BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF040I14

Length=451
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002268282.1|  PREDICTED: probable beta-1,3-galactosyltrans...  60.8    5e-08   Vitis vinifera
ref|XP_010657202.1|  PREDICTED: probable beta-1,3-galactosyltrans...  60.8    5e-08   Vitis vinifera
ref|XP_010657203.1|  PREDICTED: probable beta-1,3-galactosyltrans...  60.8    5e-08   Vitis vinifera
ref|XP_007215471.1|  hypothetical protein PRUPE_ppa006530mg           60.1    9e-08   Prunus persica
ref|XP_007215470.1|  hypothetical protein PRUPE_ppa006530mg           60.1    9e-08   Prunus persica
ref|XP_008229956.1|  PREDICTED: probable beta-1,3-galactosyltrans...  60.1    9e-08   Prunus mume [ume]
ref|XP_009598546.1|  PREDICTED: probable beta-1,3-galactosyltrans...  59.7    1e-07   Nicotiana tomentosiformis
ref|XP_009770915.1|  PREDICTED: probable beta-1,3-galactosyltrans...  59.7    1e-07   Nicotiana sylvestris
ref|XP_008342010.1|  PREDICTED: probable beta-1,3-galactosyltrans...  59.3    2e-07   Malus domestica [apple tree]
ref|XP_008342011.1|  PREDICTED: probable beta-1,3-galactosyltrans...  59.3    2e-07   Malus domestica [apple tree]
ref|XP_004287949.1|  PREDICTED: probable beta-1,3-galactosyltrans...  58.9    2e-07   Fragaria vesca subsp. vesca
ref|XP_011463344.1|  PREDICTED: probable beta-1,3-galactosyltrans...  58.9    2e-07   Fragaria vesca subsp. vesca
ref|NP_001077462.1|  putative beta-1,3-galactosyltransferase 2        58.5    3e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172009.1|  putative beta-1,3-galactosyltransferase 2           58.5    3e-07   
dbj|BAJ89822.1|  predicted protein                                    58.2    4e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ89733.1|  predicted protein                                    58.2    4e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT25658.1|  Putative beta-1,3-galactosyltransferase 2             58.2    4e-07   
ref|XP_009353285.1|  PREDICTED: probable beta-1,3-galactosyltrans...  57.8    5e-07   Pyrus x bretschneideri [bai li]
ref|XP_009353286.1|  PREDICTED: probable beta-1,3-galactosyltrans...  57.8    5e-07   Pyrus x bretschneideri [bai li]
emb|CDP10795.1|  unnamed protein product                              57.4    6e-07   Coffea canephora [robusta coffee]
ref|XP_004243473.1|  PREDICTED: probable beta-1,3-galactosyltrans...  57.4    7e-07   Solanum lycopersicum
ref|XP_010323831.1|  PREDICTED: probable beta-1,3-galactosyltrans...  57.4    7e-07   Solanum lycopersicum
ref|NP_001050543.1|  Os03g0577500                                     57.4    7e-07   
ref|XP_010923856.1|  PREDICTED: probable beta-1,3-galactosyltrans...  57.4    7e-07   Elaeis guineensis
ref|XP_002464309.1|  hypothetical protein SORBIDRAFT_01g015960        57.0    8e-07   Sorghum bicolor [broomcorn]
ref|XP_010923857.1|  PREDICTED: probable beta-1,3-galactosyltrans...  57.0    9e-07   Elaeis guineensis
ref|XP_010923855.1|  PREDICTED: probable beta-1,3-galactosyltrans...  57.0    1e-06   
ref|XP_010510018.1|  PREDICTED: probable beta-1,3-galactosyltrans...  57.0    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010469586.1|  PREDICTED: probable beta-1,3-galactosyltrans...  57.0    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010413995.1|  PREDICTED: probable beta-1,3-galactosyltrans...  57.0    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_002892271.1|  galactosyltransferase family protein             57.0    1e-06   Arabidopsis lyrata subsp. lyrata
ref|XP_010413996.1|  PREDICTED: probable beta-1,3-galactosyltrans...  56.6    1e-06   Camelina sativa [gold-of-pleasure]
gb|AFW68302.1|  hypothetical protein ZEAMMB73_372854                  56.2    1e-06   
ref|XP_010469587.1|  PREDICTED: probable beta-1,3-galactosyltrans...  56.6    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010929797.1|  PREDICTED: probable beta-1,3-galactosyltrans...  56.2    2e-06   Elaeis guineensis
gb|EYU34029.1|  hypothetical protein MIMGU_mgv1a007633mg              56.2    2e-06   Erythranthe guttata [common monkey flower]
ref|XP_006366587.1|  PREDICTED: probable beta-1,3-galactosyltrans...  56.2    2e-06   Solanum tuberosum [potatoes]
ref|XP_008379640.1|  PREDICTED: probable beta-1,3-galactosyltrans...  55.8    2e-06   Malus domestica [apple tree]
ref|XP_006366586.1|  PREDICTED: probable beta-1,3-galactosyltrans...  55.8    2e-06   Solanum tuberosum [potatoes]
ref|XP_008379639.1|  PREDICTED: probable beta-1,3-galactosyltrans...  55.8    2e-06   Malus domestica [apple tree]
ref|XP_002320464.1|  galactosyltransferase family protein             55.8    2e-06   Populus trichocarpa [western balsam poplar]
ref|XP_008681412.1|  PREDICTED: hypothetical protein isoform X1       55.8    2e-06   Zea mays [maize]
ref|XP_006375532.1|  hypothetical protein POPTR_0014s15200g           55.8    2e-06   Populus trichocarpa [western balsam poplar]
ref|XP_003540300.1|  PREDICTED: probable beta-1,3-galactosyltrans...  55.8    2e-06   Glycine max [soybeans]
gb|KDO54671.1|  hypothetical protein CISIN_1g015407mg                 55.8    2e-06   Citrus sinensis [apfelsine]
ref|XP_003596979.1|  hypothetical protein MTR_2g088270                55.8    2e-06   Medicago truncatula
gb|KDO54670.1|  hypothetical protein CISIN_1g015407mg                 55.8    2e-06   Citrus sinensis [apfelsine]
gb|KDO54672.1|  hypothetical protein CISIN_1g015407mg                 55.8    2e-06   Citrus sinensis [apfelsine]
ref|XP_006469679.1|  PREDICTED: probable beta-1,3-galactosyltrans...  55.8    2e-06   Citrus sinensis [apfelsine]
ref|XP_006469680.1|  PREDICTED: probable beta-1,3-galactosyltrans...  55.8    2e-06   Citrus sinensis [apfelsine]
ref|XP_006447568.1|  hypothetical protein CICLE_v10015443mg           55.8    2e-06   Citrus clementina [clementine]
ref|XP_008804298.1|  PREDICTED: probable beta-1,3-galactosyltrans...  55.8    2e-06   Phoenix dactylifera
ref|XP_004251520.1|  PREDICTED: probable beta-1,3-galactosyltrans...  55.5    3e-06   Solanum lycopersicum
ref|XP_010313672.1|  PREDICTED: probable beta-1,3-galactosyltrans...  55.5    3e-06   Solanum lycopersicum
ref|XP_006650268.1|  PREDICTED: probable beta-1,3-galactosyltrans...  55.5    3e-06   Oryza brachyantha
ref|XP_004982530.1|  PREDICTED: probable beta-1,3-galactosyltrans...  55.5    3e-06   Setaria italica
ref|XP_006294322.1|  hypothetical protein CARUB_v10023330mg           55.1    4e-06   Capsella rubella
ref|XP_010557003.1|  PREDICTED: probable beta-1,3-galactosyltrans...  55.1    4e-06   Tarenaya hassleriana [spider flower]
ref|XP_010276120.1|  PREDICTED: probable beta-1,3-galactosyltrans...  55.1    4e-06   Nelumbo nucifera [Indian lotus]
ref|XP_010557001.1|  PREDICTED: probable beta-1,3-galactosyltrans...  55.1    4e-06   Tarenaya hassleriana [spider flower]
ref|XP_006418057.1|  hypothetical protein EUTSA_v10007787mg           54.7    4e-06   Eutrema salsugineum [saltwater cress]
gb|KGN63249.1|  hypothetical protein Csa_2G418850                     54.7    5e-06   Cucumis sativus [cucumbers]
gb|KDP39142.1|  hypothetical protein JCGZ_00899                       54.7    5e-06   Jatropha curcas
ref|XP_008455884.1|  PREDICTED: probable beta-1,3-galactosyltrans...  54.7    5e-06   Cucumis melo [Oriental melon]
ref|XP_002879388.1|  galactosyltransferase family protein             54.7    5e-06   Arabidopsis lyrata subsp. lyrata
ref|NP_180802.1|  putative beta-1,3-galactosyltransferase 3           54.7    5e-06   Arabidopsis thaliana [mouse-ear cress]
gb|KJB13703.1|  hypothetical protein B456_002G089700                  54.7    5e-06   Gossypium raimondii
gb|KHG30061.1|  putative beta-1,3-galactosyltransferase 4 -like p...  54.7    5e-06   Gossypium arboreum [tree cotton]
ref|XP_003562342.1|  PREDICTED: probable beta-1,3-galactosyltrans...  54.7    6e-06   Brachypodium distachyon [annual false brome]
gb|KJB13702.1|  hypothetical protein B456_002G089700                  54.7    6e-06   Gossypium raimondii
ref|XP_006452384.1|  hypothetical protein CICLE_v10008439mg           54.3    6e-06   
ref|XP_006475057.1|  PREDICTED: probable beta-1,3-galactosyltrans...  54.3    6e-06   Citrus sinensis [apfelsine]
ref|XP_006452382.1|  hypothetical protein CICLE_v10008439mg           54.3    6e-06   Citrus clementina [clementine]
ref|XP_011047261.1|  PREDICTED: probable beta-1,3-galactosyltrans...  54.3    7e-06   Populus euphratica
ref|XP_010104592.1|  putative beta-1,3-galactosyltransferase 2        54.3    8e-06   
gb|KJB80506.1|  hypothetical protein B456_013G101400                  53.9    8e-06   Gossypium raimondii
ref|XP_011047262.1|  PREDICTED: probable beta-1,3-galactosyltrans...  53.9    8e-06   Populus euphratica
ref|XP_003543389.1|  PREDICTED: probable beta-1,3-galactosyltrans...  53.9    8e-06   Glycine max [soybeans]
ref|XP_004487414.1|  PREDICTED: probable beta-1,3-galactosyltrans...  53.9    9e-06   Cicer arietinum [garbanzo]
ref|XP_009359950.1|  PREDICTED: probable beta-1,3-galactosyltrans...  53.9    9e-06   Pyrus x bretschneideri [bai li]
ref|XP_007149975.1|  hypothetical protein PHAVU_005G115300g           53.9    9e-06   Phaseolus vulgaris [French bean]
ref|XP_002279814.2|  PREDICTED: probable beta-1,3-galactosyltrans...  53.5    1e-05   Vitis vinifera
ref|XP_004515096.1|  PREDICTED: probable beta-1,3-galactosyltrans...  53.5    1e-05   Cicer arietinum [garbanzo]
gb|AFW66427.1|  hypothetical protein ZEAMMB73_715676                  51.6    1e-05   
gb|EMS64796.1|  putative beta-1,3-galactosyltransferase 2             53.5    1e-05   Triticum urartu
ref|XP_006855892.1|  hypothetical protein AMTR_s00037p00154410        53.5    1e-05   Amborella trichopoda
ref|XP_006351966.1|  PREDICTED: probable beta-1,3-galactosyltrans...  53.5    1e-05   Solanum tuberosum [potatoes]
ref|XP_006351967.1|  PREDICTED: probable beta-1,3-galactosyltrans...  53.5    1e-05   Solanum tuberosum [potatoes]
gb|KJB80508.1|  hypothetical protein B456_013G101400                  53.5    1e-05   Gossypium raimondii
ref|XP_009119198.1|  PREDICTED: probable beta-1,3-galactosyltrans...  53.5    1e-05   Brassica rapa
ref|XP_009119197.1|  PREDICTED: probable beta-1,3-galactosyltrans...  53.5    1e-05   Brassica rapa
ref|XP_004144497.1|  PREDICTED: probable beta-1,3-galactosyltrans...  53.5    1e-05   Cucumis sativus [cucumbers]
ref|XP_008455443.1|  PREDICTED: probable beta-1,3-galactosyltrans...  53.1    1e-05   Cucumis melo [Oriental melon]
emb|CDY48266.1|  BnaA05g10880D                                        53.1    1e-05   Brassica napus [oilseed rape]
emb|CDY12206.1|  BnaC04g12360D                                        53.1    1e-05   Brassica napus [oilseed rape]
ref|XP_007153952.1|  hypothetical protein PHAVU_003G079100g           53.1    2e-05   Phaseolus vulgaris [French bean]
ref|XP_009143988.1|  PREDICTED: probable beta-1,3-galactosyltrans...  53.1    2e-05   Brassica rapa
gb|KJB80507.1|  hypothetical protein B456_013G101400                  53.1    2e-05   Gossypium raimondii
gb|KHF99242.1|  putative beta-1,3-galactosyltransferase 2 -like p...  53.1    2e-05   Gossypium arboreum [tree cotton]
ref|XP_007045661.1|  Galactosyltransferase family protein             53.1    2e-05   
ref|XP_009143989.1|  PREDICTED: probable beta-1,3-galactosyltrans...  53.1    2e-05   Brassica rapa
