Query  383  TMKKPGQEKDVMQEVYKTHEAIQ---SLDKSISMLKMELAATRSTQEM  517
              KK   ++DVM EV KTHEAIQ   SLDKSI+ML+M+LAA+RS+QEM
Sbjct  61   AQKKVSHDEDVMDEVLKTHEAIQRTRSLDKSIAMLEMQLAASRSSQEM  108



>ref|XP_009367323.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Pyrus 
x bretschneideri]
Length=400

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 90/120 (75%), Gaps = 4/120 (3%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYT-NRIWAPPESTNQLIAQHRRDQELQVISEDC  379
            M+SR + K+SA WIP+F I  F LGML T +R+WA PE+  QLI+  R++QELQ++SEDC
Sbjct  1    MKSRSSKKISATWIPIFCIPAFLLGMLITGSRMWAAPETNGQLISTRRQEQELQIVSEDC  60

Query  380  TTMKKPGQEKDVMQEVYKTHEAIQ---SLDKSISMLKMELAATRSTQEMKKSDGSDESPQ  550
             T KK GQ+K+VM E+Y+THE+IQ   SLDK ++ ++MELAA RS+QEM  S GS  + Q
Sbjct  61   ATKKKHGQDKNVMDEIYRTHESIQRARSLDKQMASIQMELAAARSSQEMGNSGGSTANSQ  120



>gb|ACJ83270.1| unknown [Medicago truncatula]
Length=187

 Score =   132 bits (333),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 87/113 (77%), Gaps = 3/113 (3%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRD-QELQVISEDC  379
            M++R + K+SAKWIP+FS+  F +GML T R+W  PES   +I++H+RD QELQVISEDC
Sbjct  1    MKTRASTKISAKWIPIFSVFSFLIGMLITTRMWEQPESNGVIISKHQRDQQELQVISEDC  60

Query  380  -TTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGS  535
              T KK  + KD M E+YKTHEAIQ+LDK +SML+MELAA RS+++ K S GS
Sbjct  61   DVTKKKQEKPKDEMNELYKTHEAIQALDKQVSMLQMELAAARSSRK-KNSTGS  112



>ref|XP_002513842.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
 gb|EEF48425.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
Length=396

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 87/122 (71%), Gaps = 1/122 (1%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQ-LIAQHRRDQELQVISEDC  379
            M++R +AKVS KWIP   +  F LG+L++ R W P ES  Q LIAQHR +QELQ++SED 
Sbjct  1    MKARASAKVSVKWIPFICVFSFVLGILFSIRAWDPSESNGQQLIAQHRHEQELQLVSEDS  60

Query  380  TTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
            T+ KK   +KDVM EV KTHEAIQSLDKSI+ML+ME+AA+RS+QEM     S       +
Sbjct  61   TSQKKLSNDKDVMGEVLKTHEAIQSLDKSIAMLQMEIAASRSSQEMNLDGASSVVTPHLE  120

Query  560  GP  565
            GP
Sbjct  121  GP  122



>gb|AGV54547.1| beta-1,3-galactosyltransferase 7-like protein [Phaseolus vulgaris]
Length=215

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 80/104 (77%), Gaps = 2/104 (2%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            M++R   K+SA WIP+FS+  F LGML T+R+W PPES   LIAQH+RDQ+LQVIS DC 
Sbjct  1    MKTRTFTKISASWIPIFSVFSFILGMLITSRMWDPPESNGMLIAQHQRDQQLQVISGDCE  60

Query  383  TMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE  514
            T K   Q KD + E+ KTHEAIQ+LDK +SML+MELAA RS++E
Sbjct  61   TKKM--QPKDAVSELQKTHEAIQALDKQVSMLQMELAAARSSRE  102



>ref|XP_004515660.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Cicer 
arietinum]
Length=393

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 88/112 (79%), Gaps = 2/112 (2%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYT-NRIWAPPESTNQLIAQHRRDQELQVISEDC  379
            M++R + K+SAKWIP+FS+  F LGML T +R+W  PES   +I++H+RDQELQV+SEDC
Sbjct  1    MKTRASTKISAKWIPIFSLFSFILGMLITTSRMWEQPESNGVIISKHQRDQELQVVSEDC  60

Query  380  TTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGS  535
             T KK  + KD M E+YKTHEAIQ+LDK +SML+MELAA RS++E   S+GS
Sbjct  61   ATKKKQEKPKDEMNELYKTHEAIQALDKQVSMLQMELAAARSSRE-NNSNGS  111



>ref|XP_008378522.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Malus 
domestica]
Length=399

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 92/120 (77%), Gaps = 5/120 (4%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYT-NRIWAPPESTNQLIAQHRRDQELQVISEDC  379
            M+SR ++K+SA WIP+F I  F LGML T +R+WA PE+  QLI+  R++QELQ++SEDC
Sbjct  1    MKSR-SSKISATWIPIFCIPAFLLGMLITGSRMWAAPETNGQLISTRRQEQELQIVSEDC  59

Query  380  TTMKKPGQEKDVMQEVYKTHEAIQ---SLDKSISMLKMELAATRSTQEMKKSDGSDESPQ  550
             T KK GQ+K+VM E+Y+THE+IQ   SLDK +++++MELAA RS+QEM  S GS  + Q
Sbjct  60   ETKKKHGQDKNVMDEIYRTHESIQRARSLDKQMALIQMELAAARSSQEMGNSGGSTANLQ  119



>ref|XP_008776410.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Phoenix dactylifera]
Length=180

 Score =   129 bits (325),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 81/109 (74%), Gaps = 4/109 (4%)
 Frame = +2

Query  224  KVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRR-DQELQVISEDCTTMKKPG  400
            KV  +WI +  I  F  GML+T+R WA P+  NQ+I++ RR +QELQ+ISE+C T +KPG
Sbjct  11   KVGLRWILILCIMSFGFGMLFTDRFWANPDLNNQIISRQRRQEQELQIISENCATKRKPG  70

Query  401  QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESP  547
            Q+KD+M EV +THEAIQSLDK+IS L+MELAA RS QE+    G D SP
Sbjct  71   QDKDIMGEVTRTHEAIQSLDKTISTLQMELAAKRSLQELL---GMDHSP  116



>ref|XP_010063329.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X4 [Eucalyptus 
grandis]
 gb|KCW70543.1| hypothetical protein EUGRSUZ_F03738 [Eucalyptus grandis]
Length=388

 Score =   134 bits (337),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 89/113 (79%), Gaps = 3/113 (3%)
 Frame = +2

Query  203  MRSRHNA--KVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISED  376
            M+SR     ++S KWIP+F I+FF LG+L +NR+W+PPES+ Q +++ RR+QEL+++SED
Sbjct  1    MKSRGGGGNRISTKWIPIFCISFFLLGILISNRMWSPPESSGQFVSRARREQELRMVSED  60

Query  377  CTTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGS  535
            C + KKP  +K+V+++V+KTHEAIQSLDKSI  L+MELAA+RS  E+    G+
Sbjct  61   CDS-KKPEDDKNVLKQVHKTHEAIQSLDKSIESLQMELAASRSAMELGNGSGN  112



>ref|XP_002269415.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Vitis 
vinifera]
 ref|XP_010652983.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Vitis 
vinifera]
 emb|CBI21654.3| unnamed protein product [Vitis vinifera]
Length=397

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 83/105 (79%), Gaps = 1/105 (1%)
 Frame = +2

Query  203  MRSRHNA-KVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDC  379
            M+SR+N+ K S  WI +  I  F LGML+TNR+W  PES  Q+I+  R +QELQ+ISEDC
Sbjct  1    MKSRNNSEKFSPTWIFILCIFSFALGMLFTNRMWVAPESNRQMISTQRHEQELQIISEDC  60

Query  380  TTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE  514
            T+ KK GQ+KDVM EVYKTHEAIQSLDK+IS L++EL+ATR++ +
Sbjct  61   TSKKKVGQDKDVMGEVYKTHEAIQSLDKTISTLQIELSATRTSHK  105



>gb|EYU22897.1| hypothetical protein MIMGU_mgv1a007777mg [Erythranthe guttata]
Length=395

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 86/113 (76%), Gaps = 4/113 (4%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQ-ELQVISEDC  379
            M+S+ + KVSAKWI +FS   FFLG+++TN++W P ES NQLI   RRDQ ELQ+ S DC
Sbjct  1    MKSKSSTKVSAKWIFIFSTCSFFLGIMFTNKLWVPLESNNQLITLKRRDQEELQITSSDC  60

Query  380  TT--MKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE-MKKSD  529
            +T   K   Q+KDV+ EVYKTHEAIQSLDKSISML+MEL+ +R + E MK +D
Sbjct  61   STEIKKSRNQDKDVVNEVYKTHEAIQSLDKSISMLQMELSVSRKSHEKMKTND  113



>ref|XP_010063326.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Eucalyptus 
grandis]
 gb|KCW70541.1| hypothetical protein EUGRSUZ_F03738 [Eucalyptus grandis]
Length=392

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 89/116 (77%), Gaps = 5/116 (4%)
 Frame = +2

Query  203  MRSRHNA--KVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISED  376
            M+SR     ++S KWIP+F I+FF LG+L +NR+W+PPES+ Q +++ RR+QEL+++SED
Sbjct  1    MKSRGGGGNRISTKWIPIFCISFFLLGILISNRMWSPPESSGQFVSRARREQELRMVSED  60

Query  377  CTTMKKPGQEKDVMQEVYKTHEAIQ---SLDKSISMLKMELAATRSTQEMKKSDGS  535
            C + KKP  +K+V+++V+KTHEAIQ   SLDKSI  L+MELAA+RS  E+    G+
Sbjct  61   CDSKKKPEDDKNVLKQVHKTHEAIQLDRSLDKSIESLQMELAASRSAMELGNGSGN  116



>ref|XP_007136194.1| hypothetical protein PHAVU_009G026100g [Phaseolus vulgaris]
 gb|ESW08188.1| hypothetical protein PHAVU_009G026100g [Phaseolus vulgaris]
Length=393

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 80/104 (77%), Gaps = 2/104 (2%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            M++R   K+SA WIP+FS+  F LGML T+R+W PPES   LIAQH+RDQ+LQVIS DC 
Sbjct  1    MKTRTFTKISASWIPIFSVFSFILGMLITSRMWDPPESNGMLIAQHQRDQQLQVISGDCE  60

Query  383  TMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE  514
            T K   Q KD + E+ KTHEAIQ+LDK +SML+MELAA RS++E
Sbjct  61   TKKM--QPKDAVSELQKTHEAIQALDKQVSMLQMELAAARSSRE  102



>ref|XP_003601133.1| Avr9 elicitor response protein [Medicago truncatula]
 gb|AES71384.1| beta-1,3-galactosyltransferase-like protein [Medicago truncatula]
 gb|AFK45036.1| unknown [Medicago truncatula]
Length=395

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 87/113 (77%), Gaps = 3/113 (3%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRD-QELQVISEDC  379
            M++R + K+SAKWIP+FS+  F +GML T R+W  PES   +I++H+RD QELQVISEDC
Sbjct  1    MKTRASTKISAKWIPIFSVFSFLIGMLITTRMWEQPESNGVIISKHQRDQQELQVISEDC  60

Query  380  -TTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGS  535
              T KK  + KD M E+YKTHEAIQ+LDK +SML+MELAA RS+++ K S GS
Sbjct  61   DVTKKKQEKPKDEMNELYKTHEAIQALDKQVSMLQMELAAARSSRK-KNSTGS  112



>ref|XP_010652984.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Vitis 
vinifera]
Length=396

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 83/105 (79%), Gaps = 2/105 (2%)
 Frame = +2

Query  203  MRSRHNA-KVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDC  379
            M+SR+N+ K S  WI +  I  F LGML+TNR+W  PES  Q+I+  R +QELQ+ISEDC
Sbjct  1    MKSRNNSEKFSPTWIFILCIFSFALGMLFTNRMWVAPESNRQMISTQRHEQELQIISEDC  60

Query  380  TTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE  514
            T+ KK GQ+KDVM EVYKTHEAIQSLDK+IS L++EL+ATR++ +
Sbjct  61   TS-KKVGQDKDVMGEVYKTHEAIQSLDKTISTLQIELSATRTSHK  104



>ref|XP_010063327.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Eucalyptus 
grandis]
Length=391

 Score =   129 bits (323),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 89/116 (77%), Gaps = 6/116 (5%)
 Frame = +2

Query  203  MRSRHNA--KVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISED  376
            M+SR     ++S KWIP+F I+FF LG+L +NR+W+PPES+ Q +++ RR+QEL+++SED
Sbjct  1    MKSRGGGGNRISTKWIPIFCISFFLLGILISNRMWSPPESSGQFVSRARREQELRMVSED  60

Query  377  CTTMKKPGQEKDVMQEVYKTHEAIQ---SLDKSISMLKMELAATRSTQEMKKSDGS  535
            C + KKP  +K+V+++V+KTHEAIQ   SLDKSI  L+MELAA+RS  E+    G+
Sbjct  61   CDS-KKPEDDKNVLKQVHKTHEAIQLDRSLDKSIESLQMELAASRSAMELGNGSGN  115



>ref|XP_011074895.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Sesamum indicum]
Length=372

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 78/98 (80%), Gaps = 2/98 (2%)
 Frame = +2

Query  278  MLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPG--QEKDVMQEVYKTHEAIQ  451
            M++TN+ W P ES NQLI Q RRDQELQ++SEDC+T KK    ++ DVM EVYKTHEAIQ
Sbjct  1    MVFTNKYWGPLESNNQLITQQRRDQELQIVSEDCSTRKKKAGDRDNDVMNEVYKTHEAIQ  60

Query  452  SLDKSISMLKMELAATRSTQEMKKSDGSDESPQSEDGP  565
            SLDKSISML+MEL+A+R+ QE +K+DGS  + +++  P
Sbjct  61   SLDKSISMLQMELSASRNAQEQQKTDGSSTTSEADGVP  98



>ref|XP_004952712.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Setaria italica]
Length=398

 Score =   126 bits (317),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 81/104 (78%), Gaps = 2/104 (2%)
 Frame = +2

Query  230  SAKWIPLFSIAF-FFLGMLYTNRIWAPPESTNQLIAQHRR-DQELQVISEDCTTMKKPGQ  403
            SA+W  L   AF F LGML+T+R W  P+++N +++Q RR DQELQ++SEDC T +K G+
Sbjct  13   SARWRVLVLCAFSFGLGMLFTDRFWTAPDTSNHIMSQRRRQDQELQLVSEDCNTKRKHGE  72

Query  404  EKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGS  535
            +KD+M EV KTHEAIQSLDKSIS L+MELAA RST E+ +S GS
Sbjct  73   DKDIMGEVTKTHEAIQSLDKSISTLQMELAAKRSTLELLRSSGS  116



>ref|XP_010416738.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Camelina 
sativa]
Length=429

 Score =   126 bits (317),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 81/105 (77%), Gaps = 3/105 (3%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPP-ESTNQLIAQHRRDQELQVISEDCTTMKKPGQ  403
            +S KW+P   I+FF LG ++T+R W P  +S +QLI+QH RD ELQ++S+DC   KK  Q
Sbjct  44   ISLKWVPFLCISFFALGAIFTSRSWEPSSDSGSQLISQHHRDHELQIVSDDCAHNKKATQ  103

Query  404  EKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSD  538
            EKDV+ EV +THEAI+SLDKS+S L+MEL++TRS+QE  K DGS+
Sbjct  104  EKDVINEVLRTHEAIKSLDKSVSTLQMELSSTRSSQE--KVDGSE  146



>gb|AFK48973.1| unknown [Lotus japonicus]
Length=394

 Score =   126 bits (316),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 85/120 (71%), Gaps = 1/120 (1%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            M++R + K+SAKW+P+FS+  F LG+  T+R+W   +S   +I+Q +RDQ+LQVISEDC 
Sbjct  1    MKTRTSTKISAKWLPIFSVFSFILGVFITSRMWESHDSNGLMISQLQRDQQLQVISEDCD  60

Query  383  TMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSEDG  562
            T  K  Q KD M E+YKTHEAIQ+LDK +SML+MELAA R+++    SD    +  S DG
Sbjct  61   TKNKQ-QPKDEMNELYKTHEAIQALDKQVSMLQMELAAARNSRGTNISDSDGSANTSGDG  119



>gb|ACF79671.1| unknown [Zea mays]
 gb|AFW62682.1| avr9 elicitor response protein [Zea mays]
Length=398

 Score =   126 bits (316),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 82/104 (79%), Gaps = 2/104 (2%)
 Frame = +2

Query  230  SAKWIPLFSIAF-FFLGMLYTNRIWAPPESTNQLIAQHRR-DQELQVISEDCTTMKKPGQ  403
            SA+W  L   AF F LGML+T+R W  P+S+N +++Q RR +QELQ++SEDC+T +K G+
Sbjct  13   SARWRVLLLCAFSFGLGMLFTDRFWTAPDSSNHIMSQSRRQEQELQLVSEDCSTKRKHGE  72

Query  404  EKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGS  535
            +KD+M EV KTHEAIQSLDKSIS L+MELAA RST E+ +S GS
Sbjct  73   DKDIMGEVTKTHEAIQSLDKSISTLQMELAAKRSTLELLRSSGS  116



>ref|XP_003601132.1| Avr9 elicitor response protein [Medicago truncatula]
 gb|AES71383.1| beta-1,3-galactosyltransferase-like protein [Medicago truncatula]
Length=396

 Score =   126 bits (316),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 88/114 (77%), Gaps = 4/114 (4%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYT-NRIWAPPESTNQLIAQHRRDQ-ELQVISED  376
            M++R + K+SAKWIP+FS+  F +GML T +R+W  PES   +I++H+RDQ ELQVISED
Sbjct  1    MKTRASTKISAKWIPIFSVFSFLIGMLITTSRMWEQPESNGVIISKHQRDQQELQVISED  60

Query  377  C-TTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGS  535
            C  T KK  + KD M E+YKTHEAIQ+LDK +SML+MELAA RS+++ K S GS
Sbjct  61   CDVTKKKQEKPKDEMNELYKTHEAIQALDKQVSMLQMELAAARSSRK-KNSTGS  113



>ref|XP_010943123.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Elaeis guineensis]
Length=397

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 80/105 (76%), Gaps = 1/105 (1%)
 Frame = +2

Query  224  KVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRR-DQELQVISEDCTTMKKPG  400
            KV  +WIP+  I  F  GML+T++ WA P+  NQ+I++ RR +QELQ+ISE+C T +KP 
Sbjct  11   KVCLRWIPILCIMSFGFGMLFTDKFWANPDVNNQIISKRRRQEQELQIISENCATKRKPE  70

Query  401  QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGS  535
            Q+KD+++EV +THEAIQSLDK+IS L+MELAA RS QE+   D S
Sbjct  71   QDKDIIREVTRTHEAIQSLDKTISTLQMELAAKRSLQELLGMDRS  115



>ref|XP_010471981.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X5 [Camelina 
sativa]
Length=396

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 83/106 (78%), Gaps = 4/106 (4%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPP-ESTNQLIAQHRRDQELQVISEDCT-TMKKPG  400
            +S KW+P   I+F+ LG ++T+R W P  +S +QLI+QHRRD ELQ++S+DC   +KK  
Sbjct  10   ISLKWVPFLCISFYALGAIFTSRSWEPSSDSGSQLISQHRRDHELQIVSDDCAHNIKKAT  69

Query  401  QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSD  538
            QEKDV+ EV +THEAI+SLDKS+S L+MEL++TRS+QE  K DGS+
Sbjct  70   QEKDVINEVLRTHEAIKSLDKSVSTLQMELSSTRSSQE--KVDGSE  113



>ref|NP_001131318.1| uncharacterized protein LOC100192632 [Zea mays]
 gb|ACG38477.1| avr9 elicitor response protein [Zea mays]
Length=398

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 81/103 (79%), Gaps = 2/103 (2%)
 Frame = +2

Query  233  AKWIPLFSIAF-FFLGMLYTNRIWAPPESTNQLIAQHRR-DQELQVISEDCTTMKKPGQE  406
            A+W  L   AF F LGML+T+R W  P+S+N +++Q RR +QELQ++SEDC+T +K G++
Sbjct  14   ARWRVLLLCAFSFGLGMLFTDRFWTAPDSSNHIMSQSRRQEQELQLVSEDCSTKRKHGED  73

Query  407  KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGS  535
            KD+M EV KTHEAIQSLDKSIS L+MELAA RST E+ +S GS
Sbjct  74   KDIMGEVTKTHEAIQSLDKSISTLQMELAAKRSTLELLRSSGS  116



>ref|XP_010471978.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Camelina 
sativa]
Length=424

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 83/106 (78%), Gaps = 4/106 (4%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPP-ESTNQLIAQHRRDQELQVISEDCT-TMKKPG  400
            +S KW+P   I+F+ LG ++T+R W P  +S +QLI+QHRRD ELQ++S+DC   +KK  
Sbjct  10   ISLKWVPFLCISFYALGAIFTSRSWEPSSDSGSQLISQHRRDHELQIVSDDCAHNIKKAT  69

Query  401  QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSD  538
            QEKDV+ EV +THEAI+SLDKS+S L+MEL++TRS+QE  K DGS+
Sbjct  70   QEKDVINEVLRTHEAIKSLDKSVSTLQMELSSTRSSQE--KVDGSE  113



