BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF040J08

Length=517
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010246451.1|  PREDICTED: 60S ribosomal protein L11-like          291   2e-97   Nelumbo nucifera [Indian lotus]
ref|XP_010274422.1|  PREDICTED: 60S ribosomal protein L11               290   5e-97   Nelumbo nucifera [Indian lotus]
ref|XP_009383242.1|  PREDICTED: 60S ribosomal protein L11               290   5e-97   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP21119.1|  hypothetical protein JCGZ_21590                         290   6e-97   Jatropha curcas
ref|XP_009138940.1|  PREDICTED: 60S ribosomal protein L11-1-like        291   7e-97   Brassica rapa
ref|XP_002522234.1|  60S ribosomal protein L11, putative                290   7e-97   Ricinus communis
ref|NP_001266161.1|  60S ribosomal protein L11-like                     290   8e-97   Cicer arietinum [garbanzo]
gb|EYU29260.1|  hypothetical protein MIMGU_mgv1a014673mg                290   8e-97   Erythranthe guttata [common monkey flower]
ref|XP_011033383.1|  PREDICTED: 60S ribosomal protein L11-like          290   8e-97   Populus euphratica
ref|XP_002510391.1|  60S ribosomal protein L11, putative                290   9e-97   Ricinus communis
ref|XP_011039398.1|  PREDICTED: 60S ribosomal protein L11               290   9e-97   Populus euphratica
ref|XP_002309361.1|  60S ribosomal protein L11                          289   1e-96   Populus trichocarpa [western balsam poplar]
ref|XP_009629723.1|  PREDICTED: 60S ribosomal protein L11-1-like        289   1e-96   Nicotiana tomentosiformis
ref|XP_009132192.1|  PREDICTED: 60S ribosomal protein L11-2 isofo...    289   1e-96   Brassica rapa
ref|XP_006398262.1|  hypothetical protein EUTSA_v10001041mg             289   2e-96   Eutrema salsugineum [saltwater cress]
ref|XP_009628928.1|  PREDICTED: 60S ribosomal protein L11-1             289   2e-96   Nicotiana tomentosiformis
ref|XP_010529208.1|  PREDICTED: 60S ribosomal protein L11-1-like        289   2e-96   Tarenaya hassleriana [spider flower]
ref|NP_001237077.1|  uncharacterized protein LOC100499863               288   2e-96   Glycine max [soybeans]
ref|XP_007132813.1|  hypothetical protein PHAVU_011G126600g             288   2e-96   Phaseolus vulgaris [French bean]
emb|CDX71934.1|  BnaC08g29400D                                          291   2e-96   
ref|XP_009405599.1|  PREDICTED: 60S ribosomal protein L11-like is...    288   3e-96   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY26360.1|  BnaA02g24100D                                          290   3e-96   Brassica napus [oilseed rape]
ref|XP_009405598.1|  PREDICTED: 60S ribosomal protein L11-like is...    288   3e-96   
ref|XP_009408897.1|  PREDICTED: 60S ribosomal protein L11               288   3e-96   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006446820.1|  hypothetical protein CICLE_v10016875mg             288   3e-96   Citrus clementina [clementine]
sp|P46287.1|RL11_MEDSA  RecName: Full=60S ribosomal protein L11; ...    288   3e-96   Medicago sativa [alfalfa]
ref|XP_009404521.1|  PREDICTED: 60S ribosomal protein L11               288   3e-96   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004505457.1|  PREDICTED: 60S ribosomal protein L11-like          288   3e-96   
ref|XP_003540015.1|  PREDICTED: 60S ribosomal protein L11-like          288   3e-96   
ref|XP_007215050.1|  hypothetical protein PRUPE_ppa012119mg             288   4e-96   Prunus persica
ref|NP_001132260.1|  hypothetical protein                               288   4e-96   Zea mays [maize]
ref|XP_008786958.1|  PREDICTED: 60S ribosomal protein L11-like          288   5e-96   Phoenix dactylifera
ref|XP_006850965.1|  hypothetical protein AMTR_s00025p00203150          288   5e-96   Amborella trichopoda
ref|XP_010915478.1|  PREDICTED: 60S ribosomal protein L11-like          288   5e-96   Elaeis guineensis
ref|XP_010525185.1|  PREDICTED: 60S ribosomal protein L11-1             288   6e-96   Tarenaya hassleriana [spider flower]
gb|AFK48866.1|  unknown                                                 288   6e-96   Lotus japonicus
ref|XP_008381196.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    288   6e-96   Malus domestica [apple tree]
ref|NP_001242757.1|  uncharacterized protein LOC100778713               288   6e-96   Glycine max [soybeans]
ref|XP_006843688.1|  hypothetical protein AMTR_s00007p00200160          288   6e-96   Amborella trichopoda
gb|EYU41113.1|  hypothetical protein MIMGU_mgv1a014638mg                288   6e-96   Erythranthe guttata [common monkey flower]
ref|XP_009626014.1|  PREDICTED: 60S ribosomal protein L11-1-like        288   6e-96   Nicotiana tomentosiformis
ref|XP_009378940.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    288   6e-96   Pyrus x bretschneideri [bai li]
ref|XP_007148755.1|  hypothetical protein PHAVU_005G011400g             287   7e-96   Phaseolus vulgaris [French bean]
ref|XP_009790976.1|  PREDICTED: 60S ribosomal protein L11-1             287   7e-96   Nicotiana sylvestris
ref|XP_008225318.1|  PREDICTED: 60S ribosomal protein L11               287   7e-96   Prunus mume [ume]
ref|NP_850376.2|  60S ribosomal protein L16A                            287   7e-96   Arabidopsis thaliana [mouse-ear cress]
ref|NP_191429.1|  60S ribosomal protein L11-2                           287   7e-96   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010936718.1|  PREDICTED: 60S ribosomal protein L11               287   7e-96   Elaeis guineensis
gb|EYU21905.1|  hypothetical protein MIMGU_mgv1a014651mg                287   7e-96   Erythranthe guttata [common monkey flower]
ref|XP_008343092.1|  PREDICTED: 60S ribosomal protein L11-like is...    287   8e-96   
ref|XP_004134655.1|  PREDICTED: 60S ribosomal protein L11-1-like        287   8e-96   Cucumis sativus [cucumbers]
gb|KHN42782.1|  60S ribosomal protein L11                               287   8e-96   Glycine soja [wild soybean]
ref|XP_009403504.1|  PREDICTED: 60S ribosomal protein L11               287   8e-96   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK93207.1|  unknown                                                 287   8e-96   Populus trichocarpa [western balsam poplar]
gb|AFP44117.1|  60S ribosomal protein                                   287   9e-96   Lycoris longituba
emb|CDY49245.1|  BnaA09g55240D                                          290   9e-96   Brassica napus [oilseed rape]
ref|XP_006414065.1|  hypothetical protein EUTSA_v10026344mg             287   1e-95   Eutrema salsugineum [saltwater cress]
ref|XP_009132184.1|  PREDICTED: 60S ribosomal protein L11-2 isofo...    287   1e-95   Brassica rapa
ref|XP_006449533.1|  hypothetical protein CICLE_v10016873mg             287   1e-95   Citrus clementina [clementine]
emb|CDX99436.1|  BnaC01g11160D                                          287   1e-95   
gb|AFK37822.1|  unknown                                                 287   1e-95   Medicago truncatula
ref|XP_003628237.1|  60S ribosomal protein L11                          287   1e-95   Medicago truncatula
emb|CDX87764.1|  BnaC02g31850D                                          288   1e-95   
ref|XP_011081868.1|  PREDICTED: 60S ribosomal protein L11-like          286   1e-95   Sesamum indicum [beniseed]
ref|NP_001238636.1|  uncharacterized protein LOC100305912               286   1e-95   Glycine max [soybeans]
ref|XP_011088013.1|  PREDICTED: 60S ribosomal protein L11-like          286   2e-95   Sesamum indicum [beniseed]
ref|XP_010538574.1|  PREDICTED: 60S ribosomal protein L11-1-like ...    286   2e-95   Tarenaya hassleriana [spider flower]
ref|XP_010052179.1|  PREDICTED: 60S ribosomal protein L11-1             286   2e-95   Eucalyptus grandis [rose gum]
ref|XP_010538572.1|  PREDICTED: 60S ribosomal protein L11-1-like ...    286   2e-95   Tarenaya hassleriana [spider flower]
ref|XP_004293968.1|  PREDICTED: 60S ribosomal protein L11               286   2e-95   Fragaria vesca subsp. vesca
ref|NP_001149684.1|  60S ribosomal protein L11-1                        286   2e-95   Zea mays [maize]
ref|XP_011082984.1|  PREDICTED: 60S ribosomal protein L11               286   2e-95   Sesamum indicum [beniseed]
ref|XP_006578416.1|  PREDICTED: 60S ribosomal protein L11-like          286   2e-95   
ref|XP_010052848.1|  PREDICTED: 60S ribosomal protein L11-1             286   2e-95   Eucalyptus grandis [rose gum]
gb|AFK35020.1|  unknown                                                 286   2e-95   Lotus japonicus
emb|CAA57395.1|  ribosomal protein L16                                  286   2e-95   Arabidopsis thaliana [mouse-ear cress]
gb|KFK28544.1|  hypothetical protein AALP_AA7G010400                    286   2e-95   Arabis alpina [alpine rockcress]
gb|KHN01495.1|  60S ribosomal protein L11                               288   2e-95   Glycine soja [wild soybean]
gb|AFK38385.1|  unknown                                                 286   2e-95   Lotus japonicus
gb|KHG23956.1|  60S ribosomal L11-2 -like protein                       286   2e-95   Gossypium arboreum [tree cotton]
gb|AAR83867.1|  ribosomal protein L11-like protein                      286   3e-95   Capsicum annuum
ref|NP_001274979.1|  60S ribosomal protein L11-2-like                   286   3e-95   Solanum tuberosum [potatoes]
ref|XP_002451841.1|  hypothetical protein SORBIDRAFT_04g008530          286   3e-95   Sorghum bicolor [broomcorn]
ref|XP_009351472.1|  PREDICTED: 60S ribosomal protein L11               286   3e-95   Pyrus x bretschneideri [bai li]
ref|XP_008228941.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    286   3e-95   Prunus mume [ume]
ref|XP_010052835.1|  PREDICTED: 60S ribosomal protein L11-1-like        286   3e-95   Eucalyptus grandis [rose gum]
ref|XP_009365286.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    286   3e-95   Pyrus x bretschneideri [bai li]
gb|KJB57391.1|  hypothetical protein B456_009G161300                    286   4e-95   Gossypium raimondii
gb|KHG08920.1|  60S ribosomal L11-1 -like protein                       286   4e-95   Gossypium arboreum [tree cotton]
ref|XP_002880003.1|  60S ribosomal protein L11                          285   4e-95   Arabidopsis lyrata subsp. lyrata
emb|CAA57394.1|  ribosomal protein L16                                  285   4e-95   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009378939.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    285   4e-95   Pyrus x bretschneideri [bai li]
ref|XP_008345917.1|  PREDICTED: 60S ribosomal protein L11               285   4e-95   Malus domestica [apple tree]
ref|XP_008381195.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    285   4e-95   Malus domestica [apple tree]
ref|XP_008443441.1|  PREDICTED: 60S ribosomal protein L11-1             285   5e-95   Cucumis melo [Oriental melon]
ref|XP_002876475.1|  60S ribosomal protein L11                          285   5e-95   
gb|KDO77896.1|  hypothetical protein CISIN_1g029665mg                   286   5e-95   Citrus sinensis [apfelsine]
gb|KHN27796.1|  60S ribosomal protein L11                               285   5e-95   Glycine soja [wild soybean]
ref|XP_010427776.1|  PREDICTED: 60S ribosomal protein L11-1-like        285   5e-95   Camelina sativa [gold-of-pleasure]
ref|XP_002281886.1|  PREDICTED: 60S ribosomal protein L11               285   5e-95   Vitis vinifera
ref|XP_008362518.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    285   5e-95   
ref|XP_008343091.1|  PREDICTED: 60S ribosomal protein L11-like is...    285   5e-95   
ref|XP_006285819.1|  hypothetical protein CARUB_v10007309mg             285   5e-95   Capsella rubella
gb|AFW65990.1|  hypothetical protein ZEAMMB73_747842                    285   6e-95   
pir||T04865  ribosomal protein L11, cytosolic - Arabidopsis thaliana    285   6e-95   Arabidopsis thaliana [mouse-ear cress]
gb|ABK22492.1|  unknown                                                 285   6e-95   Picea sitchensis
ref|XP_009116550.1|  PREDICTED: 60S ribosomal protein L11-1             285   7e-95   Brassica rapa
ref|NP_001046386.1|  Os02g0235600                                       285   7e-95   
gb|ACJ86159.1|  unknown                                                 285   8e-95   Medicago truncatula
ref|NP_001132427.1|  60S ribosomal protein L11-1                        285   9e-95   Zea mays [maize]
ref|XP_007025337.1|  Ribosomal protein large subunit 16A                287   9e-95   
ref|XP_008366039.1|  PREDICTED: 60S ribosomal protein L11-1             285   9e-95   Malus domestica [apple tree]
ref|XP_004976770.1|  PREDICTED: 60S ribosomal protein L11-like          285   9e-95   Setaria italica
ref|XP_010689742.1|  PREDICTED: 60S ribosomal protein L11-1 isofo...    285   9e-95   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003598139.1|  60S ribosomal protein L11                          285   1e-94   Medicago truncatula
ref|XP_007048733.1|  Ribosomal L5P family protein isoform 1             284   1e-94   Theobroma cacao [chocolate]
ref|NP_001148395.1|  LOC100282010                                       284   1e-94   Zea mays [maize]
ref|XP_007214493.1|  hypothetical protein PRUPE_ppa020372mg             288   1e-94   
gb|ADE77225.1|  unknown                                                 284   2e-94   Picea sitchensis
ref|XP_008782472.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    284   2e-94   Phoenix dactylifera
ref|XP_004133952.1|  PREDICTED: 60S ribosomal protein L11-2-like ...    284   2e-94   Cucumis sativus [cucumbers]
ref|XP_003607648.1|  60S ribosomal protein L11-1                        283   2e-94   Medicago truncatula
ref|NP_001131414.1|  uncharacterized protein LOC100192743               283   2e-94   Zea mays [maize]
gb|ACG31637.1|  60S ribosomal protein L11-1                             283   2e-94   Zea mays [maize]
ref|XP_008790022.1|  PREDICTED: 60S ribosomal protein L11-like          283   3e-94   Phoenix dactylifera
ref|XP_002454974.1|  hypothetical protein SORBIDRAFT_03g002420          283   3e-94   
ref|XP_006654147.1|  PREDICTED: 60S ribosomal protein L11-like          283   3e-94   Oryza brachyantha
ref|XP_009365285.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    283   3e-94   Pyrus x bretschneideri [bai li]
ref|XP_008362517.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    283   4e-94   
ref|XP_004968572.1|  PREDICTED: 60S ribosomal protein L11-like          282   6e-94   Setaria italica
ref|XP_010689741.1|  PREDICTED: 60S ribosomal protein L11-1 isofo...    282   7e-94   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006643887.1|  PREDICTED: 60S ribosomal protein L11-like          282   9e-94   Oryza brachyantha
ref|NP_001054899.1|  Os05g0207300                                       282   1e-93   
ref|XP_004133951.1|  PREDICTED: 60S ribosomal protein L11-2-like ...    282   1e-93   Cucumis sativus [cucumbers]
gb|ABR25412.1|  60S ribosomal protein l11                               280   2e-93   Oryza sativa Indica Group [Indian rice]
ref|XP_010940061.1|  PREDICTED: 60S ribosomal protein L11-like          281   2e-93   Elaeis guineensis
ref|NP_001042339.1|  Os01g0205500                                       281   2e-93   
gb|KHG13747.1|  60S ribosomal L11-1 -like protein                       281   2e-93   Gossypium arboreum [tree cotton]
ref|XP_002270266.1|  PREDICTED: 60S ribosomal protein L11-1-like        281   2e-93   Vitis vinifera
ref|XP_010102117.1|  60S ribosomal protein L11-2                        281   3e-93   
ref|XP_001759707.1|  predicted protein                                  280   4e-93   
gb|ADY38658.1|  putative 60S ribosomal protein L11                      280   5e-93   Wolffia arrhiza
ref|XP_008795915.1|  PREDICTED: 60S ribosomal protein L11-like          279   9e-93   Phoenix dactylifera
ref|XP_001762314.1|  predicted protein                                  279   2e-92   
gb|AAT08727.1|  60S ribosomal protein L11                               279   2e-92   Hyacinthus orientalis [common hyacinth]
ref|XP_006648487.1|  PREDICTED: 60S ribosomal protein L11-like          278   3e-92   Oryza brachyantha
ref|XP_001760204.1|  predicted protein                                  277   6e-92   
ref|XP_003565263.1|  PREDICTED: 60S ribosomal protein L11               277   7e-92   Brachypodium distachyon [annual false brome]
gb|EMS61347.1|  60S ribosomal protein L11                               276   2e-91   Triticum urartu
gb|KHN20558.1|  Endoglucanase 9                                         291   3e-91   Glycine soja [wild soybean]
ref|XP_002981065.1|  hypothetical protein SELMODRAFT_444767             274   1e-90   Selaginella moellendorffii
dbj|BAJ85332.1|  predicted protein                                      274   1e-90   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHG21292.1|  60S ribosomal protein L11-1                             275   2e-90   Gossypium arboreum [tree cotton]
gb|KHG21293.1|  60S ribosomal protein L11-1                             274   2e-90   Gossypium arboreum [tree cotton]
pdb|3J61|J  Chain J, Localization Of The Large Subunit Ribosomal ...    273   2e-90   Triticum aestivum [Canadian hard winter wheat]
emb|CDY60533.1|  BnaAnng16950D                                          270   3e-89   Brassica napus [oilseed rape]
emb|CDY62552.1|  BnaA03g58370D                                          270   3e-89   Brassica napus [oilseed rape]
gb|EMS66091.1|  60S ribosomal protein L11                               271   5e-89   Triticum urartu
gb|ACN35575.1|  unknown                                                 270   6e-89   Zea mays [maize]
gb|KHN11195.1|  60S ribosomal protein L11                               269   6e-89   Glycine soja [wild soybean]
emb|CDP15952.1|  unnamed protein product                                269   9e-89   Coffea canephora [robusta coffee]
ref|XP_010516520.1|  PREDICTED: 60S ribosomal protein L11-1-like        268   2e-88   Camelina sativa [gold-of-pleasure]
ref|NP_851137.1|  60S ribosomal protein L11-2                           268   2e-88   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA52967.1|  TPA: hypothetical protein ZEAMMB73_694767              286   4e-88   
gb|ACD56663.1|  putative ribosomal protein                              267   5e-88   Gossypium arboreum [tree cotton]
gb|AAT64021.1|  putative ribosomal protein                              267   6e-88   Gossypium hirsutum [American cotton]
gb|KJB34908.1|  hypothetical protein B456_006G089700                    267   7e-88   Gossypium raimondii
ref|XP_007048734.1|  Ribosomal L5P family protein isoform 2             267   7e-88   Theobroma cacao [chocolate]
emb|CBI22012.3|  unnamed protein product                                266   9e-88   Vitis vinifera
ref|XP_002438544.1|  hypothetical protein SORBIDRAFT_10g021710          267   1e-87   
ref|XP_006656151.1|  PREDICTED: 60S ribosomal protein L11-like          265   2e-87   
ref|XP_001751962.1|  predicted protein                                  265   5e-87   
emb|CBI30709.3|  unnamed protein product                                264   8e-87   Vitis vinifera
gb|ADR71243.1|  60S ribosomal protein L11A                              263   2e-86   Hevea brasiliensis [jebe]
gb|AAB82139.1|  ribosomal protein                                       263   3e-86   Oryza sativa Indica Group [Indian rice]
gb|AAD21733.1|  60S ribosomal protein L11B                              259   1e-84   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD53703.1|  putative 60S ribosomal protein L11-1                   257   7e-84   Oryza sativa Japonica Group [Japonica rice]
gb|AAQ96376.1|  ribosomal protein L11-like protein                      254   3e-83   Solanum palustre
gb|KHN28096.1|  60S ribosomal protein L11                               253   1e-82   Glycine soja [wild soybean]
gb|KDD76069.1|  hypothetical protein H632_c370p1                        248   2e-80   Helicosporidium sp. ATCC 50920
ref|XP_011397124.1|  60S ribosomal protein L11-1                        247   3e-80   Auxenochlorella protothecoides
emb|CBJ30107.1|  conserved unknown protein                              246   1e-79   Ectocarpus siliculosus
ref|XP_009617442.1|  PREDICTED: 60S ribosomal protein L11-1-like        246   1e-79   Nicotiana tomentosiformis
ref|XP_005647682.1|  ribosomal protein L5                               244   6e-79   Coccomyxa subellipsoidea C-169
gb|KIY97763.1|  60S ribosomal protein L11                               243   2e-78   Monoraphidium neglectum
gb|KHN95345.1|  60S ribosomal protein L11                               240   3e-77   Metarhizium album ARSEF 1941
ref|NP_595899.1|  60S ribosomal protein L11                             239   4e-77   Schizosaccharomyces pombe
ref|XP_009261766.1|  hypothetical protein FPSE_10374                    239   4e-77   Fusarium pseudograminearum CS3096
gb|KJB57390.1|  hypothetical protein B456_009G161300                    239   4e-77   Gossypium raimondii
emb|CCE35354.1|  probable ribosomal protein L11.e.A, cytosolic          239   4e-77   Claviceps purpurea 20.1
gb|KFA66324.1|  hypothetical protein S40285_01884                       239   4e-77   Stachybotrys chlorohalonata IBT 40285
gb|EQL04255.1|  Ribosomal protein L5                                    239   5e-77   Ophiocordyceps sinensis CO18
gb|EGU80777.1|  hypothetical protein FOXB_08644                         239   5e-77   Fusarium oxysporum Fo5176
gb|KDB13460.1|  60S ribosomal protein L11                               239   5e-77   Ustilaginoidea virens
gb|KFA73465.1|  hypothetical protein S40288_08466                       239   6e-77   Stachybotrys chartarum IBT 40288
ref|XP_007811586.1|  60S ribosomal protein L11                          239   7e-77   Metarhizium acridum CQMa 102
gb|AFW65989.1|  hypothetical protein ZEAMMB73_747842                    237   8e-77   
emb|CCE35372.1|  probable ribosomal protein L11.e.A, cytosolic          238   1e-76   Claviceps purpurea 20.1
gb|KEY71076.1|  hypothetical protein S7711_00899                        238   1e-76   Stachybotrys chartarum IBT 7711
gb|EPX72141.1|  60S ribosomal protein L11                               238   2e-76   Schizosaccharomyces octosporus yFS286
gb|KID77365.1|  Ribosomal protein L5                                    238   2e-76   Metarhizium brunneum ARSEF 3297
gb|EPY52057.1|  60S ribosomal protein L11                               238   2e-76   Schizosaccharomyces cryophilus OY26
gb|EPY49528.1|  60S ribosomal protein L11                               237   2e-76   Schizosaccharomyces cryophilus OY26
ref|XP_003628238.1|  60S ribosomal protein L11                          235   3e-76   
emb|CCI45988.1|  unnamed protein product                                237   3e-76   Albugo candida
ref|XP_006963013.1|  60S ribosomal protein L11, L5 family               237   4e-76   Trichoderma reesei QM6a
gb|KIL95260.1|  hypothetical protein FAVG1_02195                        237   4e-76   Fusarium avenaceum
gb|EHK17585.1|  hypothetical protein TRIVIDRAFT_76021                   237   5e-76   Trichoderma virens Gv29-8
ref|XP_003054198.1|  60S ribosomal protein L11                          236   5e-76   [Nectria] haematococca mpVI 77-13-4
gb|ACN26136.1|  unknown                                                 236   6e-76   Zea mays [maize]
ref|XP_002173490.1|  60S ribosomal protein L11                          236   6e-76   Schizosaccharomyces japonicus yFS275
ref|XP_002171744.1|  60S ribosomal protein L11                          236   6e-76   Schizosaccharomyces japonicus yFS275
gb|EHK50062.1|  hypothetical protein TRIATDRAFT_297405                  236   8e-76   Trichoderma atroviride IMI 206040
emb|CDS05445.1|  Putative 60S ribosomal protein L11                     236   8e-76   Lichtheimia ramosa
ref|XP_003302643.1|  60S ribosomal protein L11                          236   9e-76   
ref|XP_001939101.1|  60S ribosomal protein L11                          236   9e-76   Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_008593474.1|  60S ribosomal protein L11                          236   1e-75   Beauveria bassiana ARSEF 2860
ref|XP_001794114.1|  hypothetical protein SNOG_03556                    236   1e-75   Parastagonospora nodorum SN15
ref|XP_007702064.1|  hypothetical protein COCSADRAFT_28532              236   1e-75   Bipolaris sorokiniana ND90Pr
emb|CDH52194.1|  60s ribosomal protein l11                              236   1e-75   Lichtheimia corymbifera JMRC:FSU:9682
gb|KIN04023.1|  hypothetical protein OIDMADRAFT_51953                   235   1e-75   Oidiodendron maius Zn
ref|XP_002507327.1|  ribosomal protein L11                              235   2e-75   Micromonas commoda
ref|XP_007688169.1|  hypothetical protein COCMIDRAFT_5484               235   2e-75   Bipolaris oryzae ATCC 44560
emb|CEF97266.1|  Ribosomal protein L5, conserved site                   235   2e-75   Ostreococcus tauri
ref|XP_006697554.1|  putative ribosomal protein                         235   2e-75   Chaetomium thermophilum var. thermophilum DSM 1495
emb|CDS03126.1|  Putative 60S ribosomal protein L11                     234   3e-75   Lichtheimia ramosa
ref|XP_007874680.1|  hypothetical protein PNEG_02659                    234   3e-75   Pneumocystis murina B123