gb|KJB80505.1|  hypothetical protein B456_013G101400                  53.1    2e-05   Gossypium raimondii
ref|XP_009419577.1|  PREDICTED: probable beta-1,3-galactosyltrans...  53.1    2e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004159203.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...  53.1    2e-05   
ref|XP_004172360.1|  PREDICTED: probable beta-1,3-galactosyltrans...  53.1    2e-05   
ref|XP_004507687.1|  PREDICTED: probable beta-1,3-galactosyltrans...  52.8    2e-05   Cicer arietinum [garbanzo]
ref|XP_010278673.1|  PREDICTED: probable beta-1,3-galactosyltrans...  52.8    2e-05   Nelumbo nucifera [Indian lotus]
ref|XP_009624796.1|  PREDICTED: probable beta-1,3-galactosyltrans...  52.8    2e-05   Nicotiana tomentosiformis
ref|XP_009624797.1|  PREDICTED: probable beta-1,3-galactosyltrans...  52.4    3e-05   Nicotiana tomentosiformis
ref|XP_009775718.1|  PREDICTED: probable beta-1,3-galactosyltrans...  52.4    3e-05   Nicotiana sylvestris
ref|XP_009775717.1|  PREDICTED: probable beta-1,3-galactosyltrans...  52.4    3e-05   Nicotiana sylvestris
ref|XP_008364090.1|  PREDICTED: probable beta-1,3-galactosyltrans...  52.4    3e-05   
gb|KEH29683.1|  beta-1,3-galactosyltransferase-like protein           52.4    3e-05   Medicago truncatula
gb|KDO78241.1|  hypothetical protein CISIN_1g015962mg                 51.6    3e-05   Citrus sinensis [apfelsine]
gb|KDO78238.1|  hypothetical protein CISIN_1g015962mg                 52.0    3e-05   Citrus sinensis [apfelsine]
ref|XP_010278672.1|  PREDICTED: probable beta-1,3-galactosyltrans...  52.0    3e-05   Nelumbo nucifera [Indian lotus]
gb|KDO78237.1|  hypothetical protein CISIN_1g015962mg                 52.0    4e-05   Citrus sinensis [apfelsine]
ref|XP_006410375.1|  hypothetical protein EUTSA_v10016736mg           52.0    4e-05   Eutrema salsugineum [saltwater cress]
gb|KJB62838.1|  hypothetical protein B456_009G440200                  51.6    4e-05   Gossypium raimondii
ref|XP_008808431.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...  52.0    4e-05   
ref|XP_008359262.1|  PREDICTED: probable beta-1,3-galactosyltrans...  51.6    5e-05   
ref|XP_008359264.1|  PREDICTED: probable beta-1,3-galactosyltrans...  51.6    5e-05   
gb|EMS52307.1|  putative beta-1,3-galactosyltransferase 2             51.6    5e-05   Triticum urartu
emb|CDY49507.1|  BnaC05g03190D                                        51.6    5e-05   Brassica napus [oilseed rape]
gb|KFK42855.1|  hypothetical protein AALP_AA1G047700                  51.6    5e-05   Arabis alpina [alpine rockcress]
emb|CDY46836.1|  BnaA10g03200D                                        51.6    5e-05   Brassica napus [oilseed rape]
ref|XP_008385877.1|  PREDICTED: probable beta-1,3-galactosyltrans...  51.6    5e-05   
ref|XP_006467430.1|  PREDICTED: probable beta-1,3-galactosyltrans...  51.6    5e-05   Citrus sinensis [apfelsine]
ref|XP_006467429.1|  PREDICTED: probable beta-1,3-galactosyltrans...  51.6    6e-05   Citrus sinensis [apfelsine]
ref|XP_007020793.1|  Galactosyltransferase family protein             51.6    6e-05   
ref|XP_004966215.1|  PREDICTED: probable beta-1,3-galactosyltrans...  51.6    6e-05   Setaria italica
ref|XP_008677265.1|  PREDICTED: beta-1,3-galactosyltransferase sq...  51.2    7e-05   
ref|XP_002451594.1|  hypothetical protein SORBIDRAFT_04g004400        51.2    7e-05   Sorghum bicolor [broomcorn]
gb|KJB62836.1|  hypothetical protein B456_009G440200                  51.2    7e-05   Gossypium raimondii
ref|XP_010475189.1|  PREDICTED: probable beta-1,3-galactosyltrans...  51.2    8e-05   Camelina sativa [gold-of-pleasure]
ref|XP_008439989.1|  PREDICTED: probable beta-1,3-galactosyltrans...  51.2    8e-05   Cucumis melo [Oriental melon]
ref|XP_004155605.1|  PREDICTED: probable beta-1,3-galactosyltrans...  51.2    8e-05   
ref|XP_004134762.1|  PREDICTED: probable beta-1,3-galactosyltrans...  51.2    8e-05   Cucumis sativus [cucumbers]
ref|XP_010475190.1|  PREDICTED: probable beta-1,3-galactosyltrans...  51.2    8e-05   Camelina sativa [gold-of-pleasure]
ref|XP_003550487.1|  PREDICTED: probable beta-1,3-galactosyltrans...  50.8    8e-05   Glycine max [soybeans]
ref|XP_009361000.1|  PREDICTED: probable beta-1,3-galactosyltrans...  50.8    8e-05   Pyrus x bretschneideri [bai li]
ref|XP_004151891.1|  PREDICTED: probable beta-1,3-galactosyltrans...  50.8    9e-05   
ref|XP_008224857.1|  PREDICTED: probable beta-1,3-galactosyltrans...  50.8    9e-05   Prunus mume [ume]
ref|XP_007211967.1|  hypothetical protein PRUPE_ppa006589mg           50.8    9e-05   
ref|XP_011100272.1|  PREDICTED: probable beta-1,3-galactosyltrans...  50.8    1e-04   Sesamum indicum [beniseed]
ref|XP_010233857.1|  PREDICTED: probable beta-1,3-galactosyltrans...  50.8    1e-04   Brachypodium distachyon [annual false brome]
ref|NP_849454.1|  putative beta-1,3-galactosyltransferase 4           50.4    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006646915.1|  PREDICTED: probable beta-1,3-galactosyltrans...  50.8    1e-04   Oryza brachyantha
gb|EAY84604.1|  hypothetical protein OsI_05972                        50.8    1e-04   Oryza sativa Indica Group [Indian rice]
dbj|BAD25162.1|  putative Avr9 elicitor response protein              50.4    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|NP_567762.1|  putative beta-1,3-galactosyltransferase 4           50.4    1e-04   Arabidopsis thaliana [mouse-ear cress]
emb|CAB36540.1|  Avr9 elicitor response like protein                  50.4    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007132543.1|  hypothetical protein PHAVU_011G103400g           50.1    2e-04   Phaseolus vulgaris [French bean]
ref|XP_004951866.1|  PREDICTED: probable beta-1,3-galactosyltrans...  50.1    2e-04   Setaria italica
ref|XP_011095407.1|  PREDICTED: probable beta-1,3-galactosyltrans...  50.1    2e-04   Sesamum indicum [beniseed]
ref|XP_010484738.1|  PREDICTED: probable beta-1,3-galactosyltrans...  50.1    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_003539862.1|  PREDICTED: probable beta-1,3-galactosyltrans...  50.1    2e-04   Glycine max [soybeans]
ref|XP_010536663.1|  PREDICTED: probable beta-1,3-galactosyltrans...  50.1    2e-04   Tarenaya hassleriana [spider flower]
gb|KHN21228.1|  Putative beta-1,3-galactosyltransferase 2             50.1    2e-04   Glycine soja [wild soybean]
ref|XP_010484744.1|  PREDICTED: probable beta-1,3-galactosyltrans...  50.1    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_003527496.1|  PREDICTED: probable beta-1,3-galactosyltrans...  50.1    2e-04   Glycine max [soybeans]
ref|XP_010536662.1|  PREDICTED: probable beta-1,3-galactosyltrans...  50.1    2e-04   
ref|XP_011461040.1|  PREDICTED: probable beta-1,3-galactosyltrans...  49.7    2e-04   Fragaria vesca subsp. vesca
ref|XP_002437448.1|  hypothetical protein SORBIDRAFT_10g027290        49.7    2e-04   Sorghum bicolor [broomcorn]
ref|XP_004294404.1|  PREDICTED: probable beta-1,3-galactosyltrans...  49.7    2e-04   Fragaria vesca subsp. vesca
ref|XP_009399227.1|  PREDICTED: probable beta-1,3-galactosyltrans...  49.7    2e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006284182.1|  hypothetical protein CARUB_v10005329mg           49.3    2e-04   
ref|XP_007026089.1|  Galactosyltransferase family protein isoform 2   49.3    2e-04   
ref|XP_010522341.1|  PREDICTED: probable beta-1,3-galactosyltrans...  49.7    2e-04   
ref|XP_010092200.1|  putative beta-1,3-galactosyltransferase 2        49.7    2e-04   Morus notabilis
ref|XP_010522344.1|  PREDICTED: probable beta-1,3-galactosyltrans...  49.7    3e-04   Tarenaya hassleriana [spider flower]
ref|XP_010534019.1|  PREDICTED: probable beta-1,3-galactosyltrans...  49.7    3e-04   Tarenaya hassleriana [spider flower]
ref|XP_004172861.1|  PREDICTED: probable beta-1,3-galactosyltrans...  48.9    3e-04   
ref|XP_006346208.1|  PREDICTED: probable beta-1,3-galactosyltrans...  49.3    3e-04   Solanum tuberosum [potatoes]
ref|XP_004244109.1|  PREDICTED: probable beta-1,3-galactosyltrans...  49.3    3e-04   Solanum lycopersicum
ref|XP_010438679.1|  PREDICTED: probable beta-1,3-galactosyltrans...  49.3    3e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010438680.1|  PREDICTED: probable beta-1,3-galactosyltrans...  49.3    3e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010433424.1|  PREDICTED: probable beta-1,3-galactosyltrans...  49.3    3e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010448195.1|  PREDICTED: probable beta-1,3-galactosyltrans...  49.3    3e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010448194.1|  PREDICTED: probable beta-1,3-galactosyltrans...  49.3    3e-04   Camelina sativa [gold-of-pleasure]
ref|XP_002867534.1|  galactosyltransferase family protein             49.3    3e-04   Arabidopsis lyrata subsp. lyrata
ref|XP_009338707.1|  PREDICTED: probable beta-1,3-galactosyltrans...  48.9    4e-04   Pyrus x bretschneideri [bai li]
ref|XP_002518474.1|  Beta-1,3-galactosyltransferase sqv-2, putative   48.9    4e-04   Ricinus communis
ref|XP_009338706.1|  PREDICTED: probable beta-1,3-galactosyltrans...  48.9    4e-04   Pyrus x bretschneideri [bai li]
gb|ACG42389.1|  beta-1,3-galactosyltransferase sqv-2                  48.9    4e-04   Zea mays [maize]
ref|XP_004149353.1|  PREDICTED: probable beta-1,3-galactosyltrans...  48.9    4e-04   Cucumis sativus [cucumbers]
ref|XP_008463407.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...  48.9    4e-04   
ref|XP_007026088.1|  Galactosyltransferase family protein isoform 1   48.9    4e-04   
ref|XP_002974972.1|  glycosyltransferase-like protein                 48.5    5e-04   Selaginella moellendorffii
gb|KCW88781.1|  hypothetical protein EUGRSUZ_A01123                   48.5    5e-04   Eucalyptus grandis [rose gum]
ref|NP_001136834.1|  beta-1,3-galactosyltransferase sqv-2             48.5    5e-04   Zea mays [maize]
ref|XP_002977391.1|  glycosyltransferase-like protein                 48.5    5e-04   Selaginella moellendorffii
emb|CDP05735.1|  unnamed protein product                              48.5    6e-04   Coffea canephora [robusta coffee]
ref|XP_010046417.1|  PREDICTED: probable beta-1,3-galactosyltrans...  48.5    6e-04   Eucalyptus grandis [rose gum]
emb|CDY68943.1|  BnaAnng28870D                                        48.1    6e-04   Brassica napus [oilseed rape]
gb|EYU27344.1|  hypothetical protein MIMGU_mgv1a007546mg              48.1    7e-04   Erythranthe guttata [common monkey flower]
emb|CDY46675.1|  BnaA03g48330D                                        48.1    7e-04   Brassica napus [oilseed rape]
ref|XP_006365959.1|  PREDICTED: probable beta-1,3-galactosyltrans...  48.1    7e-04   Solanum tuberosum [potatoes]
ref|XP_009137625.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...  48.1    8e-04   Brassica rapa
ref|XP_009774309.1|  PREDICTED: probable beta-1,3-galactosyltrans...  48.1    8e-04   Nicotiana sylvestris
ref|XP_009610750.1|  PREDICTED: probable beta-1,3-galactosyltrans...  48.1    8e-04   Nicotiana tomentosiformis
gb|EPS64736.1|  hypothetical protein M569_10045                       47.0    8e-04   Genlisea aurea
ref|XP_009357459.1|  PREDICTED: probable beta-1,3-galactosyltrans...  47.8    9e-04   Pyrus x bretschneideri [bai li]