>ref|XP_006390051.1| hypothetical protein EUTSA_v10018693mg [Eutrema salsugineum]
 gb|ESQ27337.1| hypothetical protein EUTSA_v10018693mg [Eutrema salsugineum]
Length=388

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 81/105 (77%), Gaps = 1/105 (1%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPP-ESTNQLIAQHRRDQELQVISEDCTTMKKPGQ  403
            +S KW+P   I+FF LG ++T+R W P  +S +QLI+Q RRD ELQ++S+DC   KK  Q
Sbjct  10   ISLKWVPFLCISFFALGAIFTSRSWEPSSDSGSQLISQRRRDHELQIVSDDCAHKKKATQ  69

Query  404  EKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSD  538
            EKDV+ EV +THEAIQSLDKS+S L+M+L++TR++QE  ++ G++
Sbjct  70   EKDVIDEVLRTHEAIQSLDKSVSTLQMQLSSTRTSQETVETTGAN  114



>ref|XP_006647402.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Oryza brachyantha]
Length=398

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 83/110 (75%), Gaps = 2/110 (2%)
 Frame = +2

Query  230  SAKWIPLFSIAFFF-LGMLYTNRIWAPPESTNQLIAQHRR-DQELQVISEDCTTMKKPGQ  403
            SA+W  L   AF F LGML+T+R W  P+++N +++Q RR D+ELQ+ISEDC T +K G+
Sbjct  13   SARWRVLLLCAFCFGLGMLFTDRFWTAPDTSNHIMSQRRRQDRELQLISEDCNTKRKHGE  72

Query  404  EKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQS  553
            +KD+M EV KTHEAIQ LDKSIS L+MELAA RST E+ +S GS  + +S
Sbjct  73   DKDIMGEVTKTHEAIQLLDKSISTLQMELAAKRSTLELLRSGGSPVTSES  122



>ref|XP_006301157.1| hypothetical protein CARUB_v10021555mg [Capsella rubella]
 gb|EOA34055.1| hypothetical protein CARUB_v10021555mg [Capsella rubella]
Length=395

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 81/105 (77%), Gaps = 3/105 (3%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPP-ESTNQLIAQHRRDQELQVISEDCTTMKKPGQ  403
            +S KW+P   I+FF LG ++T+R W P  +S +QLI+QHRRDQELQ++S+DC   KK  Q
Sbjct  10   ISLKWVPFLCISFFALGAIFTSRSWEPSSDSGSQLISQHRRDQELQIVSDDCAHNKKSTQ  69

Query  404  EKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSD  538
            EKDV+ EV +T +AIQSLDKS+S L+M+L++TRS+QE    DGS+
Sbjct  70   EKDVIDEVLRTQQAIQSLDKSVSTLQMQLSSTRSSQET--VDGSE  112



>dbj|BAD17751.1| putative avr9 elicitor response protein [Oryza sativa Japonica 
Group]
 gb|EAY86345.1| hypothetical protein OsI_07722 [Oryza sativa Indica Group]
 gb|EAZ23493.1| hypothetical protein OsJ_07189 [Oryza sativa Japonica Group]
Length=400

 Score =   124 bits (310),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 86/117 (74%), Gaps = 5/117 (4%)
 Frame = +2

Query  200  MMRSRHNA---KVSAKWIPLFSIAFFF-LGMLYTNRIWAPPESTNQLIAQHRR-DQELQV  364
            MM+ +  A   + SA+W  L   AF F LGML+T+R W  P+++N +++Q RR D+ELQ+
Sbjct  2    MMKGKGGAVDRRSSARWRMLLLCAFCFGLGMLFTDRFWTAPDTSNHIMSQRRRQDRELQL  61

Query  365  ISEDCTTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGS  535
            ISEDC T +K G++KD+M EV KTHEAIQ LDKSIS L+MELAA RST E+ ++ GS
Sbjct  62   ISEDCNTKRKHGEDKDIMGEVTKTHEAIQLLDKSISTLQMELAAKRSTLELLRAGGS  118



>ref|XP_010428866.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Camelina 
sativa]
Length=396

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 81/105 (77%), Gaps = 4/105 (4%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPP-ESTNQLIAQHRRDQELQVISEDCTTM-KKPG  400
            +S KW+P   I+FF LG ++T+R W P  +S +QLI+QHRRD ELQ++S+DC    KK  
Sbjct  10   ISLKWVPFLCISFFALGAIFTSRSWEPSSDSGSQLISQHRRDHELQIVSDDCAHHNKKAT  69

Query  401  QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGS  535
            +EKDV+ EV +THEAI+SLDKS+S L+MEL++TRS+QE  K DGS
Sbjct  70   EEKDVINEVLRTHEAIKSLDKSVSTLQMELSSTRSSQE--KVDGS  112



>ref|XP_002454032.1| hypothetical protein SORBIDRAFT_04g023470 [Sorghum bicolor]
 gb|EES07008.1| hypothetical protein SORBIDRAFT_04g023470 [Sorghum bicolor]
Length=398

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 81/104 (78%), Gaps = 2/104 (2%)
 Frame = +2

Query  230  SAKWIPLFSIAFFF-LGMLYTNRIWAPPESTNQLIAQHRR-DQELQVISEDCTTMKKPGQ  403
            SA+W  L   AF F LGML+T+R W+ P+++N +++Q RR ++ELQ++SEDC T +K G+
Sbjct  13   SARWRVLVLCAFCFGLGMLFTDRFWSAPDTSNHIMSQQRRQERELQLVSEDCNTKRKHGE  72

Query  404  EKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGS  535
            +KD+M EV KTHEAIQSLDKSIS L+MELAA RST E  +S GS
Sbjct  73   DKDIMGEVTKTHEAIQSLDKSISTLQMELAAKRSTLERLRSSGS  116



>ref|XP_010534616.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Tarenaya hassleriana]
Length=396

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 89/125 (71%), Gaps = 6/125 (5%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPP-ESTNQLIAQHRRDQELQVISEDC  379
            M+++ + K+S  WIP   I+ F LG ++T+R+WAP  +S +QLI+QH RD ELQ++S+DC
Sbjct  1    MKNKGSRKLSLTWIPFLCISSFALGAIFTSRLWAPSSDSGSQLISQHMRDHELQIVSDDC  60

Query  380  TTMKKPGQEKDVMQEVYKTHEAIQ---SLDKSISMLKMELAATRSTQEMKKSDGSDESPQ  550
            +  KK  + K  ++EV +T EAIQ   SLDKS+SML+MEL+ATRS+QE    DGS  + +
Sbjct  61   SDKKKKTRGKGALEEVLRTREAIQVDGSLDKSVSMLQMELSATRSSQET--GDGSGTTSE  118

Query  551  SEDGP  565
            SE  P
Sbjct  119  SEGNP  123



>ref|XP_010416737.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Camelina 
sativa]
Length=432

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 82/110 (75%), Gaps = 6/110 (5%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPP-ESTNQLIAQHRRDQELQVISEDCTTMKKPGQ  403
            +S KW+P   I+FF LG ++T+R W P  +S +QLI+QH RD ELQ++S+DC   KK  Q
Sbjct  44   ISLKWVPFLCISFFALGAIFTSRSWEPSSDSGSQLISQHHRDHELQIVSDDCAHNKKATQ  103

Query  404  EKDVMQEVYKTHEAIQ---SLDKSISMLKMELAATRSTQEMKKSDGSDES  544
            EKDV+ EV +THEAI+   SLDKS+S L+MEL++TRS+QE  K DGS+ +
Sbjct  104  EKDVINEVLRTHEAIKVDRSLDKSVSTLQMELSSTRSSQE--KVDGSETT  151



>ref|XP_010277678.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Nelumbo nucifera]
Length=395

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 82/111 (74%), Gaps = 1/111 (1%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            M++R N K S KWI +  I+ F  GM +TNR+W+ PES  Q+I++ R +++L++IS++C 
Sbjct  1    MKNR-NEKFSGKWIVILCISSFAFGMFFTNRVWSTPESYGQMISRERYEEDLRIISDNCM  59

Query  383  TMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGS  535
              +K G++KD+M EV++T EAI+SLDK+IS L+MELAA RS QE+   D S
Sbjct  60   FRRKRGEDKDLMGEVFRTQEAIKSLDKTISTLQMELAAARSAQELGNPDHS  110



>ref|XP_010471979.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X3 [Camelina 
sativa]
Length=403

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 83/109 (76%), Gaps = 7/109 (6%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPP-ESTNQLIAQHRRDQELQVISEDCT-TMKKPG  400
            +S KW+P   I+F+ LG ++T+R W P  +S +QLI+QHRRD ELQ++S+DC   +KK  
Sbjct  10   ISLKWVPFLCISFYALGAIFTSRSWEPSSDSGSQLISQHRRDHELQIVSDDCAHNIKKAT  69

Query  401  QEKDVMQEVYKTHEAIQ---SLDKSISMLKMELAATRSTQEMKKSDGSD  538
            QEKDV+ EV +THEAI+   SLDKS+S L+MEL++TRS+QE  K DGS+
Sbjct  70   QEKDVINEVLRTHEAIKVDRSLDKSVSTLQMELSSTRSSQE--KVDGSE  116



>ref|XP_008782246.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Phoenix dactylifera]
Length=399

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 82/111 (74%), Gaps = 0/111 (0%)
 Frame = +2

Query  221  AKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPG  400
            ++VSA+WI +  +  F +G+L+ +R W  P+S   + ++ R+++ELQ+IS +CTT KKP 
Sbjct  13   SRVSARWILIACVVGFGVGVLFADRFWTAPDSNGHITSRQRQEKELQLISGECTTKKKPR  72

Query  401  QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQS  553
             +KD+M EV KTHE+IQSLDK+I+ L+MELAATRS++E+ + DG    P S
Sbjct  73   LDKDIMGEVTKTHESIQSLDKTIATLQMELAATRSSKELMRLDGHPSIPSS  123



>ref|XP_010471980.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X4 [Camelina 
sativa]
Length=399

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 83/109 (76%), Gaps = 7/109 (6%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPP-ESTNQLIAQHRRDQELQVISEDCT-TMKKPG  400
            +S KW+P   I+F+ LG ++T+R W P  +S +QLI+QHRRD ELQ++S+DC   +KK  
Sbjct  10   ISLKWVPFLCISFYALGAIFTSRSWEPSSDSGSQLISQHRRDHELQIVSDDCAHNIKKAT  69

Query  401  QEKDVMQEVYKTHEAIQ---SLDKSISMLKMELAATRSTQEMKKSDGSD  538
            QEKDV+ EV +THEAI+   SLDKS+S L+MEL++TRS+QE  K DGS+
Sbjct  70   QEKDVINEVLRTHEAIKVDRSLDKSVSTLQMELSSTRSSQE--KVDGSE  116



>ref|XP_010471977.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Camelina 
sativa]
Length=427

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 84/111 (76%), Gaps = 7/111 (6%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPP-ESTNQLIAQHRRDQELQVISEDCT-TMKKPG  400
            +S KW+P   I+F+ LG ++T+R W P  +S +QLI+QHRRD ELQ++S+DC   +KK  
Sbjct  10   ISLKWVPFLCISFYALGAIFTSRSWEPSSDSGSQLISQHRRDHELQIVSDDCAHNIKKAT  69

Query  401  QEKDVMQEVYKTHEAIQ---SLDKSISMLKMELAATRSTQEMKKSDGSDES  544
            QEKDV+ EV +THEAI+   SLDKS+S L+MEL++TRS+QE  K DGS+ +
Sbjct  70   QEKDVINEVLRTHEAIKVDRSLDKSVSTLQMELSSTRSSQE--KVDGSETT  118



>ref|NP_974164.2| beta-1,3-galactosyltransferase 7 [Arabidopsis thaliana]
 gb|AEE36030.1| beta-1,3-galactosyltransferase 7 [Arabidopsis thaliana]
Length=384

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 79/109 (72%), Gaps = 7/109 (6%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPP-ESTNQLIAQHRRDQELQVISEDCTTMKKPGQ  403
            +S KW+P   I+FF LG ++T+R W P  +S +QLI+QH RD ELQ++S+DC   KK  Q
Sbjct  10   ISLKWVPFLCISFFALGAIFTSRSWEPSSDSGSQLISQHHRDHELQIVSDDCAHNKKATQ  69

Query  404  EKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQ  550
            EKDV  EV +THEAIQSLDKS+S     L++TRS+QEM   DGS+ +P+
Sbjct  70   EKDVTGEVLRTHEAIQSLDKSVST----LSSTRSSQEM--VDGSETNPR  112



>ref|XP_006304002.1| hypothetical protein CARUB_v10011446mg [Capsella rubella]
 gb|EOA36900.1| hypothetical protein CARUB_v10011446mg [Capsella rubella]
Length=396

 Score =   118 bits (296),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 82/107 (77%), Gaps = 5/107 (5%)
 Frame = +2

Query  212  RHNAKVSAK----WIPLFSIAFFFLGMLYTNRIW-APPESTNQLIAQHRRDQELQVISED  376
            +HN KVS K    W+PL  I+ FFLG ++T+R+  A  +S +QLI QHRRDQEL ++SED
Sbjct  2    KHNYKVSKKLTLTWVPLLCISCFFLGAIFTSRLRSASSDSGSQLILQHRRDQELNIVSED  61

Query  377  CTTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEM  517
                KK  QEKDVM+EV KTH+AI+SLDKS+SML+ +L+AT+S+Q++
Sbjct  62   YAHEKKKSQEKDVMEEVLKTHKAIESLDKSVSMLQKQLSATQSSQKI  108



>ref|XP_007141114.1| hypothetical protein PHAVU_008G168500g [Phaseolus vulgaris]
 gb|ESW13108.1| hypothetical protein PHAVU_008G168500g [Phaseolus vulgaris]
Length=397

 Score =   118 bits (295),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 83/120 (69%), Gaps = 7/120 (6%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            M++R + ++ AKW+P+FS+  F LGM  T R+  P +S   L++ HRR+QELQV+S DC 
Sbjct  1    MKTRGSTRIPAKWVPIFSVFSFILGMFITTRMREPLQSNGVLLSNHRREQELQVVSGDCA  60

Query  383  TMKKPGQEKDVMQEVYKTHEAIQ---SLDKSISMLKMELAATRSTQEMKKSDGSDESPQS  553
            T K    +KDVM EVYKTHEAIQ   SLDK +S+ +ME A  RST+E + SDGS ++  S
Sbjct  61   TKK----DKDVMSEVYKTHEAIQGVRSLDKQVSIRQMEQAIARSTRESEISDGSSKTLAS  116



>ref|XP_008681428.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN34486.1| unknown [Zea mays]
 gb|AFW71914.1| avr9 elicitor response protein isoform 1 [Zea mays]
 gb|AFW71915.1| avr9 elicitor response protein isoform 2 [Zea mays]
Length=398

 Score =   117 bits (294),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 80/104 (77%), Gaps = 2/104 (2%)
 Frame = +2

Query  230  SAKWIPLFSIAF-FFLGMLYTNRIWAPPESTNQLIAQH-RRDQELQVISEDCTTMKKPGQ  403
            SA+W  L   AF F +GML+T+R W  P++++  ++Q  R++QELQ++SEDC T +K G+
Sbjct  13   SARWRLLVLCAFSFGIGMLFTDRFWTAPDTSSHTMSQRWRQEQELQLVSEDCNTKRKHGE  72

Query  404  EKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGS  535
            +KD+M EV KTHEAIQSLDKSIS L+MELAA RST E+ +S GS
Sbjct  73   DKDIMGEVTKTHEAIQSLDKSISTLQMELAAKRSTLELLRSSGS  116



>ref|XP_010428865.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Camelina 
sativa]
Length=399

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 81/108 (75%), Gaps = 7/108 (6%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPP-ESTNQLIAQHRRDQELQVISEDCTTM-KKPG  400
            +S KW+P   I+FF LG ++T+R W P  +S +QLI+QHRRD ELQ++S+DC    KK  
Sbjct  10   ISLKWVPFLCISFFALGAIFTSRSWEPSSDSGSQLISQHRRDHELQIVSDDCAHHNKKAT  69

Query  401  QEKDVMQEVYKTHEAI---QSLDKSISMLKMELAATRSTQEMKKSDGS  535
            +EKDV+ EV +THEAI   +SLDKS+S L+MEL++TRS+QE  K DGS
Sbjct  70   EEKDVINEVLRTHEAINGDRSLDKSVSTLQMELSSTRSSQE--KVDGS  115



>gb|EPS64555.1| hypothetical protein M569_10226 [Genlisea aurea]
Length=393

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 85/116 (73%), Gaps = 5/116 (4%)
 Frame = +2

Query  218  NAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKP  397
            + +V AKWIP+FSI+FF +GM++T +IW+P +S   LIAQ R +QELQ++SEDCT  KK 
Sbjct  7    SGRVPAKWIPIFSISFFTIGMIFTAKIWSPLDSNKMLIAQKRHEQELQIVSEDCTAKKKK  66

Query  398  GQEKDVM---QEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSE  556
             +EK       EV++THEAI+SLDKSISML+MEL+A+RS  E  K  G + S  SE
Sbjct  67   DEEKKKDVTRSEVHRTHEAIRSLDKSISMLQMELSASRSAVE--KGRGVNVSSPSE  120



>gb|ACG41551.1| avr9 elicitor response protein [Zea mays]
Length=398

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 80/104 (77%), Gaps = 2/104 (2%)
 Frame = +2

Query  230  SAKWIPLFSIAF-FFLGMLYTNRIWAPPESTNQLIAQH-RRDQELQVISEDCTTMKKPGQ  403
            SA+W  L   AF F +GM++T+R W  P++++  ++Q  R++QELQ++SEDC T +K G+
Sbjct  13   SARWRLLVLCAFSFGIGMIFTDRFWTAPDTSSHTMSQRWRQEQELQLVSEDCNTKRKHGE  72

Query  404  EKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGS  535
            +KD+M EV KTHEAIQSLDKSIS L+MELAA RST E+ +S GS
Sbjct  73   DKDIMGEVTKTHEAIQSLDKSISTLQMELAAKRSTLELLRSSGS  116



>ref|XP_009414059.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Musa acuminata 
subsp. malaccensis]
Length=397

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 79/115 (69%), Gaps = 4/115 (3%)
 Frame = +2

Query  203  MRSRHNA---KVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRR-DQELQVIS  370
            MR R      +VS +WI +  +  F LG+L T++ W  P+  N +++  R+ +QELQ+IS
Sbjct  1    MRGRSGGCDRRVSFRWIVILCLCSFALGILLTDKFWTVPDVNNPIVSSRRKTEQELQIIS  60

Query  371  EDCTTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGS  535
            EDCTT +K   +KDVM EV +THEAIQSLDK+IS L+MELAA RS +E+   DGS
Sbjct  61   EDCTTKRKHADDKDVMGEVTRTHEAIQSLDKAISTLQMELAAKRSARELISEDGS  115



>ref|XP_003575190.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Brachypodium 
distachyon]
Length=397

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 75/101 (74%), Gaps = 2/101 (2%)
 Frame = +2

Query  230  SAKWIPLFSIAF-FFLGMLYTNRIWAPPESTNQLIAQHRR-DQELQVISEDCTTMKKPGQ  403
            SA+W  L    F F LGML+T+R W  P+++N +++Q RR DQELQ++SEDC T +K G 
Sbjct  13   SARWRLLLLCVFSFGLGMLFTSRFWTAPDTSNHIMSQRRRQDQELQLVSEDCNTKRKHGA  72

Query  404  EKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKS  526
            +KD+M EV +THEAIQ LDKSIS L+MELAA RST E+  S
Sbjct  73   DKDIMGEVTRTHEAIQLLDKSISTLQMELAAKRSTLELLHS  113



>ref|XP_010477453.1| PREDICTED: probable beta-1,3-galactosyltransferase 5 [Camelina 
sativa]
Length=397

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 82/107 (77%), Gaps = 5/107 (5%)
 Frame = +2

Query  212  RHNAKVSAK----WIPLFSIAFFFLGMLYTNRIWA-PPESTNQLIAQHRRDQELQVISED  376
            +H  KVS K    W PL  I+ FFLG ++T+R+ +   ES +QLI QHRRDQEL+++SED
Sbjct  2    KHTNKVSKKLTLTWFPLLCISCFFLGAIFTSRLRSGSSESGSQLILQHRRDQELKIVSED  61

Query  377  CTTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEM  517
               +KK  QEKDVM+EV KTH+AI+SLDKS+SML+ +L+AT+S+Q++
Sbjct  62   YAHVKKKSQEKDVMEEVLKTHKAIESLDKSVSMLQKQLSATQSSQKV  108



>ref|XP_002889162.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65421.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=395

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 84/114 (74%), Gaps = 6/114 (5%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPP-ESTNQLIAQHRRDQELQVISEDCTTMKKPGQ  403
            +S KW+P   I+FF LG ++T+R W PP +S +QLI+Q RRD ELQ++S+DC   KK  Q
Sbjct  10   ISLKWVPFLCISFFALGAIFTSRSWEPPSDSGSQLISQLRRDHELQIVSDDCAHNKKATQ  69