emb|CDH51840.1|  60s ribosomal protein l11                              234   4e-75   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_008031258.1|  hypothetical protein SETTUDRAFT_35885              234   4e-75   Exserohilum turcica Et28A
ref|XP_004220956.1|  60S ribosomal protein L11                          234   5e-75   Plasmodium cynomolgi strain B
ref|XP_007828704.1|  60S ribosomal protein L11                          234   6e-75   Pestalotiopsis fici W106-1
gb|KEQ81180.1|  60S ribosomal protein L11                               234   7e-75   Aureobasidium pullulans EXF-150
ref|XP_007511979.1|  60S ribosomal protein L11                          233   7e-75   Bathycoccus prasinos
gb|KHJ31708.1|  putative 60s ribosomal protein l11                      234   7e-75   Erysiphe necator
gb|KEQ70785.1|  60S ribosomal protein L11                               234   7e-75   Aureobasidium namibiae CBS 147.97
emb|CCX16540.1|  Similar to 60S ribosomal protein L11; acc. no. Q...    234   8e-75   Pyronema omphalodes CBS 100304
ref|XP_003712966.1|  60S ribosomal protein L11                          233   8e-75   Magnaporthe oryzae 70-15
ref|XP_003351085.1|  60S ribosomal protein L11                          233   8e-75   Sordaria macrospora k-hell
ref|XP_965640.2|  60S ribosomal protein L11                             233   9e-75   Neurospora crassa OR74A
ref|XP_008912007.1|  60S ribosomal protein L11                          233   9e-75   Phytophthora parasitica INRA-310
gb|AFW81632.1|  hypothetical protein ZEAMMB73_719378                    231   1e-74   
ref|XP_003652525.1|  60S ribosomal protein L11                          233   1e-74   Thielavia terrestris NRRL 8126
gb|KEQ63433.1|  ribosomal protein L5                                    233   1e-74   Aureobasidium melanogenum CBS 110374
ref|XP_003833556.1|  similar to 60s ribosomal protein l11               233   1e-74   Leptosphaeria maculans JN3
gb|EHL03348.1|  putative 60S ribosomal protein L11                      233   1e-74   Glarea lozoyensis 74030
ref|XP_001553621.1|  60S ribosomal protein L11                          233   1e-74   Botrytis cinerea B05.10
ref|XP_006671375.1|  60S ribosomal protein L11                          233   2e-74   Cordyceps militaris CM01
ref|XP_008083348.1|  Ribosomal protein L5                               233   2e-74   Glarea lozoyensis ATCC 20868
ref|XP_007290432.1|  60S ribosomal protein L11                          233   2e-74   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gb|EJW85444.1|  60S ribosomal protein L11                               233   2e-74   Wuchereria bancrofti [agent of lymphatic filariasis]
gb|KEZ44553.1|  hypothetical protein SAPIO_CDS3581                      233   2e-74   Scedosporium apiospermum
ref|XP_007400955.1|  hypothetical protein PHACADRAFT_264100             233   2e-74   Phanerochaete carnosa HHB-10118-sp
gb|KCW89659.1|  hypothetical protein EUGRSUZ_A01929                     232   2e-74   Eucalyptus grandis [rose gum]
tpg|DAA52965.1|  TPA: hypothetical protein ZEAMMB73_694767              230   2e-74   
gb|AAF13719.1|AF201080_1  ribosomal protein L11                         232   3e-74   Schizosaccharomyces pombe
ref|XP_001892371.1|  60S ribosomal protein L11                          233   3e-74   Brugia malayi [agent of lymphatic filariasis]
gb|KEQ91782.1|  hypothetical protein AUEXF2481DRAFT_452160              233   3e-74   Aureobasidium subglaciale EXF-2481
ref|XP_007406729.1|  hypothetical protein MELLADRAFT_103715             233   3e-74   Melampsora larici-populina 98AG31
ref|XP_003054830.1|  predicted protein                                  232   3e-74   Micromonas pusilla CCMP1545
emb|CCF73368.1|  unnamed protein product                                232   3e-74   Babesia microti strain RI
ref|XP_007780322.1|  60S ribosomal protein L11                          233   3e-74   Coniosporium apollinis CBS 100218
ref|XP_003138893.1|  60S ribosomal protein L11                          233   3e-74   Loa loa
ref|XP_007785480.1|  60S ribosomal protein L11                          232   3e-74   Endocarpon pusillum Z07020
gb|EPQ65884.1|  Protein component of the large (60S) ribosomal su...    232   3e-74   Blumeria graminis f. sp. tritici 96224
ref|XP_008782473.1|  PREDICTED: 60S ribosomal protein L11-1 isofo...    231   3e-74   
emb|CEJ90763.1|  Putative 60S ribosomal protein L11                     232   3e-74   Torrubiella hemipterigena
emb|CEI93245.1|  Putative 60S ribosomal protein L11                     232   4e-74   Rhizopus microsporus
emb|CEG66561.1|  Putative 60S ribosomal protein L11                     232   4e-74   Rhizopus microsporus
gb|ADV17698.1|  60S ribosomal protein L11                               232   4e-74   Monascus purpureus
ref|XP_002184288.1|  predicted protein                                  232   4e-74   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_003645143.1|  hypothetical protein Ecym_2613                     232   4e-74   Eremothecium cymbalariae DBVPG#7215
gb|EMF09861.1|  60S ribosomal protein L11                               232   4e-74   Sphaerulina musiva SO2202
ref|XP_009152279.1|  60S ribosomal protein L11                          231   5e-74   Exophiala dermatitidis NIH/UT8656
dbj|GAM83435.1|  hypothetical protein ANO11243_014230                   231   5e-74   fungal sp. No.11243
ref|XP_007720703.1|  60S ribosomal protein L11                          231   5e-74   Capronia coronata CBS 617.96
gb|KIX00150.1|  60S ribosomal protein L11                               231   5e-74   Rhinocladiella mackenziei CBS 650.93
ref|XP_001586298.1|  60S ribosomal protein L11                          231   6e-74   Sclerotinia sclerotiorum 1980 UF-70
gb|KIW01718.1|  60S ribosomal protein L11                               231   6e-74   Verruconis gallopava
ref|XP_662079.1|  hypothetical protein AN4475.2                         231   7e-74   Aspergillus nidulans FGSC A4
emb|CEP61537.1|  LALA0S03e05072g1_1                                     231   7e-74   
gb|EKG14783.1|  Ribosomal protein L5                                    231   7e-74   
emb|CDX98322.1|  BnaC06g16830D                                          230   7e-74   
ref|XP_007917396.1|  putative 60s ribosomal protein l11 protein         231   7e-74   
ref|XP_009840198.1|  60S ribosomal protein L11                          231   7e-74   
gb|EAY96929.1|  hypothetical protein OsI_18847                          229   9e-74   
gb|KIH94018.1|  large subunit ribosomal protein L11e                    231   1e-73   
ref|XP_007929171.1|  hypothetical protein MYCFIDRAFT_211970             231   1e-73   
gb|KHN25831.1|  60S ribosomal protein L11                               230   1e-73   
gb|ERS98976.1|  60S ribosomal protein L11                               231   1e-73   
dbj|BAO38797.1|  60S ribosomal protein L11                              231   1e-73   
ref|XP_008614451.1|  60S ribosomal protein L11                          230   1e-73   
ref|XP_008718904.1|  60S ribosomal protein L11                          231   1e-73   
ref|XP_002289769.1|  RL11A, ribosomal protein 11A 60S large ribos...    231   1e-73   
ref|XP_007864974.1|  ribosomal protein L5                               230   1e-73   
ref|XP_001239964.1|  60S ribosomal protein L11                          230   1e-73   
emb|CEG73597.1|  Putative 60S ribosomal protein L11                     231   1e-73   
ref|XP_010759725.1|  60S ribosomal protein L11                          230   1e-73   
ref|XP_008722843.1|  60S ribosomal protein L11                          230   1e-73   
emb|CEJ04024.1|  Putative 60S ribosomal protein L11                     231   1e-73   
emb|CEI94092.1|  Putative 60S ribosomal protein L11                     231   1e-73   
ref|XP_002496405.1|  60S ribosomal protein L11                          230   2e-73   
ref|XP_003674082.1|  hypothetical protein NCAS_0A11430                  230   2e-73   
ref|XP_001644957.1|  hypothetical protein Kpol_1025p19                  230   2e-73   
gb|AGO10224.1|  AaceriAEL325Wp                                          230   2e-73   
gb|EAS28381.3|  60S ribosomal protein L11                               232   2e-73   
ref|XP_003118254.1|  CRE-RPL-11.2 protein                               231   2e-73   
ref|NP_984535.1|  60S ribosomal protein L11                             230   2e-73   
ref|XP_008868808.1|  60S ribosomal protein L11                          230   2e-73   
gb|EEH19181.2|  60S ribosomal protein L11                               230   2e-73   
gb|EYB99481.1|  hypothetical protein Y032_0122g1072                     231   2e-73   
emb|CDS14192.1|  Putative 60S ribosomal protein L11                     230   2e-73   
gb|KIX93314.1|  60S ribosomal protein L11                               230   2e-73   
ref|XP_003320143.2|  60S ribosomal protein L11                          230   2e-73   
gb|KDN52293.1|  putative RPL11B-ribosomal protein L11                   230   2e-73   
gb|ESZ98896.1|  60S ribosomal protein L11                               230   2e-73   
ref|XP_002364229.1|  ribosomal protein L11, putative                    230   2e-73   
ref|XP_003957203.1|  hypothetical protein KAFR_0D04200                  230   2e-73   
gb|KIW72643.1|  60S ribosomal protein L11                               230   2e-73   
gb|EPS30697.1|  hypothetical protein PDE_05649                          230   3e-73   
ref|XP_001540391.1|  60S ribosomal protein L11                          231   3e-73   
ref|NP_508413.1|  Protein RPL-11.2                                      230   3e-73   
ref|XP_002485190.1|  60S ribosomal protein L11                          229   3e-73   
gb|EEH37803.2|  ribosomal protein 11 large subunit                      229   3e-73   
emb|CAL00699.1|  unnamed protein product                                229   3e-73   
gb|EME39538.1|  hypothetical protein DOTSEDRAFT_75263                   230   3e-73   
dbj|GAM40478.1|  60S ribosomal protein                                  229   3e-73   
ref|XP_001401580.2|  60S ribosomal protein L11                          229   3e-73   
ref|XP_002148988.1|  60S ribosomal protein L11                          229   3e-73   
ref|XP_007753389.1|  60S ribosomal protein L11                          229   3e-73   
dbj|GAD96427.1|  60S ribosomal protein L11                              229   4e-73   
ref|XP_007750616.1|  60S ribosomal protein L11                          229   4e-73   
gb|AIU94837.1|  60S ribosomal protein                                   229   4e-73   
gb|EEH10656.1|  60S ribosomal protein L11                               229   4e-73   
gb|KIW96569.1|  60S ribosomal protein L11                               229   4e-73   
ref|XP_455455.1|  60S ribosomal protein L11                             229   4e-73   
ref|XP_007593026.1|  ribosomal L5P family protein                       229   5e-73   
dbj|BAE59301.1|  unnamed protein product                                229   5e-73   
ref|XP_011390568.1|  ribosomal 60S subunit protein L11                  229   5e-73   
ref|XP_007002598.1|  hypothetical protein TREMEDRAFT_56289              229   6e-73   
ref|XP_002377078.1|  60S ribosomal protein L11                          229   6e-73   
ref|XP_002844175.1|  60S ribosomal protein L11                          229   6e-73   
ref|XP_009225446.1|  60S ribosomal protein L11                          229   6e-73   
ref|XP_010244733.1|  PREDICTED: 60S ribosomal protein L11-1-like        229   7e-73   
emb|CCF48921.1|  probable RPL11B-ribosomal protein L11                  229   7e-73   
emb|CBQ68706.1|  probable RPL11B-ribosomal protein L11                  229   7e-73   
ref|XP_679576.1|  60S ribosomal protein L11a                            229   7e-73   
gb|EST04658.1|  60S ribosomal protein L11                               229   7e-73   
ref|XP_003012832.1|  hypothetical protein ARB_01083                     229   7e-73   
gb|EGT30223.1|  CBN-RPL-11.2 protein                                    229   8e-73   
tpe|CAL69062.1|  TPA: putative 60S ribosomal protein L11                229   8e-73   
ref|XP_003884996.1|  hypothetical protein NCLIV_053950                  228   8e-73   
gb|EXX73498.1|  ribosomal 60S subunit protein L11B                      229   8e-73   
ref|XP_003598138.1|  60S ribosomal protein L11-1                        231   8e-73   
ref|XP_008034672.1|  60S ribosomal protein L11                          228   9e-73   
gb|KIH67504.1|  ribosomal protein L5                                    229   9e-73   
gb|EPE06992.1|  60s ribosomal protein l11                               228   9e-73   
gb|EGD96677.1|  60S ribosomal protein                                   228   9e-73   
gb|EWC43909.1|  60S ribosomal protein L11                               228   9e-73   
ref|XP_002627177.1|  60S ribosomal protein L11                          228   1e-72   
ref|XP_003033464.1|  60S ribosomal protein L11                          228   1e-72   
ref|XP_001267248.1|  60S ribosomal protein L11                          228   1e-72   
ref|XP_752052.1|  60S ribosomal protein L11                             228   1e-72   
emb|CDH53106.1|  60s ribosomal protein l11                              228   1e-72   
emb|CCF38017.1|  60S ribosomal protein L11                              228   1e-72   
ref|XP_001271667.1|  60S ribosomal protein L11                          228   1e-72   
ref|XP_003850717.1|  60S ribosomal protein L11                          228   1e-72   
gb|EJK69051.1|  hypothetical protein THAOC_09733                        228   1e-72   
ref|XP_005988804.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    228   1e-72   
gb|EFQ31302.1|  ribosomal L5P family protein                            228   1e-72   
gb|KIW30639.1|  60S ribosomal protein L11                               228   1e-72   
ref|XP_007388899.1|  ribosomal protein L5                               228   1e-72   
ref|XP_004678660.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    228   2e-72   
ref|XP_004603489.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    228   2e-72   
ref|XP_011105931.1|  rpl11ap                                            228   2e-72   
gb|EFW99822.1|  60S ribosomal protein l11                               228   2e-72   
ref|XP_011103550.1|  rpl11bp                                            228   2e-72   
ref|XP_007794242.1|  putative 60s ribosomal protein l11 protein         227   2e-72   
ref|XP_002494107.1|  60S ribosomal protein L11                          228   2e-72   
gb|EYB99416.1|  hypothetical protein Y032_0122g1039                     228   2e-72   
ref|XP_446440.1|  60S ribosomal protein L11                             228   2e-72   
ref|XP_008625536.1|  60S ribosomal protein L11                          227   2e-72   
gb|EQB50817.1|  hypothetical protein CGLO_09710                         227   2e-72   
gb|KDQ26554.1|  hypothetical protein PLEOSDRAFT_1089796                 227   2e-72   
gb|AAX42399.1|  ribosomal protein L11                                   227   2e-72   
ref|XP_002554669.1|  KLTH0F10758p                                       231   2e-72   
emb|CDI54801.1|  probable RPL11B-ribosomal protein L11                  227   2e-72   
ref|XP_001612822.1|  60S ribosomal protein L11                          227   2e-72   
emb|CDF89694.1|  ZYBA0S04-10396g1_1                                     227   2e-72   
pdb|1S1I|J  Chain J, Structure Of The Ribosomal 80s-Eef2-Sordarin...    227   2e-72   
ref|NP_015427.1|  ribosomal 60S subunit protein L11A                    227   2e-72   
ref|NP_011599.1|  ribosomal 60S subunit protein L11B                    227   3e-72   
gb|KIP07125.1|  hypothetical protein PHLGIDRAFT_89957                   227   3e-72   
pdb|3JYW|J  Chain J, Structure Of The 60s Proteins For Eukaryotic...    226   3e-72   
gb|ADV03013.1|  ribosomal protein L11                                   227   3e-72   
ref|XP_006179217.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    227   3e-72   
emb|CEL61856.1|  60S ribosomal protein L11 OS=Ashbya gossypii (st...    227   3e-72   
pdb|4UJG|M  Chain M, Crystal Structure Of Narciclasine Bound To T...    227   3e-72   
ref|XP_003005415.1|  60S ribosomal protein L11                          227   3e-72   
gb|AAX29834.1|  ribosomal protein L11                                   227   3e-72   
gb|KIY49927.1|  ribosomal protein L5                                    228   3e-72   
ref|NP_001087287.1|  ribosomal protein L11                              227   3e-72   
gb|KDQ61798.1|  hypothetical protein JAAARDRAFT_150757                  227   3e-72   
ref|NP_001186731.1|  60S ribosomal protein L11 isoform 2                227   3e-72   
gb|KEY76069.1|  60S ribosomal protein L11                               227   3e-72   
gb|KIH42491.1|  ribosomal protein L5                                    227   3e-72   
ref|XP_009039589.1|  hypothetical protein AURANDRAFT_38382              226   4e-72   
emb|CDR45007.1|  CYFA0S16e01068g1_1                                     227   4e-72   
ref|XP_004357945.1|  S60 ribosomal protein L11                          227   4e-72   
ref|NP_001016640.1|  ribosomal protein L11                              227   4e-72   
ref|XP_005955884.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    227   4e-72   
dbj|GAA95328.1|  hypothetical protein E5Q_01985                         227   4e-72   
ref|NP_001002139.1|  60S ribosomal protein L11                          227   4e-72   
ref|XP_765879.1|  60S ribosomal protein L11a                            226   4e-72   
gb|KIJ20995.1|  hypothetical protein PAXINDRAFT_165800                  227   4e-72   
ref|XP_006862372.1|  PREDICTED: 60S ribosomal protein L11               227   4e-72   
ref|XP_009689157.1|  60S ribosomal protein L11a                         226   4e-72   
gb|KIM90306.1|  hypothetical protein PILCRDRAFT_812047                  226   4e-72   
ref|XP_954382.1|  60S ribosomal protein l11a                            226   5e-72   
gb|ETN75273.1|  ribosomal protein L5                                    227   5e-72   
gb|ESW98729.1|  60S ribosomal protein L11                               226   5e-72   
gb|ESA11406.1|  hypothetical protein GLOINDRAFT_190897                  226   5e-72   
gb|EYE94898.1|  60S ribosomal protein L11                               226   5e-72   
emb|CCJ29398.1|  unnamed protein product                                227   6e-72   
ref|XP_007854285.1|  60s ribosomal protein l11                          226   6e-72   
gb|KIL69083.1|  hypothetical protein M378DRAFT_157314                   226   6e-72   
gb|KDE08212.1|  60S ribosomal protein L11-B                             226   6e-72   
gb|KFY53999.1|  hypothetical protein V496_07354                         226   6e-72   
ref|XP_003680653.1|  60S ribosomal protein L11                          226   7e-72   
emb|CDW52299.1|  60S ribosomal protein L11                              227   7e-72   
ref|XP_003688183.1|  60S ribosomal protein L11                          226   7e-72   
ref|XP_007327511.1|  hypothetical protein AGABI1DRAFT_83116             226   7e-72   
emb|CAA25515.1|  unnamed protein product                                226   7e-72   
gb|KFY86046.1|  hypothetical protein V500_07912                         226   7e-72   
ref|XP_002261116.1|  60S ribosomal protein L11a                         226   7e-72   
gb|KDQ09779.1|  hypothetical protein BOTBODRAFT_137460                  226   7e-72   
gb|KIK82563.1|  hypothetical protein PAXRUDRAFT_710603                  226   8e-72   
ref|XP_003667885.1|  ribosomal protein L11                              226   8e-72   
ref|XP_001214608.1|  60S ribosomal protein L11                          226   8e-72   
gb|ENH88644.1|  60s ribosomal protein l11                               226   8e-72   
ref|XP_002471021.1|  60S ribosomal protein L11                          226   8e-72   
gb|EPT02960.1|  hypothetical protein FOMPIDRAFT_1159520                 226   8e-72   
gb|KFY30901.1|  hypothetical protein V493_01569                         226   9e-72   
gb|KIO10677.1|  hypothetical protein M404DRAFT_995159                   226   9e-72   
ref|XP_001416745.1|  Ribosomal protein L11, component of cytosoli...    226   9e-72   
gb|KIJ55455.1|  hypothetical protein M422DRAFT_41410                    226   9e-72   
ref|XP_007310512.1|  60S ribosomal protein L11                          226   9e-72   
gb|EJU03624.1|  60S ribosomal protein L11                               226   1e-71   
gb|ELR06252.1|  60S ribosomal protein L11                               226   1e-71   
ref|XP_500914.2|  60S ribosomal protein L11                             226   1e-71   
ref|XP_005941012.1|  PREDICTED: 60S ribosomal protein L11-like is...    226   1e-71   
gb|KFY77544.1|  hypothetical protein V499_03103                         226   1e-71   
ref|NP_504008.1|  Protein RPL-11.1                                      226   1e-71   
gb|EMS18870.1|  60S ribosomal protein l11                               226   1e-71   
emb|CDO95705.1|  unnamed protein product                                225   1e-71   
gb|AGH70158.1|  60S ribosomal protein L11                               226   1e-71   
ref|XP_006461769.1|  hypothetical protein AGABI2DRAFT_136687            226   1e-71   
pdb|2NOQ|H  Chain H, Structure Of Ribosome-Bound Cricket Paralysi...    225   1e-71   
ref|XP_009549021.1|  hypothetical protein HETIRDRAFT_477978             225   1e-71   
ref|XP_003227609.1|  PREDICTED: 60S ribosomal protein L11               225   2e-71   
ref|XP_005802897.1|  PREDICTED: 60S ribosomal protein L11-like          225   2e-71   
gb|ADD38729.1|  60S ribosomal protein L11                               226   2e-71   
gb|AAX11430.1|  cell growth-inhibiting protein 34                       225   2e-71   
gb|AAV90722.1|  60S ribosomal protein L11                               225   2e-71   
ref|XP_003458587.1|  PREDICTED: 60S ribosomal protein L11-like          225   2e-71   
ref|XP_003116317.1|  CRE-RPL-11.1 protein                               226   2e-71   
ref|XP_005905227.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    225   2e-71   
ref|XP_005203175.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    225   2e-71   
gb|KFM71516.1|  60S ribosomal protein L11                               225   2e-71   
gb|KIH55130.1|  ribosomal protein L5                                    226   2e-71   
ref|XP_002636073.1|  C. briggsae CBR-RPL-11.1 protein                   226   2e-71   
ref|XP_007175169.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    225   2e-71   
gb|AHA44486.1|  60S ribosomal-like protein                              226   2e-71   
ref|XP_010898594.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    225   2e-71   
gb|KFW09507.1|  60S ribosomal protein L11                               224   2e-71   
gb|AFM86389.1|  ribosomal protein L11                                   225   2e-71   
gb|KFY18316.1|  hypothetical protein V491_04793                         227   2e-71   
gb|KFP68695.1|  60S ribosomal protein L11                               225   2e-71   
ref|XP_001913063.1|  hypothetical protein                               225   2e-71   
emb|CAG32587.1|  hypothetical protein RCJMB04_30d2                      226   2e-71   
gb|KFV54375.1|  60S ribosomal protein L11                               224   2e-71   
ref|XP_006268033.1|  PREDICTED: 60S ribosomal protein L11               225   2e-71   
ref|XP_008291103.1|  PREDICTED: 60S ribosomal protein L11               225   2e-71   
ref|XP_008329249.1|  PREDICTED: 60S ribosomal protein L11               225   2e-71   
ref|XP_005875279.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    225   2e-71   
gb|EIE75470.1|  60S ribosomal protein L11                               224   3e-71   
ref|XP_011403972.1|  PREDICTED: 60S ribosomal protein L11-like is...    225   3e-71   
gb|EWM29788.1|  60s ribosomal protein l11                               226   3e-71   
gb|KFO60189.1|  60S ribosomal protein L11                               224   3e-71   
gb|EMC79466.1|  60S ribosomal protein L11                               224   3e-71   
gb|KFU91853.1|  60S ribosomal protein L11                               224   3e-71   
ref|XP_003382768.1|  PREDICTED: 60S ribosomal protein L11-like is...    225   3e-71   
gb|EIE79656.1|  60S ribosomal protein L11                               224   3e-71   
dbj|GAM29212.1|  hypothetical protein SAMD00019534_123880               225   3e-71   
gb|EIE83442.1|  60S ribosomal protein L11                               224   3e-71   
gb|KFH42297.1|  60S ribosomal protein-like protein                      225   3e-71   
ref|XP_004425775.1|  PREDICTED: 60S ribosomal protein L11 isoform 1     225   3e-71   
gb|ABW06869.1|  ribosomal protein L11                                   224   3e-71   
ref|XP_010743989.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    225   3e-71   
ref|XP_007083757.1|  PREDICTED: 60S ribosomal protein L11               225   3e-71   
ref|XP_004678659.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    224   3e-71   