>ref|XP_002268282.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Vitis vinifera]
 emb|CBI28801.3| unnamed protein product [Vitis vinifera]
Length=407

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +IS+KWTLLLC+  FCAG+FFTNRMW VPESK
Sbjct  14   VISQKWTLLLCVGCFCAGMFFTNRMWAVPESK  45



>ref|XP_010657202.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Vitis vinifera]
Length=405

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +IS+KWTLLLC+  FCAG+FFTNRMW VPESK
Sbjct  14   VISQKWTLLLCVGCFCAGMFFTNRMWAVPESK  45



>ref|XP_010657203.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X3 [Vitis vinifera]
Length=404

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +IS+KWTLLLC+  FCAG+FFTNRMW VPESK
Sbjct  14   VISQKWTLLLCVGCFCAGMFFTNRMWAVPESK  45



>ref|XP_007215471.1| hypothetical protein PRUPE_ppa006530mg [Prunus persica]
 gb|EMJ16670.1| hypothetical protein PRUPE_ppa006530mg [Prunus persica]
Length=407

 Score = 60.1 bits (144),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +ISKKWTLLLC+  FCAG+ FTNRMWTVPE+K
Sbjct  14   VISKKWTLLLCLGCFCAGMLFTNRMWTVPENK  45



>ref|XP_007215470.1| hypothetical protein PRUPE_ppa006530mg [Prunus persica]
 gb|EMJ16669.1| hypothetical protein PRUPE_ppa006530mg [Prunus persica]
Length=404

 Score = 60.1 bits (144),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +ISKKWTLLLC+  FCAG+ FTNRMWTVPE+K
Sbjct  14   VISKKWTLLLCLGCFCAGMLFTNRMWTVPENK  45



>ref|XP_008229956.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Prunus 
mume]
Length=407

 Score = 60.1 bits (144),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +ISKKWTLLLC+  FCAG+ FTNRMWTVPE+K
Sbjct  14   VISKKWTLLLCLGCFCAGMLFTNRMWTVPENK  45



>ref|XP_009598546.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Nicotiana 
tomentosiformis]
Length=410

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +IS+KWTL LCI SFCAG+FFT RMWTVPE+K
Sbjct  16   IISQKWTLFLCIGSFCAGMFFTARMWTVPETK  47



>ref|XP_009770915.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Nicotiana 
sylvestris]
Length=410

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +IS+KWTL LCI SFCAG+FFT RMWTVPE+K
Sbjct  16   VISQKWTLFLCIGSFCAGMFFTARMWTVPETK  47



>ref|XP_008342010.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Malus domestica]
Length=408

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            IS+KWTL LC+  FCAG+FFTNRMWT+PESK
Sbjct  16   ISQKWTLFLCLSCFCAGMFFTNRMWTIPESK  46