Query  404  EKDVMQEVYKTHEAIQ---SLDKSISMLKMELAATRSTQEMKKSDGS--DESPQ  550
            EKDV+ +V +THEAIQ   SLDKS+S L+M+LA+T+++Q+  ++  S   E+P+
Sbjct  70   EKDVIDQVLRTHEAIQGDRSLDKSVSTLEMQLASTKTSQDGSETTNSLTGETPR  123



>ref|XP_010498661.1| PREDICTED: probable beta-1,3-galactosyltransferase 5 [Camelina 
sativa]
Length=397

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 82/107 (77%), Gaps = 5/107 (5%)
 Frame = +2

Query  212  RHNAKVSAK----WIPLFSIAFFFLGMLYTNRIWA-PPESTNQLIAQHRRDQELQVISED  376
            +H  KVS K    W+PL  I+ FFLG ++T+R+ +   ES +QLI QHRRDQEL+++SED
Sbjct  2    KHTNKVSKKLTLTWVPLLCISCFFLGAIFTSRLRSGSSESGSQLILQHRRDQELKIVSED  61

Query  377  CTTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEM  517
                KK  QEKDVM+EV KTH+AI+SLDKS+SML+ +L+AT+S+Q++
Sbjct  62   YAHEKKKSQEKDVMEEVLKTHKAIESLDKSVSMLQKQLSATQSSQKV  108



>ref|XP_010459924.1| PREDICTED: probable beta-1,3-galactosyltransferase 5 [Camelina 
sativa]
Length=397

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 82/107 (77%), Gaps = 5/107 (5%)
 Frame = +2

Query  212  RHNAKVSAK----WIPLFSIAFFFLGMLYTNRIWA-PPESTNQLIAQHRRDQELQVISED  376
            +H  KVS K    W+PL  I+ FFLG ++T+R+ +   ES +QLI QHRRDQEL+++SED
Sbjct  2    KHTNKVSKKLTLTWVPLLCISCFFLGAIFTSRLRSGSSESGSQLILQHRRDQELKIVSED  61

Query  377  CTTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEM  517
                KK  QEKDVM+EV KTH+AI+SLDKS+SML+ +L+AT+S+Q++
Sbjct  62   YAHEKKKSQEKDVMEEVLKTHKAIESLDKSVSMLQKQLSATQSSQKV  108



>dbj|BAK03918.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=397

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 73/101 (72%), Gaps = 2/101 (2%)
 Frame = +2

Query  230  SAKWIPLFSIAF-FFLGMLYTNRIWAPPESTNQLIAQHRR-DQELQVISEDCTTMKKPGQ  403
            SA+W  L   AF F LGML+TNR W  P + N +++Q RR DQELQ++SEDC T +K   
Sbjct  13   SARWRLLLLCAFSFGLGMLFTNRFWTAPNANNHIMSQRRRQDQELQLVSEDCNTKRKHEG  72

Query  404  EKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKS  526
             KD+M EV +THEAIQ LDKSIS L+MELAA RST E+ +S
Sbjct  73   HKDIMGEVTRTHEAIQLLDKSISTLQMELAAKRSTLELVRS  113



>ref|XP_009401434.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Musa acuminata 
subsp. malaccensis]
Length=400

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +2

Query  230  SAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPGQEK  409
            SA+W  +     F LG+L+TNR W  P++T Q+++  R++QELQ+++EDC T ++  Q++
Sbjct  17   SARWTAILCACSFALGILFTNRSWEGPDATGQIVSTGRQEQELQIVAEDCATKRRAEQDE  76

Query  410  DVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGS  535
            DVM EV +THE IQSLDK+IS L+MELA+ RS  E+  ++GS
Sbjct  77   DVMGEVTRTHEVIQSLDKTISTLQMELASQRSALELNGANGS  118



>gb|AHL38868.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=387

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 79/112 (71%), Gaps = 10/112 (9%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPP-ESTNQLIAQHRRDQELQVISEDCTTMKKPGQ  403
            +S KW+P   I+FF LG ++T+R W P  +S +QLI+QH RD ELQ++S+DC   KK  Q
Sbjct  10   ISLKWVPFLCISFFALGAIFTSRSWEPSSDSGSQLISQHHRDHELQIVSDDCAHNKKATQ  69

Query  404  EKDVMQEVYKTHEAIQ---SLDKSISMLKMELAATRSTQEMKKSDGSDESPQ  550
            EKDV  EV +THEAIQ   SLDKS+S     L++TRS+QEM   DGS+ +P+
Sbjct  70   EKDVTGEVLRTHEAIQDDRSLDKSVST----LSSTRSSQEM--VDGSETNPR  115



>ref|NP_177904.3| beta-1,3-galactosyltransferase 7 [Arabidopsis thaliana]
 sp|Q6NQB7.1|B3GT7_ARATH RecName: Full=Beta-1,3-galactosyltransferase 7 [Arabidopsis thaliana]
 gb|AAQ65164.1| At1g77810 [Arabidopsis thaliana]
 dbj|BAD43246.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAD94299.1| At1g77810 [Arabidopsis thaliana]
 gb|AEE36029.1| beta-1,3-galactosyltransferase 7 [Arabidopsis thaliana]
Length=393

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 79/112 (71%), Gaps = 10/112 (9%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPP-ESTNQLIAQHRRDQELQVISEDCTTMKKPGQ  403
            +S KW+P   I+FF LG ++T+R W P  +S +QLI+QH RD ELQ++S+DC   KK  Q
Sbjct  10   ISLKWVPFLCISFFALGAIFTSRSWEPSSDSGSQLISQHHRDHELQIVSDDCAHNKKATQ  69

Query  404  EKDVMQEVYKTHEAIQ---SLDKSISMLKMELAATRSTQEMKKSDGSDESPQ  550
            EKDV  EV +THEAIQ   SLDKS+S     L++TRS+QEM   DGS+ +P+
Sbjct  70   EKDVTGEVLRTHEAIQDDRSLDKSVST----LSSTRSSQEM--VDGSETNPR  115



>ref|NP_564154.1| putative beta-1,3-galactosyltransferase 5 [Arabidopsis thaliana]
 sp|Q9LM60.1|B3GT5_ARATH RecName: Full=Probable beta-1,3-galactosyltransferase 5 [Arabidopsis 
thaliana]
 gb|AAF86563.1|AC069252_22 F2E2.6 [Arabidopsis thaliana]
 dbj|BAE98561.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE30185.1| putative beta-1,3-galactosyltransferase 5 [Arabidopsis thaliana]
 gb|AHL38935.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=398

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 84/118 (71%), Gaps = 5/118 (4%)
 Frame = +2

Query  212  RHNAKVSAK----WIPLFSIAFFFLGMLYTNRI-WAPPESTNQLIAQHRRDQELQVISED  376
            +HN KVS +    W+PL  I+ FFLG ++T+++  A  +S +QLI QHRRDQEL+++++D
Sbjct  2    KHNNKVSKRLTMTWVPLLCISCFFLGAIFTSKLRSASSDSGSQLILQHRRDQELKIVTQD  61

Query  377  CTTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQ  550
                KK  Q+ DVM+EV KTH+AI+SLDKS+SML+ +L+AT S Q++     ++ S +
Sbjct  62   YAHEKKKSQDNDVMEEVLKTHKAIESLDKSVSMLQKQLSATHSPQQIVNVSATNSSTE  119



>ref|XP_008444117.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Cucumis 
melo]
Length=396

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 82/117 (70%), Gaps = 1/117 (1%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            M+SR   K+S  W+P F  +FFF GML TNRIW+  ES  Q+I++ R +QELQ++SED +
Sbjct  1    MKSRGTRKISIIWVPFFCFSFFFFGMLITNRIWSVSESNGQVISRRRHEQELQIVSED-S  59

Query  383  TMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQS  553
            + K P ++KDVM EVY+T EAIQSLDK I+ML M+L   R+++ M  SD    S +S
Sbjct  60   SFKIPAEKKDVMTEVYRTQEAIQSLDKKITMLNMDLVEARNSRGMHSSDSRTPSIES  116



>ref|XP_003523469.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Glycine 
max]
Length=394

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 83/121 (69%), Gaps = 3/121 (2%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIA-QHRRDQELQVISEDC  379
            M++R + K+SA WIP+FS+  F +GML T+R+W PPES   L A   R  Q+LQVIS DC
Sbjct  1    MKTRTSTKISATWIPIFSVFSFIIGMLVTSRMWDPPESNGLLTAQHQRDQQQLQVISGDC  60

Query  380  TTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
             T K   Q KD + E+ KTHEAIQ+LDK +SML+MELAA RS++E   SD +  +  S +
Sbjct  61   ATKKM--QPKDAVSELQKTHEAIQALDKQVSMLQMELAAARSSRESGISDSNASTTTSGE  118

Query  560  G  562
            G
Sbjct  119  G  119



>gb|AAG51626.1|AC012193_8 putative (Avr9) elicitor response protein; 70358-68256 [Arabidopsis 
thaliana]
Length=390

 Score =   109 bits (272),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 78/115 (68%), Gaps = 13/115 (11%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPP-ESTNQLIAQHRRDQELQVISEDCTTMKK---  394
            +S KW+P   I+FF LG ++T+R W P  +S +QLI+QH RD ELQ++S+DC   K    
Sbjct  10   ISLKWVPFLCISFFALGAIFTSRSWEPSSDSGSQLISQHHRDHELQIVSDDCAHNKVRFF  69

Query  395  ---PGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQ  550
                 QEKDV  EV +THEAIQSLDKS+S     L++TRS+QEM   DGS+ +P+
Sbjct  70   IQFSTQEKDVTGEVLRTHEAIQSLDKSVST----LSSTRSSQEM--VDGSETNPR  118



>ref|XP_002893206.1| hypothetical protein ARALYDRAFT_472435 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69465.1| hypothetical protein ARALYDRAFT_472435 [Arabidopsis lyrata subsp. 
lyrata]
Length=397

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 85/118 (72%), Gaps = 1/118 (1%)
 Frame = +2

Query  200  MMRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIW-APPESTNQLIAQHRRDQELQVISED  376
            M  ++ + +++  W+PL  I+ FFLG ++T+++  A  +S +QLI QHRRDQEL+++S+D
Sbjct  1    MKHNKVSKRLTMTWVPLLCISCFFLGAIFTSKLRSASSDSGSQLILQHRRDQELKIVSQD  60

Query  377  CTTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQ  550
                KK  QEKDVM+EV KTH+AI+SLDKS+SML+ +L+ T  +Q++  +  ++ S +
Sbjct  61   YAHEKKKSQEKDVMEEVLKTHKAIESLDKSVSMLQKQLSTTHISQQIVDASSTNSSTE  118



>gb|KGN54610.1| hypothetical protein Csa_4G377730 [Cucumis sativus]
Length=397

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 84/118 (71%), Gaps = 2/118 (2%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTN-RIWAPPESTNQLIAQHRRDQELQVISEDC  379
            M++R   K+S  W+P F  +FFF GML TN RIW+  ES  Q+I++ R +QELQ++SED 
Sbjct  1    MKTRGTRKISIIWLPFFCFSFFFFGMLITNSRIWSASESNGQVISRRRHEQELQIVSED-  59

Query  380  TTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQS  553
            +++K P ++ D+M EVY+THEAIQSLDK I+ML M+L   R+++EM  SD    S +S
Sbjct  60   SSIKIPAEKTDMMTEVYRTHEAIQSLDKKITMLNMDLVEARNSREMHSSDSHTPSIES  117



>ref|XP_002306601.2| galactosyltransferase family protein [Populus trichocarpa]
 gb|EEE93597.2| galactosyltransferase family protein [Populus trichocarpa]
Length=399

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 76/124 (61%), Gaps = 4/124 (3%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTN--QLIAQHRRDQELQVISED  376
            M+ R   K S KWI    +  F +G L++NR+W      N  QL++Q R +Q LQVI++D
Sbjct  1    MKGRVTTKASVKWILFLCVFCFAIGTLFSNRLWDSSAEPNGQQLLSQRRHEQVLQVINDD  60

Query  377  CTTMKKPGQEKDVMQEVYKTHEAIQ--SLDKSISMLKMELAATRSTQEMKKSDGSDESPQ  550
             TT K      D M EV KTHEAIQ  SLDKS++ML+M+LAA+RS+QEM     +  S  
Sbjct  61   STTNKNLSHNNDAMDEVLKTHEAIQLVSLDKSVAMLQMQLAASRSSQEMSLDSSAAVSTL  120

Query  551  SEDG  562
            S DG
Sbjct  121  SRDG  124



>ref|XP_010539626.1| PREDICTED: beta-1,3-galactosyltransferase 7 [Tarenaya hassleriana]
Length=434

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 83/124 (67%), Gaps = 5/124 (4%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRI---WAPPESTNQLIAQHRRDQELQVISE  373
            M+++   K+S  W+PL  I+FF  G + T+R+       +S +QLI+QH  D ELQ++S+
Sbjct  1    MKNKVPRKLSLAWLPLLCISFFAFGAILTSRLRDSTPSSDSGSQLISQHMGDHELQIVSD  60

Query  374  DCTTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQS  553
            DC+  KK  Q+KDVM+EV +T EAIQSLDKS+S L+ +L+AT S++E+   DGS     S
Sbjct  61   DCSNKKKTSQDKDVMEEVLRTQEAIQSLDKSVSTLQRQLSATWSSKEI--GDGSGTISGS  118

Query  554  EDGP  565
            E  P
Sbjct  119  EGNP  122



>ref|XP_006416240.1| hypothetical protein EUTSA_v10009382mg [Eutrema salsugineum]
 gb|ESQ34593.1| hypothetical protein EUTSA_v10009382mg [Eutrema salsugineum]
Length=395

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 74/99 (75%), Gaps = 1/99 (1%)
 Frame = +2

Query  224  KVSAKWIPLFSIAFFFLGMLYTNRIWAPP-ESTNQLIAQHRRDQELQVISEDCTTMKKPG  400
            +++  W+PL  I+ FFLG ++T+R   P  +S  QL  QHRRDQEL++ S+D    KK  
Sbjct  10   RLTLTWVPLLCISCFFLGAIFTSRFRGPSSDSGGQLFLQHRRDQELKIASKDYAHEKKKS  69

Query  401  QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEM  517
            QEKDVM+EV KTH+AI+SLDKS+SML+ +L+ T+S+Q++
Sbjct  70   QEKDVMEEVLKTHKAIESLDKSVSMLQRQLSRTQSSQKI  108



>ref|XP_010911041.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Elaeis guineensis]
Length=398

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 76/111 (68%), Gaps = 0/111 (0%)
 Frame = +2

Query  221  AKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPG  400
            ++VSA+ I +  +  F +G+L+++R W   +S   +I+   ++QEL+VIS DCTT KKP 
Sbjct  12   SRVSARLIVVAFVVGFGIGVLFSDRFWTAADSNGHVISGPWQEQELEVISGDCTTKKKPV  71

Query  401  QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQS  553
             + D M +V K HEAIQSLDK+I+ L+MEL ATRS++E+  SDG    P S
Sbjct  72   PDNDTMGDVTKAHEAIQSLDKTIATLQMELTATRSSKELMGSDGFQSMPSS  122



>ref|XP_002302264.1| galactosyltransferase family protein [Populus trichocarpa]
 gb|EEE81537.1| galactosyltransferase family protein [Populus trichocarpa]
Length=390

 Score =   106 bits (265),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 75/109 (69%), Gaps = 5/109 (5%)
 Frame = +2

Query  203  MRSRHNAKVSA--KWIPLFSIAFFFLGMLYTNRIWAPPESTN--QLIAQHRRDQELQVIS  370
            M+ R   K SA  KWIP   +  F LG+L++NR+W      N  QL++Q R +QELQVI+
Sbjct  1    MKGRVTTKASAPAKWIPFLCVFCFALGILFSNRLWDSSAEPNGQQLLSQRRHEQELQVIN  60

Query  371  EDCTTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEM  517
             D TT KK  Q KDVM EV KTHE IQSLDKSI++L+ +L A++S+QEM
Sbjct  61   GDSTTNKKLSQNKDVMDEVLKTHEVIQSLDKSIAVLQTQL-ASKSSQEM  108



>ref|XP_008444116.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Cucumis 
melo]
Length=397

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 82/118 (69%), Gaps = 2/118 (2%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTN-RIWAPPESTNQLIAQHRRDQELQVISEDC  379
            M+SR   K+S  W+P F  +FFF GML TN RIW+  ES  Q+I++ R +QELQ++SED 
Sbjct  1    MKSRGTRKISIIWVPFFCFSFFFFGMLITNSRIWSVSESNGQVISRRRHEQELQIVSED-  59

Query  380  TTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQS  553
            ++ K P ++KDVM EVY+T EAIQSLDK I+ML M+L   R+++ M  SD    S +S
Sbjct  60   SSFKIPAEKKDVMTEVYRTQEAIQSLDKKITMLNMDLVEARNSRGMHSSDSRTPSIES  117



>ref|XP_003526605.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Glycine 
max]
 gb|KHN09160.1| Beta-1,3-galactosyltransferase 7 [Glycine soja]
Length=394

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 77/105 (73%), Gaps = 3/105 (3%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIA-QHRRDQELQVISEDC  379
            M++R +AK+SA WIP+FS+  F +GML T+R+W PPES   L+A   R  Q+LQVIS DC
Sbjct  1    MKTRTSAKISATWIPIFSVFSFIIGMLVTSRMWDPPESNGLLLAQHQRDQQQLQVISGDC  60

Query  380  TTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE  514
             T K     KD + E+ KTHEAIQ+LDK +SML+MELAA RS++E
Sbjct  61   ATKKM--LPKDAVSELQKTHEAIQALDKQVSMLQMELAAARSSRE  103



>ref|XP_004142613.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Cucumis sativus]
 ref|XP_004163674.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Cucumis sativus]
Length=399

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 82/119 (69%), Gaps = 2/119 (2%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTN-RIWAPPESTNQLIAQHRRDQELQVISEDC  379
            M++R   K+S  W+P F  +FFF GML TN RIW+  ES  Q+I++ R +QELQ++SED 
Sbjct  1    MKTRGTRKISIIWLPFFCFSFFFFGMLITNSRIWSASESNGQVISRRRHEQELQIVSEDS  60

Query  380  TT-MKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQS  553
            +  +  P ++ D+M EVY+THEAIQSLDK I+ML M+L   R+++EM  SD    S +S
Sbjct  61   SIKIVSPAEKTDMMTEVYRTHEAIQSLDKKITMLNMDLVEARNSREMHSSDSHTPSIES  119



>ref|XP_006578989.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Glycine 
max]
Length=397

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 83/124 (67%), Gaps = 6/124 (5%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIA-QHRRDQELQVISEDC  379
            M++R + K+SA WIP+FS+  F +GML T+R+W PPES   L A   R  Q+LQVIS DC
Sbjct  1    MKTRTSTKISATWIPIFSVFSFIIGMLVTSRMWDPPESNGLLTAQHQRDQQQLQVISGDC  60

Query  380  TTMKKPGQEKDVMQEVYKTHEAIQ---SLDKSISMLKMELAATRSTQEMKKSDGSDESPQ  550
             T K   Q KD + E+ KTHEAIQ   +LDK +SML+MELAA RS++E   SD +  +  
Sbjct  61   ATKKM--QPKDAVSELQKTHEAIQHARALDKQVSMLQMELAAARSSRESGISDSNASTTT  118

Query  551  SEDG  562
            S +G
Sbjct  119  SGEG  122



>ref|XP_011027637.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X3 [Populus 
euphratica]
Length=390

 Score =   103 bits (257),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 75/109 (69%), Gaps = 5/109 (5%)
 Frame = +2

Query  203  MRSRHNAKVSA--KWIPLFSIAFFFLGMLYTNRIWAPPESTN--QLIAQHRRDQELQVIS  370
            MR R   K SA  KWIP   +  F LG+L++NR+W      N  QL++Q R +QELQVI+
Sbjct  1    MRGRVTNKSSAPAKWIPFLCVFCFALGILFSNRLWDSSAEPNGQQLLSQRRHEQELQVIN  60

Query  371  EDCTTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEM  517
             D TT +K  Q KDVM EV KTHE IQSLDKSI++L+ ++ A++S+QEM
Sbjct  61   GDSTTNEKLPQNKDVMDEVLKTHEVIQSLDKSIAVLQTQI-ASKSSQEM  108



>gb|EMT29795.1| hypothetical protein F775_06766 [Aegilops tauschii]
Length=160

 Score =   100 bits (248),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 60/78 (77%), Gaps = 1/78 (1%)
 Frame = +2

Query  296  IWAPPESTNQLIAQHRR-DQELQVISEDCTTMKKPGQEKDVMQEVYKTHEAIQSLDKSIS  472
             W  P + N +++QHRR DQELQ++SEDC T +K G+ KD+M EV +THEAIQ LDKSIS
Sbjct  40   FWTAPNTNNHIMSQHRRQDQELQLVSEDCNTKRKHGEHKDIMGEVTRTHEAIQLLDKSIS  99

Query  473  MLKMELAATRSTQEMKKS  526
             L+MELAA RST E+ +S
Sbjct  100  TLQMELAAKRSTLELVRS  117



>ref|XP_002894028.1| hypothetical protein ARALYDRAFT_891474 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70287.1| hypothetical protein ARALYDRAFT_891474 [Arabidopsis lyrata subsp. 
lyrata]
Length=232