>ref|XP_010246451.1| PREDICTED: 60S ribosomal protein L11-like [Nelumbo nucifera]
Length=183

 Score =   291 bits (745),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/143 (99%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRVARR
Sbjct  121  STGIYGMDFYVVLERPGYRVARR  143



>ref|XP_010274422.1| PREDICTED: 60S ribosomal protein L11 [Nelumbo nucifera]
Length=182

 Score =   290 bits (743),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 141/143 (99%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRVARR
Sbjct  121  STGIYGMDFYVVLERPGYRVARR  143



>ref|XP_009383242.1| PREDICTED: 60S ribosomal protein L11 [Musa acuminata subsp. malaccensis]
Length=182

 Score =   290 bits (743),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 141/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLER GYRVARR
Sbjct  121  STGIYGMDFYVVLERAGYRVARR  143



>gb|KDP21119.1| hypothetical protein JCGZ_21590 [Jatropha curcas]
Length=182

 Score =   290 bits (743),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 141/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRV RR
Sbjct  121  STGIYGMDFYVVLERPGYRVGRR  143



>ref|XP_009138940.1| PREDICTED: 60S ribosomal protein L11-1-like [Brassica rapa]
 emb|CDX88999.1| BnaA04g01870D [Brassica napus]
Length=217

 Score =   291 bits (745),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 156/171 (91%), Gaps = 5/171 (3%)
 Frame = +1

Query  4    YILGFLPPLNTASFPGAGLqpqpqq*SDMASEKKLNNPMREIKVQKLVLNISVGESGDRL  183
            + L F    N +S   AG+  QP+  S MASEKKL+NPMR+IKVQKLVLNISVGESGDRL
Sbjct  13   FALSFASSFNRSS---AGVFSQPE--SQMASEKKLSNPMRDIKVQKLVLNISVGESGDRL  67

Query  184  TRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYE  363
            TRA+KVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYE
Sbjct  68   TRASKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYE  127

Query  364  LLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYRVARR  516
            LLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYRVARR
Sbjct  128  LLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYRVARR  178



>ref|XP_002522234.1| 60S ribosomal protein L11, putative [Ricinus communis]
 gb|EEF40092.1| 60S ribosomal protein L11, putative [Ricinus communis]
Length=182

 Score =   290 bits (742),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 141/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRV RR
Sbjct  121  STGIYGMDFYVVLERPGYRVGRR  143



>ref|NP_001266161.1| 60S ribosomal protein L11-like [Cicer arietinum]
 ref|XP_004510433.1| PREDICTED: 60S ribosomal protein L11-like [Cicer arietinum]
 ref|XP_004511177.1| PREDICTED: 60S ribosomal protein L11-like [Cicer arietinum]
 emb|CAD56220.1| ribosomal protein RL5 [Cicer arietinum]
Length=181

 Score =   290 bits (742),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 141/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRV RR
Sbjct  121  STGIYGMDFYVVLERPGYRVGRR  143



>gb|EYU29260.1| hypothetical protein MIMGU_mgv1a014673mg [Erythranthe guttata]
 gb|EYU41114.1| hypothetical protein MIMGU_mgv1a014638mg [Erythranthe guttata]
Length=182

 Score =   290 bits (742),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 141/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRV RR
Sbjct  121  STGIYGMDFYVVLERPGYRVGRR  143



>ref|XP_011033383.1| PREDICTED: 60S ribosomal protein L11-like [Populus euphratica]
 ref|XP_011015073.1| PREDICTED: 60S ribosomal protein L11-like isoform X1 [Populus 
euphratica]
 ref|XP_011015074.1| PREDICTED: 60S ribosomal protein L11-like isoform X2 [Populus 
euphratica]
Length=182

 Score =   290 bits (741),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 141/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRV RR
Sbjct  121  STGIYGMDFYVVLERPGYRVGRR  143



>ref|XP_002510391.1| 60S ribosomal protein L11, putative [Ricinus communis]
 gb|EEF52578.1| 60S ribosomal protein L11, putative [Ricinus communis]
Length=182

 Score =   290 bits (741),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 141/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRV RR
Sbjct  121  STGIYGMDFYVVLERPGYRVGRR  143



>ref|XP_011039398.1| PREDICTED: 60S ribosomal protein L11 [Populus euphratica]
 ref|XP_011039399.1| PREDICTED: 60S ribosomal protein L11 [Populus euphratica]
 ref|XP_011039400.1| PREDICTED: 60S ribosomal protein L11 [Populus euphratica]
Length=182

 Score =   290 bits (741),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 141/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRV RR
Sbjct  121  STGIYGMDFYVVLERPGYRVGRR  143



>ref|XP_002309361.1| 60S ribosomal protein L11 [Populus trichocarpa]
 ref|XP_002309362.1| 60S ribosomal protein L11-2 [Populus trichocarpa]
 ref|XP_002317400.1| ribosomal protein RL5 [Populus trichocarpa]
 ref|XP_002317401.1| ribosomal protein RL5 [Populus trichocarpa]
 gb|ABK93699.1| unknown [Populus trichocarpa]
 gb|EEE92884.1| 60S ribosomal protein L11 [Populus trichocarpa]
 gb|EEE92885.1| 60S ribosomal protein L11-2 [Populus trichocarpa]
 gb|EEE98012.1| ribosomal protein RL5 [Populus trichocarpa]
 gb|EEE98013.1| ribosomal protein RL5 [Populus trichocarpa]
Length=180

 Score =   289 bits (740),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 141/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRV RR
Sbjct  121  STGIYGMDFYVVLERPGYRVGRR  143



>ref|XP_009629723.1| PREDICTED: 60S ribosomal protein L11-1-like [Nicotiana tomentosiformis]
 emb|CAC12883.1| ribosomal protein L11-like [Nicotiana tabacum]
Length=181

 Score =   289 bits (740),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRVARR
Sbjct  121  STGIYGMDFYVVLERPGYRVARR  143



>ref|XP_009132192.1| PREDICTED: 60S ribosomal protein L11-2 isoform X2 [Brassica rapa]
 ref|XP_009136955.1| PREDICTED: 60S ribosomal protein L11-2 isoform X2 [Brassica rapa]
 ref|XP_009101572.1| PREDICTED: 60S ribosomal protein L11-2 [Brassica rapa]
Length=182

 Score =   289 bits (740),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRVARR
Sbjct  121  STGIYGMDFYVVLERPGYRVARR  143



>ref|XP_006398262.1| hypothetical protein EUTSA_v10001041mg [Eutrema salsugineum]
 ref|XP_006402758.1| hypothetical protein EUTSA_v10006260mg [Eutrema salsugineum]
 ref|XP_006414066.1| hypothetical protein EUTSA_v10026344mg [Eutrema salsugineum]
 ref|XP_006414067.1| hypothetical protein EUTSA_v10026344mg [Eutrema salsugineum]
 ref|XP_009128823.1| PREDICTED: 60S ribosomal protein L11-1 [Brassica rapa]
 gb|ESQ39715.1| hypothetical protein EUTSA_v10001041mg [Eutrema salsugineum]
 gb|ESQ44211.1| hypothetical protein EUTSA_v10006260mg [Eutrema salsugineum]
 gb|ESQ55519.1| hypothetical protein EUTSA_v10026344mg [Eutrema salsugineum]
 gb|ESQ55520.1| hypothetical protein EUTSA_v10026344mg [Eutrema salsugineum]
Length=182

 Score =   289 bits (739),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRVARR
Sbjct  121  STGIYGMDFYVVLERPGYRVARR  143



>ref|XP_009628928.1| PREDICTED: 60S ribosomal protein L11-1 [Nicotiana tomentosiformis]
 ref|XP_009796075.1| PREDICTED: 60S ribosomal protein L11-1 [Nicotiana sylvestris]
Length=181

 Score =   289 bits (739),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRVARR
Sbjct  121  STGIYGMDFYVVLERPGYRVARR  143



>ref|XP_010529208.1| PREDICTED: 60S ribosomal protein L11-1-like [Tarenaya hassleriana]
 ref|XP_010538573.1| PREDICTED: 60S ribosomal protein L11-1-like isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010518817.1| PREDICTED: 60S ribosomal protein L11-1-like [Tarenaya hassleriana]
Length=182

 Score =   289 bits (739),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRVARR
Sbjct  121  STGIYGMDFYVVLERPGYRVARR  143



>ref|NP_001237077.1| uncharacterized protein LOC100499863 [Glycine max]
 ref|XP_003527577.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max]
 ref|XP_006582268.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max]
 ref|XP_006598073.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max]
 gb|ACU13960.1| unknown [Glycine max]
 gb|ACU24606.1| unknown [Glycine max]
 gb|KHN27795.1| 60S ribosomal protein L11 [Glycine soja]
Length=181

 Score =   288 bits (738),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVLERPGYRV RR
Sbjct  121  STGIYGMDFFVVLERPGYRVGRR  143



>ref|XP_007132813.1| hypothetical protein PHAVU_011G126600g [Phaseolus vulgaris]
 gb|ESW04807.1| hypothetical protein PHAVU_011G126600g [Phaseolus vulgaris]
Length=181

 Score =   288 bits (738),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVLERPGYRV RR
Sbjct  121  STGIYGMDFFVVLERPGYRVGRR  143



>emb|CDX71934.1| BnaC08g29400D [Brassica napus]
Length=255

 Score =   291 bits (745),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/145 (97%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +1

Query  82   SDMASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRS  261
            S MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRS
Sbjct  72   SQMASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRS  131

Query  262  FGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKY  441
            FGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKY
Sbjct  132  FGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKY  191

Query  442  DPSTGIYGMDFYVVLERPGYRVARR  516
            DPSTGIYGMDFYVVLERPGYRVARR
Sbjct  192  DPSTGIYGMDFYVVLERPGYRVARR  216



>ref|XP_009405599.1| PREDICTED: 60S ribosomal protein L11-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=182

 Score =   288 bits (738),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVLER GYRVARR
Sbjct  121  STGIYGMDFFVVLERAGYRVARR  143



>emb|CDY26360.1| BnaA02g24100D [Brassica napus]
Length=227

 Score =   290 bits (742),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  46   MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  105

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  106  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  165

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRVARR
Sbjct  166  STGIYGMDFYVVLERPGYRVARR  188



>ref|XP_009405598.1| PREDICTED: 60S ribosomal protein L11-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=185

 Score =   288 bits (738),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/144 (97%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = +1

Query  85   DMASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF  264
            D ASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF
Sbjct  3    DTASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF  62

Query  265  GIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  444
            GIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD
Sbjct  63   GIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  122

Query  445  PSTGIYGMDFYVVLERPGYRVARR  516
            PSTGIYGMDF+VVLER GYRVARR
Sbjct  123  PSTGIYGMDFFVVLERAGYRVARR  146



>ref|XP_009408897.1| PREDICTED: 60S ribosomal protein L11 [Musa acuminata subsp. malaccensis]
Length=182

 Score =   288 bits (738),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLER GYRV+RR
Sbjct  121  STGIYGMDFYVVLERAGYRVSRR  143



>ref|XP_006446820.1| hypothetical protein CICLE_v10016875mg [Citrus clementina]
 ref|XP_006468988.1| PREDICTED: 60S ribosomal protein L11-like [Citrus sinensis]
 gb|ESR60060.1| hypothetical protein CICLE_v10016875mg [Citrus clementina]
 gb|KDO63410.1| hypothetical protein CISIN_1g030128mg [Citrus sinensis]
Length=182

 Score =   288 bits (738),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVLERPGYRV RR
Sbjct  121  STGIYGMDFFVVLERPGYRVGRR  143



>sp|P46287.1|RL11_MEDSA RecName: Full=60S ribosomal protein L11; AltName: Full=L5 [Medicago 
sativa]
 emb|CAA55090.1| RL5 ribosomal protein [Medicago sativa]
Length=181

 Score =   288 bits (738),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVLERPGYRV RR
Sbjct  121  STGIYGMDFFVVLERPGYRVGRR  143



>ref|XP_009404521.1| PREDICTED: 60S ribosomal protein L11 [Musa acuminata subsp. malaccensis]
Length=182

 Score =   288 bits (738),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVLER GYRVARR
Sbjct  121  STGIYGMDFFVVLERAGYRVARR  143



>ref|XP_004505457.1| PREDICTED: 60S ribosomal protein L11-like [Cicer arietinum]
Length=181

 Score =   288 bits (737),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVLERPGYRV RR
Sbjct  121  STGIYGMDFFVVLERPGYRVGRR  143



>ref|XP_003540015.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max]
Length=181

 Score =   288 bits (737),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVLERPGYRV RR
Sbjct  121  STGIYGMDFFVVLERPGYRVGRR  143



>ref|XP_007215050.1| hypothetical protein PRUPE_ppa012119mg [Prunus persica]
 ref|XP_008228942.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Prunus mume]
 gb|EMJ16249.1| hypothetical protein PRUPE_ppa012119mg [Prunus persica]
Length=183

 Score =   288 bits (737),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVLERPGYRV RR
Sbjct  121  STGIYGMDFFVVLERPGYRVGRR  143



>ref|NP_001132260.1| hypothetical protein [Zea mays]
 gb|ACF81036.1| unknown [Zea mays]
 gb|AFW65988.1| hypothetical protein ZEAMMB73_747842 [Zea mays]
Length=182

 Score =   288 bits (737),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLER GYRVARR
Sbjct  121  STGIYGMDFYVVLERAGYRVARR  143



>ref|XP_008786958.1| PREDICTED: 60S ribosomal protein L11-like [Phoenix dactylifera]
Length=181

 Score =   288 bits (736),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKK++NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKMSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRV RR
Sbjct  121  STGIYGMDFYVVLERPGYRVGRR  143



>ref|XP_006850965.1| hypothetical protein AMTR_s00025p00203150 [Amborella trichopoda]
 gb|ERN12546.1| hypothetical protein AMTR_s00025p00203150 [Amborella trichopoda]
Length=183

 Score =   288 bits (736),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLTNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRV RR
Sbjct  121  STGIYGMDFYVVLERPGYRVGRR  143



>ref|XP_010915478.1| PREDICTED: 60S ribosomal protein L11-like [Elaeis guineensis]
 ref|XP_010925608.1| PREDICTED: 60S ribosomal protein L11-like [Elaeis guineensis]
Length=182

 Score =   288 bits (736),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKK++NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKMSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRV RR
Sbjct  121  STGIYGMDFYVVLERPGYRVGRR  143



>ref|XP_010525185.1| PREDICTED: 60S ribosomal protein L11-1 [Tarenaya hassleriana]
Length=182

 Score =   288 bits (736),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLANPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRVARR
Sbjct  121  STGIYGMDFYVVLERPGYRVARR  143



>gb|AFK48866.1| unknown [Lotus japonicus]
Length=181

 Score =   288 bits (736),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLR+NFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRKNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRV RR
Sbjct  121  STGIYGMDFYVVLERPGYRVGRR  143



>ref|XP_008381196.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Malus domestica]
Length=183

 Score =   288 bits (736),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MA EKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAEEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRV RR
Sbjct  121  STGIYGMDFYVVLERPGYRVGRR  143



>ref|NP_001242757.1| uncharacterized protein LOC100778713 [Glycine max]
 gb|ACU13845.1| unknown [Glycine max]
Length=181

 Score =   288 bits (736),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVLERPGYRV RR
Sbjct  121  STGIYGMDFFVVLERPGYRVGRR  143



>ref|XP_006843688.1| hypothetical protein AMTR_s00007p00200160 [Amborella trichopoda]
 gb|ERN05363.1| hypothetical protein AMTR_s00007p00200160 [Amborella trichopoda]
Length=183

 Score =   288 bits (736),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLTNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRV RR
Sbjct  121  STGIYGMDFYVVLERPGYRVGRR  143



>gb|EYU41113.1| hypothetical protein MIMGU_mgv1a014638mg [Erythranthe guttata]
Length=183

 Score =   288 bits (736),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 140/142 (99%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  91   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  270
            ASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    ASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  271  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  450
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  451  TGIYGMDFYVVLERPGYRVARR  516
            TGIYGMDFYVVLERPGYRV RR
Sbjct  123  TGIYGMDFYVVLERPGYRVGRR  144



>ref|XP_009626014.1| PREDICTED: 60S ribosomal protein L11-1-like [Nicotiana tomentosiformis]
 ref|XP_009593767.1| PREDICTED: 60S ribosomal protein L11-1-like [Nicotiana tomentosiformis]
 ref|XP_009799522.1| PREDICTED: 60S ribosomal protein L11-1-like [Nicotiana sylvestris]
 ref|XP_009766474.1| PREDICTED: 60S ribosomal protein L11-1-like [Nicotiana sylvestris]
Length=181

 Score =   288 bits (736),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRVARR
Sbjct  121  STGIYGMDFYVVLERPGYRVARR  143



>ref|XP_009378940.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Pyrus x bretschneideri]
Length=182

 Score =   288 bits (736),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MA EKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAEEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRV RR
Sbjct  121  STGIYGMDFYVVLERPGYRVGRR  143



>ref|XP_007148755.1| hypothetical protein PHAVU_005G011400g [Phaseolus vulgaris]
 gb|ESW20749.1| hypothetical protein PHAVU_005G011400g [Phaseolus vulgaris]
Length=181

 Score =   287 bits (735),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MA+EKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAAEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVLERPGYRV RR
Sbjct  121  STGIYGMDFFVVLERPGYRVGRR  143



>ref|XP_009790976.1| PREDICTED: 60S ribosomal protein L11-1 [Nicotiana sylvestris]
Length=181

 Score =   287 bits (735),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRVARR
Sbjct  121  STGIYGMDFYVVLERPGYRVARR  143



>ref|XP_008225318.1| PREDICTED: 60S ribosomal protein L11 [Prunus mume]
Length=182

 Score =   287 bits (735),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVLERPGYRV RR
Sbjct  121  STGIYGMDFFVVLERPGYRVGRR  143