>ref|XP_008342011.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Malus domestica]
Length=405

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            IS+KWTL LC+  FCAG+FFTNRMWT+PESK
Sbjct  16   ISQKWTLFLCLSCFCAGMFFTNRMWTIPESK  46



>ref|XP_004287949.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=407

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +IS+KWTLLLC+  FCAG+ FTNRMW+VPESK
Sbjct  15   VISQKWTLLLCLSCFCAGMLFTNRMWSVPESK  46



>ref|XP_011463344.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=404

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +IS+KWTLLLC+  FCAG+ FTNRMW+VPESK
Sbjct  15   VISQKWTLLLCLSCFCAGMLFTNRMWSVPESK  46



>ref|NP_001077462.1| putative beta-1,3-galactosyltransferase 2 [Arabidopsis thaliana]
 sp|A8MRC7.1|B3GT2_ARATH RecName: Full=Probable beta-1,3-galactosyltransferase 2 [Arabidopsis 
thaliana]
 gb|AEE27798.1| putative beta-1,3-galactosyltransferase 2 [Arabidopsis thaliana]
 gb|AHL38970.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=407

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +S+KWT+LLC+ SFC G+FFTNRMW +PESK
Sbjct  15   VSRKWTILLCLGSFCVGMFFTNRMWNIPESK  45



>ref|NP_172009.1| putative beta-1,3-galactosyltransferase 2 [Arabidopsis thaliana]
 gb|AAK63859.1|AF389287_1 At1g05170/YUP8H12_22 [Arabidopsis thaliana]
 gb|AAB71461.1| Similar to Sequence 10 from patent 5477002 (gb|1253956) [Arabidopsis 
thaliana]
 gb|AAM47315.1| At1g05170/YUP8H12_22 [Arabidopsis thaliana]
 gb|AEE27797.1| putative beta-1,3-galactosyltransferase 2 [Arabidopsis thaliana]
Length=404

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +S+KWT+LLC+ SFC G+FFTNRMW +PESK
Sbjct  15   VSRKWTILLCLGSFCVGMFFTNRMWNIPESK  45



>dbj|BAJ89822.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89142.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=399

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            IS+KWT LLC+ SFC G+ FTNRMWTVPESK
Sbjct  17   ISRKWTSLLCLSSFCVGLIFTNRMWTVPESK  47



>dbj|BAJ89733.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=399

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            IS+KWT LLC+ SFC G+ FTNRMWTVPESK
Sbjct  17   ISRKWTSLLCLSSFCVGLIFTNRMWTVPESK  47



>gb|EMT25658.1| Putative beta-1,3-galactosyltransferase 2 [Aegilops tauschii]
Length=400

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            IS+KWT LLC+ SFC G+ FTNRMWTVPESK
Sbjct  17   ISRKWTSLLCLSSFCVGLIFTNRMWTVPESK  47



>ref|XP_009353285.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Pyrus x bretschneideri]
Length=408

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            IS+KWTL LC+  FCAG+ FTNRMWTVPESK
Sbjct  16   ISQKWTLFLCLSCFCAGMLFTNRMWTVPESK  46



>ref|XP_009353286.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Pyrus x bretschneideri]
Length=405

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            IS+KWTL LC+  FCAG+ FTNRMWTVPESK
Sbjct  16   ISQKWTLFLCLSCFCAGMLFTNRMWTVPESK  46



>emb|CDP10795.1| unnamed protein product [Coffea canephora]
Length=409

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +IS+KWT+ LCI SFC G+ FTNRMW VPESK
Sbjct  16   VISQKWTIFLCIGSFCVGMLFTNRMWAVPESK  47



>ref|XP_004243473.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Solanum lycopersicum]
Length=408

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            + S+KWTL LCI SFCAG+FFT RMWT+PE+K
Sbjct  14   VASQKWTLFLCISSFCAGMFFTARMWTIPEAK  45



>ref|XP_010323831.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Solanum lycopersicum]
Length=406

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            + S+KWTL LCI SFCAG+FFT RMWT+PE+K
Sbjct  14   VASQKWTLFLCISSFCAGMFFTARMWTIPEAK  45



>ref|NP_001050543.1| Os03g0577500 [Oryza sativa Japonica Group]
 gb|AAT76370.1| putative glycosyltransferase [Oryza sativa Japonica Group]
 gb|ABF97265.1| Galactosyltransferase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12457.1| Os03g0577500 [Oryza sativa Japonica Group]
 gb|EAY90748.1| hypothetical protein OsI_12348 [Oryza sativa Indica Group]
 gb|EAZ27579.1| hypothetical protein OsJ_11528 [Oryza sativa Japonica Group]
Length=406

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ISKKWTLLLC+ SFC G+ FTNRMWT+PE K
Sbjct  25   ISKKWTLLLCLASFCIGLIFTNRMWTMPEPK  55



>ref|XP_010923856.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Elaeis guineensis]
Length=412

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++SKKWT LLC+ SFC G+FFTNRMWT+PE+ 
Sbjct  22   MVSKKWTFLLCLGSFCIGLFFTNRMWTMPEAN  53



>ref|XP_002464309.1| hypothetical protein SORBIDRAFT_01g015960 [Sorghum bicolor]
 gb|EER91307.1| hypothetical protein SORBIDRAFT_01g015960 [Sorghum bicolor]
Length=409

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ISKKWTLLLC+ SFC G+ FTNRMWT+PE K
Sbjct  29   ISKKWTLLLCLGSFCIGLLFTNRMWTMPEPK  59



>ref|XP_010923857.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X3 [Elaeis guineensis]
Length=374

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++SKKWT LLC+ SFC G+FFTNRMWT+PE+ 
Sbjct  22   MVSKKWTFLLCLGSFCIGLFFTNRMWTMPEAN  53



>ref|XP_010923855.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Elaeis guineensis]
Length=428

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++SKKWT LLC+ SFC G+FFTNRMWT+PE+ 
Sbjct  22   MVSKKWTFLLCLGSFCIGLFFTNRMWTMPEAN  53



>ref|XP_010510018.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 [Camelina 
sativa]
Length=408

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            L+SKKWTLLLC  SFC G+ FT+RMW +PESK
Sbjct  15   LVSKKWTLLLCFGSFCFGILFTDRMWNIPESK  46



>ref|XP_010469586.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 isoform 
X1 [Camelina sativa]
Length=408

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            L+SKKWTLLLC  SFC G+ FT+RMW +PESK
Sbjct  15   LVSKKWTLLLCFGSFCFGILFTDRMWNIPESK  46



>ref|XP_010413995.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 isoform 
X1 [Camelina sativa]
Length=408

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            L+SKKWTLLLC  SFC G+ FT+RMW +PESK
Sbjct  15   LVSKKWTLLLCFGSFCFGILFTDRMWNIPESK  46



>ref|XP_002892271.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68530.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=407

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +S+KWT+LLC+ SFC G+FFT+RMW +PESK
Sbjct  15   VSRKWTILLCLGSFCVGMFFTDRMWNIPESK  45



>ref|XP_010413996.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 isoform 
X2 [Camelina sativa]
Length=405

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            L+SKKWTLLLC  SFC G+ FT+RMW +PESK
Sbjct  15   LVSKKWTLLLCFGSFCFGILFTDRMWNIPESK  46



>gb|AFW68302.1| hypothetical protein ZEAMMB73_372854 [Zea mays]
Length=299

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ISKKWT LLC  SFC G+ FTNRMWTVPE K
Sbjct  33   ISKKWTFLLCFGSFCIGLLFTNRMWTVPEPK  63



>ref|XP_010469587.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 isoform 
X2 [Camelina sativa]
Length=405

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            L+SKKWTLLLC  SFC G+ FT+RMW +PESK
Sbjct  15   LVSKKWTLLLCFGSFCFGILFTDRMWNIPESK  46



>ref|XP_010929797.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Elaeis 
guineensis]
Length=411

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++SK+WT LLC+ SFC G+ FTNRMWT+PE+K
Sbjct  21   MVSKRWTFLLCLGSFCVGLLFTNRMWTMPEAK  52



>gb|EYU34029.1| hypothetical protein MIMGU_mgv1a007633mg [Erythranthe guttata]
Length=401

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++S KWTL LC+ SFCAG+FFTNR+W +PE+K
Sbjct  17   VVSHKWTLFLCVASFCAGLFFTNRLWIMPEAK  48



>ref|XP_006366587.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Solanum tuberosum]
Length=406

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +IS+KW L LCI SFCAG+FFT RMWT+P++K
Sbjct  14   VISQKWILFLCISSFCAGMFFTARMWTIPDAK  45



>ref|XP_008379640.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Malus domestica]
Length=405

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            IS+KWT  LC+  FCAG+ FTNRMWTVPESK
Sbjct  16   ISQKWTFFLCLSCFCAGMLFTNRMWTVPESK  46



>ref|XP_006366586.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X1 [Solanum tuberosum]
Length=408

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +IS+KW L LCI SFCAG+FFT RMWT+P++K
Sbjct  14   VISQKWILFLCISSFCAGMFFTARMWTIPDAK  45



>ref|XP_008379639.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Malus domestica]
Length=408

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            IS+KWT  LC+  FCAG+ FTNRMWTVPESK
Sbjct  16   ISQKWTFFLCLSCFCAGMLFTNRMWTVPESK  46



>ref|XP_002320464.1| galactosyltransferase family protein [Populus trichocarpa]
 gb|EEE98779.1| galactosyltransferase family protein [Populus trichocarpa]
Length=405

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +ISKKW L  C+  FCAGVFF NRMWTVPE K
Sbjct  15   VISKKWALFFCLACFCAGVFFNNRMWTVPEPK  46



>ref|XP_008681412.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|AFW68303.1| hypothetical protein ZEAMMB73_372854 [Zea mays]
Length=416