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 78/105 (74%), Gaps = 1/105 (1%)
 Frame = +2

Query  239  WIPLFSIAFFFLGMLYTNRI-WAPPESTNQLIAQHRRDQELQVISEDCTTMKKPGQEKDV  415
            W+P+  I+ FFLG ++T+++  A  +S +QLI QHR DQE++++++D    KK  ++KDV
Sbjct  3    WVPILCISCFFLGAIFTSKLRSASSDSGSQLILQHRCDQEVKIVTQDYAHEKKKSEDKDV  62

Query  416  MQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQ  550
            M+EV KTH+AI+SLDKS+SML+ +L+ T S+Q++  +  ++ S +
Sbjct  63   MEEVLKTHKAIESLDKSVSMLQKQLSTTHSSQQILDATSTNSSTE  107



>ref|XP_011027638.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X4 [Populus 
euphratica]
Length=389

 Score =   101 bits (251),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 75/109 (69%), Gaps = 6/109 (6%)
 Frame = +2

Query  203  MRSRHNAKVSA--KWIPLFSIAFFFLGMLYTNRIWAPPESTN--QLIAQHRRDQELQVIS  370
            MR R   K SA  KWIP   +  F LG+L++NR+W      N  QL++Q R +QELQVI+
Sbjct  1    MRGRVTNKSSAPAKWIPFLCVFCFALGILFSNRLWDSSAEPNGQQLLSQRRHEQELQVIN  60

Query  371  EDCTTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEM  517
             D TT + P Q KDVM EV KTHE IQSLDKSI++L+ ++ A++S+QEM
Sbjct  61   GDSTTNELP-QNKDVMDEVLKTHEVIQSLDKSIAVLQTQI-ASKSSQEM  107



>gb|AGZ15279.1| putative Avr9 elicitor response protein, partial [Taraxacum brevicorniculatum]
Length=392

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 76/113 (67%), Gaps = 6/113 (5%)
 Frame = +2

Query  221  AKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPG  400
             KVS KWI +FSI  F LGML+TNR+WAP ES  +++   R++QE++++++DC T K   
Sbjct  9    GKVSPKWIIIFSIFSFVLGMLFTNRVWAPIESDGRIM--RRQEQEMKIVTDDCITNK---  63

Query  401  QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
             + D+M EV+KT EAIQSL+ SIS L++EL   +S+ E  K D    +   ED
Sbjct  64   -DNDLMGEVHKTQEAIQSLENSISELRLELPRNQSSFEEVKDDNLHSNKTIED  115



>ref|XP_006581562.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Glycine 
max]
Length=397

 Score =   100 bits (249),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 77/108 (71%), Gaps = 6/108 (6%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIA-QHRRDQELQVISEDC  379
            M++R +AK+SA WIP+FS+  F +GML T+R+W PPES   L+A   R  Q+LQVIS DC
Sbjct  1    MKTRTSAKISATWIPIFSVFSFIIGMLVTSRMWDPPESNGLLLAQHQRDQQQLQVISGDC  60

Query  380  TTMKKPGQEKDVMQEVYKTHEAIQ---SLDKSISMLKMELAATRSTQE  514
             T K     KD + E+ KTHEAIQ   +LDK +SML+MELAA RS++E
Sbjct  61   ATKKM--LPKDAVSELQKTHEAIQHARALDKQVSMLQMELAAARSSRE  106



>gb|KCW70544.1| hypothetical protein EUGRSUZ_F03738 [Eucalyptus grandis]
Length=356

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  296  IWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPGQEKDVMQEVYKTHEAIQSLDKSISM  475
            +W+PPES+ Q +++ RR+QEL+++SEDC + KKP  +K+V+++V+KTHEAIQSLDKSI  
Sbjct  1    MWSPPESSGQFVSRARREQELRMVSEDCDSKKKPEDDKNVLKQVHKTHEAIQSLDKSIES  60

Query  476  LKMELAATRSTQEMKKSDGS  535
            L+MELAA+RS  E+    G+
Sbjct  61   LQMELAASRSAMELGNGSGN  80



>ref|XP_009106424.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Brassica 
rapa]
 emb|CDX87501.1| BnaA07g33720D [Brassica napus]
Length=383

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPP-ESTNQLIAQHRRDQELQVISEDCTTMKKPGQ  403
            +S +W+P   I+FF LG ++T+R W P  +S +QLI+Q  RD ELQ++S+DC   KK  Q
Sbjct  11   ISLRWVPFICISFFVLGAIFTSRSWEPSSDSGSQLISQRHRDHELQIVSDDCAHKKKATQ  70

Query  404  EKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQ  511
            EKDV+ +V +TH+A++SLDKS+S  + E  ++  T+
Sbjct  71   EKDVIDQVLRTHQAVESLDKSVSSQEKETLSSSITE  106



>ref|XP_011027635.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Populus 
euphratica]
Length=393

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 75/112 (67%), Gaps = 8/112 (7%)
 Frame = +2

Query  203  MRSRHNAKVSA--KWIPLFSIAFFFLGMLYTNRIWAPPESTN--QLIAQHRRDQELQVIS  370
            MR R   K SA  KWIP   +  F LG+L++NR+W      N  QL++Q R +QELQVI+
Sbjct  1    MRGRVTNKSSAPAKWIPFLCVFCFALGILFSNRLWDSSAEPNGQQLLSQRRHEQELQVIN  60

Query  371  EDCTTMKKPGQEKDVMQEVYKTHEAIQ---SLDKSISMLKMELAATRSTQEM  517
             D TT +K  Q KDVM EV KTHE IQ   SLDKSI++L+ ++ A++S+QEM
Sbjct  61   GDSTTNEKLPQNKDVMDEVLKTHEVIQPTRSLDKSIAVLQTQI-ASKSSQEM  111



>gb|KFK42175.1| hypothetical protein AALP_AA2G220800 [Arabis alpina]
Length=386

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 72/109 (66%), Gaps = 6/109 (6%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPP-ESTNQLIAQHRRDQELQVISEDCTTMKKPGQ  403
            +S KW+P   I+FF LG L+T R      +S+NQLI+Q R D ELQ++S+DC   KK   
Sbjct  11   ISLKWVPFLCISFFALGALFTFRSSERSLDSSNQLISQRRLDNELQIVSDDCGHKKKEKD  70

Query  404  EKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQ  550
               VM +V +THEAIQSLDKS   L+M+L++TR++QE    DGS   P+
Sbjct  71   VNHVMDQVLRTHEAIQSLDKS---LQMQLSSTRTSQET--VDGSGAKPR  114



>gb|KFK44305.1| hypothetical protein AALP_AA1G240600 [Arabis alpina]
Length=396

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 75/106 (71%), Gaps = 1/106 (1%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPEST-NQLIAQHRRDQELQVISEDC  379
            M+ + + ++S  W  L  I+ FFLG + T+R+      + NQLI QHRRDQE+ ++SED 
Sbjct  1    MKPKVSKRLSLTWTTLLCISCFFLGAIVTSRLRLSSSDSGNQLIVQHRRDQEVNLVSEDY  60

Query  380  TTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEM  517
               KK  QEK VM EV KTH+AI+SLDKS+SML+ +L+AT+S+Q++
Sbjct  61   DHEKKKSQEKYVMDEVLKTHKAIESLDKSVSMLQRQLSATQSSQQI  106



>ref|XP_011027636.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Populus 
euphratica]
Length=392

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 75/112 (67%), Gaps = 9/112 (8%)
 Frame = +2

Query  203  MRSRHNAKVSA--KWIPLFSIAFFFLGMLYTNRIWAPPESTN--QLIAQHRRDQELQVIS  370
            MR R   K SA  KWIP   +  F LG+L++NR+W      N  QL++Q R +QELQVI+
Sbjct  1    MRGRVTNKSSAPAKWIPFLCVFCFALGILFSNRLWDSSAEPNGQQLLSQRRHEQELQVIN  60

Query  371  EDCTTMKKPGQEKDVMQEVYKTHEAIQ---SLDKSISMLKMELAATRSTQEM  517
             D TT + P Q KDVM EV KTHE IQ   SLDKSI++L+ ++ A++S+QEM
Sbjct  61   GDSTTNELP-QNKDVMDEVLKTHEVIQPTRSLDKSIAVLQTQI-ASKSSQEM  110



>dbj|BAJ94062.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=396

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 71/104 (68%), Gaps = 2/104 (2%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRR-DQELQVISEDCTTMKKPGQ  403
            V ++ I L     F LGML+T+R  A P+  + ++AQ RR ++ELQV+SED     KP  
Sbjct  16   VLSRTILLLCACSFGLGMLFTDRFGAMPDLKSPVVAQRRRQEEELQVVSEDFVAKTKPSD  75

Query  404  EKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKS-DG  532
            ++DVM EV KTHEAIQ LDKSI+ L+MELAA RS  E+ +S DG
Sbjct  76   DRDVMGEVAKTHEAIQYLDKSIATLQMELAARRSKHELLESADG  119



>gb|EMT26667.1| Beta-1,3-galactosyltransferase 7 [Aegilops tauschii]
Length=395

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 71/104 (68%), Gaps = 2/104 (2%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRR-DQELQVISEDCTTMKKPGQ  403
            V ++ I L     F LGML+T+R  A P+  + ++AQ RR ++ELQV+SED     KP  
Sbjct  15   VLSRTILLLCACSFGLGMLFTDRFGAMPDLKSPVVAQRRRQEEELQVVSEDFVAKTKPSD  74

Query  404  EKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKS-DG  532
            ++DVM EV KTHEAIQ LDKSI+ L+MELAA RS  E+ +S DG
Sbjct  75   DRDVMGEVAKTHEAIQYLDKSIATLQMELAARRSRHELLESADG  118



>ref|XP_009106423.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Brassica 
rapa]
Length=386

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 68/99 (69%), Gaps = 4/99 (4%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPP-ESTNQLIAQHRRDQELQVISEDCTTMKKPGQ  403
            +S +W+P   I+FF LG ++T+R W P  +S +QLI+Q  RD ELQ++S+DC   KK  Q
Sbjct  11   ISLRWVPFICISFFVLGAIFTSRSWEPSSDSGSQLISQRHRDHELQIVSDDCAHKKKATQ  70

Query  404  EKDVMQEVYKTHEAI---QSLDKSISMLKMELAATRSTQ  511
            EKDV+ +V +TH+A+   +SLDKS+S  + E  ++  T+
Sbjct  71   EKDVIDQVLRTHQAVDVDRSLDKSVSSQEKETLSSSITE  109



>emb|CDY38836.1| BnaC08g20100D [Brassica napus]
Length=390

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 75/105 (71%), Gaps = 2/105 (2%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            M+++ + ++S  W+ L  I+ FFLG ++ +R     +S +QL+  HRRDQE+ V++E+  
Sbjct  1    MKTKISKRLSLTWVSLLCISCFFLGAMFNSRF-RGSDSGSQLML-HRRDQEVNVVTEEYA  58

Query  383  TMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEM  517
              KK  QEKDV+QEV KTH+AI+SLDKS+SML+ +L+  +S Q++
Sbjct  59   HEKKKSQEKDVIQEVLKTHKAIESLDKSVSMLQKQLSVRQSHQQI  103



>ref|XP_009110158.1| PREDICTED: probable beta-1,3-galactosyltransferase 5 [Brassica 
rapa]
Length=390

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 75/105 (71%), Gaps = 2/105 (2%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            M+++ + ++S  W+ L  I+ FFLG ++ +R     +S +QL+  HRRDQE+ V++E+  
Sbjct  1    MKTKISKRLSLTWVSLLCISCFFLGAMFNSRF-RGSDSGSQLML-HRRDQEVNVVTEEYA  58

Query  383  TMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEM  517
              KK  QEKDV+QEV KTH+AI+SLDKS+SML+ +L+  +S Q++
Sbjct  59   HEKKKSQEKDVIQEVLKTHKAIESLDKSVSMLQKQLSVRQSHQQI  103



>ref|XP_004172861.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like, partial 
[Cucumis sativus]
Length=250

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 65/101 (64%), Gaps = 3/101 (3%)
 Frame = +2

Query  221  AKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQE-LQVISEDCTTMKKP  397
              VS KW  LF I  F  GML+++R+WA PE  N        +++ L+++SE C T  K 
Sbjct  15   GSVSRKWTFLFCIGCFCAGMLFSDRMWAVPEVENMPGGSTGSEEDKLKMVSEGCNTSNKD  74

Query  398  G--QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE  514
            G  + KD++ EV KTH AIQ+LDK+IS L+MELAA R+ Q+
Sbjct  75   GSSESKDILGEVSKTHNAIQTLDKTISSLEMELAAARAAQD  115



>ref|XP_010923857.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X3 [Elaeis guineensis]
Length=374

 Score = 92.0 bits (227),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 70/113 (62%), Gaps = 6/113 (5%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT--TMKKPG  400
            VS KW  L  +  F +G+ +TNR+W  PE+ + + A    D ++ +++ DC   T+ +  
Sbjct  23   VSKKWTFLLCLGSFCIGLFFTNRMWTMPEANDIIRATGTEDNKMNLVTGDCNPKTINEKQ  82

Query  401  QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
            Q KD++ EV KTH AIQ+LDK+IS L+MELAA R+ QE       + SP SE+
Sbjct  83   QSKDILGEVSKTHHAIQTLDKTISNLEMELAAARAAQE----SILNGSPLSEN  131



>ref|XP_010923856.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Elaeis guineensis]
Length=412

 Score = 92.8 bits (229),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 64/98 (65%), Gaps = 2/98 (2%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT--TMKKPG  400
            VS KW  L  +  F +G+ +TNR+W  PE+ + + A    D ++ +++ DC   T+ +  
Sbjct  23   VSKKWTFLLCLGSFCIGLFFTNRMWTMPEANDIIRATGTEDNKMNLVTGDCNPKTINEKQ  82

Query  401  QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE  514
            Q KD++ EV KTH AIQ+LDK+IS L+MELAA R+ QE
Sbjct  83   QSKDILGEVSKTHHAIQTLDKTISNLEMELAAARAAQE  120



>ref|XP_010923855.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Elaeis guineensis]
Length=428

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 70/113 (62%), Gaps = 6/113 (5%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT--TMKKPG  400
            VS KW  L  +  F +G+ +TNR+W  PE+ + + A    D ++ +++ DC   T+ +  
Sbjct  23   VSKKWTFLLCLGSFCIGLFFTNRMWTMPEANDIIRATGTEDNKMNLVTGDCNPKTINEKQ  82

Query  401  QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
            Q KD++ EV KTH AIQ+LDK+IS L+MELAA R+ QE       + SP SE+
Sbjct  83   QSKDILGEVSKTHHAIQTLDKTISNLEMELAAARAAQE----SILNGSPLSEN  131



>ref|XP_009353286.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Pyrus x bretschneideri]
Length=405

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 68/113 (60%), Gaps = 6/113 (5%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKK--PG  400
            +S KW     ++ F  GML+TNR+W  PES          +++L ++SE C    K    
Sbjct  16   ISQKWTLFLCLSCFCAGMLFTNRMWTVPESKGITRRTAMEEEKLNLVSEGCNPKSKEVKR  75

Query  401  QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
            ++KD+  EVYKTH AIQ+LDK+IS L+MELAA R+TQE  +S     SP S D
Sbjct  76   EDKDIFGEVYKTHNAIQTLDKTISNLEMELAAARATQESIRSG----SPLSGD  124



>ref|XP_008379640.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Malus domestica]
Length=405

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 68/113 (60%), Gaps = 6/113 (5%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKK--PG  400
            +S KW     ++ F  GML+TNR+W  PES          +++L ++SE C    K    
Sbjct  16   ISQKWTFFLCLSCFCAGMLFTNRMWTVPESKGITRRTAMEEEKLNLVSEGCNPKSKEVKR  75

Query  401  QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
            ++KD+  EVYKTH AIQ+LDK+IS L+MELAA R+TQE  +S     SP S D
Sbjct  76   EDKDIFGEVYKTHNAIQTLDKTISNLEMELAAARATQESIRSG----SPLSGD  124



>ref|XP_002279814.2| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Vitis vinifera]
 emb|CBI26647.3| unnamed protein product [Vitis vinifera]
Length=405

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 70/115 (61%), Gaps = 6/115 (5%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDC--TTMKKPG  400
            VS KW  LF I  F  GML+++R+W  PE+          D+EL+++SE C  TT     
Sbjct  16   VSRKWTLLFCIGCFCAGMLFSDRMWTMPEAKGISRTTRTEDEELKLVSEGCAPTTKDVKH  75

Query  401  QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSEDGP  565
            + KD++ EV +TH AIQ+LDK+IS L+MELAA R+ QE   +     SP +ED P
Sbjct  76   KSKDILGEVSRTHYAIQTLDKTISNLEMELAAARAAQESILNG----SPITEDLP  126



>gb|KDO54672.1| hypothetical protein CISIN_1g015407mg [Citrus sinensis]
Length=404

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 73/126 (58%), Gaps = 8/126 (6%)
 Frame = +2

Query  188  KKKAMMRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVI  367
            K K  + SR  + VS KW  L  +  F  GML+TNR+WA PES           ++L+++
Sbjct  4    KSKGELTSR--SVVSQKWTFLLCLGCFCAGMLFTNRMWAVPESKGFTRTTAMEAEKLKLV  61

Query  368  SEDCTTMKKPGQE--KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDE  541
            SE C    K  +   KD+  EV+KTH AIQ+LDK+IS L+MELAA R+ QE   S     
Sbjct  62   SEGCNPRLKVVRHDSKDIFGEVFKTHNAIQTLDKTISNLEMELAAARAAQESILSG----  117

Query  542  SPQSED  559
            SP SED
Sbjct  118  SPLSED  123



>ref|XP_006469680.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X3 [Citrus sinensis]
Length=404

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 73/126 (58%), Gaps = 8/126 (6%)
 Frame = +2

Query  188  KKKAMMRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVI  367
            K K  + SR  + VS KW  L  +  F  GML+TNR+WA PES           ++L+++
Sbjct  4    KSKGELTSR--SVVSQKWTFLLCLGCFCAGMLFTNRMWAVPESKGFTRTTAMEAEKLKLV  61

Query  368  SEDCTTMKKPGQE--KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDE  541
            SE C    K  +   KD+  EV+KTH AIQ+LDK+IS L+MELAA R+ QE   S     
Sbjct  62   SEGCNPRLKVVRHDSKDIFGEVFKTHNAIQTLDKTISNLEMELAAARAAQESILSG----  117

Query  542  SPQSED  559
            SP SED
Sbjct  118  SPLSED  123



>gb|KFK42176.1| hypothetical protein AALP_AA2G220800 [Arabis alpina]
Length=389

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 72/112 (64%), Gaps = 9/112 (8%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPP-ESTNQLIAQHRRDQELQVISEDCTTMKKPGQ  403
            +S KW+P   I+FF LG L+T R      +S+NQLI+Q R D ELQ++S+DC   KK   
Sbjct  11   ISLKWVPFLCISFFALGALFTFRSSERSLDSSNQLISQRRLDNELQIVSDDCGHKKKEKD  70

Query  404  EKDVMQEVYKTHEAIQ---SLDKSISMLKMELAATRSTQEMKKSDGSDESPQ  550
               VM +V +THEAIQ   SLDKS   L+M+L++TR++QE    DGS   P+
Sbjct  71   VNHVMDQVLRTHEAIQVDRSLDKS---LQMQLSSTRTSQET--VDGSGAKPR  117



>ref|XP_004150699.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Cucumis sativus]
 ref|XP_004163325.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Cucumis sativus]
 gb|KGN62177.1| hypothetical protein Csa_2G309380 [Cucumis sativus]
Length=393

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 71/103 (69%), Gaps = 3/103 (3%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTN--RIWAPPESTNQLIAQHRRDQE-LQVISE  373
            M++R   KVSAKW+P F +AFF  GML T+  RIW P +S ++L+++ + +Q+ L+ +SE
Sbjct  1    MKNRGLRKVSAKWVPFFCLAFFLFGMLLTSSGRIWTPKQSDSRLVSRLQNEQQQLRSVSE  60

Query  374  DCTTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATR  502
              TT +K  ++K V+ E +KT  AIQSL + +S LK E+AA R
Sbjct  61   GITTNQKSVEDKRVLAEFHKTQAAIQSLGRQVSTLKSEMAAAR  103



>ref|XP_004149353.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
 gb|KGN56118.1| hypothetical protein Csa_3G076540 [Cucumis sativus]
Length=407

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 65/101 (64%), Gaps = 3/101 (3%)
 Frame = +2

Query  221  AKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQE-LQVISEDCTTMKKP  397
              VS KW  LF I  F  GML+++R+WA PE  N        +++ L+++SE C T  K 
Sbjct  15   GSVSRKWTFLFCIGCFCAGMLFSDRMWAVPEVENMPGGSTGSEEDKLKMVSEGCNTSNKD  74

Query  398  G--QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE  514
            G  + KD++ EV KTH AIQ+LDK+IS L+MELAA R+ Q+
Sbjct  75   GSSESKDILGEVSKTHNAIQTLDKTISSLEMELAAARAAQD  115



>ref|XP_008463407.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-1,3-galactosyltransferase 
3 [Cucumis melo]
Length=412

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 65/101 (64%), Gaps = 3/101 (3%)
 Frame = +2