>ref|NP_850376.2| 60S ribosomal protein L16A [Arabidopsis thaliana]
 ref|XP_002863455.1| 60S ribosomal protein L11 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002870025.1| 60S ribosomal protein L11 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006281176.1| hypothetical protein CARUB_v10027211mg [Capsella rubella]
 ref|XP_006291911.1| hypothetical protein CARUB_v10018095mg [Capsella rubella]
 ref|XP_010504827.1| PREDICTED: 60S ribosomal protein L11-1 [Camelina sativa]
 ref|XP_010439816.1| PREDICTED: 60S ribosomal protein L11-1 isoform X2 [Camelina sativa]
 ref|XP_010441671.1| PREDICTED: 60S ribosomal protein L11-1 [Camelina sativa]
 ref|XP_010449473.1| PREDICTED: 60S ribosomal protein L11-1 isoform X2 [Camelina sativa]
 ref|XP_010481534.1| PREDICTED: 60S ribosomal protein L11-1 [Camelina sativa]
 ref|XP_010494724.1| PREDICTED: 60S ribosomal protein L11-1 [Camelina sativa]
 ref|XP_010496881.1| PREDICTED: 60S ribosomal protein L11-1 isoform X2 [Camelina sativa]
 sp|P42795.2|RL111_ARATH RecName: Full=60S ribosomal protein L11-1; AltName: Full=L16A 
[Arabidopsis thaliana]
 dbj|BAF00458.1| 60S ribosomal protein L11B [Arabidopsis thaliana]
 gb|EFH39714.1| 60S ribosomal protein L11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46284.1| 60S ribosomal protein L11 [Arabidopsis lyrata subsp. lyrata]
 gb|AEC10163.1| 60S ribosomal protein L11-1/L16A [Arabidopsis thaliana]
 gb|EOA14074.1| hypothetical protein CARUB_v10027211mg [Capsella rubella]
 gb|EOA24809.1| hypothetical protein CARUB_v10018095mg [Capsella rubella]
Length=182

 Score =   287 bits (735),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRVARR
Sbjct  121  STGIYGMDFYVVLERPGYRVARR  143



>ref|NP_191429.1| 60S ribosomal protein L11-2 [Arabidopsis thaliana]
 ref|NP_567563.1| 60S ribosomal protein L11-2 [Arabidopsis thaliana]
 ref|NP_568649.2| 60S ribosomal protein L11-2 [Arabidopsis thaliana]
 sp|P42794.2|RL112_ARATH RecName: Full=60S ribosomal protein L11-2; AltName: Full=L16 
[Arabidopsis thaliana]
 gb|AAG41458.1|AF326876_1 putative ribosomal protein L11 [Arabidopsis thaliana]
 gb|AAK00379.1|AF339697_1 putative ribosomal protein L11 [Arabidopsis thaliana]
 gb|AAK60313.1|AF385722_1 AT4g18730/F28A21_140 [Arabidopsis thaliana]
 emb|CAB88287.1| ribosomal protein L11-like [Arabidopsis thaliana]
 dbj|BAB09220.1| ribosomal protein L11-like [Arabidopsis thaliana]
 gb|AAK62625.1| AT4g18730/F28A21_140 [Arabidopsis thaliana]
 gb|AAL77722.1| AT4g18730/F28A21_140 [Arabidopsis thaliana]
 gb|AAM62465.1| ribosomal protein L11, cytosolic [Arabidopsis thaliana]
 gb|AAM64372.1| ribosomal protein L11, cytosolic [Arabidopsis thaliana]
 gb|AAM91073.1| AT4g18730/F28A21_140 [Arabidopsis thaliana]
 gb|AED95297.1| 60S ribosomal protein L11-2 [Arabidopsis thaliana]
 gb|AEE79819.1| 60S ribosomal protein L11-2 [Arabidopsis thaliana]
 gb|AEE84082.1| 60S ribosomal protein L11-2 [Arabidopsis thaliana]
Length=182

 Score =   287 bits (735),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRVARR
Sbjct  121  STGIYGMDFYVVLERPGYRVARR  143



>ref|XP_010936718.1| PREDICTED: 60S ribosomal protein L11 [Elaeis guineensis]
Length=182

 Score =   287 bits (735),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVLERPGYRV RR
Sbjct  121  STGIYGMDFFVVLERPGYRVGRR  143



>gb|EYU21905.1| hypothetical protein MIMGU_mgv1a014651mg [Erythranthe guttata]
Length=182

 Score =   287 bits (735),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MA+EKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MAAEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRV RR
Sbjct  121  STGIYGMDFYVVLERPGYRVGRR  143



>ref|XP_008343092.1| PREDICTED: 60S ribosomal protein L11-like isoform X2 [Malus domestica]
Length=182

 Score =   287 bits (735),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MA EKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAEEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRV RR
Sbjct  121  STGIYGMDFYVVLERPGYRVGRR  143



>ref|XP_004134655.1| PREDICTED: 60S ribosomal protein L11-1-like [Cucumis sativus]
 ref|XP_004163354.1| PREDICTED: 60S ribosomal protein L11-1-like [Cucumis sativus]
 ref|XP_008439725.1| PREDICTED: 60S ribosomal protein L11-1-like [Cucumis melo]
 gb|KGN49316.1| hypothetical protein Csa_6G519680 [Cucumis sativus]
Length=181

 Score =   287 bits (735),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRV RR
Sbjct  121  STGIYGMDFYVVLERPGYRVGRR  143



>gb|KHN42782.1| 60S ribosomal protein L11 [Glycine soja]
Length=181

 Score =   287 bits (735),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVLERPGYRV RR
Sbjct  121  STGIYGMDFFVVLERPGYRVGRR  143



>ref|XP_009403504.1| PREDICTED: 60S ribosomal protein L11 [Musa acuminata subsp. malaccensis]
Length=182

 Score =   287 bits (735),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVLER GYRV+RR
Sbjct  121  STGIYGMDFFVVLERAGYRVSRR  143



>gb|ABK93207.1| unknown [Populus trichocarpa]
Length=180

 Score =   287 bits (735),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQL ESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLQESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRV RR
Sbjct  121  STGIYGMDFYVVLERPGYRVGRR  143



>gb|AFP44117.1| 60S ribosomal protein [Lycoris longituba]
Length=182

 Score =   287 bits (734),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRV RR
Sbjct  121  STGIYGMDFYVVLERPGYRVGRR  143



>emb|CDY49245.1| BnaA09g55240D [Brassica napus]
Length=259

 Score =   290 bits (742),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 153/176 (87%), Positives = 161/176 (91%), Gaps = 6/176 (3%)
 Frame = +1

Query  1    GYI-LGFLPPLN--TASFP-GAGLqpqpqq*SDMASEKKLNNPMREIKVQKLVLNISVGE  168
            G+I  G   PL+   +SFP  AG+  QP+  S MASEKKL+NPMR+IKVQKLVLNISVGE
Sbjct  47   GFIYFGAASPLSLFDSSFPFPAGVLSQPE--SQMASEKKLSNPMRDIKVQKLVLNISVGE  104

Query  169  SGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLK  348
            SGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLK
Sbjct  105  SGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLK  164

Query  349  VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYRVARR  516
            VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYRVARR
Sbjct  165  VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYRVARR  220



>ref|XP_006414065.1| hypothetical protein EUTSA_v10026344mg [Eutrema salsugineum]
 gb|ESQ55518.1| hypothetical protein EUTSA_v10026344mg [Eutrema salsugineum]
Length=183

 Score =   287 bits (734),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/142 (98%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +1

Query  91   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  270
            ASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    ASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  271  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  450
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  451  TGIYGMDFYVVLERPGYRVARR  516
            TGIYGMDFYVVLERPGYRVARR
Sbjct  123  TGIYGMDFYVVLERPGYRVARR  144



>ref|XP_009132184.1| PREDICTED: 60S ribosomal protein L11-2 isoform X1 [Brassica rapa]
 ref|XP_009136954.1| PREDICTED: 60S ribosomal protein L11-2 isoform X1 [Brassica rapa]
 emb|CDY64920.1| BnaC07g50200D [Brassica napus]
Length=183

 Score =   287 bits (734),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/142 (98%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +1

Query  91   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  270
            ASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    ASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  271  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  450
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  451  TGIYGMDFYVVLERPGYRVARR  516
            TGIYGMDFYVVLERPGYRVARR
Sbjct  123  TGIYGMDFYVVLERPGYRVARR  144



>ref|XP_006449533.1| hypothetical protein CICLE_v10016873mg [Citrus clementina]
 ref|XP_006467622.1| PREDICTED: 60S ribosomal protein L11-like [Citrus sinensis]
 gb|ESR62773.1| hypothetical protein CICLE_v10016873mg [Citrus clementina]
 gb|KDO77895.1| hypothetical protein CISIN_1g029665mg [Citrus sinensis]
Length=182

 Score =   287 bits (734),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MAS+KKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASDKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVLERPGYRV RR
Sbjct  121  STGIYGMDFFVVLERPGYRVGRR  143



>emb|CDX99436.1| BnaC01g11160D [Brassica napus]
Length=184

 Score =   287 bits (734),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/142 (98%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +1

Query  91   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  270
            ASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  4    ASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGI  63

Query  271  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  450
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  64   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  123

Query  451  TGIYGMDFYVVLERPGYRVARR  516
            TGIYGMDFYVVLERPGYRVARR
Sbjct  124  TGIYGMDFYVVLERPGYRVARR  145



>gb|AFK37822.1| unknown [Medicago truncatula]
Length=181

 Score =   287 bits (734),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVLERPGYRV RR
Sbjct  121  STGIYGMDFFVVLERPGYRVGRR  143



>ref|XP_003628237.1| 60S ribosomal protein L11 [Medicago truncatula]
 gb|AET02713.1| 50S ribosomal protein L5P [Medicago truncatula]
 gb|AFK39602.1| unknown [Medicago truncatula]
Length=181

 Score =   287 bits (734),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVLERPGYRV RR
Sbjct  121  STGIYGMDFFVVLERPGYRVGRR  143



>emb|CDX87764.1| BnaC02g31850D [Brassica napus]
Length=228

 Score =   288 bits (738),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  47   MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  106

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLR+NFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  107  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRKNFSDTGCFGFGIQEHIDLGIKYDP  166

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRVARR
Sbjct  167  STGIYGMDFYVVLERPGYRVARR  189



>ref|XP_011081868.1| PREDICTED: 60S ribosomal protein L11-like [Sesamum indicum]
Length=183

 Score =   286 bits (733),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRV RR
Sbjct  121  STGIYGMDFYVVLERPGYRVGRR  143



>ref|NP_001238636.1| uncharacterized protein LOC100305912 [Glycine max]
 gb|ACU13823.1| unknown [Glycine max]
Length=181

 Score =   286 bits (733),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQAPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVLERPGYRV RR
Sbjct  121  STGIYGMDFFVVLERPGYRVGRR  143



>ref|XP_011088013.1| PREDICTED: 60S ribosomal protein L11-like [Sesamum indicum]
Length=183

 Score =   286 bits (733),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRV RR
Sbjct  121  STGIYGMDFYVVLERPGYRVGRR  143



>ref|XP_010538574.1| PREDICTED: 60S ribosomal protein L11-1-like isoform X3 [Tarenaya 
hassleriana]
Length=183

 Score =   286 bits (733),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/142 (98%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +1

Query  91   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  270
            ASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    ASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  271  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  450
            RRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  451  TGIYGMDFYVVLERPGYRVARR  516
            TGIYGMDFYVVLERPGYRVARR
Sbjct  123  TGIYGMDFYVVLERPGYRVARR  144



>ref|XP_010052179.1| PREDICTED: 60S ribosomal protein L11-1 [Eucalyptus grandis]
 gb|KCW76098.1| hypothetical protein EUGRSUZ_D00478 [Eucalyptus grandis]
Length=182

 Score =   286 bits (733),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRV RR
Sbjct  121  STGIYGMDFYVVLERPGYRVGRR  143



>ref|XP_010538572.1| PREDICTED: 60S ribosomal protein L11-1-like isoform X1 [Tarenaya 
hassleriana]
Length=183

 Score =   286 bits (733),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/142 (98%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +1

Query  91   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  270
            ASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    ASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  271  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  450
            RRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  451  TGIYGMDFYVVLERPGYRVARR  516
            TGIYGMDFYVVLERPGYRVARR
Sbjct  123  TGIYGMDFYVVLERPGYRVARR  144



>ref|XP_004293968.1| PREDICTED: 60S ribosomal protein L11 [Fragaria vesca subsp. vesca]
Length=181

 Score =   286 bits (733),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLR+NFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRKNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVLERPGYRV RR
Sbjct  121  STGIYGMDFFVVLERPGYRVGRR  143



>ref|NP_001149684.1| 60S ribosomal protein L11-1 [Zea mays]
 gb|ACF85974.1| unknown [Zea mays]
 gb|ACG36357.1| 60S ribosomal protein L11-1 [Zea mays]
 gb|ACR34870.1| unknown [Zea mays]
 gb|AFW71163.1| 60S ribosomal protein L11-1 [Zea mays]
Length=182

 Score =   286 bits (733),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MA EKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAHEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLER GYRVARR
Sbjct  121  STGIYGMDFYVVLERAGYRVARR  143



>ref|XP_011082984.1| PREDICTED: 60S ribosomal protein L11 [Sesamum indicum]
Length=183

 Score =   286 bits (733),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRV RR
Sbjct  121  STGIYGMDFYVVLERPGYRVGRR  143



>ref|XP_006578416.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max]
Length=181

 Score =   286 bits (732),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIAC+VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACHVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVLERPGYRV RR
Sbjct  121  STGIYGMDFFVVLERPGYRVGRR  143



>ref|XP_010052848.1| PREDICTED: 60S ribosomal protein L11-1 [Eucalyptus grandis]
 gb|KCW89658.1| hypothetical protein EUGRSUZ_A01929 [Eucalyptus grandis]
Length=182

 Score =   286 bits (732),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFY+VLERPGYRV RR
Sbjct  121  STGIYGMDFYIVLERPGYRVGRR  143



>gb|AFK35020.1| unknown [Lotus japonicus]
Length=181

 Score =   286 bits (732),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLR+NFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRKNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVLERPGYRV RR
Sbjct  121  STGIYGMDFFVVLERPGYRVGRR  143



>emb|CAA57395.1| ribosomal protein L16 [Arabidopsis thaliana]
Length=182

 Score =   286 bits (732),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGI+YDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIRYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRVARR
Sbjct  121  STGIYGMDFYVVLERPGYRVARR  143



>gb|KFK28544.1| hypothetical protein AALP_AA7G010400 [Arabis alpina]
 gb|KFK31523.1| hypothetical protein AALP_AA6G123700 [Arabis alpina]
Length=182

 Score =   286 bits (732),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLR+NFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRKNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRVARR
Sbjct  121  STGIYGMDFYVVLERPGYRVARR  143



>gb|KHN01495.1| 60S ribosomal protein L11 [Glycine soja]
Length=224

 Score =   288 bits (736),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/142 (98%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  91   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  270
            ASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  45   ASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  104

Query  271  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  450
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  105  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  164

Query  451  TGIYGMDFYVVLERPGYRVARR  516
            TGIYGMDF+VVLERPGYRV RR
Sbjct  165  TGIYGMDFFVVLERPGYRVGRR  186



>gb|AFK38385.1| unknown [Lotus japonicus]
Length=181

 Score =   286 bits (732),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLR+NFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRKNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVLERPGYRV RR
Sbjct  121  STGIYGMDFFVVLERPGYRVGRR  143



>gb|KHG23956.1| 60S ribosomal L11-2 -like protein [Gossypium arboreum]
Length=182

 Score =   286 bits (732),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLER GYRV RR
Sbjct  121  STGIYGMDFYVVLERAGYRVGRR  143



>gb|AAR83867.1| ribosomal protein L11-like protein [Capsicum annuum]
Length=181

 Score =   286 bits (731),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASE KLNNPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASENKLNNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRVARR
Sbjct  121  STGIYGMDFYVVLERPGYRVARR  143



>ref|NP_001274979.1| 60S ribosomal protein L11-2-like [Solanum tuberosum]
 ref|XP_004232337.1| PREDICTED: 60S ribosomal protein L11-1 [Solanum lycopersicum]
 ref|XP_004243273.1| PREDICTED: 60S ribosomal protein L11-1 [Solanum lycopersicum]
 ref|XP_004248195.1| PREDICTED: 60S ribosomal protein L11-1 [Solanum lycopersicum]
 ref|XP_004251809.1| PREDICTED: 60S ribosomal protein L11-1 [Solanum lycopersicum]
 ref|XP_006348888.1| PREDICTED: 60S ribosomal protein L11-2-like [Solanum tuberosum]
 ref|XP_006350023.1| PREDICTED: 60S ribosomal protein L11-2-like [Solanum tuberosum]
 ref|XP_006357834.1| PREDICTED: 60S ribosomal protein L11-2-like [Solanum tuberosum]
 gb|ABB29943.1| ribosomal protein L11-like protein [Solanum tuberosum]
Length=181

 Score =   286 bits (731),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRVARR
Sbjct  121  STGIYGMDFYVVLERPGYRVARR  143



>ref|XP_002451841.1| hypothetical protein SORBIDRAFT_04g008530 [Sorghum bicolor]
 ref|XP_002451842.1| hypothetical protein SORBIDRAFT_04g008540 [Sorghum bicolor]
 gb|EES04817.1| hypothetical protein SORBIDRAFT_04g008530 [Sorghum bicolor]
 gb|EES04818.1| hypothetical protein SORBIDRAFT_04g008540 [Sorghum bicolor]
Length=182

 Score =   286 bits (731),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLER GYRVARR
Sbjct  121  STGIYGMDFYVVLERAGYRVARR  143



>ref|XP_009351472.1| PREDICTED: 60S ribosomal protein L11 [Pyrus x bretschneideri]
Length=182

 Score =   286 bits (731),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASE KL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASESKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVLERPGYRV RR
Sbjct  121  STGIYGMDFFVVLERPGYRVGRR  143



>ref|XP_008228941.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Prunus mume]
Length=184

 Score =   286 bits (731),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/142 (98%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  91   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  270
            ASEKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    ASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  271  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  450
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  451  TGIYGMDFYVVLERPGYRVARR  516
            TGIYGMDF+VVLERPGYRV RR
Sbjct  123  TGIYGMDFFVVLERPGYRVGRR  144



>ref|XP_010052835.1| PREDICTED: 60S ribosomal protein L11-1-like [Eucalyptus grandis]
Length=182

 Score =   286 bits (731),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MA+EKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MAAEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRV RR
Sbjct  121  STGIYGMDFYVVLERPGYRVGRR  143



>ref|XP_009365286.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Pyrus x bretschneideri]
Length=183

 Score =   286 bits (731),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MA E KL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAEENKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRV RR
Sbjct  121  STGIYGMDFYVVLERPGYRVGRR  143



>gb|KJB57391.1| hypothetical protein B456_009G161300 [Gossypium raimondii]
 gb|KJB66842.1| hypothetical protein B456_010G160100 [Gossypium raimondii]
 gb|KJB66843.1| hypothetical protein B456_010G160100 [Gossypium raimondii]
 gb|KJB68369.1| hypothetical protein B456_010G241400 [Gossypium raimondii]
 gb|KJB69699.1| hypothetical protein B456_011G038200 [Gossypium raimondii]
Length=182

 Score =   286 bits (731),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLER GYRV RR
Sbjct  121  STGIYGMDFYVVLERAGYRVGRR  143



>gb|KHG08920.1| 60S ribosomal L11-1 -like protein [Gossypium arboreum]
 gb|KJB34907.1| hypothetical protein B456_006G089700 [Gossypium raimondii]
Length=182

 Score =   286 bits (731),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLER GYRV RR
Sbjct  121  STGIYGMDFYVVLERAGYRVGRR  143



>ref|XP_002880003.1| 60S ribosomal protein L11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56262.1| 60S ribosomal protein L11 [Arabidopsis lyrata subsp. lyrata]
Length=182

 Score =   285 bits (730),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
             RRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   TRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRVARR
Sbjct  121  STGIYGMDFYVVLERPGYRVARR  143



>emb|CAA57394.1| ribosomal protein L16 [Arabidopsis thaliana]
Length=182

 Score =   285 bits (730),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGM+FYVVLERPGYRVARR
Sbjct  121  STGIYGMEFYVVLERPGYRVARR  143



>ref|XP_009378939.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Pyrus x bretschneideri]
Length=183

 Score =   285 bits (730),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 139/142 (98%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +1

Query  91   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  270
            A EKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    AEEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  271  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  450
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  451  TGIYGMDFYVVLERPGYRVARR  516
            TGIYGMDFYVVLERPGYRV RR
Sbjct  123  TGIYGMDFYVVLERPGYRVGRR  144



>ref|XP_008345917.1| PREDICTED: 60S ribosomal protein L11 [Malus domestica]
Length=182

 Score =   285 bits (730),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASE KL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASENKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVLERPGYRV RR
Sbjct  121  STGIYGMDFFVVLERPGYRVGRR  143



>ref|XP_008381195.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Malus domestica]
Length=184

 Score =   285 bits (730),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 139/142 (98%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +1

Query  91   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  270
            A EKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    AEEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  271  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  450
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  451  TGIYGMDFYVVLERPGYRVARR  516
            TGIYGMDFYVVLERPGYRV RR
Sbjct  123  TGIYGMDFYVVLERPGYRVGRR  144



>ref|XP_008443441.1| PREDICTED: 60S ribosomal protein L11-1 [Cucumis melo]
 gb|KGN65615.1| hypothetical protein Csa_1G470310 [Cucumis sativus]
Length=182

 Score =   285 bits (730),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRV RR
Sbjct  121  STGIYGMDFYVVLERPGYRVGRR  143



>ref|XP_002876475.1| 60S ribosomal protein L11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52734.1| 60S ribosomal protein L11 [Arabidopsis lyrata subsp. lyrata]
Length=182

 Score =   285 bits (730),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSK RYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKGRYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRVARR
Sbjct  121  STGIYGMDFYVVLERPGYRVARR  143



>gb|KDO77896.1| hypothetical protein CISIN_1g029665mg [Citrus sinensis]
Length=190

 Score =   286 bits (731),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 138/144 (96%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = +1

Query  85   DMASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF  264
            + AS+KKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF
Sbjct  8    NQASDKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF  67

Query  265  GIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  444
            GIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD
Sbjct  68   GIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  127

Query  445  PSTGIYGMDFYVVLERPGYRVARR  516
            PSTGIYGMDF+VVLERPGYRV RR
Sbjct  128  PSTGIYGMDFFVVLERPGYRVGRR  151



>gb|KHN27796.1| 60S ribosomal protein L11, partial [Glycine soja]
Length=182

 Score =   285 bits (730),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 138/142 (97%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  91   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  270
            ASEKKL+NPMRE+KVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    ASEKKLSNPMREMKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  271  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  450
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  451  TGIYGMDFYVVLERPGYRVARR  516
            TGIYGMDF+VVLERPGYRV RR
Sbjct  123  TGIYGMDFFVVLERPGYRVGRR  144