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ISKKWT LLC  SFC G+ FTNRMWTVPE K
Sbjct  33   ISKKWTFLLCFGSFCIGLLFTNRMWTVPEPK  63



>ref|XP_006375532.1| hypothetical protein POPTR_0014s15200g [Populus trichocarpa]
 gb|ERP53329.1| hypothetical protein POPTR_0014s15200g [Populus trichocarpa]
Length=408

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +ISKKW L  C+  FCAGVFF NRMWTVPE K
Sbjct  15   VISKKWALFFCLACFCAGVFFNNRMWTVPEPK  46



>ref|XP_003540300.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoformX1 
[Glycine max]
 gb|KHN44874.1| Putative beta-1,3-galactosyltransferase 2 [Glycine soja]
Length=407

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++S+KW + LC+ SFCAG+FFTNRMWT+PE K
Sbjct  14   VMSQKWMIFLCVGSFCAGMFFTNRMWTIPEPK  45



>gb|KDO54671.1| hypothetical protein CISIN_1g015407mg [Citrus sinensis]
Length=405

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++S+KWT LLC+  FCAG+ FTNRMW VPESK
Sbjct  14   VVSQKWTFLLCLGCFCAGMLFTNRMWAVPESK  45



>ref|XP_003596979.1| hypothetical protein MTR_2g088270 [Medicago truncatula]
 gb|AES67230.1| beta-1,3-galactosyltransferase-like protein [Medicago truncatula]
Length=402

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +S+KW + LCI SFCAG+FFTNRMWT+PE K
Sbjct  15   MSQKWMIFLCIGSFCAGMFFTNRMWTIPEPK  45



>gb|KDO54670.1| hypothetical protein CISIN_1g015407mg [Citrus sinensis]
Length=407

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++S+KWT LLC+  FCAG+ FTNRMW VPESK
Sbjct  14   VVSQKWTFLLCLGCFCAGMLFTNRMWAVPESK  45



>gb|KDO54672.1| hypothetical protein CISIN_1g015407mg [Citrus sinensis]
Length=404

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++S+KWT LLC+  FCAG+ FTNRMW VPESK
Sbjct  14   VVSQKWTFLLCLGCFCAGMLFTNRMWAVPESK  45



>ref|XP_006469679.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Citrus sinensis]
Length=405

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++S+KWT LLC+  FCAG+ FTNRMW VPESK
Sbjct  14   VVSQKWTFLLCLGCFCAGMLFTNRMWAVPESK  45



>ref|XP_006469680.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X3 [Citrus sinensis]
Length=404

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++S+KWT LLC+  FCAG+ FTNRMW VPESK
Sbjct  14   VVSQKWTFLLCLGCFCAGMLFTNRMWAVPESK  45



>ref|XP_006447568.1| hypothetical protein CICLE_v10015443mg [Citrus clementina]
 ref|XP_006469678.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X1 [Citrus sinensis]
 gb|ESR60808.1| hypothetical protein CICLE_v10015443mg [Citrus clementina]
Length=407

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++S+KWT LLC+  FCAG+ FTNRMW VPESK
Sbjct  14   VVSQKWTFLLCLGCFCAGMLFTNRMWAVPESK  45



>ref|XP_008804298.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Phoenix 
dactylifera]
Length=411

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            + SKKWT LLC+ SFC G+ FTNRMWT+PE+K
Sbjct  21   MASKKWTFLLCLGSFCVGLLFTNRMWTMPEAK  52



>ref|XP_004251520.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Solanum lycopersicum]
Length=397

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++SKKW+L LC+ SFCAG+FFTNRMW V E+K
Sbjct  16   VVSKKWSLFLCLGSFCAGMFFTNRMWIVSETK  47



>ref|XP_010313672.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Solanum lycopersicum]
Length=395

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++SKKW+L LC+ SFCAG+FFTNRMW V E+K
Sbjct  16   VVSKKWSLFLCLGSFCAGMFFTNRMWIVSETK  47



>ref|XP_006650268.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Oryza 
brachyantha]
Length=405

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ISKKWT LLC+ SFC G+ FTNRMWT+PE K
Sbjct  24   ISKKWTFLLCLGSFCIGLIFTNRMWTMPEPK  54



>ref|XP_004982530.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Setaria 
italica]
Length=405

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ISKKWT LLC+ SFC G+ FTNRMWT+PE K
Sbjct  25   ISKKWTFLLCLGSFCIGLLFTNRMWTMPEPK  55



>ref|XP_006294322.1| hypothetical protein CARUB_v10023330mg [Capsella rubella]
 gb|EOA27220.1| hypothetical protein CARUB_v10023330mg [Capsella rubella]
Length=408

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            L+SKKWT LLC  SFC G+ FT+RMW +PESK
Sbjct  15   LVSKKWTFLLCFGSFCFGILFTDRMWNIPESK  46



>ref|XP_010557003.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X3 [Tarenaya hassleriana]
Length=405

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +SKKW LLLC+  FCAG+FFT+RMW VPE K
Sbjct  16   VSKKWALLLCLGCFCAGMFFTDRMWNVPEPK  46



>ref|XP_010276120.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Nelumbo 
nucifera]
Length=404

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++S+KWTL LCI SFC G+ FTN+MW VPE+K
Sbjct  14   VVSQKWTLFLCIGSFCVGMLFTNKMWAVPETK  45



>ref|XP_010557001.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010557002.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Tarenaya hassleriana]
Length=408

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +SKKW LLLC+  FCAG+FFT+RMW VPE K
Sbjct  16   VSKKWALLLCLGCFCAGMFFTDRMWNVPEPK  46



>ref|XP_006418057.1| hypothetical protein EUTSA_v10007787mg [Eutrema salsugineum]
 gb|ESQ36410.1| hypothetical protein EUTSA_v10007787mg [Eutrema salsugineum]
Length=407

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  362  SKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            S+KWT LLCI SFC G+ FT+RMW+VPESK
Sbjct  16   SRKWTFLLCIGSFCVGMLFTDRMWSVPESK  45



>gb|KGN63249.1| hypothetical protein Csa_2G418850 [Cucumis sativus]
Length=409

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +IS+KWTL LC+  FC+G+ FTNRMWT+PE K
Sbjct  15   VISQKWTLFLCLVCFCSGMLFTNRMWTIPEHK  46



>gb|KDP39142.1| hypothetical protein JCGZ_00899 [Jatropha curcas]
Length=404

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++SKKWTLL CI  FCAG+ F++RMWTVPE K
Sbjct  14   VVSKKWTLLFCIGCFCAGMLFSDRMWTVPEVK  45



>ref|XP_008455884.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Cucumis 
melo]
Length=408

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +IS+KWTL LC+  FC+G+ FTNRMWT+PE K
Sbjct  15   VISQKWTLFLCLVCFCSGMLFTNRMWTIPEHK  46



>ref|XP_002879388.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55647.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=409

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            L+SKKWT LLC  SFC G+ FT+RMW +PESK
Sbjct  15   LVSKKWTFLLCFGSFCFGILFTDRMWIIPESK  46



>ref|NP_180802.1| putative beta-1,3-galactosyltransferase 3 [Arabidopsis thaliana]
 sp|Q9ZV71.1|B3GT3_ARATH RecName: Full=Probable beta-1,3-galactosyltransferase 3 [Arabidopsis 
thaliana]
 gb|AAC69935.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42172.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08684.1| putative beta-1,3-galactosyltransferase 3 [Arabidopsis thaliana]
 gb|AHL38822.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=409

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            L+SKKWT LLC  SFC G+ FT+RMW +PESK
Sbjct  15   LVSKKWTFLLCFGSFCFGILFTDRMWIIPESK  46



>gb|KJB13703.1| hypothetical protein B456_002G089700 [Gossypium raimondii]
Length=374

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++KKWTLLLCI  FCAG+ F++RMWTVPE++
Sbjct  16   VTKKWTLLLCIGCFCAGMLFSDRMWTVPEAE  46



>gb|KHG30061.1| putative beta-1,3-galactosyltransferase 4 -like protein [Gossypium 
arboreum]
Length=406

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++KKWTLLLCI  FCAG+ F++RMWTVPE++
Sbjct  16   VTKKWTLLLCIGCFCAGMLFSDRMWTVPEAE  46



>ref|XP_003562342.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Brachypodium 
distachyon]
Length=405

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            IS+KWT +LCI SFC G+ FTNRMWT+PE K
Sbjct  25   ISRKWTFILCIGSFCIGLIFTNRMWTLPEPK  55



>gb|KJB13702.1| hypothetical protein B456_002G089700 [Gossypium raimondii]
Length=406

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++KKWTLLLCI  FCAG+ F++RMWTVPE++
Sbjct  16   VTKKWTLLLCIGCFCAGMLFSDRMWTVPEAE  46



>ref|XP_006452384.1| hypothetical protein CICLE_v10008439mg [Citrus clementina]
 gb|ESR65624.1| hypothetical protein CICLE_v10008439mg [Citrus clementina]
Length=417

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPE  445
            +SKKWTLLLCI  FCAG+ F++RMWTVPE
Sbjct  18   MSKKWTLLLCIGCFCAGMLFSDRMWTVPE  46



>ref|XP_006475057.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Citrus sinensis]
 gb|KDO62741.1| hypothetical protein CISIN_1g015419mg [Citrus sinensis]
Length=406

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPE  445
            +SKKWTLLLCI  FCAG+ F++RMWTVPE
Sbjct  18   MSKKWTLLLCIGCFCAGMLFSDRMWTVPE  46



>ref|XP_006452382.1| hypothetical protein CICLE_v10008439mg [Citrus clementina]
 ref|XP_006475056.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X1 [Citrus sinensis]
 gb|ESR65622.1| hypothetical protein CICLE_v10008439mg [Citrus clementina]
 gb|KDO62740.1| hypothetical protein CISIN_1g015419mg [Citrus sinensis]
Length=407