Query  221  AKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQE-LQVISEDCTTMKKP  397
              VS KW  LF I  F  GML+++R+WA PE  N        +++ L+++SE C T  K 
Sbjct  15   GSVSRKWTFLFCIGCFCAGMLFSDRMWAVPEVENMPGGSTGSEEDKLKMVSEGCNTSNKD  74

Query  398  G--QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE  514
            G  + KD++ EV KTH AIQ+LDK+IS L+MELAA R+ Q+
Sbjct  75   GSNESKDILGEVSKTHNAIQTLDKTISSLEMELAAARAAQD  115



>ref|XP_006434095.1| hypothetical protein CICLE_v10001364mg [Citrus clementina]
 gb|ESR47335.1| hypothetical protein CICLE_v10001364mg [Citrus clementina]
Length=394

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 64/95 (67%), Gaps = 3/95 (3%)
 Frame = +2

Query  236  KWIPLFSIAFFFLGMLYTNRIWAPPESTNQ-LIAQHRRDQELQVISEDCTTMKKPGQEKD  412
            KWIP   +  F LG+L++N  W PPES  +  +   RR+Q++ V S DC   KK  Q++D
Sbjct  14   KWIPFLCLFCFALGILFSNLTWNPPESDGRPSLNVRRREQQVAVASTDCA--KKAFQDQD  71

Query  413  VMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEM  517
            V +EV KT  AIQ+LDK I  L+MELAA+RS++EM
Sbjct  72   VAKEVLKTRGAIQTLDKPIGQLQMELAASRSSREM  106



>gb|KDP39142.1| hypothetical protein JCGZ_00899 [Jatropha curcas]
Length=404

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 61/98 (62%), Gaps = 2/98 (2%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT--TMKKPG  400
            VS KW  LF I  F  GML+++R+W  PE      A    D++L ++SE C   T     
Sbjct  15   VSKKWTLLFCIGCFCAGMLFSDRMWTVPEVKGISRATSLEDEKLNLVSEGCAPETKNVKH  74

Query  401  QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE  514
            + KD+M EV KTH AIQ+LDK+IS L+MELAA R+ QE
Sbjct  75   ESKDIMGEVSKTHHAIQTLDKTISNLEMELAAARAAQE  112



>ref|XP_011463344.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=404

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 71/113 (63%), Gaps = 6/113 (5%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKK--PG  400
            +S KW  L  ++ F  GML+TNR+W+ PES          +++L+++SE C    K    
Sbjct  16   ISQKWTLLLCLSCFCAGMLFTNRMWSVPESKGITRRTTLEEEKLKLVSEGCHPKAKEVKR  75

Query  401  QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
            + KD++ EV+KTH AIQ+LDK+IS L+MELAA R+TQE  +S     +P S D
Sbjct  76   ETKDIIGEVFKTHNAIQTLDKTISNLEMELAAARATQESIRSG----APSSGD  124



>ref|XP_009777689.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Nicotiana 
sylvestris]
Length=396

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 75/112 (67%), Gaps = 4/112 (4%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIA--QHRRDQELQVISED  376
            M++R+  KVS KWI +  I  F LGML++NR+W PPES   ++   +H+++++L  IS+D
Sbjct  1    MKNRNRGKVSPKWIAILCIFSFALGMLFSNRVWTPPESDGMIMFGRRHKQERDLAFISDD  60

Query  377  CTTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDG  532
            C +  K  Q++D++ E  K   AIQSLDKSI+ ++ EL +T++    +K++ 
Sbjct  61   CDS--KDNQKEDMIGEFNKAQVAIQSLDKSIAKIQSELPSTKTLLTPRKTEA  110



>gb|KDO80824.1| hypothetical protein CISIN_1g015683mg [Citrus sinensis]
Length=394

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 64/95 (67%), Gaps = 3/95 (3%)
 Frame = +2

Query  236  KWIPLFSIAFFFLGMLYTNRIWAPPESTNQ-LIAQHRRDQELQVISEDCTTMKKPGQEKD  412
            KWIP   +  F LG+L++N  W PPES  +  +   RR+Q++ V S DC   KK  Q++D
Sbjct  14   KWIPFVCLFCFALGILFSNLTWNPPESDGRPSLNVRRREQQVAVASTDCA--KKAFQDQD  71

Query  413  VMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEM  517
            V +EV KT  AIQ+LDK+I  L+MELAA+RS +EM
Sbjct  72   VAKEVLKTRGAIQTLDKTIGQLQMELAASRSGREM  106



>ref|XP_006472695.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Citrus 
sinensis]
Length=394

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 64/95 (67%), Gaps = 3/95 (3%)
 Frame = +2

Query  236  KWIPLFSIAFFFLGMLYTNRIWAPPESTNQ-LIAQHRRDQELQVISEDCTTMKKPGQEKD  412
            KWIP   +  F LG+L++N  W PPES  +  +   RR+Q++ V S DC   KK  Q++D
Sbjct  14   KWIPFVCLFCFALGILFSNLTWNPPESDGRPSLNVRRREQQVAVASTDCA--KKAFQDQD  71

Query  413  VMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEM  517
            V +EV KT  AIQ+LDK+I  L+MELAA+RS +EM
Sbjct  72   VAKEVLKTRGAIQTLDKTIGQLQMELAASRSGREM  106



>ref|XP_008342011.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Malus domestica]
Length=405

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 65/113 (58%), Gaps = 6/113 (5%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPGQ-  403
            +S KW     ++ F  GM +TNR+W  PES          ++ L ++SE C    K  Q 
Sbjct  16   ISQKWTLFLCLSCFCAGMFFTNRMWTIPESKGITRRTAMEEETLNLVSEGCNPKSKEVQR  75

Query  404  -EKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
              KD+  EVYKTH AIQ+LDK+IS L+MELAA R+TQE  +S     SP S D
Sbjct  76   ENKDIFGEVYKTHNAIQTLDKTISNLEMELAAARATQESIRSG----SPLSGD  124



>ref|XP_006469679.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Citrus sinensis]
Length=405

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 75/127 (59%), Gaps = 9/127 (7%)
 Frame = +2

Query  188  KKKAMMRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVI  367
            K K  + SR  + VS KW  L  +  F  GML+TNR+WA PES           ++L+++
Sbjct  4    KSKGELTSR--SVVSQKWTFLLCLGCFCAGMLFTNRMWAVPESKGFTRTTAMEAEKLKLV  61

Query  368  SEDCT-TMKKPGQE--KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSD  538
            SE C   ++K  +   KD+  EV+KTH AIQ+LDK+IS L+MELAA R+ QE   S    
Sbjct  62   SEGCNPRLQKVVRHDSKDIFGEVFKTHNAIQTLDKTISNLEMELAAARAAQESILSG---  118

Query  539  ESPQSED  559
             SP SED
Sbjct  119  -SPLSED  124



>gb|KDO54671.1| hypothetical protein CISIN_1g015407mg [Citrus sinensis]
Length=405

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 75/127 (59%), Gaps = 9/127 (7%)
 Frame = +2

Query  188  KKKAMMRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVI  367
            K K  + SR  + VS KW  L  +  F  GML+TNR+WA PES           ++L+++
Sbjct  4    KSKGELTSR--SVVSQKWTFLLCLGCFCAGMLFTNRMWAVPESKGFTRTTAMEAEKLKLV  61

Query  368  SEDCT-TMKKPGQE--KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSD  538
            SE C   ++K  +   KD+  EV+KTH AIQ+LDK+IS L+MELAA R+ QE   S    
Sbjct  62   SEGCNPRLQKVVRHDSKDIFGEVFKTHNAIQTLDKTISNLEMELAAARAAQESILSG---  118

Query  539  ESPQSED  559
             SP SED
Sbjct  119  -SPLSED  124



>gb|KJB59160.1| hypothetical protein B456_009G242100 [Gossypium raimondii]
Length=378

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 63/111 (57%), Gaps = 18/111 (16%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            M+ R + K+S KWIP   I+FF LG +++NR+W P                   I  DC 
Sbjct  1    MKQRSSTKISLKWIPFVCISFFVLGTVFSNRLWIP------------------TIFNDCD  42

Query  383  TMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGS  535
            T KKP  +     EV KTHEAI+SLDKS + L+++LA   S+Q+MK SD +
Sbjct  43   TKKKPATDNFEKGEVLKTHEAIESLDKSFATLQIKLAPPGSSQKMKNSDAT  93



>ref|XP_008445355.1| PREDICTED: beta-1,3-galactosyltransferase 7 [Cucumis melo]
 ref|XP_008445356.1| PREDICTED: beta-1,3-galactosyltransferase 7 [Cucumis melo]
Length=393

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 70/103 (68%), Gaps = 3/103 (3%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTN--RIWAPPESTNQLIAQHRRDQE-LQVISE  373
            M++R   KVSAKW+P F +AFF  GML T+  R+W P +S ++L+++ + +Q+ L  +SE
Sbjct  1    MKNRGLRKVSAKWVPFFCLAFFLFGMLLTSSGRMWTPKQSDSRLVSRLQNEQQQLWSVSE  60

Query  374  DCTTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATR  502
              TT +K  ++K V+ E +KT  AIQSL + +S LK E+AA R
Sbjct  61   GITTNQKSMEDKRVLAEFHKTQAAIQSLGRQVSTLKTEMAAAR  103



>ref|XP_009353285.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Pyrus x bretschneideri]
Length=408

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 67/116 (58%), Gaps = 9/116 (8%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPGQE  406
            +S KW     ++ F  GML+TNR+W  PES          +++L ++SE C       +E
Sbjct  16   ISQKWTLFLCLSCFCAGMLFTNRMWTVPESKGITRRTAMEEEKLNLVSEGCNPKSLNQKE  75

Query  407  -----KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
                 KD+  EVYKTH AIQ+LDK+IS L+MELAA R+TQE  +S     SP S D
Sbjct  76   VKREDKDIFGEVYKTHNAIQTLDKTISNLEMELAAARATQESIRSG----SPLSGD  127



>ref|XP_009610750.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 [Nicotiana 
tomentosiformis]
Length=409

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 68/112 (61%), Gaps = 6/112 (5%)
 Frame = +2

Query  230  SAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDC--TTMKKPGQ  403
            S K   L  I  F +GML+T+R+W  PE+      +   DQ+L V+SEDC  TT     +
Sbjct  21   SPKLTILLCIGCFCVGMLFTDRMWTVPEAKGISRTRQIDDQKLGVVSEDCDPTTKGVKSE  80

Query  404  EKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
             KD++ EV KTH AIQ+LDK+IS L+MELAA RS Q+   S     SP +ED
Sbjct  81   TKDILGEVSKTHHAIQTLDKTISNLEMELAAARSLQDSILSG----SPITED  128



>ref|XP_007215470.1| hypothetical protein PRUPE_ppa006530mg [Prunus persica]
 gb|EMJ16669.1| hypothetical protein PRUPE_ppa006530mg [Prunus persica]
Length=404

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 67/113 (59%), Gaps = 6/113 (5%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKK--PG  400
            +S KW  L  +  F  GML+TNR+W  PE+          +++L+++SE C    K    
Sbjct  15   ISKKWTLLLCLGCFCAGMLFTNRMWTVPENKGITRRTAMEEEQLKLVSEGCNPKAKEVKR  74

Query  401  QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
            + KD+  EV KTH AIQ+LDK+IS L+MELAA R+TQE  +S     SP S D
Sbjct  75   ENKDIFGEVSKTHNAIQTLDKTISNLEMELAAARATQESIRSG----SPLSGD  123



>ref|XP_004287949.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=407

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 71/116 (61%), Gaps = 9/116 (8%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPGQE  406
            +S KW  L  ++ F  GML+TNR+W+ PES          +++L+++SE C       +E
Sbjct  16   ISQKWTLLLCLSCFCAGMLFTNRMWSVPESKGITRRTTLEEEKLKLVSEGCHPKALHQKE  75

Query  407  -----KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
                 KD++ EV+KTH AIQ+LDK+IS L+MELAA R+TQE  +S     +P S D
Sbjct  76   VKRETKDIIGEVFKTHNAIQTLDKTISNLEMELAAARATQESIRSG----APSSGD  127



>ref|XP_008379639.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Malus domestica]
Length=408

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 67/116 (58%), Gaps = 9/116 (8%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPGQE  406
            +S KW     ++ F  GML+TNR+W  PES          +++L ++SE C       +E
Sbjct  16   ISQKWTFFLCLSCFCAGMLFTNRMWTVPESKGITRRTAMEEEKLNLVSEGCNPKSLNQKE  75

Query  407  -----KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
                 KD+  EVYKTH AIQ+LDK+IS L+MELAA R+TQE  +S     SP S D
Sbjct  76   VKREDKDIFGEVYKTHNAIQTLDKTISNLEMELAAARATQESIRSG----SPLSGD  127



>emb|CDX88390.1| BnaC06g38340D [Brassica napus]
Length=382

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 59/85 (69%), Gaps = 4/85 (5%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPP-ESTNQLIAQHRRDQELQVISEDCTTMKKPGQ  403
            +S +W+P   I+FF LG ++T+R W P  +S +QLI+Q  RD ELQ++S+DC   KK  Q
Sbjct  10   ISLRWVPFICISFFVLGAIFTSRSWEPSSDSGSQLISQRHRDHELQIVSDDCAHKKKATQ  69

Query  404  EKDVMQEVYKTHEAI---QSLDKSI  469
            EKDV+ +V +TH+ I   +SLD S+
Sbjct  70   EKDVIDQVLRTHQEIDVARSLDNSV  94



>gb|AFW71913.1| hypothetical protein ZEAMMB73_862603 [Zea mays]
Length=88

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 59/80 (74%), Gaps = 2/80 (3%)
 Frame = +2

Query  218  NAKVSAKWIPLFSIAF-FFLGMLYTNRIWAPPESTNQLIAQH-RRDQELQVISEDCTTMK  391
            + + SA+W  L   AF F +GML+T+R W  P++++  ++Q  R++QELQ++SEDC T +
Sbjct  9    DRRSSARWRLLVLCAFSFGIGMLFTDRFWTAPDTSSHTMSQRWRQEQELQLVSEDCNTKR  68

Query  392  KPGQEKDVMQEVYKTHEAIQ  451
            K G++KD+M EV KTHEAIQ
Sbjct  69   KHGEDKDIMGEVTKTHEAIQ  88



>ref|XP_006346208.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Solanum 
tuberosum]
Length=408

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 73/130 (56%), Gaps = 12/130 (9%)
 Frame = +2

Query  194  KAMMRSRHNAKVSAKWI------PLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQE  355
            K+ M+SR   + + K +       L  I  F +GML+T+R+W  PE+          DQ+
Sbjct  2    KSTMKSRGGGESAGKGVFSRKLTVLLCIGCFCVGMLFTDRMWTVPEAKGITRTTQIDDQK  61

Query  356  LQVISEDCTTMKKP--GQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSD  529
            L V+SEDC    K    + KD+  EV KTH AIQ+LDK+IS L+MELAA R+ Q+   S 
Sbjct  62   LGVVSEDCDPTNKDVKSESKDIFGEVTKTHHAIQTLDKTISNLEMELAAARALQDSILSG  121

Query  530  GSDESPQSED  559
                SP +ED
Sbjct  122  ----SPITED  127



>ref|XP_007020793.1| Galactosyltransferase family protein [Theobroma cacao]
 gb|EOY12318.1| Galactosyltransferase family protein [Theobroma cacao]
Length=406

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 69/100 (69%), Gaps = 4/100 (4%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHR--RDQELQVISEDCTTMKKPG  400
            V+ KW  L  I  F  GML+++R+WA PE+ ++ +++    +++ L++I+E C  M+K  
Sbjct  16   VTKKWALLLCIGCFCAGMLFSDRMWAVPEADDKGVSRETGAKEEGLKLITEGCDPMRKDV  75

Query  401  QE--KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE  514
            +   KD++ EV KTH AIQ+LDK+IS L+MELAA R+ QE
Sbjct  76   KREPKDILGEVSKTHHAIQTLDKTISNLEMELAAARAAQE  115



>gb|KJB80506.1| hypothetical protein B456_013G101400 [Gossypium raimondii]
Length=319

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 71/114 (62%), Gaps = 8/114 (7%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPGQE  406
            VS KW  L  ++ F  G+L+TNR+ A PES   +       ++L++ISE C  +K  G++
Sbjct  15   VSKKWTFLLCLSCFCAGILFTNRMVAVPESKAIMRTTAVEAEKLKLISEGCN-LKAKGEK  73

Query  407  ---KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
               KD++ EV+KTH AIQ+LDK+IS L+MELAA R+ QE         SP SED
Sbjct  74   HVSKDIIGEVFKTHHAIQTLDKTISNLEMELAAARAAQESLHGG----SPLSED  123



>ref|XP_009774309.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Nicotiana 
sylvestris]
Length=409

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 68/112 (61%), Gaps = 6/112 (5%)
 Frame = +2

Query  230  SAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDC--TTMKKPGQ  403
            S K   L  I  F +GML+T+R+W  PE+      +   DQ+L VISEDC  T+     +
Sbjct  21   SPKLTILLCIGCFCVGMLFTDRMWTVPEAKGISRTRQIDDQKLGVISEDCDPTSKDVKSE  80

Query  404  EKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
             KD++ EV KTH AIQ+LDK+IS L+MELAA RS Q+   S     SP +ED
Sbjct  81   TKDILGEVSKTHHAIQTLDKTISNLEMELAAARSLQDSILSG----SPITED  128



>ref|XP_009607565.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Nicotiana tomentosiformis]
Length=390

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 69/115 (60%), Gaps = 4/115 (3%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQV--ISED  376
            M++R+  KVS  WI +  I  F LGML++NR+W PPES  +++   R  QE+ +  +S+D
Sbjct  1    MKNRNRGKVSPNWIAILCIFSFALGMLFSNRVWTPPESDGRIMFGRRHKQEIDLASVSDD  60

Query  377  CTTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDE  541
            C T  K  Q++D++ E  K   AI SLD SI+ ++ EL + R T+ +  +    E
Sbjct  61   CDT--KNSQKEDIVGEFNKAQVAIHSLDNSIAKIQSELPSIRRTEAVPSTSADSE  113



>gb|KJB62838.1| hypothetical protein B456_009G440200 [Gossypium raimondii]
Length=280

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 67/100 (67%), Gaps = 4/100 (4%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLI--AQHRRDQELQVISEDCTTMKKP-  397
            V+ K   L  I  F  GML+++R+W  PE+ ++ I  A   +D+ L++ISE C  ++K  
Sbjct  16   VTKKLTLLLCIGCFCAGMLFSDRMWTVPEAEDKTISRAMGVKDERLKLISEGCDPIRKDV  75

Query  398  -GQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE  514
              + KD++ EV +TH AIQ+LDK+IS L+MELAATR+ QE
Sbjct  76   KHESKDILSEVSRTHNAIQTLDKTISNLEMELAATRAVQE  115



>ref|XP_010657203.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X3 [Vitis vinifera]
Length=404

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 66/113 (58%), Gaps = 6/113 (5%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKK--PG  400
            +S KW  L  +  F  GM +TNR+WA PES           ++L+++SE C    K    
Sbjct  15   ISQKWTLLLCVGCFCAGMFFTNRMWAVPESKGITRTTAVEAEKLKLVSEGCDPKTKFVKR  74

Query  401  QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
              KD++ EV+KTH AIQ+LDK+IS L+MELAA R+ QE       + SP SED
Sbjct  75   DSKDIIGEVHKTHHAIQTLDKTISNLEMELAAARAAQESM----VNGSPISED  123



>gb|KDO54670.1| hypothetical protein CISIN_1g015407mg [Citrus sinensis]
Length=407

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 74/129 (57%), Gaps = 11/129 (9%)
 Frame = +2

Query  188  KKKAMMRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVI  367
            K K  + SR  + VS KW  L  +  F  GML+TNR+WA PES           ++L+++
Sbjct  4    KSKGELTSR--SVVSQKWTFLLCLGCFCAGMLFTNRMWAVPESKGFTRTTAMEAEKLKLV  61

Query  368  SEDCT---TMKKPGQE--KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDG  532
            SE C      +K  +   KD+  EV+KTH AIQ+LDK+IS L+MELAA R+ QE   S  
Sbjct  62   SEGCNPRLLQQKVVRHDSKDIFGEVFKTHNAIQTLDKTISNLEMELAAARAAQESILSG-  120

Query  533  SDESPQSED  559
               SP SED
Sbjct  121  ---SPLSED  126



>ref|XP_006447568.1| hypothetical protein CICLE_v10015443mg [Citrus clementina]
 ref|XP_006469678.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X1 [Citrus sinensis]
 gb|ESR60808.1| hypothetical protein CICLE_v10015443mg [Citrus clementina]
Length=407

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 74/129 (57%), Gaps = 11/129 (9%)
 Frame = +2

Query  188  KKKAMMRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVI  367
            K K  + SR  + VS KW  L  +  F  GML+TNR+WA PES           ++L+++
Sbjct  4    KSKGELTSR--SVVSQKWTFLLCLGCFCAGMLFTNRMWAVPESKGFTRTTAMEAEKLKLV  61