>ref|XP_010427776.1| PREDICTED: 60S ribosomal protein L11-1-like [Camelina sativa]
Length=182

 Score =   285 bits (730),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLE GLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLEGGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRVARR
Sbjct  121  STGIYGMDFYVVLERPGYRVARR  143



>ref|XP_002281886.1| PREDICTED: 60S ribosomal protein L11 [Vitis vinifera]
Length=183

 Score =   285 bits (730),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVLERPGYRV RR
Sbjct  121  STGIYGMDFFVVLERPGYRVGRR  143



>ref|XP_008362518.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Malus domestica]
Length=182

 Score =   285 bits (730),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MA EKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAEEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFY VLERPGYRV RR
Sbjct  121  STGIYGMDFYXVLERPGYRVGRR  143



>ref|XP_008343091.1| PREDICTED: 60S ribosomal protein L11-like isoform X1 [Malus domestica]
Length=183

 Score =   285 bits (730),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 139/142 (98%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +1

Query  91   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  270
            A EKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    AEEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  271  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  450
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  451  TGIYGMDFYVVLERPGYRVARR  516
            TGIYGMDFYVVLERPGYRV RR
Sbjct  123  TGIYGMDFYVVLERPGYRVGRR  144



>ref|XP_006285819.1| hypothetical protein CARUB_v10007309mg [Capsella rubella]
 ref|XP_010439815.1| PREDICTED: 60S ribosomal protein L11-1 isoform X1 [Camelina sativa]
 ref|XP_010449472.1| PREDICTED: 60S ribosomal protein L11-1 isoform X1 [Camelina sativa]
 ref|XP_010496880.1| PREDICTED: 60S ribosomal protein L11-1 isoform X1 [Camelina sativa]
 gb|EOA18717.1| hypothetical protein CARUB_v10007309mg [Capsella rubella]
Length=183

 Score =   285 bits (730),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 138/142 (97%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +1

Query  91   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  270
            ASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    ASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  271  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  450
            RRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  451  TGIYGMDFYVVLERPGYRVARR  516
            TGIYGMDFYVVLERPGYRVARR
Sbjct  123  TGIYGMDFYVVLERPGYRVARR  144



>gb|AFW65990.1| hypothetical protein ZEAMMB73_747842 [Zea mays]
Length=187

 Score =   285 bits (730),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 139/142 (98%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  91   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  270
            ASEKK +NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  7    ASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  66

Query  271  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  450
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  67   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  126

Query  451  TGIYGMDFYVVLERPGYRVARR  516
            TGIYGMDFYVVLER GYRVARR
Sbjct  127  TGIYGMDFYVVLERAGYRVARR  148



>pir||T04865 ribosomal protein L11, cytosolic - Arabidopsis thaliana
 emb|CAA57396.1| ribosomal protein L16 [Arabidopsis thaliana]
 emb|CAB37458.1| ribosomal protein L11, cytosolic [Arabidopsis thaliana]
 emb|CAB78875.1| ribosomal protein L11, cytosolic [Arabidopsis thaliana]
Length=184

 Score =   285 bits (729),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 138/142 (97%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +1

Query  91   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  270
            ASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  4    ASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGI  63

Query  271  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  450
            RRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  64   RRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  123

Query  451  TGIYGMDFYVVLERPGYRVARR  516
            TGIYGMDFYVVLERPGYRVARR
Sbjct  124  TGIYGMDFYVVLERPGYRVARR  145



>gb|ABK22492.1| unknown [Picea sitchensis]
 gb|ABK26358.1| unknown [Picea sitchensis]
Length=180

 Score =   285 bits (729),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MA+EKKLNNPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAAEKKLNNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KA+QLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKALQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVLERPGYR+ RR
Sbjct  121  STGIYGMDFFVVLERPGYRIGRR  143



>ref|XP_009116550.1| PREDICTED: 60S ribosomal protein L11-1 [Brassica rapa]
Length=182

 Score =   285 bits (729),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHI LGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIYLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRVARR
Sbjct  121  STGIYGMDFYVVLERPGYRVARR  143



>ref|NP_001046386.1| Os02g0235600 [Oryza sativa Japonica Group]
 dbj|BAF08300.1| Os02g0235600 [Oryza sativa Japonica Group]
 dbj|BAH00003.1| unnamed protein product [Oryza sativa Japonica Group]
Length=182

 Score =   285 bits (729),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLER GYRVARR
Sbjct  121  STGIYGMDFYVVLERAGYRVARR  143



>gb|ACJ86159.1| unknown [Medicago truncatula]
Length=181

 Score =   285 bits (728),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRN SDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNLSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVLERPGYRV RR
Sbjct  121  STGIYGMDFFVVLERPGYRVGRR  143



>ref|NP_001132427.1| 60S ribosomal protein L11-1 [Zea mays]
 gb|ACF81262.1| unknown [Zea mays]
 gb|AFW81631.1| 60S ribosomal protein L11-1 [Zea mays]
Length=181

 Score =   285 bits (728),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLER GYRVARR
Sbjct  121  STGIYGMDFYVVLERAGYRVARR  143



>ref|XP_007025337.1| Ribosomal protein large subunit 16A [Theobroma cacao]
 gb|EOY27959.1| Ribosomal protein large subunit 16A [Theobroma cacao]
Length=257

 Score =   287 bits (735),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  76   MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  135

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  136  IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  195

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLER GYRV RR
Sbjct  196  STGIYGMDFYVVLERAGYRVGRR  218



>ref|XP_008366039.1| PREDICTED: 60S ribosomal protein L11-1 [Malus domestica]
 ref|XP_009352738.1| PREDICTED: 60S ribosomal protein L11-1 [Pyrus x bretschneideri]
Length=182

 Score =   285 bits (728),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASE K+ NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASESKMANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRV RR
Sbjct  121  STGIYGMDFYVVLERPGYRVGRR  143



>ref|XP_004976770.1| PREDICTED: 60S ribosomal protein L11-like [Setaria italica]
Length=180

 Score =   285 bits (728),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLER GYRVARR
Sbjct  121  STGIYGMDFYVVLERAGYRVARR  143



>ref|XP_010689742.1| PREDICTED: 60S ribosomal protein L11-1 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=182

 Score =   285 bits (728),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MA EKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVRSFG
Sbjct  1    MAPEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRVARR
Sbjct  121  STGIYGMDFYVVLERPGYRVARR  143



>ref|XP_003598139.1| 60S ribosomal protein L11 [Medicago truncatula]
 gb|AES68390.1| 50S ribosomal protein L5P [Medicago truncatula]
 gb|AFK34937.1| unknown [Medicago truncatula]
Length=182

 Score =   285 bits (728),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +1

Query  94   SEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIR  273
            SEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIR
Sbjct  4    SEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIR  63

Query  274  RNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPST  453
            RNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPST
Sbjct  64   RNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPST  123

Query  454  GIYGMDFYVVLERPGYRVARR  516
            GIYGMDF+VVLERPGYRV RR
Sbjct  124  GIYGMDFFVVLERPGYRVGRR  144



>ref|XP_007048733.1| Ribosomal L5P family protein isoform 1 [Theobroma cacao]
 gb|EOX92890.1| Ribosomal L5P family protein isoform 1 [Theobroma cacao]
Length=182

 Score =   284 bits (727),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASE+KL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEQKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLER GYRV RR
Sbjct  121  STGIYGMDFYVVLERAGYRVGRR  143



>ref|NP_001148395.1| LOC100282010 [Zea mays]
 gb|ACG31313.1| 60S ribosomal protein L11-1 [Zea mays]
 gb|AFW86972.1| 60S ribosomal protein L11-1 [Zea mays]
Length=182

 Score =   284 bits (727),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLER GYRVARR
Sbjct  121  STGIYGMDFYVVLERAGYRVARR  143



>ref|XP_007214493.1| hypothetical protein PRUPE_ppa020372mg [Prunus persica]
 gb|EMJ15692.1| hypothetical protein PRUPE_ppa020372mg [Prunus persica]
Length=276

 Score =   288 bits (736),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/142 (98%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  91   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  270
            ASEKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  96   ASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  155

Query  271  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  450
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  156  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  215

Query  451  TGIYGMDFYVVLERPGYRVARR  516
            TGIYGMDF+VVLERPGYRV RR
Sbjct  216  TGIYGMDFFVVLERPGYRVGRR  237



>gb|ADE77225.1| unknown [Picea sitchensis]
Length=180

 Score =   284 bits (726),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MA+EKKLNNPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAAEKKLNNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KA+QLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKALQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVLERPGYRV RR
Sbjct  121  STGIYGMDFFVVLERPGYRVGRR  143



>ref|XP_008782472.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Phoenix dactylifera]
Length=180

 Score =   284 bits (726),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMR IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRGIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVLERPGYRV RR
Sbjct  121  STGIYGMDFFVVLERPGYRVGRR  143



>ref|XP_004133952.1| PREDICTED: 60S ribosomal protein L11-2-like isoform 2 [Cucumis 
sativus]
 ref|XP_004164745.1| PREDICTED: 60S ribosomal protein L11-2-like isoform 2 [Cucumis 
sativus]
 ref|XP_008438244.1| PREDICTED: 60S ribosomal protein L11-1-like isoform X2 [Cucumis 
melo]
 gb|KGN56659.1| hypothetical protein Csa_3G127210 [Cucumis sativus]
Length=182

 Score =   284 bits (726),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVLERPGYRV RR
Sbjct  121  STGIYGMDFFVVLERPGYRVGRR  143



>ref|XP_003607648.1| 60S ribosomal protein L11-1 [Medicago truncatula]
 gb|ACJ86168.1| unknown [Medicago truncatula]
 gb|AES89845.1| 50S ribosomal protein L5P [Medicago truncatula]
 gb|AFK48476.1| unknown [Medicago truncatula]
Length=181

 Score =   283 bits (725),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MAS+KKL NPMR++KVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASDKKLANPMRDMKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVLERPGYRV RR
Sbjct  121  STGIYGMDFFVVLERPGYRVGRR  143



>ref|NP_001131414.1| uncharacterized protein LOC100192743 [Zea mays]
 gb|ACF79812.1| unknown [Zea mays]
 gb|ACG39381.1| 60S ribosomal protein L11-1 [Zea mays]
 tpg|DAA52966.1| TPA: 60S ribosomal protein L11-1 [Zea mays]
Length=182

 Score =   283 bits (725),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKK +NPMRE+KVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREMKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLER GYRVARR
Sbjct  121  STGIYGMDFYVVLERAGYRVARR  143



>gb|ACG31637.1| 60S ribosomal protein L11-1 [Zea mays]
Length=181

 Score =   283 bits (725),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTV+G+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVKGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLER GYRVARR
Sbjct  121  STGIYGMDFYVVLERAGYRVARR  143



>ref|XP_008790022.1| PREDICTED: 60S ribosomal protein L11-like [Phoenix dactylifera]
Length=182

 Score =   283 bits (725),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL NPMR+I VQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLLNPMRDINVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRV RR
Sbjct  121  STGIYGMDFYVVLERPGYRVGRR  143



>ref|XP_002454974.1| hypothetical protein SORBIDRAFT_03g002420 [Sorghum bicolor]
 gb|EES00094.1| hypothetical protein SORBIDRAFT_03g002420 [Sorghum bicolor]
Length=182

 Score =   283 bits (725),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLER GYRVARR
Sbjct  121  STGIYGMDFYVVLERAGYRVARR  143



>ref|XP_006654147.1| PREDICTED: 60S ribosomal protein L11-like [Oryza brachyantha]
Length=182

 Score =   283 bits (725),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLER GYRVARR
Sbjct  121  STGIYGMDFYVVLERAGYRVARR  143



>ref|XP_009365285.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Pyrus x bretschneideri]
Length=184

 Score =   283 bits (725),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 138/142 (97%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +1

Query  91   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  270
            A E KL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    AEENKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  271  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  450
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  451  TGIYGMDFYVVLERPGYRVARR  516
            TGIYGMDFYVVLERPGYRV RR
Sbjct  123  TGIYGMDFYVVLERPGYRVGRR  144



>ref|XP_008362517.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Malus domestica]
Length=183

 Score =   283 bits (724),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 138/142 (97%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +1

Query  91   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  270
            A EKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    AEEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  271  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  450
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  451  TGIYGMDFYVVLERPGYRVARR  516
            TGIYGMDFY VLERPGYRV RR
Sbjct  123  TGIYGMDFYXVLERPGYRVGRR  144



>ref|XP_004968572.1| PREDICTED: 60S ribosomal protein L11-like [Setaria italica]
Length=181

 Score =   282 bits (722),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKK  NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLER GYRVARR
Sbjct  121  STGIYGMDFYVVLERAGYRVARR  143



>ref|XP_010689741.1| PREDICTED: 60S ribosomal protein L11-1 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=183

 Score =   282 bits (722),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 137/142 (96%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  91   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  270
            A EKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVRSFGI
Sbjct  3    APEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRSFGI  62

Query  271  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  450
            RRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  451  TGIYGMDFYVVLERPGYRVARR  516
            TGIYGMDFYVVLERPGYRVARR
Sbjct  123  TGIYGMDFYVVLERPGYRVARR  144



>ref|XP_006643887.1| PREDICTED: 60S ribosomal protein L11-like [Oryza brachyantha]
Length=182

 Score =   282 bits (721),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLER GYRVARR
Sbjct  121  STGIYGMDFYVVLERAGYRVARR  143



>ref|NP_001054899.1| Os05g0207300 [Oryza sativa Japonica Group]
 ref|NP_001057834.2| Os06g0550000 [Oryza sativa Japonica Group]
 sp|Q0DK10.1|RL11_ORYSJ RecName: Full=60S ribosomal protein L11 [Oryza sativa Japonica 
Group]
 sp|A2YDY2.2|RL11_ORYSI RecName: Full=60S ribosomal protein L11 [Oryza sativa Indica 
Group]
 gb|AAU90185.1| putative 60S ribosomal protein L11 [Oryza sativa Japonica Group]
 dbj|BAF16813.1| Os05g0207300 [Oryza sativa Japonica Group]
 dbj|BAG92054.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC78695.1| hypothetical protein OsI_18846 [Oryza sativa Indica Group]
 gb|EEC80790.1| hypothetical protein OsI_23322 [Oryza sativa Indica Group]
 gb|EEE62702.1| hypothetical protein OsJ_17505 [Oryza sativa Japonica Group]
 gb|EEE65858.1| hypothetical protein OsJ_21642 [Oryza sativa Japonica Group]
 dbj|BAF19748.2| Os06g0550000 [Oryza sativa Japonica Group]
Length=182

 Score =   282 bits (721),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLER GYRVARR
Sbjct  121  STGIYGMDFYVVLERAGYRVARR  143



>ref|XP_004133951.1| PREDICTED: 60S ribosomal protein L11-2-like isoform 1 [Cucumis 
sativus]
 ref|XP_004164744.1| PREDICTED: 60S ribosomal protein L11-2-like isoform 1 [Cucumis 
sativus]
 ref|XP_008438243.1| PREDICTED: 60S ribosomal protein L11-like isoform X1 [Cucumis 
melo]
Length=184

 Score =   282 bits (721),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/142 (96%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  91   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  270
            ASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFGI
Sbjct  4    ASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFGI  63

Query  271  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  450
            RRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  64   RRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  123

Query  451  TGIYGMDFYVVLERPGYRVARR  516
            TGIYGMDF+VVLERPGYRV RR
Sbjct  124  TGIYGMDFFVVLERPGYRVGRR  145



>gb|ABR25412.1| 60S ribosomal protein l11 [Oryza sativa Indica Group]
Length=152

 Score =   280 bits (717),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLER GYRVARR
Sbjct  121  STGIYGMDFYVVLERAGYRVARR  143



>ref|XP_010940061.1| PREDICTED: 60S ribosomal protein L11-like [Elaeis guineensis]
Length=181

 Score =   281 bits (719),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 141/143 (99%), Gaps = 1/143 (1%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEK+ +NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKQ-SNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  59

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  60   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  119

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRV RR
Sbjct  120  STGIYGMDFYVVLERPGYRVGRR  142



>ref|NP_001042339.1| Os01g0205500 [Oryza sativa Japonica Group]
 dbj|BAA92964.1| putative 60S ribosomal protein L11-1 [Oryza sativa Japonica Group]
 dbj|BAF04253.1| Os01g0205500 [Oryza sativa Japonica Group]
 gb|EAY72954.1| hypothetical protein OsI_00826 [Oryza sativa Indica Group]
 gb|EAZ10965.1| hypothetical protein OsJ_00808 [Oryza sativa Japonica Group]
 dbj|BAG90584.1| unnamed protein product [Oryza sativa Japonica Group]
Length=182

 Score =   281 bits (719),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKK  NPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQANPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLER GYRVARR
Sbjct  121  STGIYGMDFYVVLERAGYRVARR  143



>gb|KHG13747.1| 60S ribosomal L11-1 -like protein [Gossypium arboreum]
Length=188

 Score =   281 bits (720),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/142 (96%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +1

Query  91   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  270
            ASEKKL+NPMREIKVQKLVLNI VGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  8    ASEKKLSNPMREIKVQKLVLNICVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  67

Query  271  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  450
            RRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  68   RRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  127

Query  451  TGIYGMDFYVVLERPGYRVARR  516
            TGIYGMDFYVVLER GYRV RR
Sbjct  128  TGIYGMDFYVVLERAGYRVGRR  149



>ref|XP_002270266.1| PREDICTED: 60S ribosomal protein L11-1-like [Vitis vinifera]
Length=183

 Score =   281 bits (719),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASE+KL NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSF 
Sbjct  1    MASERKLANPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFA  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRV RR
Sbjct  121  STGIYGMDFYVVLERPGYRVGRR  143



>ref|XP_010102117.1| 60S ribosomal protein L11-2 [Morus notabilis]
 gb|EXB92367.1| 60S ribosomal protein L11-2 [Morus notabilis]
Length=207

 Score =   281 bits (720),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 137/142 (96%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +1

Query  91   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  270
            ASEKKL NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFGI
Sbjct  27   ASEKKLANPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFGI  86

Query  271  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  450
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  87   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  146

Query  451  TGIYGMDFYVVLERPGYRVARR  516
            TGIYGMDFYVVLER GYRV RR
Sbjct  147  TGIYGMDFYVVLERAGYRVGRR  168



>ref|XP_001759707.1| predicted protein [Physcomitrella patens]
 ref|XP_001778446.1| predicted protein [Physcomitrella patens]
 ref|XP_001779787.1| predicted protein [Physcomitrella patens]
 gb|EDQ55388.1| predicted protein [Physcomitrella patens]
 gb|EDQ56721.1| predicted protein [Physcomitrella patens]
 gb|EDQ75619.1| predicted protein [Physcomitrella patens]
Length=181

 Score =   280 bits (717),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKK+ N MREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKMQNSMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS++GCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSESGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRV RR
Sbjct  121  STGIYGMDFYVVLERPGYRVGRR  143



>gb|ADY38658.1| putative 60S ribosomal protein L11 [Wolffia arrhiza]
Length=182

 Score =   280 bits (717),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKK +NPMREIKVQKLVLNI VGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNICVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLER GYRV RR
Sbjct  121  STGIYGMDFYVVLERAGYRVGRR  143



>ref|XP_008795915.1| PREDICTED: 60S ribosomal protein L11-like [Phoenix dactylifera]
Length=179

 Score =   279 bits (714),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 141/143 (99%), Gaps = 1/143 (1%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEK+ +NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKQ-SNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  59

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  60   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  119

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVLERPGYRV RR
Sbjct  120  STGIYGMDFFVVLERPGYRVGRR  142



>ref|XP_001762314.1| predicted protein [Physcomitrella patens]
 gb|EDQ72781.1| predicted protein [Physcomitrella patens]
Length=181

 Score =   279 bits (713),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKK  N MREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQQNSMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS++GCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSESGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRV RR
Sbjct  121  STGIYGMDFYVVLERPGYRVGRR  143



>gb|AAT08727.1| 60S ribosomal protein L11 [Hyacinthus orientalis]
Length=189

 Score =   279 bits (713),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/141 (96%), Positives = 137/141 (97%), Gaps = 0/141 (0%)
 Frame = +1

Query  94   SEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIR  273
              KKL NPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGIR
Sbjct  10   QHKKLANPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIR  69

Query  274  RNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPST  453
            RNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPST
Sbjct  70   RNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPST  129

Query  454  GIYGMDFYVVLERPGYRVARR  516
            GIYGMDFYVVLERPGYRV RR
Sbjct  130  GIYGMDFYVVLERPGYRVGRR  150



>ref|XP_006648487.1| PREDICTED: 60S ribosomal protein L11-like [Oryza brachyantha]
Length=189

 Score =   278 bits (712),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 135/142 (95%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +1

Query  91   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  270
            A EKK +NPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  9    ALEKKQSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGI  68

Query  271  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  450
            RRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDPS
Sbjct  69   RRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDPS  128

Query  451  TGIYGMDFYVVLERPGYRVARR  516
            TGIYGMDFYVVLER GYRVARR
Sbjct  129  TGIYGMDFYVVLERAGYRVARR  150



>ref|XP_001760204.1| predicted protein [Physcomitrella patens]
 gb|EDQ74960.1| predicted protein [Physcomitrella patens]
Length=181

 Score =   277 bits (709),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKK  N MREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQQNLMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS++GCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSESGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRV RR
Sbjct  121  STGIYGMDFYVVLERPGYRVGRR  143



>ref|XP_003565263.1| PREDICTED: 60S ribosomal protein L11 [Brachypodium distachyon]
 ref|XP_003568752.1| PREDICTED: 60S ribosomal protein L11 [Brachypodium distachyon]
 ref|XP_003571886.1| PREDICTED: 60S ribosomal protein L11 [Brachypodium distachyon]
Length=180

 Score =   277 bits (709),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            M++EKK  NPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MSTEKKQLNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLG+KYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGMKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLER GYRV+RR
Sbjct  121  STGIYGMDFYVVLERAGYRVSRR  143



>gb|EMS61347.1| 60S ribosomal protein L11 [Triticum urartu]
Length=180

 Score =   276 bits (706),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            M++EKK  NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MSTEKKQLNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVT+RG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLG+KYDP
Sbjct  61   IRRNEKIACYVTIRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGMKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVLER GYRV+RR
Sbjct  121  STGIYGMDFFVVLERAGYRVSRR  143



>gb|KHN20558.1| Endoglucanase 9 [Glycine soja]
Length=677

 Score =   291 bits (745),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 154/172 (90%), Gaps = 10/172 (6%)
 Frame = +1