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPE  445
            +SKKWTLLLCI  FCAG+ F++RMWTVPE
Sbjct  18   MSKKWTLLLCIGCFCAGMLFSDRMWTVPE  46



>ref|XP_011047261.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Populus euphratica]
Length=408

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +ISKKW L  C+  FCAGVFF NRMW VPE K
Sbjct  15   VISKKWALFFCLACFCAGVFFNNRMWAVPEPK  46



>ref|XP_010104592.1| putative beta-1,3-galactosyltransferase 2 [Morus notabilis]
 gb|EXC01255.1| putative beta-1,3-galactosyltransferase 2 [Morus notabilis]
Length=420

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++S+KW LLLC+  FCAG+ FTNRMW VPE+K
Sbjct  14   ILSQKWALLLCLGCFCAGMLFTNRMWDVPETK  45



>gb|KJB80506.1| hypothetical protein B456_013G101400 [Gossypium raimondii]
Length=319

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +SKKWT LLC+  FCAG+ FTNRM  VPESK
Sbjct  15   VSKKWTFLLCLSCFCAGILFTNRMVAVPESK  45



>ref|XP_011047262.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Populus euphratica]
Length=405

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +ISKKW L  C+  FCAGVFF NRMW VPE K
Sbjct  15   VISKKWALFFCLACFCAGVFFNNRMWAVPEPK  46



>ref|XP_003543389.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Glycine 
max]
 gb|KHN36530.1| Putative beta-1,3-galactosyltransferase 2 [Glycine soja]
Length=407

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++S+KW + LCI  FCAG+FFTNRMWT+PE K
Sbjct  14   VMSQKWMIFLCIGCFCAGMFFTNRMWTIPEPK  45



>ref|XP_004487414.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cicer 
arietinum]
Length=408

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++S KW + LCI SFCAG+FFTNRMW +PE K
Sbjct  14   VMSHKWMVFLCIGSFCAGMFFTNRMWNIPEPK  45



>ref|XP_009359950.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 [Pyrus x 
bretschneideri]
Length=402

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +IS+ W LLLC  SFCAGV FTNR+W VPES+
Sbjct  17   VISRNWALLLCFCSFCAGVLFTNRLWMVPESR  48



>ref|XP_007149975.1| hypothetical protein PHAVU_005G115300g [Phaseolus vulgaris]
 gb|ESW21969.1| hypothetical protein PHAVU_005G115300g [Phaseolus vulgaris]
Length=407

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++SKKW + LCI SFCAG+ FTNR+WT+PE K
Sbjct  14   VMSKKWVIFLCIGSFCAGLVFTNRIWTIPEPK  45



>ref|XP_002279814.2| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Vitis vinifera]
 emb|CBI26647.3| unnamed protein product [Vitis vinifera]
Length=405

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++S+KWTLL CI  FCAG+ F++RMWT+PE+K
Sbjct  15   VVSRKWTLLFCIGCFCAGMLFSDRMWTMPEAK  46



>ref|XP_004515096.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cicer 
arietinum]
Length=408

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPE  445
             IS+KWTL LC+ SFCAG+ FTNR+W++PE
Sbjct  15   FISQKWTLFLCLGSFCAGMLFTNRIWSIPE  44



>gb|AFW66427.1| hypothetical protein ZEAMMB73_715676 [Zea mays]
Length=174

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPES  448
            +S++W +LLC+ SFC G+ FTNRMWT+PE+
Sbjct  14   VSRRWAVLLCVGSFCLGLLFTNRMWTLPEA  43



>gb|EMS64796.1| putative beta-1,3-galactosyltransferase 2 [Triticum urartu]
Length=400

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            IS+KWT LLC+ SF  G+ FTNRMWTVPESK
Sbjct  17   ISRKWTSLLCLSSFFVGLIFTNRMWTVPESK  47



>ref|XP_006855892.1| hypothetical protein AMTR_s00037p00154410 [Amborella trichopoda]
 gb|ERN17359.1| hypothetical protein AMTR_s00037p00154410 [Amborella trichopoda]
Length=405

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +S++WT  LC+ SFCAG+ FTNRMW++PE+K
Sbjct  16   VSRRWTFFLCLASFCAGLLFTNRMWSMPEAK  46



>ref|XP_006351966.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X1 [Solanum tuberosum]
Length=397

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++SKKW+L LC+ SFCAG+FFTNRMW + E++
Sbjct  16   VVSKKWSLFLCLGSFCAGMFFTNRMWIISETE  47



>ref|XP_006351967.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Solanum tuberosum]
Length=395

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++SKKW+L LC+ SFCAG+FFTNRMW + E++
Sbjct  16   VVSKKWSLFLCLGSFCAGMFFTNRMWIISETE  47



>gb|KJB80508.1| hypothetical protein B456_013G101400 [Gossypium raimondii]
Length=398

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +SKKWT LLC+  FCAG+ FTNRM  VPESK
Sbjct  15   VSKKWTFLLCLSCFCAGILFTNRMVAVPESK  45



>ref|XP_009119198.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Brassica rapa]
Length=408

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  371  WTLLLCIXSFCAGVFFTNRMWTVPESK  451
            WTLLLC+ SFCAG+FFT+RMW +PES+
Sbjct  26   WTLLLCLGSFCAGMFFTDRMWNIPESR  52



>ref|XP_009119197.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Brassica rapa]
Length=411

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  371  WTLLLCIXSFCAGVFFTNRMWTVPESK  451
            WTLLLC+ SFCAG+FFT+RMW +PES+
Sbjct  26   WTLLLCLGSFCAGMFFTDRMWNIPESR  52



>ref|XP_004144497.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
 gb|KGN43517.1| hypothetical protein Csa_7G043590 [Cucumis sativus]
Length=407

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +IS+KW + LC+ SFC G+FFTNRMW VPE K
Sbjct  14   VISQKWAVFLCLGSFCLGMFFTNRMWNVPEPK  45



>ref|XP_008455443.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Cucumis 
melo]
Length=407

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +IS+KW + LC+ SFC G+FFTNRMW VPE K
Sbjct  14   VISQKWAVFLCLGSFCLGMFFTNRMWNVPEPK  45



>emb|CDY48266.1| BnaA05g10880D [Brassica napus]
Length=409

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
             +S+KWT LLC  SFC G+FFT+RMW +PES 
Sbjct  15   FVSRKWTFLLCFASFCFGIFFTDRMWNIPESN  46



>emb|CDY12206.1| BnaC04g12360D [Brassica napus]
Length=409

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPES  448
             +S+KWT LLC  SFC G+FFT+RMW +PES
Sbjct  15   FVSRKWTFLLCFASFCFGIFFTDRMWNIPES  45



>ref|XP_007153952.1| hypothetical protein PHAVU_003G079100g [Phaseolus vulgaris]
 gb|ESW25946.1| hypothetical protein PHAVU_003G079100g [Phaseolus vulgaris]
Length=380

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPE  445
            ++ +KW LLLC+ SFCAG+FFTNR+W++PE
Sbjct  17   VLQRKWALLLCVASFCAGMFFTNRIWSMPE  46



>ref|XP_009143988.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 isoform 
X1 [Brassica rapa]
Length=409

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
             +S+KWT LLC  SFC G+FFT+RMW +PES 
Sbjct  15   FVSRKWTFLLCFASFCFGIFFTDRMWNIPESN  46



>gb|KJB80507.1| hypothetical protein B456_013G101400 [Gossypium raimondii]
Length=405

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +SKKWT LLC+  FCAG+ FTNRM  VPESK
Sbjct  15   VSKKWTFLLCLSCFCAGILFTNRMVAVPESK  45



>gb|KHF99242.1| putative beta-1,3-galactosyltransferase 2 -like protein [Gossypium 
arboreum]
Length=404

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +SKKWT LLC+  FCAG+ FTNRM  VPESK
Sbjct  15   VSKKWTFLLCLSCFCAGILFTNRMVAVPESK  45



>ref|XP_007045661.1| Galactosyltransferase family protein [Theobroma cacao]
 gb|EOY01493.1| Galactosyltransferase family protein [Theobroma cacao]
Length=435

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +SKKWT LLC+  FCAG+ FTNRM +VPESK
Sbjct  15   VSKKWTFLLCLGCFCAGMLFTNRMGSVPESK  45



>ref|XP_009143989.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 isoform 
X2 [Brassica rapa]
Length=406

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
             +S+KWT LLC  SFC G+FFT+RMW +PES 
Sbjct  15   FVSRKWTFLLCFASFCFGIFFTDRMWNIPESN  46



>gb|KJB80505.1| hypothetical protein B456_013G101400 [Gossypium raimondii]
Length=404

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +SKKWT LLC+  FCAG+ FTNRM  VPESK
Sbjct  15   VSKKWTFLLCLSCFCAGILFTNRMVAVPESK  45



>ref|XP_009419577.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009419578.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Musa acuminata 
subsp. malaccensis]
Length=400

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++++WTLLLC+ SF  G+ FTNRMWTVPE+K
Sbjct  11   VARRWTLLLCLGSFVTGLLFTNRMWTVPEAK  41



>ref|XP_004159203.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-1,3-galactosyltransferase 
2-like [Cucumis sativus]
Length=407

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +IS+KW + LC+ SFC G+FFTNRMW VPE K
Sbjct  14   VISQKWAVXLCLGSFCLGMFFTNRMWNVPEPK  45



>ref|XP_004172360.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
Length=408

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +IS+KWTL LC+  FC+G+ FTNR+WT+PE K
Sbjct  15   VISQKWTLFLCLVCFCSGMLFTNRVWTIPEHK  46



>ref|XP_004507687.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cicer 
arietinum]
Length=378