Query  368  SEDCT---TMKKPGQE--KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDG  532
            SE C      +K  +   KD+  EV+KTH AIQ+LDK+IS L+MELAA R+ QE   S  
Sbjct  62   SEGCNPRLLQQKVVRHDSKDIFGEVFKTHNAIQTLDKTISNLEMELAAARAAQESILSG-  120

Query  533  SDESPQSED  559
               SP SED
Sbjct  121  ---SPLSED  126



>gb|KJB80508.1| hypothetical protein B456_013G101400 [Gossypium raimondii]
Length=398

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 71/114 (62%), Gaps = 8/114 (7%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPGQE  406
            VS KW  L  ++ F  G+L+TNR+ A PES   +       ++L++ISE C  +K  G++
Sbjct  15   VSKKWTFLLCLSCFCAGILFTNRMVAVPESKAIMRTTAVEAEKLKLISEGCN-LKAKGEK  73

Query  407  ---KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
               KD++ EV+KTH AIQ+LDK+IS L+MELAA R+ QE         SP SED
Sbjct  74   HVSKDIIGEVFKTHHAIQTLDKTISNLEMELAAARAAQESLHGG----SPLSED  123



>ref|XP_004245304.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Solanum lycopersicum]
Length=396

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 67/102 (66%), Gaps = 4/102 (4%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQE--LQVISED  376
            M++R+ AK+S KWI +  I  F LGML++NR+W PPES  + I   R+ QE  L  +S+D
Sbjct  1    MKNRNRAKISTKWIAILCIFSFALGMLFSNRVWTPPESDGRNIFGRRQTQERVLPSVSDD  60

Query  377  CTTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATR  502
            C T  K  Q++++M E  K   AIQSLD SI+ ++ EL +T+
Sbjct  61   CET--KNSQKEEMMGEFNKAQVAIQSLDDSIAKIQSELPSTK  100



>ref|NP_001063339.1| Os09g0452900 [Oryza sativa Japonica Group]
 dbj|BAD38021.1| putative Avr9 elicitor response protein [Oryza sativa Japonica 
Group]
 dbj|BAF25253.1| Os09g0452900 [Oryza sativa Japonica Group]
 dbj|BAG90885.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC84687.1| hypothetical protein OsI_31612 [Oryza sativa Indica Group]
 gb|EEE69834.1| hypothetical protein OsJ_29598 [Oryza sativa Japonica Group]
Length=393

 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 67/99 (68%), Gaps = 2/99 (2%)
 Frame = +2

Query  224  KVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHR-RDQELQVISEDCTTMKKPG  400
            ++  +WI L + +F  LGML++++  + PE    L AQ R +D++LQ++ ED     KP 
Sbjct  13   RLPPRWILLCAFSFG-LGMLFSDQFGSVPEWQKPLAAQRRVQDRKLQILDEDFVAKPKPT  71

Query  401  QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEM  517
             ++DVM EV KTHEAIQ LDKSI+ L+MELA  RST E+
Sbjct  72   DDRDVMSEVTKTHEAIQYLDKSIATLQMELAGKRSTLEL  110



>gb|KJB80505.1| hypothetical protein B456_013G101400 [Gossypium raimondii]
Length=404

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 71/114 (62%), Gaps = 8/114 (7%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPGQE  406
            VS KW  L  ++ F  G+L+TNR+ A PES   +       ++L++ISE C  +K  G++
Sbjct  15   VSKKWTFLLCLSCFCAGILFTNRMVAVPESKAIMRTTAVEAEKLKLISEGCN-LKAKGEK  73

Query  407  ---KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
               KD++ EV+KTH AIQ+LDK+IS L+MELAA R+ QE         SP SED
Sbjct  74   HVSKDIIGEVFKTHHAIQTLDKTISNLEMELAAARAAQESLHGG----SPLSED  123



>gb|KJB80507.1| hypothetical protein B456_013G101400 [Gossypium raimondii]
Length=405

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 71/114 (62%), Gaps = 8/114 (7%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPGQE  406
            VS KW  L  ++ F  G+L+TNR+ A PES   +       ++L++ISE C  +K  G++
Sbjct  15   VSKKWTFLLCLSCFCAGILFTNRMVAVPESKAIMRTTAVEAEKLKLISEGCN-LKAKGEK  73

Query  407  ---KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
               KD++ EV+KTH AIQ+LDK+IS L+MELAA R+ QE         SP SED
Sbjct  74   HVSKDIIGEVFKTHHAIQTLDKTISNLEMELAAARAAQESLHGG----SPLSED  123



>ref|XP_008342010.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Malus domestica]
Length=408

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 65/116 (56%), Gaps = 9/116 (8%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPGQE  406
            +S KW     ++ F  GM +TNR+W  PES          ++ L ++SE C       +E
Sbjct  16   ISQKWTLFLCLSCFCAGMFFTNRMWTIPESKGITRRTAMEEETLNLVSEGCNPKSLNQKE  75

Query  407  -----KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
                 KD+  EVYKTH AIQ+LDK+IS L+MELAA R+TQE  +S     SP S D
Sbjct  76   VQRENKDIFGEVYKTHNAIQTLDKTISNLEMELAAARATQESIRSG----SPLSGD  127



>ref|XP_011047262.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Populus euphratica]
Length=405

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 65/113 (58%), Gaps = 6/113 (5%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPGQE  406
            +S KW   F +A F  G+ + NR+WA PE            + L+++SE C    K  + 
Sbjct  16   ISKKWALFFCLACFCAGVFFNNRMWAVPEPKGITRTTTMEAESLKLVSEGCGDEIKEVKR  75

Query  407  --KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
              KD++ EVYKTH AIQ+LDK+IS L+MELAA R+ QE   S     SP SED
Sbjct  76   GSKDIIGEVYKTHNAIQTLDKTISNLEMELAAARAAQESILSG----SPLSED  124



>gb|KHF99242.1| putative beta-1,3-galactosyltransferase 2 -like protein [Gossypium 
arboreum]
Length=404

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 71/114 (62%), Gaps = 8/114 (7%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPGQE  406
            VS KW  L  ++ F  G+L+TNR+ A PES   +       ++L++ISE C  +K  G++
Sbjct  15   VSKKWTFLLCLSCFCAGILFTNRMVAVPESKAIMRITAVEAEKLKLISEGCN-LKAKGEK  73

Query  407  ---KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
               KD++ EV+KTH AIQ+LDK+IS L+MELAA R+ QE         SP SED
Sbjct  74   HVSKDIIGEVFKTHHAIQTLDKTISNLEMELAAARAAQESLHGG----SPLSED  123



>ref|XP_006413124.1| hypothetical protein EUTSA_v10025360mg [Eutrema salsugineum]
 gb|ESQ54577.1| hypothetical protein EUTSA_v10025360mg [Eutrema salsugineum]
Length=403

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 71/109 (65%), Gaps = 6/109 (6%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKK--PG  400
            VS KW     I FF  G+L+++R+W  PE+   ++++   D+ L+++S+DC + KK    
Sbjct  17   VSKKWTFFLCIGFFCAGILFSDRMWPEPEA--NVVSREASDEGLRLVSDDCDSSKKGLKH  74

Query  401  QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE--MKKSDGSDE  541
            + KD++ EVYK+ +AIQ LDK+IS L+ ELAA R+ QE  M  S  SD+
Sbjct  75   ESKDILGEVYKSPDAIQRLDKTISNLETELAAARAAQESIMNGSPVSDD  123



>ref|XP_010657202.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Vitis vinifera]
Length=405

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 66/114 (58%), Gaps = 7/114 (6%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDC---TTMKKP  397
            +S KW  L  +  F  GM +TNR+WA PES           ++L+++SE C   T     
Sbjct  15   ISQKWTLLLCVGCFCAGMFFTNRMWAVPESKGITRTTAVEAEKLKLVSEGCDPKTQKFVK  74

Query  398  GQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
               KD++ EV+KTH AIQ+LDK+IS L+MELAA R+ QE       + SP SED
Sbjct  75   RDSKDIIGEVHKTHHAIQTLDKTISNLEMELAAARAAQESM----VNGSPISED  124



>ref|XP_006355190.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Solanum tuberosum]
Length=396

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 66/102 (65%), Gaps = 4/102 (4%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQE--LQVISED  376
            M++R+  K+S KWI +  I  F LGML++NR+W PPES  + I   R+ QE  L  +S+D
Sbjct  1    MKNRNRGKISTKWIAILCIFSFVLGMLFSNRVWTPPESDGRNIFGRRQTQERDLPSVSDD  60

Query  377  CTTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATR  502
            C T  K  Q++++M E  K   AIQSLD SI+ ++ EL +T+
Sbjct  61   CET--KNSQKEEMMGEFNKAQVAIQSLDDSIAKIQSELPSTK  100



>gb|KJB62836.1| hypothetical protein B456_009G440200 [Gossypium raimondii]
 gb|KJB62837.1| hypothetical protein B456_009G440200 [Gossypium raimondii]
Length=405

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 67/100 (67%), Gaps = 4/100 (4%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLI--AQHRRDQELQVISEDCTTMKKP-  397
            V+ K   L  I  F  GML+++R+W  PE+ ++ I  A   +D+ L++ISE C  ++K  
Sbjct  16   VTKKLTLLLCIGCFCAGMLFSDRMWTVPEAEDKTISRAMGVKDERLKLISEGCDPIRKDV  75

Query  398  -GQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE  514
              + KD++ EV +TH AIQ+LDK+IS L+MELAATR+ QE
Sbjct  76   KHESKDILSEVSRTHNAIQTLDKTISNLEMELAATRAVQE  115



>ref|XP_007215471.1| hypothetical protein PRUPE_ppa006530mg [Prunus persica]
 gb|EMJ16670.1| hypothetical protein PRUPE_ppa006530mg [Prunus persica]
Length=407

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 67/116 (58%), Gaps = 9/116 (8%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPGQE  406
            +S KW  L  +  F  GML+TNR+W  PE+          +++L+++SE C       +E
Sbjct  15   ISKKWTLLLCLGCFCAGMLFTNRMWTVPENKGITRRTAMEEEQLKLVSEGCNPKALHQKE  74

Query  407  -----KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
                 KD+  EV KTH AIQ+LDK+IS L+MELAA R+TQE  +S     SP S D
Sbjct  75   VKRENKDIFGEVSKTHNAIQTLDKTISNLEMELAAARATQESIRSG----SPLSGD  126



>ref|XP_008808431.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-1,3-galactosyltransferase 
2 [Phoenix dactylifera]
Length=411

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 62/95 (65%), Gaps = 2/95 (2%)
 Frame = +2

Query  236  KWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT--TMKKPGQEK  409
            KW  L  +  F +G+ +TNR+W  PE+ + +      D ++ +++ DC+  T+ +  Q K
Sbjct  25   KWTFLLCLGSFCIGLFFTNRMWTMPEANDIIRTTGTEDNKMNLVTGDCSPKTINEKPQSK  84

Query  410  DVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE  514
            +++ EV KTH AIQ+LDK+IS L+MELAA R+ QE
Sbjct  85   NILGEVSKTHHAIQTLDKTISNLEMELAAARAAQE  119



>ref|XP_006452384.1| hypothetical protein CICLE_v10008439mg [Citrus clementina]
 gb|ESR65624.1| hypothetical protein CICLE_v10008439mg [Citrus clementina]
Length=417

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 66/102 (65%), Gaps = 2/102 (2%)
 Frame = +2

Query  215  HNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDC-TTMK  391
            H + +S KW  L  I  F  GML+++R+W  PE  +        D++L+++SE C + MK
Sbjct  14   HKSFMSKKWTLLLCIGCFCAGMLFSDRMWTVPEVRDVSRGAGFEDEKLKLVSEGCDSVMK  73

Query  392  KPGQE-KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE  514
               +E  +++ EV KTH AIQ+LDK+IS L+MELAA R+TQE
Sbjct  74   NVKREPAEILGEVSKTHHAIQALDKTISNLEMELAAARATQE  115



>ref|XP_008229956.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Prunus 
mume]
Length=407

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 67/116 (58%), Gaps = 9/116 (8%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPGQE  406
            +S KW  L  +  F  GML+TNR+W  PE+          +++L+++SE C       +E
Sbjct  15   ISKKWTLLLCLGCFCAGMLFTNRMWTVPENKGITRRTAMEEEQLKLVSEGCNPKALHQKE  74

Query  407  -----KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
                 KD+  EV KTH AIQ+LDK+IS L+MELAA R+TQE  +S     SP S D
Sbjct  75   VKRENKDIFGEVSKTHNAIQTLDKTISNLEMELAAARATQESIRSG----SPLSGD  126



>emb|CDX97371.1| BnaC08g12360D [Brassica napus]
Length=405

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 69/109 (63%), Gaps = 6/109 (6%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPG--  400
            VS KW     I FF  G L+++R+W  PE+   ++++   D+ L ++S+DC + KK    
Sbjct  19   VSKKWTFFLCIGFFCAGTLFSDRMWPEPEA--NVVSREASDERLHLVSDDCDSSKKSLKL  76

Query  401  QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE--MKKSDGSDE  541
            + KD + E YK+ +AIQ+LDK+IS L+MELAA R+ QE  M  S  SD+
Sbjct  77   ESKDSLGEAYKSPDAIQTLDKTISTLEMELAAARAAQESIMNGSPVSDD  125



>ref|XP_002268282.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Vitis vinifera]
 emb|CBI28801.3| unnamed protein product [Vitis vinifera]
Length=407

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 68/116 (59%), Gaps = 9/116 (8%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDC---TTMKK-  394
            +S KW  L  +  F  GM +TNR+WA PES           ++L+++SE C   T  +K 
Sbjct  15   ISQKWTLLLCVGCFCAGMFFTNRMWAVPESKGITRTTAVEAEKLKLVSEGCDPKTLQQKF  74

Query  395  -PGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
                 KD++ EV+KTH AIQ+LDK+IS L+MELAA R+ QE       + SP SED
Sbjct  75   VKRDSKDIIGEVHKTHHAIQTLDKTISNLEMELAAARAAQESM----VNGSPISED  126



>ref|XP_008804298.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Phoenix 
dactylifera]
Length=411

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 64/97 (66%), Gaps = 2/97 (2%)
 Frame = +2

Query  230  SAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT--TMKKPGQ  403
            S KW  L  +  F +G+L+TNR+W  PE+ + +      D ++ +++ DC+  T+ +  Q
Sbjct  23   SKKWTFLLCLGSFCVGLLFTNRMWTMPEAKDIIRRTGTEDNKMNLVTGDCSLKTINEKRQ  82

Query  404  EKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE  514
             KD++ +V KTH AIQ+LDK+IS L+MELAA ++ QE
Sbjct  83   SKDILGQVSKTHRAIQTLDKTISNLEMELAAAKAAQE  119



>ref|XP_006452382.1| hypothetical protein CICLE_v10008439mg [Citrus clementina]
 ref|XP_006475056.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X1 [Citrus sinensis]
 gb|ESR65622.1| hypothetical protein CICLE_v10008439mg [Citrus clementina]
 gb|KDO62740.1| hypothetical protein CISIN_1g015419mg [Citrus sinensis]
Length=407

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 66/102 (65%), Gaps = 2/102 (2%)
 Frame = +2

Query  215  HNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDC-TTMK  391
            H + +S KW  L  I  F  GML+++R+W  PE  +        D++L+++SE C + MK
Sbjct  14   HKSFMSKKWTLLLCIGCFCAGMLFSDRMWTVPEVRDVSRGAGFEDEKLKLVSEGCDSVMK  73

Query  392  KPGQE-KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE  514
               +E  +++ EV KTH AIQ+LDK+IS L+MELAA R+TQE
Sbjct  74   NVKREPAEILGEVSKTHHAIQALDKTISNLEMELAAARATQE  115



>gb|KHG30061.1| putative beta-1,3-galactosyltransferase 4 -like protein [Gossypium 
arboreum]
Length=406

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 71/105 (68%), Gaps = 6/105 (6%)
 Frame = +2

Query  218  NAK--VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHR--RDQELQVISEDCTT  385
            NAK  V+ KW  L  I  F  GML+++R+W  PE+ +++++     +D+ L++++E C  
Sbjct  11   NAKSFVTKKWTLLLCIGCFCAGMLFSDRMWTVPEAEDKVVSLETGVKDERLKLVTEGCDP  70

Query  386  MKKPGQE--KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE  514
            ++K  +   K+++ EV KTH AIQ+LDK+IS L+MELAA R+ QE
Sbjct  71   IQKDVKRGSKNILGEVSKTHNAIQTLDKTISNLEMELAAARAMQE  115



>ref|XP_006475057.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Citrus sinensis]
 gb|KDO62741.1| hypothetical protein CISIN_1g015419mg [Citrus sinensis]
Length=406

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 65/101 (64%), Gaps = 1/101 (1%)
 Frame = +2

Query  215  HNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKK  394
            H + +S KW  L  I  F  GML+++R+W  PE  +        D++L+++SE C ++  
Sbjct  14   HKSFMSKKWTLLLCIGCFCAGMLFSDRMWTVPEVRDVSRGAGFEDEKLKLVSEGCDSVMN  73

Query  395  PGQE-KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE  514
              +E  +++ EV KTH AIQ+LDK+IS L+MELAA R+TQE
Sbjct  74   VKREPAEILGEVSKTHHAIQALDKTISNLEMELAAARATQE  114



>ref|XP_010536663.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X2 [Tarenaya hassleriana]
Length=405

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 77/127 (61%), Gaps = 4/127 (3%)
 Frame = +2

Query  188  KKKAMMRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVI  367
            K + +  S   + VS +W  L  I  F  G+L+++R+W  PE+ +        D++LQ++
Sbjct  4    KHRGLEVSASKSVVSKRWTFLLCIGCFCAGILFSDRMWPEPEARSVPRGIGASDEQLQLV  63

Query  368  SEDCTTMKKPG--QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE--MKKSDGS  535
            +ED  +++K    + KDV  EV KTH+AIQ+LDK+IS L+MELAA ++ QE  M  S  S
Sbjct  64   TEDRDSLRKEARHESKDVFHEVSKTHDAIQTLDKTISNLEMELAAAKAVQESIMNGSPVS  123

Query  536  DESPQSE  556
            +E   +E
Sbjct  124  EEFKLTE  130



>ref|XP_004244109.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Solanum 
lycopersicum]
Length=408

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 71/130 (55%), Gaps = 12/130 (9%)
 Frame = +2

Query  194  KAMMRSRHNAKVSAKWI------PLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQE  355
            K  M+SR   + + K +       L  I  F +GML+T+R+W  PE+          DQ+
Sbjct  2    KNTMKSRGGGESAGKGVFSRKLTVLLCIGCFCVGMLFTDRMWTVPEAKGITRTTQIDDQK  61

Query  356  LQVISEDCTTMKKP--GQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSD  529
            L V+SEDC    K    + KD   EV KTH AIQ+LDK+IS L+MELAA R+ Q+   S 
Sbjct  62   LGVVSEDCDPTNKDVKSESKDNFGEVTKTHHAIQTLDKTISNLEMELAAARALQDSILSG  121

Query  530  GSDESPQSED  559
                SP +ED
Sbjct  122  ----SPITED  127



>ref|XP_010536662.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X1 [Tarenaya hassleriana]
Length=428

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 77/127 (61%), Gaps = 4/127 (3%)
 Frame = +2

Query  188  KKKAMMRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVI  367
            K + +  S   + VS +W  L  I  F  G+L+++R+W  PE+ +        D++LQ++
Sbjct  4    KHRGLEVSASKSVVSKRWTFLLCIGCFCAGILFSDRMWPEPEARSVPRGIGASDEQLQLV  63

Query  368  SEDCTTMKKPG--QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE--MKKSDGS  535
            +ED  +++K    + KDV  EV KTH+AIQ+LDK+IS L+MELAA ++ QE  M  S  S
Sbjct  64   TEDRDSLRKEARHESKDVFHEVSKTHDAIQTLDKTISNLEMELAAAKAVQESIMNGSPVS  123

Query  536  DESPQSE  556
            +E   +E
Sbjct  124  EEFKLTE  130



>ref|XP_007045661.1| Galactosyltransferase family protein [Theobroma cacao]
 gb|EOY01493.1| Galactosyltransferase family protein [Theobroma cacao]
Length=435

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 62/98 (63%), Gaps = 2/98 (2%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPGQE  406
            VS KW  L  +  F  GML+TNR+ + PES   +       ++L++ISE C    K  + 
Sbjct  15   VSKKWTFLLCLGCFCAGMLFTNRMGSVPESKGIMRTTAVEAEKLKLISEGCNLKAKEEKH  74

Query  407  --KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE  514
              KD++ EV+KTH AIQ+LDK+IS L+MELAA R+ QE
Sbjct  75   VSKDIIGEVFKTHHAIQTLDKTISNLEMELAAARAAQE  112



>ref|XP_011047261.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Populus euphratica]
Length=408

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 65/116 (56%), Gaps = 9/116 (8%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPGQE  406
            +S KW   F +A F  G+ + NR+WA PE            + L+++SE C       +E
Sbjct  16   ISKKWALFFCLACFCAGVFFNNRMWAVPEPKGITRTTTMEAESLKLVSEGCGDEILHQKE  75

Query  407  -----KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
                 KD++ EVYKTH AIQ+LDK+IS L+MELAA R+ QE   S     SP SED
Sbjct  76   VKRGSKDIIGEVYKTHNAIQTLDKTISNLEMELAAARAAQESILSG----SPLSED  127