Query  1    GYILGFLPPLNTASFPGAGLqpqpqq*SDMASEKKLNNPMREIKVQKLVLNISVGESGDR  180
             Y  GF+  ++T+SF  A         + MASEKKL+NPMREIKVQKLVLNISVGESGDR
Sbjct  478  AYFAGFV--ISTSSFHTAA--------ATMASEKKLSNPMREIKVQKLVLNISVGESGDR  527

Query  181  LTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEY  360
            LTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEY
Sbjct  528  LTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEY  587

Query  361  ELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYRVARR  516
            ELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDF+VVLERPGYRV RR
Sbjct  588  ELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFFVVLERPGYRVGRR  639



>ref|XP_002981065.1| hypothetical protein SELMODRAFT_444767 [Selaginella moellendorffii]
 ref|XP_002982539.1| hypothetical protein SELMODRAFT_271568 [Selaginella moellendorffii]
 gb|EFJ16292.1| hypothetical protein SELMODRAFT_271568 [Selaginella moellendorffii]
 gb|EFJ17766.1| hypothetical protein SELMODRAFT_444767 [Selaginella moellendorffii]
Length=177

 Score =   274 bits (701),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +1

Query  109  NNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKI  288
             NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ PVFSKAR+TVRSFGIRRNEKI
Sbjct  5    QNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQQPVFSKARFTVRSFGIRRNEKI  64

Query  289  ACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGM  468
            ACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGM
Sbjct  65   ACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGM  124

Query  469  DFYVVLERPGYRVARR  516
            DF+VVLERPGYRVARR
Sbjct  125  DFFVVLERPGYRVARR  140



>dbj|BAJ85332.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95551.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMT17477.1| 60S ribosomal protein L11 [Aegilops tauschii]
Length=180

 Score =   274 bits (701),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            M++EKK  N MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MSTEKKQLNTMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVT+RG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLG+KYDP
Sbjct  61   IRRNEKIACYVTIRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGMKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVLER GYRV+RR
Sbjct  121  STGIYGMDFFVVLERAGYRVSRR  143



>gb|KHG21292.1| 60S ribosomal protein L11-1 [Gossypium arboreum]
Length=228

 Score =   275 bits (704),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 141/160 (88%), Gaps = 17/160 (11%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  30   MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  89

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGI----  435
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGI    
Sbjct  90   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGINSHL  149

Query  436  -------------KYDPSTGIYGMDFYVVLERPGYRVARR  516
                         +YDPSTGIYGMDFYVVLER GYRV RR
Sbjct  150  TRLSNRTRFGIINRYDPSTGIYGMDFYVVLERAGYRVGRR  189



>gb|KHG21293.1| 60S ribosomal protein L11-1 [Gossypium arboreum]
Length=199

 Score =   274 bits (701),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 141/160 (88%), Gaps = 17/160 (11%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGI----  435
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGI    
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGINSHL  120

Query  436  -------------KYDPSTGIYGMDFYVVLERPGYRVARR  516
                         +YDPSTGIYGMDFYVVLER GYRV RR
Sbjct  121  TRLSNRTRFGIINRYDPSTGIYGMDFYVVLERAGYRVGRR  160



>pdb|3J61|J Chain J, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 gb|AAW50983.1| ribosomal protein L11 [Triticum aestivum]
 gb|EMT22063.1| 60S ribosomal protein L11 [Aegilops tauschii]
Length=180

 Score =   273 bits (699),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            M++EKK  NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MSTEKKQLNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVT+RG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLG+KYDP
Sbjct  61   IRRNEKIACYVTIRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGMKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVLER GYRV+RR
Sbjct  121  STGIYGMDFFVVLERAGYRVSRR  143



>emb|CDY60533.1| BnaAnng16950D [Brassica napus]
 emb|CDY23103.1| BnaC09g18570D [Brassica napus]
 emb|CDY00582.1| BnaC04g23430D [Brassica napus]
 emb|CDX77611.1| BnaC07g18650D [Brassica napus]
Length=172

 Score =   270 bits (690),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 131/133 (98%), Positives = 133/133 (100%), Gaps = 0/133 (0%)
 Frame = +1

Query  118  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  297
            MR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  298  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  477
            VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  478  VVLERPGYRVARR  516
            VVLERPGYRVARR
Sbjct  121  VVLERPGYRVARR  133



>emb|CDY62552.1| BnaA03g58370D [Brassica napus]
 emb|CDY39447.1| BnaAnng05780D [Brassica napus]
 emb|CDX78887.1| BnaA01g09540D [Brassica napus]
Length=172

 Score =   270 bits (690),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 131/133 (98%), Positives = 133/133 (100%), Gaps = 0/133 (0%)
 Frame = +1

Query  118  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  297
            MR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  298  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  477
            VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  478  VVLERPGYRVARR  516
            VVLERPGYRVARR
Sbjct  121  VVLERPGYRVARR  133



>gb|EMS66091.1| 60S ribosomal protein L11 [Triticum urartu]
Length=225

 Score =   271 bits (694),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +1

Query  91   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  270
            ++EKK  NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFGI
Sbjct  47   STEKKQLNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFGI  106

Query  271  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  450
            RRNEKIACYVT+RG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLG+KYDPS
Sbjct  107  RRNEKIACYVTIRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGMKYDPS  166

Query  451  TGIYGMDFYVVLERPGYRVARR  516
            TGIYGMDF+VVLER GYRV+RR
Sbjct  167  TGIYGMDFFVVLERAGYRVSRR  188



>gb|ACN35575.1| unknown [Zea mays]
 gb|AFW71161.1| hypothetical protein ZEAMMB73_877153 [Zea mays]
 gb|AFW71162.1| hypothetical protein ZEAMMB73_877153 [Zea mays]
Length=172

 Score =   270 bits (689),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 131/133 (98%), Positives = 132/133 (99%), Gaps = 0/133 (0%)
 Frame = +1

Query  118  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  297
            MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  298  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  477
            VTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  478  VVLERPGYRVARR  516
            VVLER GYRVARR
Sbjct  121  VVLERAGYRVARR  133



>gb|KHN11195.1| 60S ribosomal protein L11 [Glycine soja]
Length=171

 Score =   269 bits (688),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 131/133 (98%), Positives = 132/133 (99%), Gaps = 0/133 (0%)
 Frame = +1

Query  118  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  297
            MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  298  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  477
            VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDF+
Sbjct  61   VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFF  120

Query  478  VVLERPGYRVARR  516
            VVLERPGYRV RR
Sbjct  121  VVLERPGYRVGRR  133



>emb|CDP15952.1| unnamed protein product [Coffea canephora]
Length=173

 Score =   269 bits (688),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 130/133 (98%), Positives = 133/133 (100%), Gaps = 0/133 (0%)
 Frame = +1

Query  118  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  297
            MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFGIRRNEKIACY  60

Query  298  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  477
            VTVRGDKAMQLLESGLKVKEYELL+RNFS+TGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGDKAMQLLESGLKVKEYELLKRNFSETGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  478  VVLERPGYRVARR  516
            VVLERPGYRVARR
Sbjct  121  VVLERPGYRVARR  133



>ref|XP_010516520.1| PREDICTED: 60S ribosomal protein L11-1-like [Camelina sativa]
 gb|AAL69452.1| At2g42740/F7D19.26 [Arabidopsis thaliana]
Length=172

 Score =   268 bits (686),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 130/133 (98%), Positives = 133/133 (100%), Gaps = 0/133 (0%)
 Frame = +1

Query  118  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  297
            MR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  298  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  477
            VTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  478  VVLERPGYRVARR  516
            VVLERPGYRVARR
Sbjct  121  VVLERPGYRVARR  133



>ref|NP_851137.1| 60S ribosomal protein L11-2 [Arabidopsis thaliana]
 gb|AAM64289.1| ribosomal protein L11, cytosolic [Arabidopsis thaliana]
 gb|AED95296.1| 60S ribosomal protein L11-2 [Arabidopsis thaliana]
Length=172

 Score =   268 bits (685),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 130/133 (98%), Positives = 133/133 (100%), Gaps = 0/133 (0%)
 Frame = +1

Query  118  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  297
            MR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  298  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  477
            VTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  478  VVLERPGYRVARR  516
            VVLERPGYRVARR
Sbjct  121  VVLERPGYRVARR  133



>tpg|DAA52967.1| TPA: hypothetical protein ZEAMMB73_694767 [Zea mays]
Length=831

 Score =   286 bits (733),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKK +NPMRE+KVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREMKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLER GYRVARR
Sbjct  121  STGIYGMDFYVVLERAGYRVARR  143



>gb|ACD56663.1| putative ribosomal protein [Gossypium arboreum]
Length=172

 Score =   267 bits (682),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 130/133 (98%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +1

Query  118  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  297
            MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  298  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  477
            VTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  478  VVLERPGYRVARR  516
            VVLER GYRV RR
Sbjct  121  VVLERAGYRVGRR  133



>gb|AAT64021.1| putative ribosomal protein [Gossypium hirsutum]
 gb|AAT64031.1| putative ribosomal protein [Gossypium hirsutum]
 gb|ACD56649.1| putative ribosomal protein [Gossypioides kirkii]
 gb|KJB68370.1| hypothetical protein B456_010G241400 [Gossypium raimondii]
 gb|KJB69700.1| hypothetical protein B456_011G038200 [Gossypium raimondii]
Length=172

 Score =   267 bits (682),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 130/133 (98%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +1

Query  118  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  297
            MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  298  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  477
            VTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  478  VVLERPGYRVARR  516
            VVLER GYRV RR
Sbjct  121  VVLERAGYRVGRR  133



>gb|KJB34908.1| hypothetical protein B456_006G089700 [Gossypium raimondii]
Length=172

 Score =   267 bits (682),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 130/133 (98%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +1

Query  118  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  297
            MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  298  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  477
            VTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  478  VVLERPGYRVARR  516
            VVLER GYRV RR
Sbjct  121  VVLERAGYRVGRR  133



>ref|XP_007048734.1| Ribosomal L5P family protein isoform 2 [Theobroma cacao]
 gb|EOX92891.1| Ribosomal L5P family protein isoform 2 [Theobroma cacao]
Length=172

 Score =   267 bits (682),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 130/133 (98%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +1

Query  118  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  297
            MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  298  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  477
            VTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  478  VVLERPGYRVARR  516
            VVLER GYRV RR
Sbjct  121  VVLERAGYRVGRR  133



>emb|CBI22012.3| unnamed protein product [Vitis vinifera]
Length=173

 Score =   266 bits (681),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 129/133 (97%), Positives = 132/133 (99%), Gaps = 0/133 (0%)
 Frame = +1

Query  118  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  297
            MR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  298  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  477
            VTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDF+
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFF  120

Query  478  VVLERPGYRVARR  516
            VVLERPGYRV RR
Sbjct  121  VVLERPGYRVGRR  133



>ref|XP_002438544.1| hypothetical protein SORBIDRAFT_10g021710 [Sorghum bicolor]
 gb|EER89911.1| hypothetical protein SORBIDRAFT_10g021710 [Sorghum bicolor]
Length=183

 Score =   267 bits (682),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 136/144 (94%), Gaps = 1/144 (1%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLE-QLSGQTPVFSKARYTVRSF  264
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRAAK++     GQ+PVFSKARYTVRSF
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKLMHLSWRGQSPVFSKARYTVRSF  60

Query  265  GIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  444
            GIRRNEKI CYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYD
Sbjct  61   GIRRNEKIVCYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYD  120

Query  445  PSTGIYGMDFYVVLERPGYRVARR  516
            PSTGIYGMDFYVVLER GYRVARR
Sbjct  121  PSTGIYGMDFYVVLERAGYRVARR  144



>ref|XP_006656151.1| PREDICTED: 60S ribosomal protein L11-like [Oryza brachyantha]
Length=172

 Score =   265 bits (678),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/133 (96%), Positives = 132/133 (99%), Gaps = 0/133 (0%)
 Frame = +1

Query  118  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  297
            MREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFGIRRNEKIACY  60

Query  298  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  477
            VTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  478  VVLERPGYRVARR  516
            VVLER GYRVARR
Sbjct  121  VVLERAGYRVARR  133



>ref|XP_001751962.1| predicted protein [Physcomitrella patens]
 gb|EDQ83397.1| predicted protein [Physcomitrella patens]
Length=171

 Score =   265 bits (676),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 127/133 (95%), Positives = 132/133 (99%), Gaps = 0/133 (0%)
 Frame = +1

Query  118  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  297
            MREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFGIRRNEKIACY  60

Query  298  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  477
            VTVRG+KAMQLLESGLKVKEYELLRRNFS++GCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSESGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  478  VVLERPGYRVARR  516
            VVLERPGYRV RR
Sbjct  121  VVLERPGYRVGRR  133



>emb|CBI30709.3| unnamed protein product [Vitis vinifera]
Length=173

 Score =   264 bits (675),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 128/133 (96%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +1

Query  118  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  297
            MR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSF IRRNEKIACY
Sbjct  1    MRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFAIRRNEKIACY  60

Query  298  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  477
            VTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  478  VVLERPGYRVARR  516
            VVLERPGYRV RR
Sbjct  121  VVLERPGYRVGRR  133



>gb|ADR71243.1| 60S ribosomal protein L11A [Hevea brasiliensis]
Length=172

 Score =   263 bits (672),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/133 (97%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +1

Query  118  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  297
            MREIKVQK VLNISVGESGDRLTRAAKVLEQLSGQ PVFSKARYTVRSFGIR NEKIACY
Sbjct  1    MREIKVQKRVLNISVGESGDRLTRAAKVLEQLSGQAPVFSKARYTVRSFGIRCNEKIACY  60

Query  298  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  477
            VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  478  VVLERPGYRVARR  516
            VVLERPGYRV RR
Sbjct  121  VVLERPGYRVGRR  133



>gb|AAB82139.1| ribosomal protein [Oryza sativa Indica Group]
Length=182

 Score =   263 bits (672),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKK +NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQL GQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLIGQSPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKE ELLRR+ S+TGCFGFGIQEHIDLGI+ DP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKECELLRRSCSETGCFGFGIQEHIDLGIQCDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STG YGMDFYVVLER GYRVARR
Sbjct  121  STGFYGMDFYVVLERAGYRVARR  143



>gb|AAD21733.1| 60S ribosomal protein L11B [Arabidopsis thaliana]
Length=182

 Score =   259 bits (661),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 133/143 (93%), Gaps = 10/143 (7%)
 Frame = +1

Query  118  MREIKVQKLVLNISVGESGDRLTRAAKV----------LEQLSGQTPVFSKARYTVRSFG  267
            MR+IKVQKLVLNISVGESGDRLTRA+KV          LEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MRDIKVQKLVLNISVGESGDRLTRASKVPPVFYPFSVVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRVARR
Sbjct  121  STGIYGMDFYVVLERPGYRVARR  143



>dbj|BAD53703.1| putative 60S ribosomal protein L11-1 [Oryza sativa Japonica Group]
Length=182

 Score =   257 bits (656),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 132/143 (92%), Gaps = 10/143 (7%)
 Frame = +1

Query  118  MREIKVQKLVLNISVGESGDRLTRAAKV----------LEQLSGQTPVFSKARYTVRSFG  267
            MREIKVQKLVLNISVGESGDRLTRA+KV          LEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRASKVWPIFSMYFQVLEQLSGQSPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLER GYRVARR
Sbjct  121  STGIYGMDFYVVLERAGYRVARR  143



>gb|AAQ96376.1| ribosomal protein L11-like protein [Solanum palustre]
Length=163

 Score =   254 bits (650),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/126 (98%), Positives = 126/126 (100%), Gaps = 0/126 (0%)
 Frame = +1

Query  139  KLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDK  318
            KLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFGIRRNEKIACYVTVRG+K
Sbjct  1    KLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFGIRRNEKIACYVTVRGEK  60

Query  319  AMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPG  498
            AMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPG
Sbjct  61   AMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPG  120

Query  499  YRVARR  516
            YRVARR
Sbjct  121  YRVARR  126



>gb|KHN28096.1| 60S ribosomal protein L11 [Glycine soja]
Length=170

 Score =   253 bits (646),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 127/133 (95%), Gaps = 1/133 (1%)
 Frame = +1

Query  118  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  297
            MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ PVFSK    +RSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQAPVFSKG-TLIRSFGIRRNEKIACY  59

Query  298  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  477
            VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDF+
Sbjct  60   VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFF  119

Query  478  VVLERPGYRVARR  516
            VVLERPGYRV RR
Sbjct  120  VVLERPGYRVGRR  132



>gb|KDD76069.1| hypothetical protein H632_c370p1 [Helicosporidium sp. ATCC 50920]
Length=179

 Score =   248 bits (633),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKK  NPMR+I+V KLVLN  VGESGDRL +AAKVLEQL+GQ PVF +ARYTVR + 
Sbjct  1    MASEKKKQNPMRDIRVAKLVLNCEVGESGDRLQKAAKVLEQLTGQQPVFGRARYTVRQWS  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRR EKI+C+VTVRGDKA+QLLE+GLKVKEYELLRRNFSDTG FGFGI EHIDLGIKYDP
Sbjct  61   IRRGEKISCFVTVRGDKALQLLEAGLKVKEYELLRRNFSDTGNFGFGISEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRV++R
Sbjct  121  STGIYGMDFYVVLERPGYRVSKR  143



>ref|XP_011397124.1| 60S ribosomal protein L11-1 [Auxenochlorella protothecoides]
 gb|KFM24237.1| 60S ribosomal protein L11-1 [Auxenochlorella protothecoides]
Length=180

 Score =   247 bits (631),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            M ++KK +NPMREI+V KLVLN  VGESGDRL +AAKVLEQL+GQ PVF KARYTVR + 
Sbjct  1    MVADKKASNPMREIRVAKLVLNCCVGESGDRLQKAAKVLEQLTGQQPVFGKARYTVRQWS  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            +RRNEKI+C+VTVRG+KA+QLLE+GLKVKEYELLRRNFSD+G FGFGI EHIDLGIKYDP
Sbjct  61   VRRNEKISCHVTVRGEKALQLLEAGLKVKEYELLRRNFSDSGNFGFGITEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLERPGYRVA+R
Sbjct  121  STGIYGMDFYVVLERPGYRVAKR  143



>emb|CBJ30107.1| conserved unknown protein [Ectocarpus siliculosus]
Length=173

 Score =   246 bits (628),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 129/136 (95%), Gaps = 0/136 (0%)
 Frame = +1

Query  109  NNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKI  288
             NPMR++KV KLVLN SVGESGDRLTRAAKVLEQL+GQ+PV+SKARYTVRSFGIRRNEKI
Sbjct  6    TNPMRDLKVDKLVLNCSVGESGDRLTRAAKVLEQLTGQSPVYSKARYTVRSFGIRRNEKI  65

Query  289  ACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGM  468
            AC+VTVRGDKA+++LE GLKVKEYEL R+NFS+TG FGFGIQEHIDLG+KYDPSTGIYGM
Sbjct  66   ACHVTVRGDKALEILERGLKVKEYELKRKNFSNTGSFGFGIQEHIDLGLKYDPSTGIYGM  125

Query  469  DFYVVLERPGYRVARR  516
            DF+VVL RPGYRVA+R
Sbjct  126  DFFVVLNRPGYRVAKR  141



>ref|XP_009617442.1| PREDICTED: 60S ribosomal protein L11-1-like [Nicotiana tomentosiformis]
Length=171

 Score =   246 bits (627),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +1

Query  118  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  297
            MREIKV KL LNIS+ ESGDRLTRAAKVLEQLSGQ+P+FSKARYTVRSFGIRRNEKI  Y
Sbjct  1    MREIKVHKLFLNISISESGDRLTRAAKVLEQLSGQSPIFSKARYTVRSFGIRRNEKIPYY  60

Query  298  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  477
            VTVRGDKAMQL ESGLKVKEYELLRRNFS+T CFGFGIQEHIDLGIKYDPSTGIYG++FY
Sbjct  61   VTVRGDKAMQLFESGLKVKEYELLRRNFSETSCFGFGIQEHIDLGIKYDPSTGIYGINFY  120

Query  478  VVLERPGYRVAR  513
            VVLE PGYRVAR
Sbjct  121  VVLEHPGYRVAR  132



>ref|XP_005647682.1| ribosomal protein L5 [Coccomyxa subellipsoidea C-169]
 gb|EIE23138.1| ribosomal protein L5 [Coccomyxa subellipsoidea C-169]
Length=180

 Score =   244 bits (623),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            M ++KK  NPMREI+V KLVLNI VGESGDRL +AAKVLEQL+GQ PVF KARYTVR+F 
Sbjct  1    MVNDKKTTNPMREIRVAKLVLNICVGESGDRLQKAAKVLEQLTGQQPVFGKARYTVRTFA  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKI+  VTVRG+KA+QL+E+GLKVKEYELLRRNFS+TG FGFGI EHIDLGIKYDP
Sbjct  61   IRRNEKISTSVTVRGEKALQLIEAGLKVKEYELLRRNFSETGNFGFGINEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYVVLER GYRVARR
Sbjct  121  STGIYGMDFYVVLERAGYRVARR  143



>gb|KIY97763.1| 60S ribosomal protein L11, partial [Monoraphidium neglectum]
 gb|KIZ07647.1| 60S ribosomal protein L11 [Monoraphidium neglectum]
Length=180

 Score =   243 bits (620),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            M ++ K  NPMREI+V KLVLNI VGESGDRL +AAKVLEQL+GQ PV+ KARYTVRSF 
Sbjct  1    MVNDAKAGNPMREIRVSKLVLNICVGESGDRLQKAAKVLEQLTGQQPVYGKARYTVRSFS  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKI+C VTVRG+KAMQLL++GLKVKEYEL+R+NFS++G FGFGI EHIDLGIKYDP
Sbjct  61   IRRNEKISCSVTVRGEKAMQLLDAGLKVKEYELIRKNFSESGNFGFGISEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDFYV LERPGYRVARR
Sbjct  121  STGIYGMDFYVCLERPGYRVARR  143



>gb|KHN95345.1| 60S ribosomal protein L11 [Metarhizium album ARSEF 1941]
Length=173

 Score =   240 bits (612),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 129/143 (90%), Gaps = 1/143 (1%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            M+SEK LNNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MSSEK-LNNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            S GIYGMDFY  + RPG RV RR
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRR  142



>ref|NP_595899.1| 60S ribosomal protein L11 [Schizosaccharomyces pombe 972h-]
 ref|NP_594150.1| 60S ribosomal protein L11 [Schizosaccharomyces pombe 972h-]
 sp|Q10157.1|RL11_SCHPO RecName: Full=60S ribosomal protein L11 [Schizosaccharomyces 
pombe 972h-]
 emb|CAA93230.1| 60S ribosomal protein L11 (predicted) [Schizosaccharomyces pombe]
 dbj|BAA31552.1| ribosomal protein L11 homolog [Schizosaccharomyces pombe]
 emb|CAB52808.1| 60S ribosomal protein L11 (predicted) [Schizosaccharomyces pombe]
Length=174