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +I +KW LLLC+ SFCAG+FFTNRMW++ E K
Sbjct  17   VIHRKWVLLLCLASFCAGMFFTNRMWSMSEYK  48



>ref|XP_010278673.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Nelumbo nucifera]
Length=360

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +S+KWT+ LCI  FCAG+ FTNRM TVPE+K
Sbjct  16   VSRKWTIFLCIACFCAGMLFTNRMLTVPETK  46



>ref|XP_009624796.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Nicotiana tomentosiformis]
Length=404

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++S+KW+LLLC+ SFCAG+ FT RMW +PE K
Sbjct  16   VVSQKWSLLLCLGSFCAGMLFTTRMWIIPEIK  47



>ref|XP_009624797.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Nicotiana tomentosiformis]
Length=402

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++S+KW+LLLC+ SFCAG+ FT RMW +PE K
Sbjct  16   VVSQKWSLLLCLGSFCAGMLFTTRMWIIPEIK  47



>ref|XP_009775718.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Nicotiana sylvestris]
Length=404

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++S+KW+LLLC+ SFCAG+ FT RMW +PE K
Sbjct  16   VVSQKWSLLLCLGSFCAGMLFTTRMWIIPEIK  47



>ref|XP_009775717.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Nicotiana sylvestris]
Length=405

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++S+KW+LLLC+ SFCAG+ FT RMW +PE K
Sbjct  16   VVSQKWSLLLCLGSFCAGMLFTTRMWIIPEIK  47



>ref|XP_008364090.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 [Malus domestica]
Length=402

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +IS+ W LLLC  SFCAGV FTNR+W +PES+
Sbjct  17   VISRNWALLLCFCSFCAGVLFTNRLWMMPESR  48



>gb|KEH29683.1| beta-1,3-galactosyltransferase-like protein [Medicago truncatula]
Length=407

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPE  445
            +IS+KW L LC+ SFCAG+ FTNR+W++PE
Sbjct  14   VISQKWALFLCLGSFCAGMLFTNRIWSIPE  43



>gb|KDO78241.1| hypothetical protein CISIN_1g015962mg [Citrus sinensis]
Length=253

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            LI +KW L LC  SFCAG+ FTNRMW +PESK
Sbjct  15   LIPRKWALFLCACSFCAGMSFTNRMWMMPESK  46



>gb|KDO78238.1| hypothetical protein CISIN_1g015962mg [Citrus sinensis]
 gb|KDO78239.1| hypothetical protein CISIN_1g015962mg [Citrus sinensis]
 gb|KDO78240.1| hypothetical protein CISIN_1g015962mg [Citrus sinensis]
Length=270

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            LI +KW L LC  SFCAG+ FTNRMW +PESK
Sbjct  15   LIPRKWALFLCACSFCAGMSFTNRMWMMPESK  46



>ref|XP_010278672.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Nelumbo nucifera]
Length=405

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +S+KWT+ LCI  FCAG+ FTNRM TVPE+K
Sbjct  16   VSRKWTIFLCIACFCAGMLFTNRMLTVPETK  46



>gb|KDO78237.1| hypothetical protein CISIN_1g015962mg [Citrus sinensis]
Length=313

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            LI +KW L LC  SFCAG+ FTNRMW +PESK
Sbjct  15   LIPRKWALFLCACSFCAGMSFTNRMWMMPESK  46



>ref|XP_006410375.1| hypothetical protein EUTSA_v10016736mg [Eutrema salsugineum]
 gb|ESQ51828.1| hypothetical protein EUTSA_v10016736mg [Eutrema salsugineum]
Length=408

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
             +++KWT LLC  SFC G+FFT+RMW +PES+
Sbjct  15   FVTRKWTFLLCFASFCFGMFFTDRMWNIPESR  46



>gb|KJB62838.1| hypothetical protein B456_009G440200 [Gossypium raimondii]
Length=280

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +++KK TLLLCI  FCAG+ F++RMWTVPE++
Sbjct  15   MVTKKLTLLLCIGCFCAGMLFSDRMWTVPEAE  46



>ref|XP_008808431.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-1,3-galactosyltransferase 
2 [Phoenix dactylifera]
Length=411

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +2

Query  365  KKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +KWT LLC+ SFC G+FFTNRMWT+PE+ 
Sbjct  24   EKWTFLLCLGSFCIGLFFTNRMWTMPEAN  52



>ref|XP_008359262.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Malus domestica]
Length=412

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +S+KWTLL CI  FCAG+ F++RMW+VPE K
Sbjct  24   VSRKWTLLFCIGCFCAGMLFSDRMWSVPEIK  54



>ref|XP_008359264.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Malus domestica]
Length=411

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +S+KWTLL CI  FCAG+ F++RMW+VPE K
Sbjct  24   VSRKWTLLFCIGCFCAGMLFSDRMWSVPEIK  54



>gb|EMS52307.1| putative beta-1,3-galactosyltransferase 2 [Triticum urartu]
 gb|EMT29217.1| Putative beta-1,3-galactosyltransferase 2 [Aegilops tauschii]
Length=400

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPES  448
            +SK+W +LLC+ SFC G+ FTNRMWT+PE+
Sbjct  12   VSKRWAVLLCLGSFCLGLLFTNRMWTLPEA  41



>emb|CDY49507.1| BnaC05g03190D [Brassica napus]
Length=410

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +2

Query  371  WTLLLCIXSFCAGVFFTNRMWTVPESK  451
            WTLLLC+ SFC G+FFT+RMW +PES+
Sbjct  24   WTLLLCLGSFCVGMFFTDRMWNIPESR  50



>gb|KFK42855.1| hypothetical protein AALP_AA1G047700 [Arabis alpina]
Length=408

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +S+K TL LC+ SFC G+FFT+RMW++PES+
Sbjct  15   VSRKLTLFLCLASFCVGLFFTDRMWSIPESR  45



>emb|CDY46836.1| BnaA10g03200D [Brassica napus]
Length=407

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +2

Query  371  WTLLLCIXSFCAGVFFTNRMWTVPESK  451
            WTLLLC+ SFC G+FFT+RMW +PES+
Sbjct  24   WTLLLCLGSFCVGMFFTDRMWNIPESR  50



>ref|XP_008385877.1| PREDICTED: probable beta-1,3-galactosyltransferase 2, partial 
[Malus domestica]
Length=407

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +S+KWTLL CI  FCAG+ F++RMW+VPE K
Sbjct  19   VSRKWTLLFCIGCFCAGMLFSDRMWSVPEIK  49



>ref|XP_006467430.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Citrus sinensis]
 gb|KDO78236.1| hypothetical protein CISIN_1g015962mg [Citrus sinensis]
Length=396

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            LI +KW L LC  SFCAG+ FTNRMW +PESK
Sbjct  15   LIPRKWALFLCACSFCAGMSFTNRMWMMPESK  46



>ref|XP_006467429.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X1 [Citrus sinensis]
 gb|KDO78235.1| hypothetical protein CISIN_1g015962mg [Citrus sinensis]
Length=397

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            LI +KW L LC  SFCAG+ FTNRMW +PESK
Sbjct  15   LIPRKWALFLCACSFCAGMSFTNRMWMMPESK  46



>ref|XP_007020793.1| Galactosyltransferase family protein [Theobroma cacao]
 gb|EOY12318.1| Galactosyltransferase family protein [Theobroma cacao]
Length=406

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPES  448
            +++KKW LLLCI  FCAG+ F++RMW VPE+
Sbjct  15   VVTKKWALLLCIGCFCAGMLFSDRMWAVPEA  45



>ref|XP_004966215.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Setaria 
italica]
Length=400

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPES  448
            ++++W LLLC+ SFC G+ FTNRMWT+PE+
Sbjct  12   VARRWVLLLCVGSFCLGLLFTNRMWTLPEA  41



>ref|XP_008677265.1| PREDICTED: beta-1,3-galactosyltransferase sqv-2 isoform X1 [Zea 
mays]
 gb|AFW66428.1| beta-1,3-galactosyltransferase sqv-2 [Zea mays]
Length=402

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPES  448
            +S++W +LLC+ SFC G+ FTNRMWT+PE+
Sbjct  14   VSRRWAVLLCVGSFCLGLLFTNRMWTLPEA  43



>ref|XP_002451594.1| hypothetical protein SORBIDRAFT_04g004400 [Sorghum bicolor]
 gb|EES04570.1| hypothetical protein SORBIDRAFT_04g004400 [Sorghum bicolor]
Length=402

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPES  448
            +S++W +LLC+ SFC G+ FTNRMWT+PE+
Sbjct  14   VSRRWAVLLCVGSFCLGLLFTNRMWTLPEA  43



>gb|KJB62836.1| hypothetical protein B456_009G440200 [Gossypium raimondii]
 gb|KJB62837.1| hypothetical protein B456_009G440200 [Gossypium raimondii]
Length=405

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +++KK TLLLCI  FCAG+ F++RMWTVPE++
Sbjct  15   MVTKKLTLLLCIGCFCAGMLFSDRMWTVPEAE  46



>ref|XP_010475189.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Camelina sativa]
Length=409

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +S+K+T+LLC+ SFC G+FFT+RMW++ ESK
Sbjct  17   VSRKYTILLCLGSFCLGLFFTDRMWSIEESK  47



>ref|XP_008439989.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Cucumis 
melo]
 ref|XP_008439990.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Cucumis 
melo]
 ref|XP_008439991.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Cucumis 
melo]
Length=403

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +2

Query  362  SKKWTLLLCIXSFCAGVFFTNRMWTVP  442
            S+ W LLLC+ SFCAG+FFTNRMW VP
Sbjct  18   SRNWVLLLCLGSFCAGMFFTNRMWLVP  44



>ref|XP_004155605.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
Length=403