>ref|XP_002320464.1| galactosyltransferase family protein [Populus trichocarpa]
 gb|EEE98779.1| galactosyltransferase family protein [Populus trichocarpa]
Length=405

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 64/113 (57%), Gaps = 6/113 (5%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPGQE  406
            +S KW   F +A F  G+ + NR+W  PE            + L+++SE C    K  + 
Sbjct  16   ISKKWALFFCLACFCAGVFFNNRMWTVPEPKGITRTTTMEAESLKLVSEGCGDEIKEVKR  75

Query  407  --KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
              KD++ EVYKTH AIQ+LDK+IS L+MELAA R+ QE   S     SP SED
Sbjct  76   DSKDIIGEVYKTHNAIQTLDKTISNLEMELAAARAAQESILSG----SPLSED  124



>gb|EYU21104.1| hypothetical protein MIMGU_mgv1a007738mg [Erythranthe guttata]
Length=396

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 70/111 (63%), Gaps = 1/111 (1%)
 Frame = +2

Query  206  RSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVIS-EDCT  382
            ++R  A VS KWI +     FFLG L+TNRIWA P S ++++   R   +    S +DC 
Sbjct  4    KNRSRAMVSLKWIAILCFISFFLGALFTNRIWAAPRSDHRILEIRRNVGDSAASSFDDCD  63

Query  383  TMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGS  535
            T KK  ++K+V++E  K H+AIQ+LD S++ L++EL + + ++++   + S
Sbjct  64   TNKKLIRDKEVIKEFSKAHDAIQTLDSSVTKLRLELPSNKKSRKIGHFENS  114



>emb|CDY01303.1| BnaA07g10760D [Brassica napus]
Length=386

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 68/98 (69%), Gaps = 3/98 (3%)
 Frame = +2

Query  224  KVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPGQ  403
            K+S  W+ L  I+ FFLG ++T+R+    +S +Q I QHRRDQE+ VI++     KK  Q
Sbjct  8    KLSLTWVSLLCISCFFLGAIFTSRL-RLSDSGSQFILQHRRDQEVNVITKLHAHEKKKSQ  66

Query  404  EKDVMQEVYKTHEAI--QSLDKSISMLKMELAATRSTQ  511
            EK V++ V +TH+AI  +SLDKS+SML+ +L+  +S+Q
Sbjct  67   EKHVIENVLRTHKAIDNRSLDKSVSMLQKQLSVKQSSQ  104



>ref|XP_010276120.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Nelumbo 
nucifera]
Length=404

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 70/111 (63%), Gaps = 4/111 (4%)
 Frame = +2

Query  188  KKKAMMRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVI  367
            K K  + SR  + VS KW     I  F +GML+TN++WA PE+          D++L++I
Sbjct  4    KSKGELPSR--SVVSQKWTLFLCIGSFCVGMLFTNKMWAVPETKGFTRINSVEDEKLKLI  61

Query  368  SEDCT-TMKKPGQE-KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE  514
            SE C  + K   +E KD++ EV KTH A+Q+LDK+IS L++ELAA R+ QE
Sbjct  62   SEGCDPSFKDVKRESKDIIGEVSKTHYAMQTLDKTISNLEVELAAARAAQE  112



>ref|XP_006855892.1| hypothetical protein AMTR_s00037p00154410 [Amborella trichopoda]
 gb|ERN17359.1| hypothetical protein AMTR_s00037p00154410 [Amborella trichopoda]
Length=405

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 63/102 (62%), Gaps = 2/102 (2%)
 Frame = +2

Query  215  HNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKK  394
            H + VS +W     +A F  G+L+TNR+W+ PE+ +   +     ++L + SE C     
Sbjct  12   HRSSVSRRWTFFLCLASFCAGLLFTNRMWSMPEAKDVSRSHENEQEKLNLFSEGCDPKSN  71

Query  395  PGQE--KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE  514
              ++  KD++ EV KTH AIQ+LDK+IS L+MELAA R+ QE
Sbjct  72   VVKQEPKDILGEVSKTHHAIQTLDKTISNLEMELAAARAAQE  113



>ref|XP_006284182.1| hypothetical protein CARUB_v10005329mg [Capsella rubella]
 gb|EOA17080.1| hypothetical protein CARUB_v10005329mg [Capsella rubella]
Length=305

 Score = 83.2 bits (204),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 67/109 (61%), Gaps = 4/109 (4%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKK--PG  400
            VS KW     I FF  G+L+++R+W  PE+          D+ L++ SEDC + KK    
Sbjct  19   VSKKWTLFLCIGFFCAGILFSDRMWPEPEANLVSRDTVASDERLRLESEDCDSSKKGLKR  78

Query  401  QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE--MKKSDGSDE  541
            + KD++ EVYK+ +AIQ+LDK+IS L+ ELAA R+ QE  M  S  SD+
Sbjct  79   ESKDILGEVYKSPDAIQTLDKTISTLETELAAARAAQESIMNGSPVSDD  127



>ref|XP_010278673.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Nelumbo nucifera]
Length=360

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 61/98 (62%), Gaps = 2/98 (2%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKK--PG  400
            VS KW     IA F  GML+TNR+   PE+ +        D++L+++SE C +  K    
Sbjct  16   VSRKWTIFLCIACFCAGMLFTNRMLTVPETKDLTRINGMEDEKLKLVSEGCDSRFKEVKH  75

Query  401  QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE  514
            + KD++ EV KTH AIQ+LDK+IS L+MELAA R+  E
Sbjct  76   ESKDILGEVSKTHHAIQTLDKTISNLEMELAAARAAHE  113



>ref|XP_009777688.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Nicotiana 
sylvestris]
Length=399

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 75/115 (65%), Gaps = 7/115 (6%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIA--QHRRDQELQVISED  376
            M++R+  KVS KWI +  I  F LGML++NR+W PPES   ++   +H+++++L  IS+D
Sbjct  1    MKNRNRGKVSPKWIAILCIFSFALGMLFSNRVWTPPESDGMIMFGRRHKQERDLAFISDD  60

Query  377  CTTMKKPGQEKDVMQEVYKTHEAI---QSLDKSISMLKMELAATRSTQEMKKSDG  532
            C +  K  Q++D++ E  K   AI   +SLDKSI+ ++ EL +T++    +K++ 
Sbjct  61   CDS--KDNQKEDMIGEFNKAQVAIHSFRSLDKSIAKIQSELPSTKTLLTPRKTEA  113



>emb|CDY00412.1| BnaC07g14140D [Brassica napus]
Length=397

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 68/98 (69%), Gaps = 3/98 (3%)
 Frame = +2

Query  224  KVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPGQ  403
            ++S  W+ L  I+ FFLG ++T+R+    +S +Q I QHRRDQE+ VI++     KK  Q
Sbjct  8    RLSLTWVSLLCISCFFLGAIFTSRL-RLSDSGSQFILQHRRDQEVNVITKLHDHEKKKSQ  66

Query  404  EKDVMQEVYKTHEAI--QSLDKSISMLKMELAATRSTQ  511
            EK V++ V +TH+AI  +SLDKS+SML+ +L+  +S+Q
Sbjct  67   EKHVIENVLRTHKAIDHRSLDKSVSMLQKQLSVKQSSQ  104



>ref|XP_009798738.1| PREDICTED: uncharacterized protein LOC104244918 [Nicotiana sylvestris]
Length=558

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 64/106 (60%), Gaps = 7/106 (7%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPEST-----NQLIAQHRRDQELQVI  367
            M++R   KVS KWI +  I  F LGML++ R+WAPP+ T           + ++Q+L  +
Sbjct  1    MKNRSKGKVSPKWIVILCIFSFALGMLFSKRVWAPPDHTVSDGRATFPRLYNQEQKLNSV  60

Query  368  SEDCTTMKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRS  505
             +DC   K   QE D+M E  K HEAI SLD SI+ +++EL +T++
Sbjct  61   PDDCENKKN--QEDDMMGEFNKAHEAISSLDNSIAKIRIELPSTKT  104



>gb|KDO80830.1| hypothetical protein CISIN_1g015683mg [Citrus sinensis]
 gb|KDO80831.1| hypothetical protein CISIN_1g015683mg [Citrus sinensis]
Length=275

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 64/103 (62%), Gaps = 11/103 (11%)
 Frame = +2

Query  236  KWIPLFSIAFFFLGMLYTNRIWAPPESTNQ-LIAQHRRDQELQVISEDCTTMKKPGQEKD  412
            KWIP   +  F LG+L++N  W PPES  +  +   RR+Q++ V S DC   KK  Q++D
Sbjct  14   KWIPFVCLFCFALGILFSNLTWNPPESDGRPSLNVRRREQQVAVASTDCA--KKAFQDQD  71

Query  413  VMQEVYKTHEAI--------QSLDKSISMLKMELAATRSTQEM  517
            V +EV KT  AI        ++LDK+I  L+MELAA+RS +EM
Sbjct  72   VAKEVLKTRGAIHDGSVESDRTLDKTIGQLQMELAASRSGREM  114



>ref|XP_010278672.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Nelumbo nucifera]
Length=405

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 61/98 (62%), Gaps = 2/98 (2%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKP--G  400
            VS KW     IA F  GML+TNR+   PE+ +        D++L+++SE C +  K    
Sbjct  16   VSRKWTIFLCIACFCAGMLFTNRMLTVPETKDLTRINGMEDEKLKLVSEGCDSRFKEVKH  75

Query  401  QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE  514
            + KD++ EV KTH AIQ+LDK+IS L+MELAA R+  E
Sbjct  76   ESKDILGEVSKTHHAIQTLDKTISNLEMELAAARAAHE  113



>ref|XP_006434094.1| hypothetical protein CICLE_v10001364mg [Citrus clementina]
 ref|XP_006434097.1| hypothetical protein CICLE_v10001364mg [Citrus clementina]
 gb|ESR47334.1| hypothetical protein CICLE_v10001364mg [Citrus clementina]
 gb|ESR47337.1| hypothetical protein CICLE_v10001364mg [Citrus clementina]
Length=317

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 64/103 (62%), Gaps = 11/103 (11%)
 Frame = +2

Query  236  KWIPLFSIAFFFLGMLYTNRIWAPPESTNQ-LIAQHRRDQELQVISEDCTTMKKPGQEKD  412
            KWIP   +  F LG+L++N  W PPES  +  +   RR+Q++ V S DC   KK  Q++D
Sbjct  14   KWIPFLCLFCFALGILFSNLTWNPPESDGRPSLNVRRREQQVAVASTDCA--KKAFQDQD  71

Query  413  VMQEVYKTHEAI--------QSLDKSISMLKMELAATRSTQEM  517
            V +EV KT  AI        ++LDK I  L+MELAA+RS++EM
Sbjct  72   VAKEVLKTRGAIHDGSVESDRTLDKPIGQLQMELAASRSSREM  114



>gb|KDO80832.1| hypothetical protein CISIN_1g015683mg [Citrus sinensis]
Length=261

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 64/103 (62%), Gaps = 11/103 (11%)
 Frame = +2

Query  236  KWIPLFSIAFFFLGMLYTNRIWAPPESTNQ-LIAQHRRDQELQVISEDCTTMKKPGQEKD  412
            KWIP   +  F LG+L++N  W PPES  +  +   RR+Q++ V S DC   KK  Q++D
Sbjct  14   KWIPFVCLFCFALGILFSNLTWNPPESDGRPSLNVRRREQQVAVASTDCA--KKAFQDQD  71

Query  413  VMQEVYKTHEAI--------QSLDKSISMLKMELAATRSTQEM  517
            V +EV KT  AI        ++LDK+I  L+MELAA+RS +EM
Sbjct  72   VAKEVLKTRGAIHDGSVESDRTLDKTIGQLQMELAASRSGREM  114



>ref|XP_007132543.1| hypothetical protein PHAVU_011G103400g [Phaseolus vulgaris]
 gb|ESW04537.1| hypothetical protein PHAVU_011G103400g [Phaseolus vulgaris]
Length=406

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 69/119 (58%), Gaps = 15/119 (13%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQE-LQVISEDCTT------  385
            +S +W     +  F  GML+T RIW  PE+   L      + + L V+SE C +      
Sbjct  15   ISQRWALFLCLGSFCAGMLFTTRIWTIPENNKGLARPTAAEADKLNVVSEGCNSRIMQEL  74

Query  386  -MKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
             MK+   +KD+  EVYK+H +IQ+LDK+IS L+MELAA R+TQE  +S     +P S+D
Sbjct  75   EMKR---DKDIYGEVYKSHNSIQTLDKTISNLEMELAAARATQESLRSG----APVSDD  126



>ref|XP_006375532.1| hypothetical protein POPTR_0014s15200g [Populus trichocarpa]
 gb|ERP53329.1| hypothetical protein POPTR_0014s15200g [Populus trichocarpa]
Length=408

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 64/116 (55%), Gaps = 9/116 (8%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPGQE  406
            +S KW   F +A F  G+ + NR+W  PE            + L+++SE C       +E
Sbjct  16   ISKKWALFFCLACFCAGVFFNNRMWTVPEPKGITRTTTMEAESLKLVSEGCGDEILHQKE  75

Query  407  -----KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
                 KD++ EVYKTH AIQ+LDK+IS L+MELAA R+ QE   S     SP SED
Sbjct  76   VKRDSKDIIGEVYKTHNAIQTLDKTISNLEMELAAARAAQESILSG----SPLSED  127



>gb|KDO80828.1| hypothetical protein CISIN_1g015683mg [Citrus sinensis]
 gb|KDO80829.1| hypothetical protein CISIN_1g015683mg [Citrus sinensis]
Length=317

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 64/103 (62%), Gaps = 11/103 (11%)
 Frame = +2

Query  236  KWIPLFSIAFFFLGMLYTNRIWAPPESTNQ-LIAQHRRDQELQVISEDCTTMKKPGQEKD  412
            KWIP   +  F LG+L++N  W PPES  +  +   RR+Q++ V S DC   KK  Q++D
Sbjct  14   KWIPFVCLFCFALGILFSNLTWNPPESDGRPSLNVRRREQQVAVASTDCA--KKAFQDQD  71

Query  413  VMQEVYKTHEAI--------QSLDKSISMLKMELAATRSTQEM  517
            V +EV KT  AI        ++LDK+I  L+MELAA+RS +EM
Sbjct  72   VAKEVLKTRGAIHDGSVESDRTLDKTIGQLQMELAASRSGREM  114



>ref|XP_010104592.1| putative beta-1,3-galactosyltransferase 2 [Morus notabilis]
 gb|EXC01255.1| putative beta-1,3-galactosyltransferase 2 [Morus notabilis]
Length=420

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 62/101 (61%), Gaps = 5/101 (5%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPGQE  406
            +S KW  L  +  F  GML+TNR+W  PE+ +         ++L+++SE C       +E
Sbjct  15   LSQKWALLLCLGCFCAGMLFTNRMWDVPETKDITRTTSVEAEKLKLVSEGCGPKSLLQKE  74

Query  407  -----KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE  514
                 KD+ +EV+KTH AIQ+LDK+IS L+MELAA R+ QE
Sbjct  75   VKRDPKDIYREVFKTHNAIQTLDKTISNLEMELAAARAAQE  115



>ref|XP_002867534.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43793.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=407

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 67/109 (61%), Gaps = 4/109 (4%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKK--PG  400
            VS KW     I FF  G+L+++R+W  PE+          D+ L++ SEDC + KK    
Sbjct  19   VSKKWTLFLCIGFFCAGILFSDRMWPEPEANVVSRDTVASDERLRLESEDCDSSKKGLKR  78

Query  401  QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE--MKKSDGSDE  541
            + KD++ EVYK+ +AIQ+LDK+IS L+ ELAA R+ QE  M  S  SD+
Sbjct  79   ESKDILGEVYKSPDAIQTLDKTISNLENELAAARAAQESIMNGSPVSDD  127



>ref|XP_006434096.1| hypothetical protein CICLE_v10001364mg [Citrus clementina]
 gb|ESR47336.1| hypothetical protein CICLE_v10001364mg [Citrus clementina]
Length=402

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 64/103 (62%), Gaps = 11/103 (11%)
 Frame = +2

Query  236  KWIPLFSIAFFFLGMLYTNRIWAPPESTNQ-LIAQHRRDQELQVISEDCTTMKKPGQEKD  412
            KWIP   +  F LG+L++N  W PPES  +  +   RR+Q++ V S DC   KK  Q++D
Sbjct  14   KWIPFLCLFCFALGILFSNLTWNPPESDGRPSLNVRRREQQVAVASTDCA--KKAFQDQD  71

Query  413  VMQEVYKTHEAI--------QSLDKSISMLKMELAATRSTQEM  517
            V +EV KT  AI        ++LDK I  L+MELAA+RS++EM
Sbjct  72   VAKEVLKTRGAIHDGSVESDRTLDKPIGQLQMELAASRSSREM  114



>gb|KDO80827.1| hypothetical protein CISIN_1g015683mg [Citrus sinensis]
Length=370

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 64/103 (62%), Gaps = 11/103 (11%)
 Frame = +2

Query  236  KWIPLFSIAFFFLGMLYTNRIWAPPESTNQ-LIAQHRRDQELQVISEDCTTMKKPGQEKD  412
            KWIP   +  F LG+L++N  W PPES  +  +   RR+Q++ V S DC   KK  Q++D
Sbjct  14   KWIPFVCLFCFALGILFSNLTWNPPESDGRPSLNVRRREQQVAVASTDCA--KKAFQDQD  71

Query  413  VMQEVYKTHEAI--------QSLDKSISMLKMELAATRSTQEM  517
            V +EV KT  AI        ++LDK+I  L+MELAA+RS +EM
Sbjct  72   VAKEVLKTRGAIHDGSVESDRTLDKTIGQLQMELAASRSGREM  114



>ref|XP_006472694.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Citrus 
sinensis]
Length=402

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 64/103 (62%), Gaps = 11/103 (11%)
 Frame = +2

Query  236  KWIPLFSIAFFFLGMLYTNRIWAPPESTNQ-LIAQHRRDQELQVISEDCTTMKKPGQEKD  412
            KWIP   +  F LG+L++N  W PPES  +  +   RR+Q++ V S DC   KK  Q++D
Sbjct  14   KWIPFVCLFCFALGILFSNLTWNPPESDGRPSLNVRRREQQVAVASTDCA--KKAFQDQD  71

Query  413  VMQEVYKTHEAI--------QSLDKSISMLKMELAATRSTQEM  517
            V +EV KT  AI        ++LDK+I  L+MELAA+RS +EM
Sbjct  72   VAKEVLKTRGAIHDGSVESDRTLDKTIGQLQMELAASRSGREM  114



>ref|NP_849454.1| putative beta-1,3-galactosyltransferase 4 [Arabidopsis thaliana]
 gb|AEE85273.1| putative beta-1,3-galactosyltransferase 4 [Arabidopsis thaliana]
Length=306

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 66/109 (61%), Gaps = 4/109 (4%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKK--PG  400
            VS KW     I FF  G+L+++R+W  PES          D+ L++ SEDC + KK    
Sbjct  19   VSKKWTLFLCIGFFCAGILFSDRMWPEPESNVVSRDTVASDERLRLESEDCDSSKKGLKR  78

Query  401  QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE--MKKSDGSDE  541
            + KD++ +VYK+ +AIQ+LDK+IS L+ ELA  R+ QE  M  S  SD+
Sbjct  79   ESKDILGDVYKSPDAIQTLDKTISKLETELADARAAQESIMNGSPVSDD  127



>ref|XP_011095407.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Sesamum 
indicum]
Length=405

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 70/113 (62%), Gaps = 6/113 (5%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKP--G  400
            VS K   L  I  F  GML+T+R+WA PE+ +   +    D++LQ++S+ C    K   G
Sbjct  16   VSRKLTFLLCIGCFCAGMLFTDRMWAVPEAKDISRSTGIEDEKLQLVSDGCGPKLKGVKG  75

Query  401  QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
            + K+++ EV KT +AIQ+LDK+IS L+MELAA R+ Q+   S     SP SED
Sbjct  76   EAKEILGEVSKTPDAIQTLDKTISNLEMELAAARAVQDSLLSG----SPISED  124



>gb|KDO80825.1| hypothetical protein CISIN_1g015683mg [Citrus sinensis]
Length=402

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 64/103 (62%), Gaps = 11/103 (11%)
 Frame = +2

Query  236  KWIPLFSIAFFFLGMLYTNRIWAPPESTNQ-LIAQHRRDQELQVISEDCTTMKKPGQEKD  412
            KWIP   +  F LG+L++N  W PPES  +  +   RR+Q++ V S DC   KK  Q++D
Sbjct  14   KWIPFVCLFCFALGILFSNLTWNPPESDGRPSLNVRRREQQVAVASTDCA--KKAFQDQD  71

Query  413  VMQEVYKTHEAI--------QSLDKSISMLKMELAATRSTQEM  517
            V +EV KT  AI        ++LDK+I  L+MELAA+RS +EM
Sbjct  72   VAKEVLKTRGAIHDGSVESDRTLDKTIGQLQMELAASRSGREM  114