 Score =   239 bits (611),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  100  KKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRN  279
            +K  NPM+E+++ KLVLNIS+GESGDRLTRAAKVLEQLSGQTPVFSKARYT+R FGIRRN
Sbjct  3    EKAQNPMKELRISKLVLNISLGESGDRLTRAAKVLEQLSGQTPVFSKARYTIRRFGIRRN  62

Query  280  EKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGI  459
            EKIAC+VTVRG KA ++LE GLKVKEYEL +RNFS TG FGFGIQEHIDLGIKYDPS GI
Sbjct  63   EKIACHVTVRGPKAEEILERGLKVKEYELKKRNFSATGNFGFGIQEHIDLGIKYDPSIGI  122

Query  460  YGMDFYVVLERPGYRVARR  516
            YGMDFYVV++RPG RVARR
Sbjct  123  YGMDFYVVMDRPGMRVARR  141



>ref|XP_009261766.1| hypothetical protein FPSE_10374 [Fusarium pseudograminearum CS3096]
 ref|XP_011316841.1| 60S ribosomal protein L11 [Fusarium graminearum PH-1]
 gb|EKJ69441.1| hypothetical protein FPSE_10374 [Fusarium pseudograminearum CS3096]
 gb|ESU06356.1| 60S ribosomal protein L11 [Fusarium graminearum PH-1]
 gb|EYB33769.1| hypothetical protein FG05_01081 [Fusarium graminearum]
 emb|CEF73150.1| unnamed protein product [Fusarium graminearum]
Length=173

 Score =   239 bits (611),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEK  NNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-ANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            S GIYGMDFY  + RPG RV RR
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRR  142



>gb|KJB57390.1| hypothetical protein B456_009G161300 [Gossypium raimondii]
Length=154

 Score =   239 bits (609),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/124 (94%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIK   
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKCKS  120

Query  448  STGI  459
              GI
Sbjct  121  RVGI  124



>emb|CCE35354.1| probable ribosomal protein L11.e.A, cytosolic [Claviceps purpurea 
20.1]
Length=173

 Score =   239 bits (610),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 129/143 (90%), Gaps = 1/143 (1%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEK  NNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-ANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            S GIYGMDFY  + RPG RV+RR
Sbjct  120  SIGIYGMDFYCCMTRPGERVSRR  142



>gb|KFA66324.1| hypothetical protein S40285_01884 [Stachybotrys chlorohalonata 
IBT 40285]
Length=173

 Score =   239 bits (610),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEK  NNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-ANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKI+ +VTVRG KA ++LE GLKVKEYEL RRNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKISVHVTVRGPKAEEILERGLKVKEYELRRRNFSETGNFGFGISEHIDLGIKYDP  119

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            S GIYGMDFY  + RPG RV RR
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRR  142



>gb|EQL04255.1| Ribosomal protein L5 [Ophiocordyceps sinensis CO18]
Length=173

 Score =   239 bits (610),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEK  NNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-ANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            S GIYGMDFY  + RPG RV RR
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRR  142



>gb|EGU80777.1| hypothetical protein FOXB_08644 [Fusarium oxysporum Fo5176]
 gb|EMT62178.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. cubense 
race 4]
 gb|ENH60794.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. cubense 
race 1]
 emb|CCT62200.1| probable ribosomal protein L11.e.A, cytosolic [Fusarium fujikuroi 
IMI 58289]
 gb|EWG37687.1| 60S ribosomal protein L11 [Fusarium verticillioides 7600]
 gb|EWG37688.1| 60S ribosomal protein L11 [Fusarium verticillioides 7600]
 gb|EWY94221.1| 60S ribosomal protein L11 [Fusarium oxysporum FOSC 3-a]
 gb|EWZ50488.1| 60S ribosomal protein L11 [Fusarium oxysporum Fo47]
 gb|EWZ92049.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EXA53310.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXK47721.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. melonis 
26406]
 gb|EXK89881.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. raphani 
54005]
 gb|EXL49418.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXL83529.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
 gb|EXM10892.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
 gb|EXM28225.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. vasinfectum 
25433]
Length=173

 Score =   239 bits (610),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEK  NNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-ANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            S GIYGMDFY  + RPG RV RR
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRR  142



>gb|KDB13460.1| 60S ribosomal protein L11 [Ustilaginoidea virens]
Length=173

 Score =   239 bits (610),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEK  NNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-ANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            S GIYGMDFY  + RPG RV RR
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRR  142



>gb|KFA73465.1| hypothetical protein S40288_08466 [Stachybotrys chartarum IBT 
40288]
Length=173

 Score =   239 bits (610),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 129/143 (90%), Gaps = 1/143 (1%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEK +NNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-VNNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKI+ +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKISVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            S GIYGMDFY  + RPG RV RR
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRR  142



>ref|XP_007811586.1| 60S ribosomal protein L11 [Metarhizium acridum CQMa 102]
 ref|XP_007820170.1| Ribosomal protein L5 [Metarhizium robertsii ARSEF 23]
 gb|EFY88628.1| 60S ribosomal protein L11 [Metarhizium acridum CQMa 102]
 gb|EFZ00204.1| Ribosomal protein L5 [Metarhizium robertsii ARSEF 23]
 gb|EXV02661.1| 60S ribosomal protein L11 [Metarhizium robertsii]
 gb|KFG86990.1| 60S ribosomal protein L11 [Metarhizium anisopliae]
 gb|KID60088.1| Ribosomal protein L5, partial [Metarhizium anisopliae ARSEF 549]
 gb|KID88047.1| Ribosomal protein L5 [Metarhizium guizhouense ARSEF 977]
 gb|KIE01988.1| Ribosomal protein L5, partial [Metarhizium majus ARSEF 297]
Length=173

 Score =   239 bits (609),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEK  NNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-ANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            S GIYGMDFY  + RPG RV RR
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRR  142



>gb|AFW65989.1| hypothetical protein ZEAMMB73_747842 [Zea mays]
Length=127

 Score =   237 bits (604),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 116/118 (98%), Positives = 117/118 (99%), Gaps = 0/118 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKY  441
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKY
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKY  118



>emb|CCE35372.1| probable ribosomal protein L11.e.A, cytosolic [Claviceps purpurea 
20.1]
Length=173

 Score =   238 bits (607),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 129/143 (90%), Gaps = 1/143 (1%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            M+SEK  NNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MSSEK-ANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            S GIYGMDFY  + RPG RV+RR
Sbjct  120  SIGIYGMDFYCCMTRPGERVSRR  142



>gb|KEY71076.1| hypothetical protein S7711_00899 [Stachybotrys chartarum IBT 
7711]
 gb|KFA50220.1| hypothetical protein S40293_03699 [Stachybotrys chartarum IBT 
40293]
Length=173

 Score =   238 bits (607),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEK  NNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-ANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKI+ +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKISVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            S GIYGMDFY  + RPG RV RR
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRR  142



>gb|EPX72141.1| 60S ribosomal protein L11 [Schizosaccharomyces octosporus yFS286]
 gb|EPX75112.1| 60S ribosomal protein L11 [Schizosaccharomyces octosporus yFS286]
Length=174

 Score =   238 bits (607),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  100  KKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRN  279
            +K  NPM+E+++ KLVLNIS+GESGDRLTRAAKVLEQLSGQTPVFSKARYT+R FGIRRN
Sbjct  3    EKAQNPMKELRISKLVLNISLGESGDRLTRAAKVLEQLSGQTPVFSKARYTIRRFGIRRN  62

Query  280  EKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGI  459
            EKI+C+VTVRG KA ++LE GLKVKEYEL RRNFS TG FGFGIQEHIDLGIKYDPS GI
Sbjct  63   EKISCHVTVRGPKAEEILERGLKVKEYELKRRNFSATGNFGFGIQEHIDLGIKYDPSIGI  122

Query  460  YGMDFYVVLERPGYRVARR  516
            YGMDFYVV++RPG RV RR
Sbjct  123  YGMDFYVVMDRPGMRVTRR  141



>gb|KID77365.1| Ribosomal protein L5, partial [Metarhizium brunneum ARSEF 3297]
Length=173

 Score =   238 bits (606),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEK  NNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-ANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKI+ +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKISVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            S GIYGMDFY  + RPG RV RR
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRR  142



>gb|EPY52057.1| 60S ribosomal protein L11 [Schizosaccharomyces cryophilus OY26]
Length=174

 Score =   238 bits (606),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  100  KKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRN  279
            +K  NPM+E+++ KLVLNIS+GESGDRLTRAAKVLEQLSGQTPVFSKARYT+R FGIRRN
Sbjct  3    EKAQNPMKELRISKLVLNISLGESGDRLTRAAKVLEQLSGQTPVFSKARYTIRRFGIRRN  62

Query  280  EKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGI  459
            EKI+C+VTVRG KA ++LE GLKVKEYEL RRNFS TG FGFGIQEHIDLGIKYDPS GI
Sbjct  63   EKISCHVTVRGPKAEEILERGLKVKEYELKRRNFSATGNFGFGIQEHIDLGIKYDPSIGI  122

Query  460  YGMDFYVVLERPGYRVARR  516
            YGMDFYVV++RPG RV RR
Sbjct  123  YGMDFYVVMDRPGMRVTRR  141



>gb|EPY49528.1| 60S ribosomal protein L11 [Schizosaccharomyces cryophilus OY26]
Length=174

 Score =   237 bits (605),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  100  KKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRN  279
            +K  NPM+E+++ KLVLNIS+GESGDRLTRAAKVLEQLSGQTPVFSKARYT+R FGIRRN
Sbjct  3    EKAQNPMKELRISKLVLNISLGESGDRLTRAAKVLEQLSGQTPVFSKARYTIRRFGIRRN  62

Query  280  EKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGI  459
            EKI+C+VTVRG KA ++LE GLKVKEYEL RRNFS TG FGFGIQEHIDLGIKYDPS GI
Sbjct  63   EKISCHVTVRGPKAEEILERGLKVKEYELKRRNFSATGNFGFGIQEHIDLGIKYDPSIGI  122

Query  460  YGMDFYVVLERPGYRVARR  516
            YGMDFYVV++RPG RV RR
Sbjct  123  YGMDFYVVMDRPGMRVTRR  141



>ref|XP_003628238.1| 60S ribosomal protein L11 [Medicago truncatula]
Length=117

 Score =   235 bits (600),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/117 (98%), Positives = 117/117 (100%), Gaps = 0/117 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIK  438
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIK
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIK  117



>emb|CCI45988.1| unnamed protein product [Albugo candida]
Length=176

 Score =   237 bits (605),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MA +KK NN MREIKV KLV+N  VGESGD+LTRAA+VLEQL+GQ PV+SKARYTVRSFG
Sbjct  1    MAGDKKSNNAMREIKVDKLVINCCVGESGDKLTRAARVLEQLTGQKPVYSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKI+C+VTVRG+ A ++L+ GLKVKEYEL R+NFSDTG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKISCHVTVRGEMASEILDRGLKVKEYELKRKNFSDTGNFGFGIQEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVL RPG RV+ R
Sbjct  121  STGIYGMDFFVVLSRPGARVSHR  143



>ref|XP_006963013.1| 60S ribosomal protein L11, L5 family [Trichoderma reesei QM6a]
 gb|EGR51550.1| 60S ribosomal protein L11, L5 family [Trichoderma reesei QM6a]
 gb|ETS04354.1| 60S ribosomal protein L11 [Trichoderma reesei RUT C-30]
Length=173

 Score =   237 bits (604),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEK  +NPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-ASNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            S GIYGMDFY  + RPG RV RR
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRR  142



>gb|KIL95260.1| hypothetical protein FAVG1_02195 [Fusarium avenaceum]
Length=173

 Score =   237 bits (604),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MA+EK  NNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MATEK-ANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKI+ +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKISVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            S GIYGMDFY  + RPG RV RR
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRR  142



>gb|EHK17585.1| hypothetical protein TRIVIDRAFT_76021 [Trichoderma virens Gv29-8]
Length=173

 Score =   237 bits (604),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEK  +NPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-TSNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            S GIYGMDFY  + RPG RV RR
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRR  142



>ref|XP_003054198.1| 60S ribosomal protein L11 [Nectria haematococca mpVI 77-13-4]
 gb|EEU48485.1| predicted protein [Nectria haematococca mpVI 77-13-4]
Length=173

 Score =   236 bits (603),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEK  +NPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-TSNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            S GIYGMDFY  + RPG RV RR
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRR  142



>gb|ACN26136.1| unknown [Zea mays]
Length=168

 Score =   236 bits (602),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 115/118 (97%), Positives = 117/118 (99%), Gaps = 0/118 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MA EKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAHEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKY  441
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKY
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKY  118



>ref|XP_002173490.1| 60S ribosomal protein L11 [Schizosaccharomyces japonicus yFS275]
 gb|EEB07197.1| 60S ribosomal protein L11 [Schizosaccharomyces japonicus yFS275]
Length=174

 Score =   236 bits (603),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  100  KKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRN  279
            +K  NPM+E+++ KLVLNIS+GESGDRLTRAAKVLEQLSGQTPVFSKARYT+R FGIRRN
Sbjct  3    EKAQNPMKELRIAKLVLNISLGESGDRLTRAAKVLEQLSGQTPVFSKARYTIRRFGIRRN  62

Query  280  EKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGI  459
            EKIA +VTVRG KA ++LE GLKVKE+EL RRNFS TG FGFGIQEHIDLGIKYDPS GI
Sbjct  63   EKIAVHVTVRGPKAEEILERGLKVKEFELKRRNFSATGNFGFGIQEHIDLGIKYDPSIGI  122

Query  460  YGMDFYVVLERPGYRVARR  516
            YGMDFYVV++RPG RVARR
Sbjct  123  YGMDFYVVMDRPGMRVARR  141



>ref|XP_002171744.1| 60S ribosomal protein L11 [Schizosaccharomyces japonicus yFS275]
 gb|EEB05451.1| 60S ribosomal protein L11 [Schizosaccharomyces japonicus yFS275]
Length=174

 Score =   236 bits (603),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  100  KKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRN  279
            +K  NPM+E+++ KLVLNIS+GESGDRLTRAAKVLEQLSGQTPVFSKARYT+R FGIRRN
Sbjct  3    EKAQNPMKELRIAKLVLNISLGESGDRLTRAAKVLEQLSGQTPVFSKARYTIRRFGIRRN  62

Query  280  EKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGI  459
            EKIA +VTVRG KA ++LE GLKVKE+EL RRNFS TG FGFGIQEHIDLGIKYDPS GI
Sbjct  63   EKIAVHVTVRGPKAEEILERGLKVKEFELKRRNFSATGNFGFGIQEHIDLGIKYDPSIGI  122

Query  460  YGMDFYVVLERPGYRVARR  516
            YGMDFYVV++RPG RVARR
Sbjct  123  YGMDFYVVMDRPGMRVARR  141



>gb|EHK50062.1| hypothetical protein TRIATDRAFT_297405 [Trichoderma atroviride 
IMI 206040]
Length=173

 Score =   236 bits (602),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MA+EK  +NPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MATEKS-SNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            S GIYGMDFY  + RPG RV RR
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRR  142



>emb|CDS05445.1| Putative 60S ribosomal protein L11 [Absidia idahoensis var. thermophila]
Length=177

 Score =   236 bits (602),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 132/144 (92%), Gaps = 1/144 (1%)
 Frame = +1

Query  88   MASEKKLN-NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF  264
            M++EK++  NPMR++K++KLVLNISVGESGDRLTRAAKVLEQL+GQTPV+SKARYTVR+F
Sbjct  1    MSAEKQVKKNPMRQLKIEKLVLNISVGESGDRLTRAAKVLEQLTGQTPVYSKARYTVRTF  60

Query  265  GIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  444
            GIRRNEKIA +VTVRG KA ++LE GLKVKEYEL  RNFS+TG FGFGI EHIDLGIKYD
Sbjct  61   GIRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRARNFSETGNFGFGIDEHIDLGIKYD  120

Query  445  PSTGIYGMDFYVVLERPGYRVARR  516
            PS GIYGMD++VV+ RPGYRVARR
Sbjct  121  PSIGIYGMDYFVVMGRPGYRVARR  144



>ref|XP_003302643.1| 60S ribosomal protein L11 [Pyrenophora teres f. teres 0-1]
 gb|EFQ89243.1| hypothetical protein PTT_14551 [Pyrenophora teres f. teres 0-1]
Length=178

 Score =   236 bits (602),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = +1

Query  94   SEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIR  273
            S+ K +NPMRE+++QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FGIR
Sbjct  7    SDSKASNPMRELRIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGIR  66

Query  274  RNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPST  453
            RNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS++G FGFGI EHIDLGIKYDPS 
Sbjct  67   RNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSESGNFGFGISEHIDLGIKYDPSI  126

Query  454  GIYGMDFYVVLERPGYRVARR  516
            GIYGMDFYV + RPG RVA+R
Sbjct  127  GIYGMDFYVCMTRPGERVAKR  147



>ref|XP_001939101.1| 60S ribosomal protein L11 [Pyrenophora tritici-repentis Pt-1C-BFP]
 gb|EDU41820.1| 60S ribosomal protein L11 [Pyrenophora tritici-repentis Pt-1C-BFP]
Length=173

 Score =   236 bits (602),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = +1

Query  94   SEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIR  273
            S+ K +NPMRE+++QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FGIR
Sbjct  2    SDSKASNPMRELRIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGIR  61

Query  274  RNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPST  453
            RNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS++G FGFGI EHIDLGIKYDPS 
Sbjct  62   RNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSESGNFGFGISEHIDLGIKYDPSI  121

Query  454  GIYGMDFYVVLERPGYRVARR  516
            GIYGMDFYV + RPG RVA+R
Sbjct  122  GIYGMDFYVCMTRPGERVAKR  142



>ref|XP_008593474.1| 60S ribosomal protein L11 [Beauveria bassiana ARSEF 2860]
 gb|EJP70525.1| 60S ribosomal protein L11 [Beauveria bassiana ARSEF 2860]
 gb|KGQ11909.1| 60S ribosomal protein L11 [Beauveria bassiana D1-5]
Length=173

 Score =   236 bits (601),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 127/143 (89%), Gaps = 1/143 (1%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEK  NNPMRE+K+QKLVLNI VGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-ANNPMRELKIQKLVLNICVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKI+ +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKISVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            S GIYGMDFY  + RPG RV RR
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRR  142



>ref|XP_001794114.1| hypothetical protein SNOG_03556 [Phaeosphaeria nodorum SN15]
 gb|EAT88761.1| hypothetical protein SNOG_03556 [Phaeosphaeria nodorum SN15]
Length=173

 Score =   236 bits (601),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = +1

Query  94   SEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIR  273
            S+ K +NPMRE+++QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FGIR
Sbjct  2    SDSKASNPMRELRIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGIR  61

Query  274  RNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPST  453
            RNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS++G FGFGI EHIDLGIKYDPS 
Sbjct  62   RNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSESGNFGFGISEHIDLGIKYDPSI  121

Query  454  GIYGMDFYVVLERPGYRVARR  516
            GIYGMDFYV + RPG RVA+R
Sbjct  122  GIYGMDFYVCMTRPGERVAKR  142



>ref|XP_007702064.1| hypothetical protein COCSADRAFT_28532 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD62134.1| hypothetical protein COCSADRAFT_28532 [Bipolaris sorokiniana 
ND90Pr]
Length=176

 Score =   236 bits (601),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +1

Query  85   DMASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF  264
               S+ K +NPMRE+++QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+F
Sbjct  2    QWQSDSKASNPMRELRIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTF  61

Query  265  GIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  444
            GIRRNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS++G FGFGI EHIDLGIKYD
Sbjct  62   GIRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSESGNFGFGISEHIDLGIKYD  121

Query  445  PSTGIYGMDFYVVLERPGYRVARR  516
            PS GIYGMDFYV + RPG RVA+R
Sbjct  122  PSIGIYGMDFYVCMTRPGERVAKR  145



>emb|CDH52194.1| 60s ribosomal protein l11 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=177

 Score =   236 bits (601),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 132/144 (92%), Gaps = 1/144 (1%)
 Frame = +1

Query  88   MASEKKLN-NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF  264
            M++EK++  NPMR++K++KLVLNISVGESGDRLTRAAKVLEQL+GQTPV+SKARYTVR+F
Sbjct  1    MSAEKQVKKNPMRQLKIEKLVLNISVGESGDRLTRAAKVLEQLTGQTPVYSKARYTVRTF  60

Query  265  GIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  444
            GIRRNEKIA +VTVRG KA ++LE GLKVKEYEL  RNFS+TG FGFGI EHIDLGIKYD
Sbjct  61   GIRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRARNFSETGNFGFGIDEHIDLGIKYD  120

Query  445  PSTGIYGMDFYVVLERPGYRVARR  516
            PS GIYGMD++VV+ RPGYR+ARR
Sbjct  121  PSIGIYGMDYFVVMGRPGYRIARR  144



>gb|KIN04023.1| hypothetical protein OIDMADRAFT_51953 [Oidiodendron maius Zn]
Length=174

 Score =   235 bits (600),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MA   K NNPMRE+++QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MAEGDKSNNPMRELRIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  61   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            + GIYGMDFY  + RPG RVA+R
Sbjct  121  AIGIYGMDFYCCMTRPGERVAKR  143



>ref|XP_002507327.1| ribosomal protein L11 [Micromonas sp. RCC299]
 gb|ACO68585.1| ribosomal protein L11 [Micromonas sp. RCC299]
Length=170

 Score =   235 bits (600),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 125/134 (93%), Gaps = 1/134 (1%)
 Frame = +1

Query  118  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  297
            MRE+++ KLVLNISVGESGDRLT+AAKVLEQL+GQ PVFSKARYTVR+FGIRRNEKIA +
Sbjct  1    MREVRIHKLVLNISVGESGDRLTKAAKVLEQLTGQQPVFSKARYTVRTFGIRRNEKIATH  60

Query  298  VTV-RGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDF  474
            VTV   DKAMQ+LESGLKVKEYEL++ NFS TGCFGFGI EHIDLGIKYDPSTGIYGMDF
Sbjct  61   VTVGNRDKAMQILESGLKVKEYELIKSNFSQTGCFGFGISEHIDLGIKYDPSTGIYGMDF  120

Query  475  YVVLERPGYRVARR  516
            +VVLERPG+RVA+R
Sbjct  121  FVVLERPGFRVAKR  134



>ref|XP_007688169.1| hypothetical protein COCMIDRAFT_5484 [Bipolaris oryzae ATCC 44560]
 ref|XP_007706981.1| hypothetical protein COCCADRAFT_662 [Bipolaris zeicola 26-R-13]
 gb|EMD91114.1| hypothetical protein COCHEDRAFT_1214489 [Bipolaris maydis C5]
 gb|ENI05805.1| hypothetical protein COCC4DRAFT_49878 [Bipolaris maydis ATCC 
48331]
 gb|EUC38653.1| hypothetical protein COCCADRAFT_662 [Bipolaris zeicola 26-R-13]
 gb|EUC45279.1| hypothetical protein COCMIDRAFT_5484 [Bipolaris oryzae ATCC 44560]
 gb|EUN31867.1| hypothetical protein COCVIDRAFT_22426 [Bipolaris victoriae FI3]
Length=179