>emb|CDP04596.1| unnamed protein product [Coffea canephora]
Length=393

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 77/126 (61%), Gaps = 14/126 (11%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT  382
            M+SR+ A VS KWI +F I  F LG+L++NR+WAP E  + +++  RR QEL + S    
Sbjct  1    MKSRNKAIVSPKWIVVFCIFSFALGVLFSNRLWAPSEWDDPIVSLRRRQQELAIDS----  56

Query  383  TMKKPGQEKDVMQEVYKTHEAIQ---SLDKSISMLKMELAATRSTQEMKKSD-----GSD  538
              K+   ++DV++   +  EAI+   SLD SI+ L++EL + R   +M KS+     G+D
Sbjct  57   --KREKDKEDVIRGYKEAQEAIKNNRSLDNSIAKLRLELPSVRDVDQMGKSENLPALGTD  114

Query  539  ESPQSE  556
             + +S+
Sbjct  115  SNGKSK  120



>ref|XP_003527496.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Glycine 
max]
 gb|KHN41227.1| Putative beta-1,3-galactosyltransferase 2 [Glycine soja]
Length=407

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 69/119 (58%), Gaps = 15/119 (13%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQE-LQVISEDCTT------  385
            +S +W+    +  F  GML+T RIW  PE+   L      + E L ++SE C +      
Sbjct  15   ISQRWVLFLCLGSFCAGMLFTTRIWTIPENNKGLARPTASEAEKLSLVSEGCNSRILQEM  74

Query  386  -MKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
             MK+   +KD+  EV+K+H +IQ+LDK+IS L+MELAA R TQE  +S     +P S+D
Sbjct  75   EMKR---DKDIYGEVFKSHNSIQTLDKTISNLEMELAAARVTQESLRSG----APISDD  126



>ref|XP_010433424.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 [Camelina 
sativa]
Length=408

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 62/98 (63%), Gaps = 2/98 (2%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKK--PG  400
            VS KW     I FF  G+L+++R+W  PE+          D+ +++ SEDC + KK    
Sbjct  20   VSKKWTLFLCIGFFCAGILFSDRMWPEPEANIVSRDTVASDERMRLESEDCDSSKKGLKR  79

Query  401  QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE  514
            + KD++ EVYK+ +AIQ+LDK+IS L+ ELAA R+ QE
Sbjct  80   ESKDILGEVYKSPDAIQTLDKTISNLETELAAARAAQE  117



>ref|XP_010929797.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Elaeis 
guineensis]
Length=411

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 62/98 (63%), Gaps = 2/98 (2%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT--TMKKPG  400
            VS +W  L  +  F +G+L+TNR+W  PE+ + +      D ++ +++ DC   T+ +  
Sbjct  22   VSKRWTFLLCLGSFCVGLLFTNRMWTMPEAKDIIRTTGTEDSKMNLVTGDCNLKTINERR  81

Query  401  QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE  514
            Q KD++ +V KT  AIQ++DK+IS L+MELA  R+ QE
Sbjct  82   QAKDIVGQVSKTQHAIQTIDKTISNLEMELAVARAAQE  119



>ref|XP_002974972.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ23757.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=402

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 71/115 (62%), Gaps = 8/115 (7%)
 Frame = +2

Query  206  RSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISED-CT  382
            R+  +  VS KW+ +  +  F +GML+TNR+W  PE  +  + + +  Q LQ++SED C 
Sbjct  4    RASSSFSVSGKWMLVLCVGSFCVGMLFTNRMWNSPEDLD--VTRPQTSQHLQIVSEDHCD  61

Query  383  TMKKP----GQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRS-TQEMKKSDG  532
               KP       ++++ +V KTH+A+ +LDK++S L+MELAA R+ TQ+   S G
Sbjct  62   PKPKPVNSEASPREILNQVSKTHDAVWNLDKTMSALEMELAAARAITQQSTSSPG  116



>ref|XP_007211967.1| hypothetical protein PRUPE_ppa006589mg [Prunus persica]
 gb|EMJ13166.1| hypothetical protein PRUPE_ppa006589mg [Prunus persica]
Length=404

 Score = 81.3 bits (199),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 58/97 (60%), Gaps = 1/97 (1%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPGQE  406
            VS KW  LF I  F  GML+++R+W+ PE           ++ LQ++S    T+K    E
Sbjct  16   VSRKWTILFCIGCFCAGMLFSDRMWSVPEIKGIARTARHEEETLQLVSGCDPTIKDVEHE  75

Query  407  -KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE  514
             KDV  EV KTH AI +LDK IS L+MELAA R+ QE
Sbjct  76   QKDVYGEVSKTHHAIHTLDKKISNLEMELAAARAAQE  112



>ref|XP_003576598.1| PREDICTED: probable beta-1,3-galactosyltransferase 5 [Brachypodium 
distachyon]
Length=398

 Score = 81.3 bits (199),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 59/93 (63%), Gaps = 3/93 (3%)
 Frame = +2

Query  248  LFSIAF-FFLGMLYTNRIWAPPESTNQLIAQHRR--DQELQVISEDCTTMKKPGQEKDVM  418
            L   AF F LGML+T+R    P+  N  + Q RR   +  ++++ED     KP  ++DVM
Sbjct  23   LLLCAFSFGLGMLFTDRFGTVPDLRNPGMTQRRRLEGEPKKIVTEDFVAKAKPSNDRDVM  82

Query  419  QEVYKTHEAIQSLDKSISMLKMELAATRSTQEM  517
             EV KTHEAIQ LDKSI+ L+MELAA RS  E+
Sbjct  83   GEVSKTHEAIQYLDKSIATLQMELAARRSKHEL  115



>ref|XP_008802930.1| PREDICTED: probable beta-1,3-galactosyltransferase 8 [Phoenix 
dactylifera]
Length=405

 Score = 81.3 bits (199),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 66/112 (59%), Gaps = 2/112 (2%)
 Frame = +2

Query  233  AKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPGQ--E  406
             K I +  +A FF+G+L++NRI   P  T +      R+ ++ +I+ DC    + G+   
Sbjct  22   GKAIVVLCMASFFMGLLFSNRIGVMPLETTEQRTSTTRESKISLIAHDCEHKHRLGEGST  81

Query  407  KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSEDG  562
            KDV+ EV KTH+AIQSLDKSIS L+MELA  R+ Q   ++     + +S  G
Sbjct  82   KDVIGEVSKTHQAIQSLDKSISSLEMELAVARTNQNGGQASSGGVTMRSNKG  133



>ref|XP_002988781.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ10043.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=399

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 72/121 (60%), Gaps = 3/121 (2%)
 Frame = +2

Query  203  MRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTN-QLIAQHRRDQELQVISE-D  376
            M+ +  + +SAKW+ +  ++ F +GML+TNR+W   E    + +      + LQ+++E  
Sbjct  1    MKLKGASAISAKWMVVLCVSSFLVGMLFTNRMWNMSEDFEAEALKAPVNTEHLQLVTEIQ  60

Query  377  CTTMKKP-GQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQS  553
            C    KP   E++V  EV KTH+AI++LDK+IS L+MELAA R+ Q      G+ E P  
Sbjct  61   CDPKPKPVTPEREVYVEVSKTHQAIRNLDKTISSLEMELAAVRAAQASTIGGGAAEKPAM  120

Query  554  E  556
            E
Sbjct  121  E  121



>ref|XP_004515096.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cicer 
arietinum]
Length=408

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 63/116 (54%), Gaps = 9/116 (8%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTT-----MK  391
            +S KW     +  F  GML+TNRIW+ PE             +  V+SE C T     M+
Sbjct  16   ISQKWTLFLCLGSFCAGMLFTNRIWSIPEQNGLARPTASETGKFNVVSEGCNTRILQEME  75

Query  392  KPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
               + +D+  E +K H +IQ+LDK+IS L+M+LAA RS QE  +S     +P SED
Sbjct  76   MRRETRDMYGEDFKGHNSIQALDKTISNLEMDLAAARSVQESMRSG----APVSED  127



>ref|XP_002977391.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ21395.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=402

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 71/115 (62%), Gaps = 8/115 (7%)
 Frame = +2

Query  206  RSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISED-CT  382
            R+  +  VS KW+ +  +  F +GML+TNR+W  PE  +  + + +  Q LQ++SED C 
Sbjct  4    RASSSFSVSGKWMLVLCVGSFCVGMLFTNRMWNSPEDLD--VTRPQTSQRLQIVSEDHCD  61

Query  383  TMKKPGQE----KDVMQEVYKTHEAIQSLDKSISMLKMELAATRS-TQEMKKSDG  532
               KP       ++++ +V KTH+A+ +LDK++S L+MELAA R+ TQ+   S G
Sbjct  62   PKPKPVNSEESPREILNQVSKTHDAVWNLDKTMSALEMELAAARALTQQSTSSPG  116



>emb|CDX92791.1| BnaC07g40490D [Brassica napus]
Length=402

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 65/107 (61%), Gaps = 8/107 (7%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPGQE  406
            VS KW  L  I FF  G L+++R+W  PES N    +   D+ L ++SEDC + KK    
Sbjct  22   VSKKWAFLLCIGFFCAGTLFSDRMWPEPES-NVASREAASDERLLLMSEDCDSSKKTS--  78

Query  407  KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE--MKKSDGSDE  541
               + EVYK+ +A Q+LDK+IS L+MELAA R+ QE  +  S  SDE
Sbjct  79   ---LGEVYKSPDATQTLDKTISTLEMELAAARAAQESIVNGSPVSDE  122



>ref|XP_010448194.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X1 [Camelina sativa]
Length=409

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 62/98 (63%), Gaps = 2/98 (2%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKP--G  400
            VS KW     I FF  G+L+++R+W  PE+          D+ +++ SEDC + KK    
Sbjct  21   VSKKWTLFLCIGFFCAGILFSDRMWPEPEANIVSRDTVASDERMRLESEDCDSSKKGLKR  80

Query  401  QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE  514
            + KD++ EVYK+ +A+Q+LDK+IS L+ ELAA R+ QE
Sbjct  81   EAKDILGEVYKSPDALQTLDKTISNLETELAAARAAQE  118



>ref|XP_010448195.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X2 [Camelina sativa]
Length=408

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPGQE  406
            VS KW     I FF  G+L+++R+W  PE+          D+ +++ SEDC + K   +E
Sbjct  21   VSKKWTLFLCIGFFCAGILFSDRMWPEPEANIVSRDTVASDERMRLESEDCDSSKGLKRE  80

Query  407  -KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE  514
             KD++ EVYK+ +A+Q+LDK+IS L+ ELAA R+ QE
Sbjct  81   AKDILGEVYKSPDALQTLDKTISNLETELAAARAAQE  117



>ref|XP_010438679.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X1 [Camelina sativa]
Length=409

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 62/98 (63%), Gaps = 2/98 (2%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKP--G  400
            VS KW     I FF  G+L+++R+W  PE+          D+ +++ SEDC + KK    
Sbjct  21   VSKKWTLFLCIGFFCAGILFSDRMWPEPEANLVSRDTVASDERMRLESEDCDSSKKGLKR  80

Query  401  QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE  514
            + KD++ EVYK+ +AIQ+LDK+IS L+ +LAA R+ QE
Sbjct  81   ESKDILGEVYKSPDAIQTLDKTISNLETDLAAARAAQE  118



>ref|NP_567762.1| putative beta-1,3-galactosyltransferase 4 [Arabidopsis thaliana]
 sp|Q8LEJ9.1|B3GT4_ARATH RecName: Full=Probable beta-1,3-galactosyltransferase 4 [Arabidopsis 
thaliana]
 gb|AAM62612.1| Avr9 elicitor response-like protein [Arabidopsis thaliana]
 gb|AEE85272.1| putative beta-1,3-galactosyltransferase 4 [Arabidopsis thaliana]
Length=407

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 66/109 (61%), Gaps = 4/109 (4%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKK--PG  400
            VS KW     I FF  G+L+++R+W  PES          D+ L++ SEDC + KK    
Sbjct  19   VSKKWTLFLCIGFFCAGILFSDRMWPEPESNVVSRDTVASDERLRLESEDCDSSKKGLKR  78

Query  401  QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE--MKKSDGSDE  541
            + KD++ +VYK+ +AIQ+LDK+IS L+ ELA  R+ QE  M  S  SD+
Sbjct  79   ESKDILGDVYKSPDAIQTLDKTISKLETELADARAAQESIMNGSPVSDD  127



>ref|XP_010438680.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X2 [Camelina sativa]
Length=408

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPGQE  406
            VS KW     I FF  G+L+++R+W  PE+          D+ +++ SEDC + K   +E
Sbjct  21   VSKKWTLFLCIGFFCAGILFSDRMWPEPEANLVSRDTVASDERMRLESEDCDSSKGLKRE  80

Query  407  -KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE  514
             KD++ EVYK+ +AIQ+LDK+IS L+ +LAA R+ QE
Sbjct  81   SKDILGEVYKSPDAIQTLDKTISNLETDLAAARAAQE  117



>emb|CAB36540.1| Avr9 elicitor response like protein [Arabidopsis thaliana]
 emb|CAB79549.1| Avr9 elicitor response like protein [Arabidopsis thaliana]
Length=406

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 66/108 (61%), Gaps = 3/108 (3%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPGQE  406
            VS KW     I FF  G+L+++R+W  PES          D+ L++ SEDC + K   +E
Sbjct  19   VSKKWTLFLCIGFFCAGILFSDRMWPEPESNVVSRDTVASDERLRLESEDCDSSKGLKRE  78

Query  407  -KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE--MKKSDGSDE  541
             KD++ +VYK+ +AIQ+LDK+IS L+ ELA  R+ QE  M  S  SD+
Sbjct  79   SKDILGDVYKSPDAIQTLDKTISKLETELADARAAQESIMNGSPVSDD  126



>ref|XP_011048789.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Populus euphratica]
Length=405

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 69/126 (55%), Gaps = 7/126 (6%)
 Frame = +2

Query  188  KKKAMMRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVI  367
            K +   +S  NA +S KW  L  +A F  GML  N +W  PE            ++L+++
Sbjct  4    KSRGDQQSSKNA-ISQKWTLLLCLACFCSGMLLANWMWNVPEPIGINRTTTVEAEKLKLV  62

Query  368  SEDCTTMKK--PGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDE  541
            SE C    K      KD++ EVYKTH AIQ+LDK+IS L+MELAA R+ QE   S     
Sbjct  63   SEGCGGEIKEVTRDSKDIIGEVYKTHNAIQTLDKTISNLEMELAAARAAQESILSG----  118

Query  542  SPQSED  559
            SP S+D
Sbjct  119  SPLSDD  124



>ref|XP_011097870.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X2 [Sesamum indicum]
Length=403

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 65/103 (63%), Gaps = 3/103 (3%)
 Frame = +2

Query  209  SRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCT-T  385
            SRH+  VS K      +  FF GML+T+R+WA PE+ +        + +L++ S++    
Sbjct  12   SRHS--VSRKLTIFLCVGCFFAGMLFTDRMWAVPEAKDISQTTGVANDKLKLDSDNWDRK  69

Query  386  MKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE  514
            +   GQ KDV+ EV KTH AIQ+LDK+IS L+MELAA R+ Q+
Sbjct  70   VDARGQAKDVLGEVSKTHHAIQTLDKTISNLEMELAAARAVQD  112



>ref|XP_008455443.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Cucumis 
melo]
Length=407

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 64/116 (55%), Gaps = 9/116 (8%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPGQE  406
            +S KW     +  F LGM +TNR+W  PE            ++L+++SE C       +E
Sbjct  15   ISQKWAVFLCLGSFCLGMFFTNRMWNVPEPKGITRTTPFEAEKLKLVSEGCGPKSLDEKE  74

Query  407  -----KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
                 KD+  EV KTH AIQ+LDK+IS L+MELAA ++ QE  +S     SP S+D
Sbjct  75   VKRVSKDIFGEVSKTHNAIQTLDKTISNLEMELAAAKAAQESIQSG----SPSSDD  126



>ref|XP_010063019.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Eucalyptus grandis]
 gb|KCW70192.1| hypothetical protein EUGRSUZ_F03473 [Eucalyptus grandis]
Length=403

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 63/98 (64%), Gaps = 3/98 (3%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPGQE  406
            VS KW  L  I  F+ GML+++RI   PE+ + +      D +L+++S  CT   K G+ 
Sbjct  15   VSKKWALLLCIGCFWGGMLFSSRIETEPEARD-IPRTMNEDGKLKIVSGGCTPKPKDGKH  73

Query  407  K--DVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE  514
            +  D++ EV +TH AIQ+LDK+IS L+MELAA R+ QE
Sbjct  74   ESTDILGEVSRTHHAIQTLDKTISNLEMELAAARAAQE  111



>ref|XP_004144497.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
 gb|KGN43517.1| hypothetical protein Csa_7G043590 [Cucumis sativus]
Length=407

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 64/116 (55%), Gaps = 9/116 (8%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPGQE  406
            +S KW     +  F LGM +TNR+W  PE            ++L+++SE C       +E
Sbjct  15   ISQKWAVFLCLGSFCLGMFFTNRMWNVPEPKGITRTTPFEAEKLKLVSEGCDPKSLDEKE  74

Query  407  -----KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
                 KD+  EV KTH AIQ+LDK+IS L+MELAA ++ QE  +S     SP S+D
Sbjct  75   VKRVSKDIFGEVSKTHNAIQTLDKTISNLEMELAAAKAAQESIQSG----SPSSDD  126



>ref|XP_009109161.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 [Brassica 
rapa]
 emb|CDY14294.1| BnaA08g14250D [Brassica napus]
Length=406

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 67/109 (61%), Gaps = 6/109 (6%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPG--  400
            VS K      I FF  G L+++R+W  PE+   ++++   D+ L ++S+DC + KK    
Sbjct  20   VSKKLTFFLCIGFFCAGTLFSDRMWPEPEA--NVVSREASDERLHLVSDDCDSSKKSLKL  77

Query  401  QEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE--MKKSDGSDE  541
            + KD + E YK+ +AIQ+LDK+IS L+MEL A R+ QE  M  S  SD+
Sbjct  78   ESKDSLGEAYKSPDAIQTLDKTISTLEMELVAARAAQESIMNGSPVSDD  126



>gb|KHN21228.1| Putative beta-1,3-galactosyltransferase 2 [Glycine soja]
Length=406

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 67/119 (56%), Gaps = 15/119 (13%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQE-LQVISEDCTT------  385
            +S +W     +  F  GML+T RIW  PE+   L      + E L ++SE C +      
Sbjct  15   ISQRWALFLCLGSFCAGMLFTTRIWTIPENNKGLARPTASEAEKLSLVSEGCNSRILQEM  74

Query  386  -MKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
             MK    +KD   EV+K+H +IQ+LDK+IS L+MELAA R+TQE  +S     +P S+D
Sbjct  75   EMK---HDKDTYGEVFKSHNSIQTLDKTISNLEMELAAARATQESLRSG----APISDD  126



>ref|XP_003539862.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Glycine 
max]
Length=406

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 67/119 (56%), Gaps = 15/119 (13%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQE-LQVISEDCTT------  385
            +S +W     +  F  GML+T RIW  PE+   L      + E L ++SE C +      
Sbjct  15   ISQRWALFLCLGSFCAGMLFTTRIWTIPENNKGLARPTASEAEKLSLVSEGCNSRILQEM  74

Query  386  -MKKPGQEKDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQEMKKSDGSDESPQSED  559
             MK    +KD   EV+K+H +IQ+LDK+IS L+MELAA R+TQE  +S     +P S+D
Sbjct  75   EMK---HDKDTYGEVFKSHNSIQTLDKAISNLEMELAAARATQESLRSG----APISDD  126



>gb|KJB13702.1| hypothetical protein B456_002G089700 [Gossypium raimondii]
Length=406

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 72/115 (63%), Gaps = 5/115 (4%)
 Frame = +2

Query  182  GRKKKAMMRSRHNAKVSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHR--RDQE  355
            G K K +  S   + V+ KW  L  I  F  GML+++R+W  PE+ +++++     +D+ 
Sbjct  2    GWKSKGL-ESNTKSFVTKKWTLLLCIGCFCAGMLFSDRMWTVPEAEDKVVSLETGIKDER  60

Query  356  LQVISEDCTTMKKPGQE--KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE  514
            L++++E C  ++K  +   K+++ EV KT  AIQ+LDK+IS L+MELA  R+ QE
Sbjct  61   LKLVTEGCDPIQKDVKRGSKNIVGEVSKTPNAIQTLDKTISNLEMELATARAMQE  115



>ref|XP_009137625.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-1,3-galactosyltransferase 
4 [Brassica rapa]
Length=411

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 58/96 (60%), Gaps = 5/96 (5%)
 Frame = +2

Query  227  VSAKWIPLFSIAFFFLGMLYTNRIWAPPESTNQLIAQHRRDQELQVISEDCTTMKKPGQE  406
            VS KW  L  I FF  G L+++R+W  PE+      +   D+ L ++SEDC + KK    
Sbjct  21   VSKKWTFLLCIGFFCAGTLFSDRMWPEPEANVASSREAASDERLLLMSEDCDSSKKTS--  78

Query  407  KDVMQEVYKTHEAIQSLDKSISMLKMELAATRSTQE  514
               + EVYK+ +A Q+LDK+IS L+MEL A R+ QE
Sbjct  79   ---LGEVYKSPDATQTLDKTISALEMELTAARAAQE  111



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920