 Score =   235 bits (600),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = +1

Query  94   SEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIR  273
            S+ K +NPMRE+++QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FGIR
Sbjct  8    SDSKASNPMRELRIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGIR  67

Query  274  RNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPST  453
            RNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS++G FGFGI EHIDLGIKYDPS 
Sbjct  68   RNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSESGNFGFGISEHIDLGIKYDPSI  127

Query  454  GIYGMDFYVVLERPGYRVARR  516
            GIYGMDFYV + RPG RVA+R
Sbjct  128  GIYGMDFYVCMTRPGERVAKR  148



>emb|CEF97266.1| Ribosomal protein L5, conserved site [Ostreococcus tauri]
Length=179

 Score =   235 bits (600),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 128/144 (89%), Gaps = 2/144 (1%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MA +K   NPMR I++ KLVLNI VGESGDRLT+AAKVLEQL+GQ P+FSKARYTVR+FG
Sbjct  1    MAGDKS-ENPMRAIRIHKLVLNICVGESGDRLTKAAKVLEQLTGQQPIFSKARYTVRTFG  59

Query  268  IRRNEKIACYVTV-RGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  444
            IRRNEKI+ +VT+   DKAMQ+LESGLKVKE+ELL+RNFS TG FGFGI EHIDLGIKYD
Sbjct  60   IRRNEKISAHVTIGNRDKAMQILESGLKVKEFELLKRNFSATGNFGFGISEHIDLGIKYD  119

Query  445  PSTGIYGMDFYVVLERPGYRVARR  516
            PSTGIYGMDFYVVLERPGYRV RR
Sbjct  120  PSTGIYGMDFYVVLERPGYRVHRR  143



>ref|XP_006697554.1| putative ribosomal protein [Chaetomium thermophilum var. thermophilum 
DSM 1495]
 gb|EGS16972.1| putative ribosomal protein [Chaetomium thermophilum var. thermophilum 
DSM 1495]
Length=173

 Score =   235 bits (599),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 127/143 (89%), Gaps = 1/143 (1%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            M+SEK   NPMRE+++QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR FG
Sbjct  1    MSSEK-AQNPMRELRIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRQFG  59

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIA +VTVRG KA ++LE GLKVKEYEL RRNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRRRNFSETGNFGFGISEHIDLGIKYDP  119

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            S GIYGMDFY  + RPG RVA+R
Sbjct  120  SIGIYGMDFYCCMTRPGERVAKR  142



>emb|CDS03126.1| Putative 60S ribosomal protein L11 [Absidia idahoensis var. thermophila]
Length=177

 Score =   234 bits (598),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 132/144 (92%), Gaps = 1/144 (1%)
 Frame = +1

Query  88   MASEKKLN-NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF  264
            M++E+++  NPMR++K++KLVLNISVGESGDRLTRAAKVLEQL+GQTPV+SKARYTVR+F
Sbjct  1    MSAEQQVKKNPMRQLKIEKLVLNISVGESGDRLTRAAKVLEQLTGQTPVYSKARYTVRTF  60

Query  265  GIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  444
            GIRRNEKIA +VTVRG KA ++LE GLKVKEYEL  RNFS+TG FGFGI EHIDLGIKYD
Sbjct  61   GIRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRARNFSETGNFGFGIDEHIDLGIKYD  120

Query  445  PSTGIYGMDFYVVLERPGYRVARR  516
            PS GIYGMD++VV+ RPGYR+ARR
Sbjct  121  PSIGIYGMDYFVVMGRPGYRIARR  144



>ref|XP_007874680.1| hypothetical protein PNEG_02659 [Pneumocystis murina B123]
 gb|EMR08874.1| hypothetical protein PNEG_02659 [Pneumocystis murina B123]
Length=175

 Score =   234 bits (598),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  100  KKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRN  279
            +K +NPMREIK+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYT+R+FGIRRN
Sbjct  4    EKGSNPMREIKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTIRAFGIRRN  63

Query  280  EKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGI  459
            EKI+ YVTVRG KA ++LE GLKVKEYEL R NFSDTG FGFGI EHIDL IKYDPS GI
Sbjct  64   EKISVYVTVRGAKAEEILERGLKVKEYELKRSNFSDTGNFGFGIHEHIDLNIKYDPSIGI  123

Query  460  YGMDFYVVLERPGYRVARR  516
            +GM+FYVVL RPG+RV++R
Sbjct  124  FGMNFYVVLGRPGFRVSKR  142



>emb|CDH51840.1| 60s ribosomal protein l11 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=177

 Score =   234 bits (598),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 132/144 (92%), Gaps = 1/144 (1%)
 Frame = +1

Query  88   MASEKKLN-NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF  264
            M++E+++  NPMR++K++KLVLNISVGESGDRLTRAAKVLEQL+GQTPV+SKARYTVR+F
Sbjct  1    MSAEQQVKKNPMRQLKIEKLVLNISVGESGDRLTRAAKVLEQLTGQTPVYSKARYTVRTF  60

Query  265  GIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  444
            GIRRNEKIA +VTVRG KA ++LE GLKVKEYEL  RNFS+TG FGFGI EHIDLGIKYD
Sbjct  61   GIRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRARNFSETGNFGFGIDEHIDLGIKYD  120

Query  445  PSTGIYGMDFYVVLERPGYRVARR  516
            PS GIYGMD++VV+ RPGYR+ARR
Sbjct  121  PSIGIYGMDYFVVMGRPGYRIARR  144



>ref|XP_008031258.1| hypothetical protein SETTUDRAFT_35885 [Setosphaeria turcica Et28A]
 gb|EOA80998.1| hypothetical protein SETTUDRAFT_35885 [Setosphaeria turcica Et28A]
Length=173

 Score =   234 bits (597),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = +1

Query  94   SEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIR  273
            ++ K +NPMRE+++QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FGIR
Sbjct  2    TDSKASNPMRELRIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGIR  61

Query  274  RNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPST  453
            RNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS++G FGFGI EHIDLGIKYDPS 
Sbjct  62   RNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSESGNFGFGISEHIDLGIKYDPSI  121

Query  454  GIYGMDFYVVLERPGYRVARR  516
            GIYGMDFYV + RPG RVA+R
Sbjct  122  GIYGMDFYVCMTRPGERVAKR  142



>ref|XP_004220956.1| 60S ribosomal protein L11 [Plasmodium cynomolgi strain B]
 dbj|GAB64825.1| 60S ribosomal protein L11 [Plasmodium cynomolgi strain B]
Length=173

 Score =   234 bits (597),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +1

Query  97   EKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRR  276
            EKK +N MREIKV KLVLNI VGESGDRLTRAA+VLEQL+ Q P+F K R+T+RSFG+RR
Sbjct  2    EKKEDNVMREIKVNKLVLNICVGESGDRLTRAARVLEQLTEQKPIFGKCRFTIRSFGVRR  61

Query  277  NEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTG  456
            NEKI+C+VTVRG KA+++LE GLKVKEYEL R+NFS+TG FGFGIQEHIDLGIKYDPSTG
Sbjct  62   NEKISCFVTVRGKKALEILEKGLKVKEYELRRKNFSETGNFGFGIQEHIDLGIKYDPSTG  121

Query  457  IYGMDFYVVLERPGYRVARR  516
            IYGMDFYV L RPGYRV +R
Sbjct  122  IYGMDFYVHLSRPGYRVTKR  141



>ref|XP_007828704.1| 60S ribosomal protein L11 [Pestalotiopsis fici W106-1]
 gb|ETS88104.1| 60S ribosomal protein L11 [Pestalotiopsis fici W106-1]
Length=173

 Score =   234 bits (596),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 127/143 (89%), Gaps = 1/143 (1%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            M+SEK   NPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MSSEK-AQNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            + GIYGMDFY  + RPG R+ RR
Sbjct  120  AIGIYGMDFYCCMTRPGERITRR  142



>gb|KEQ81180.1| 60S ribosomal protein L11 [Aureobasidium pullulans EXF-150]
Length=191

 Score =   234 bits (597),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = +1

Query  85   DMASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF  264
            D A + K  NPMRE+++ KLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+F
Sbjct  17   DNAGKDKSGNPMRELRISKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTF  76

Query  265  GIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  444
            GIRRNEKIA +VTVRG KA +++E GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYD
Sbjct  77   GIRRNEKIAVHVTVRGPKAEEIIERGLKVKEYELRKRNFSETGNFGFGINEHIDLGIKYD  136

Query  445  PSTGIYGMDFYVVLERPGYRVARR  516
            P  GIYGMDFY  +ERPG RVARR
Sbjct  137  PGIGIYGMDFYCCMERPGERVARR  160



>ref|XP_007511979.1| 60S ribosomal protein L11 [Bathycoccus prasinos]
 emb|CCO66067.1| 60S ribosomal protein L11 [Bathycoccus prasinos]
Length=169

 Score =   233 bits (595),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 127/134 (95%), Gaps = 1/134 (1%)
 Frame = +1

Query  118  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  297
            M++I++ KL+LNISVGESGDRLT+AAKVLEQL+GQ PVFSKARYTVR+FGIRRNEKIAC+
Sbjct  1    MKDIRIHKLILNISVGESGDRLTKAAKVLEQLTGQQPVFSKARYTVRTFGIRRNEKIACH  60

Query  298  VTV-RGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDF  474
            VTV   DKA+Q+LESGLKVKE+ELL++NFS TG FGFGIQEHIDLGIKYDPSTGIYGMDF
Sbjct  61   VTVGNRDKALQILESGLKVKEFELLKKNFSSTGNFGFGIQEHIDLGIKYDPSTGIYGMDF  120

Query  475  YVVLERPGYRVARR  516
            +VVLERPG+RV+RR
Sbjct  121  FVVLERPGFRVSRR  134



>gb|KHJ31708.1| putative 60s ribosomal protein l11 [Erysiphe necator]
Length=175

 Score =   234 bits (596),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = +1

Query  94   SEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIR  273
            S++K  NPM+E+++QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FGIR
Sbjct  4    SKEKAENPMKELRIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGIR  63

Query  274  RNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPST  453
            RNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP+ 
Sbjct  64   RNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDPAI  123

Query  454  GIYGMDFYVVLERPGYRVARR  516
            GIYGMDFY  + RPG RVA+R
Sbjct  124  GIYGMDFYACMTRPGERVAKR  144



>gb|KEQ70785.1| 60S ribosomal protein L11 [Aureobasidium pullulans var. namibiae 
CBS 147.97]
Length=191

 Score =   234 bits (597),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = +1

Query  85   DMASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF  264
            D A + K  NPMRE+++ KLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+F
Sbjct  17   DNAGKDKSGNPMRELRISKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTF  76

Query  265  GIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  444
            GIRRNEKIA +VTVRG KA +++E GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYD
Sbjct  77   GIRRNEKIAVHVTVRGPKAEEIIERGLKVKEYELRKRNFSETGNFGFGINEHIDLGIKYD  136

Query  445  PSTGIYGMDFYVVLERPGYRVARR  516
            P  GIYGMDFY  +ERPG RVARR
Sbjct  137  PGIGIYGMDFYCCMERPGERVARR  160



>emb|CCX16540.1| Similar to 60S ribosomal protein L11; acc. no. Q7RVN0 [Pyronema 
omphalodes CBS 100304]
Length=175

 Score =   234 bits (596),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 128/144 (89%), Gaps = 1/144 (1%)
 Frame = +1

Query  88   MASEK-KLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF  264
            MA  K K  N MRE++++KLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+F
Sbjct  1    MADTKTKETNAMRELRIEKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTF  60

Query  265  GIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  444
            GIRRNEKIA +VT+RG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYD
Sbjct  61   GIRRNEKIAVHVTIRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYD  120

Query  445  PSTGIYGMDFYVVLERPGYRVARR  516
            P+ GIYGMDFYV++ RPG RVARR
Sbjct  121  PAIGIYGMDFYVIMSRPGLRVARR  144



>ref|XP_003712966.1| 60S ribosomal protein L11 [Magnaporthe oryzae 70-15]
 gb|ADD84631.1| Rpl11ap [Magnaporthe oryzae]
 gb|EHA53159.1| 60S ribosomal protein L11 [Magnaporthe oryzae 70-15]
 gb|ELQ44353.1| 60S ribosomal protein L11 [Magnaporthe oryzae Y34]
 gb|ELQ60582.1| 60S ribosomal protein L11 [Magnaporthe oryzae P131]
Length=173

 Score =   233 bits (595),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 127/143 (89%), Gaps = 1/143 (1%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            M+SEK   NPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MSSEK-TQNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  448  STGIYGMDFYVVLERPGYRVARR  516
              GIYGMDFY  + RPG RV+RR
Sbjct  120  GIGIYGMDFYCCMTRPGERVSRR  142



>ref|XP_003351085.1| 60S ribosomal protein L11 [Sordaria macrospora k-hell]
 emb|CCC08608.1| unnamed protein product [Sordaria macrospora k-hell]
Length=174

 Score =   233 bits (595),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            M++E+K  NPMRE+++QKLVLNI VGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MSTEQKAQNPMRELRIQKLVLNICVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKI+ +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  61   IRRNEKISVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
              GIYGMDFY  + RPG RV+RR
Sbjct  121  GIGIYGMDFYCCMTRPGERVSRR  143



>ref|XP_965640.2| 60S ribosomal protein L11 [Neurospora crassa OR74A]
 ref|XP_009856785.1| 60S ribosomal protein L11 [Neurospora tetrasperma FGSC 2508]
 sp|Q7RVN0.2|RL11_NEUCR RecName: Full=60S ribosomal protein L11 [Neurospora crassa OR74A]
 gb|EAA36404.2| 60S ribosomal protein L11 [Neurospora crassa OR74A]
 gb|EGO53163.1| 60S ribosomal protein L11 [Neurospora tetrasperma FGSC 2508]
 gb|EGZ78005.1| 60S ribosomal protein L11 [Neurospora tetrasperma FGSC 2509]
 gb|KHE89934.1| 60S ribosomal protein L11 [Neurospora crassa]
Length=174

 Score =   233 bits (595),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            M++E+K  NPMRE+++QKLVLNI VGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MSTEQKAQNPMRELRIQKLVLNICVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKI+ +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  61   IRRNEKISVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
              GIYGMDFY  + RPG RV+RR
Sbjct  121  GIGIYGMDFYCCMTRPGERVSRR  143



>ref|XP_008912007.1| 60S ribosomal protein L11 [Phytophthora parasitica INRA-310]
 gb|ETI37223.1| 60S ribosomal protein L11 [Phytophthora parasitica P1569]
 gb|ETK77445.1| 60S ribosomal protein L11 [Phytophthora parasitica]
 gb|ETL30892.1| 60S ribosomal protein L11 [Phytophthora parasitica]
 gb|ETL84131.1| 60S ribosomal protein L11 [Phytophthora parasitica]
 gb|ETM37312.1| 60S ribosomal protein L11 [Phytophthora parasitica]
 gb|ETN02792.1| 60S ribosomal protein L11 [Phytophthora parasitica INRA-310]
 gb|ETO65966.1| 60S ribosomal protein L11 [Phytophthora parasitica P1976]
 gb|ETP07076.1| 60S ribosomal protein L11 [Phytophthora parasitica CJ01A1]
 gb|ETP35169.1| 60S ribosomal protein L11 [Phytophthora parasitica P10297]
Length=178

 Score =   233 bits (595),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 130/143 (91%), Gaps = 1/143 (1%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MA +K  NNPMR+I V KLV+N  VGESGD+LTRAA+VLEQL+GQ PV+SKARYTVR+FG
Sbjct  1    MAGDKS-NNPMRDIHVDKLVINCCVGESGDKLTRAARVLEQLTGQKPVYSKARYTVRTFG  59

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKI+C+VT+RG+ A ++L+ GLKVKEYELLR+NFS+TG FGFGIQEHIDLGIKYDP
Sbjct  60   IRRNEKISCHVTIRGELAQEILDRGLKVKEYELLRKNFSETGNFGFGIQEHIDLGIKYDP  119

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            STGIYGMDF+VVL+RPG RVARR
Sbjct  120  STGIYGMDFFVVLKRPGARVARR  142



>gb|AFW81632.1| hypothetical protein ZEAMMB73_719378 [Zea mays]
Length=117

 Score =   231 bits (590),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/117 (97%), Positives = 116/117 (99%), Gaps = 0/117 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIK  438
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIK
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIK  117



>ref|XP_003652525.1| 60S ribosomal protein L11 [Thielavia terrestris NRRL 8126]
 gb|AEO66189.1| hypothetical protein THITE_67248 [Thielavia terrestris NRRL 8126]
Length=172

 Score =   233 bits (595),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +1

Query  100  KKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRN  279
            +K  NPMRE+++QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FGIRRN
Sbjct  3    EKAQNPMRELRIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGIRRN  62

Query  280  EKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGI  459
            EKIA +VTVRG KA ++LE GLKVKEYEL RRNFS+TG FGFGI EHIDLGIKYDP  GI
Sbjct  63   EKIAVHVTVRGPKAEEILERGLKVKEYELRRRNFSETGNFGFGISEHIDLGIKYDPGIGI  122

Query  460  YGMDFYVVLERPGYRVARR  516
            YGMDFY  + RPG RVARR
Sbjct  123  YGMDFYCCMTRPGERVARR  141



>gb|KEQ63433.1| ribosomal protein L5, partial [Aureobasidium melanogenum CBS 
110374]
Length=174

 Score =   233 bits (595),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +1

Query  91   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  270
            AS+ K  NPMRE+++ KLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FGI
Sbjct  2    ASKDKSGNPMRELRISKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI  61

Query  271  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  450
            RRNEKIA +VTVRG KA +++E GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP 
Sbjct  62   RRNEKIAVHVTVRGPKAEEIIERGLKVKEYELRKRNFSETGNFGFGINEHIDLGIKYDPG  121

Query  451  TGIYGMDFYVVLERPGYRVARR  516
             GIYGMDFY  +ERPG RVARR
Sbjct  122  IGIYGMDFYCCMERPGERVARR  143



>ref|XP_003833556.1| similar to 60s ribosomal protein l11 [Leptosphaeria maculans 
JN3]
 emb|CBX90191.1| similar to 60s ribosomal protein l11 [Leptosphaeria maculans 
JN3]
Length=172

 Score =   233 bits (594),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +1

Query  103  KLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNE  282
            K +NPMRE+++QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FGIRRNE
Sbjct  4    KSSNPMRELRIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGIRRNE  63

Query  283  KIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIY  462
            KIA +VTVRG KA ++LE GLKVKEYEL +RNFS++G FGFGI EHIDLGIKYDPS GIY
Sbjct  64   KIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSESGNFGFGISEHIDLGIKYDPSIGIY  123

Query  463  GMDFYVVLERPGYRVARR  516
            GMDFYV + RPG RVA+R
Sbjct  124  GMDFYVCMTRPGERVAKR  141



>gb|EHL03348.1| putative 60S ribosomal protein L11 [Glarea lozoyensis 74030]
Length=172

 Score =   233 bits (594),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = +1

Query  94   SEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIR  273
            S+KK  NPM+E+++QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FGIR
Sbjct  4    SDKKEQNPMKELRIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGIR  63

Query  274  RNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPST  453
            RNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP+ 
Sbjct  64   RNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDPAI  123

Query  454  GIYGMDFYVVLERPGYRVARR  516
            GIYGMDF+  + RPG RVA+R
Sbjct  124  GIYGMDFFCCMTRPGERVAKR  144



>ref|XP_001553621.1| 60S ribosomal protein L11 [Botrytis cinerea B05.10]
 emb|CCD42339.1| similar to 60s ribosomal protein l11 [Botrytis cinerea T4]
 gb|EMR87425.1| putative 60s ribosomal protein l11 protein [Botrytis cinerea 
BcDW1]
Length=175

 Score =   233 bits (594),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +1

Query  91   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  270
            A+ +K  NPM+E+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FGI
Sbjct  3    ATGEKTANPMKELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGI  62

Query  271  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  450
            RRNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP+
Sbjct  63   RRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDPA  122

Query  451  TGIYGMDFYVVLERPGYRVARR  516
             GIYGMDFY  + RPG RVA+R
Sbjct  123  IGIYGMDFYACMTRPGERVAKR  144



>ref|XP_006671375.1| 60S ribosomal protein L11 [Cordyceps militaris CM01]
 gb|EGX92011.1| 60S ribosomal protein L11 [Cordyceps militaris CM01]
Length=173

 Score =   233 bits (593),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MASEK   NPMRE+K+QKLVLNI VGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-TGNPMRELKIQKLVLNICVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKI+ +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKISVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            S GIYGMDFY  + RPG RV RR
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRR  142



>ref|XP_008083348.1| Ribosomal protein L5 [Glarea lozoyensis ATCC 20868]
 gb|EPE29239.1| Ribosomal protein L5 [Glarea lozoyensis ATCC 20868]
Length=175

 Score =   233 bits (593),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = +1

Query  94   SEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIR  273
            S+KK  NPM+E+++QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FGIR
Sbjct  4    SDKKEQNPMKELRIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGIR  63

Query  274  RNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPST  453
            RNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP+ 
Sbjct  64   RNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDPAI  123

Query  454  GIYGMDFYVVLERPGYRVARR  516
            GIYGMDF+  + RPG RVA+R
Sbjct  124  GIYGMDFFCCMTRPGERVAKR  144



>ref|XP_007290432.1| 60S ribosomal protein L11 [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
 gb|EKD19306.1| 60S ribosomal protein L11 [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
Length=174

 Score =   233 bits (593),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = +1

Query  88   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  267
            MA   K  NPM+E+++QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MAEAAKTENPMKELRIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  60

Query  268  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  447
            IRRNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  61   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  120

Query  448  STGIYGMDFYVVLERPGYRVARR  516
            + GIYGMDF+  + RPG RVA+R
Sbjct  121  AIGIYGMDFFCCMTRPGERVAKR  143



>gb|EJW85444.1| 60S ribosomal protein L11 [Wuchereria bancrofti]
Length=195

 Score =   233 bits (595),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +1

Query  97   EKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRR  276
            EKK  NPMRE+K++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFGIRR
Sbjct  12   EKKAANPMRELKIEKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRR  71

Query  277  NEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTG  456
            NEKIA + TVRG KA +++E GLKVKEYEL R NFSDTG FGFGIQEHIDLGIKYDP  G
Sbjct  72   NEKIAVHCTVRGPKAEEIIERGLKVKEYELHRENFSDTGNFGFGIQEHIDLGIKYDPLIG  131

Query  457  IYGMDFYVVLERPGYRVARR  516
            IYGMDFYVVL R G+RVA+R
Sbjct  132  IYGMDFYVVLGRAGHRVAKR  151



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552470516325