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +2

Query  362  SKKWTLLLCIXSFCAGVFFTNRMWTVP  442
            S+ W LLLC+ SFCAG+FFTNRMW VP
Sbjct  18   SRNWVLLLCLGSFCAGMFFTNRMWLVP  44



>ref|XP_004134762.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
 gb|KGN49110.1| hypothetical protein Csa_6G513740 [Cucumis sativus]
Length=403

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +2

Query  362  SKKWTLLLCIXSFCAGVFFTNRMWTVP  442
            S+ W LLLC+ SFCAG+FFTNRMW VP
Sbjct  18   SRNWVLLLCLGSFCAGMFFTNRMWLVP  44



>ref|XP_010475190.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Camelina sativa]
Length=406

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +S+K+T+LLC+ SFC G+FFT+RMW++ ESK
Sbjct  17   VSRKYTILLCLGSFCLGLFFTDRMWSIEESK  47



>ref|XP_003550487.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X1 [Glycine max]
 ref|XP_006600308.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Glycine max]
Length=374

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++ +KW LLLC+ SFCAG+FFTNR+W++ E K
Sbjct  14   VLHRKWALLLCVASFCAGMFFTNRIWSMAEYK  45



>ref|XP_009361000.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Pyrus x bretschneideri]
Length=403

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPE  445
            +S+KWTLL CI  FCAG+ F++RMW+VPE
Sbjct  16   VSRKWTLLFCIGCFCAGMLFSDRMWSVPE  44



>ref|XP_004151891.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
Length=408

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +IS+KWTL LC+  FC+G+ FTNR+W +PE K
Sbjct  15   VISQKWTLFLCLVCFCSGMLFTNRLWLIPEHK  46



>ref|XP_008224857.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 [Prunus 
mume]
Length=402

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++S+ W  LLC  SFCAGV FTNR+W VPES+
Sbjct  17   VMSRNWAFLLCFCSFCAGVLFTNRLWMVPESR  48



>ref|XP_007211967.1| hypothetical protein PRUPE_ppa006589mg [Prunus persica]
 gb|EMJ13166.1| hypothetical protein PRUPE_ppa006589mg [Prunus persica]
Length=404

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +S+KWT+L CI  FCAG+ F++RMW+VPE K
Sbjct  16   VSRKWTILFCIGCFCAGMLFSDRMWSVPEIK  46



>ref|XP_011100272.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Sesamum 
indicum]
Length=405

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +IS+KWT+ LCI SF AG+ FT+R+WT PE+K
Sbjct  15   VISQKWTVFLCIASFSAGMLFTSRVWTTPEAK  46



>ref|XP_010233857.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Brachypodium 
distachyon]
Length=408

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPES  448
            +S++W +LLC+ SFC G+ FTNRMWT+PE+
Sbjct  20   VSRRWAVLLCLGSFCIGLLFTNRMWTLPEA  49



>ref|NP_849454.1| putative beta-1,3-galactosyltransferase 4 [Arabidopsis thaliana]
 gb|AEE85273.1| putative beta-1,3-galactosyltransferase 4 [Arabidopsis thaliana]
Length=306

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPES  448
            +SKKWTL LCI  FCAG+ F++RMW  PES
Sbjct  19   VSKKWTLFLCIGFFCAGILFSDRMWPEPES  48



>ref|XP_006646915.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Oryza 
brachyantha]
Length=404

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +S++W +LLC+ SFC G+ FTNRMWT+PE+ 
Sbjct  15   VSRRWAVLLCLGSFCLGLLFTNRMWTLPEAN  45



>gb|EAY84604.1| hypothetical protein OsI_05972 [Oryza sativa Indica Group]
Length=400

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +S++W +LLC+ SFC G+ FTNRMWT+PE+ 
Sbjct  13   VSRRWAVLLCLGSFCLGLLFTNRMWTLPEAN  43



>dbj|BAD25162.1| putative Avr9 elicitor response protein [Oryza sativa Japonica 
Group]
 gb|EEE56368.1| hypothetical protein OsJ_05500 [Oryza sativa Japonica Group]
Length=400

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +S++W +LLC+ SFC G+ FTNRMWT+PE+ 
Sbjct  13   VSRRWAVLLCLGSFCLGLLFTNRMWTLPEAN  43



>ref|NP_567762.1| putative beta-1,3-galactosyltransferase 4 [Arabidopsis thaliana]
 sp|Q8LEJ9.1|B3GT4_ARATH RecName: Full=Probable beta-1,3-galactosyltransferase 4 [Arabidopsis 
thaliana]
 gb|AAM62612.1| Avr9 elicitor response-like protein [Arabidopsis thaliana]
 gb|AEE85272.1| putative beta-1,3-galactosyltransferase 4 [Arabidopsis thaliana]
Length=407

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +SKKWTL LCI  FCAG+ F++RMW  PES 
Sbjct  19   VSKKWTLFLCIGFFCAGILFSDRMWPEPESN  49



>emb|CAB36540.1| Avr9 elicitor response like protein [Arabidopsis thaliana]
 emb|CAB79549.1| Avr9 elicitor response like protein [Arabidopsis thaliana]
Length=406

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +SKKWTL LCI  FCAG+ F++RMW  PES 
Sbjct  19   VSKKWTLFLCIGFFCAGILFSDRMWPEPESN  49



>ref|XP_007132543.1| hypothetical protein PHAVU_011G103400g [Phaseolus vulgaris]
 gb|ESW04537.1| hypothetical protein PHAVU_011G103400g [Phaseolus vulgaris]
Length=406

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +IS++W L LC+ SFCAG+ FT R+WT+PE+ 
Sbjct  14   VISQRWALFLCLGSFCAGMLFTTRIWTIPENN  45



>ref|XP_004951866.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Setaria 
italica]
Length=403

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +2

Query  362  SKKWTLLLCIXSFCAGVFFTNRMWTVPES  448
            S++W +LLC+ SFC G+ FTNRMWT+PE+
Sbjct  16   SRRWAVLLCVGSFCLGLLFTNRMWTLPEA  44



>ref|XP_011095407.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Sesamum 
indicum]
Length=405

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++S+K T LLCI  FCAG+ FT+RMW VPE+K
Sbjct  15   VVSRKLTFLLCIGCFCAGMLFTDRMWAVPEAK  46



>ref|XP_010484738.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Camelina sativa]
Length=408

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  362  SKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            S+K+T+LLC+ SFC G+FFT+RMW++ ESK
Sbjct  17   SRKYTILLCLGSFCLGLFFTDRMWSIQESK  46



>ref|XP_003539862.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Glycine 
max]
Length=406

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +IS++W L LC+ SFCAG+ FT R+WT+PE+ 
Sbjct  14   VISQRWALFLCLGSFCAGMLFTTRIWTIPENN  45



>ref|XP_010536663.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X2 [Tarenaya hassleriana]
Length=405

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++SK+WT LLCI  FCAG+ F++RMW  PE++
Sbjct  16   VVSKRWTFLLCIGCFCAGILFSDRMWPEPEAR  47



>gb|KHN21228.1| Putative beta-1,3-galactosyltransferase 2 [Glycine soja]
Length=406

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +IS++W L LC+ SFCAG+ FT R+WT+PE+ 
Sbjct  14   VISQRWALFLCLGSFCAGMLFTTRIWTIPENN  45



>ref|XP_010484744.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Camelina sativa]
Length=405

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  362  SKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            S+K+T+LLC+ SFC G+FFT+RMW++ ESK
Sbjct  17   SRKYTILLCLGSFCLGLFFTDRMWSIQESK  46



>ref|XP_003527496.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Glycine 
max]
 gb|KHN41227.1| Putative beta-1,3-galactosyltransferase 2 [Glycine soja]
Length=407

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +IS++W L LC+ SFCAG+ FT R+WT+PE+ 
Sbjct  14   VISQRWVLFLCLGSFCAGMLFTTRIWTIPENN  45



>ref|XP_010536662.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X1 [Tarenaya hassleriana]
Length=428

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++SK+WT LLCI  FCAG+ F++RMW  PE++
Sbjct  16   VVSKRWTFLLCIGCFCAGILFSDRMWPEPEAR  47



>ref|XP_011461040.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=406

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +S++WT+L CI  FCAG+ F++RMW+VPE K
Sbjct  19   VSRRWTILFCIACFCAGMLFSDRMWSVPEIK  49



>ref|XP_002437448.1| hypothetical protein SORBIDRAFT_10g027290 [Sorghum bicolor]
 gb|EER88815.1| hypothetical protein SORBIDRAFT_10g027290 [Sorghum bicolor]
Length=400

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPES  448
            ++++W LLLC+ SFC G+ FT+RMWT+PE+
Sbjct  12   VARRWVLLLCVGSFCLGLLFTDRMWTLPEA  41



>ref|XP_004294404.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=407

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +S++WT+L CI  FCAG+ F++RMW+VPE K
Sbjct  19   VSRRWTILFCIACFCAGMLFSDRMWSVPEIK  49



>ref|XP_009399227.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Musa acuminata 
subsp. malaccensis]
Length=401

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +S++WTLLLC+ SF  G+ FTNRMW VP++K
Sbjct  12   VSRRWTLLLCVGSFFTGLVFTNRMWLVPDAK  42



>ref|XP_006284182.1| hypothetical protein CARUB_v10005329mg [Capsella rubella]
 gb|EOA17080.1| hypothetical protein CARUB_v10005329mg [Capsella rubella]
Length=305

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPES  448
            +SKKWTL LCI  FCAG+ F++RMW  PE+
Sbjct  19   VSKKWTLFLCIGFFCAGILFSDRMWPEPEA  48



>ref|XP_007026089.1| Galactosyltransferase family protein isoform 2 [Theobroma cacao]
 gb|EOY28711.1| Galactosyltransferase family protein isoform 2 [Theobroma cacao]
Length=318

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++S+   LLLC  SFCAG+FFTNRMW +P+ K
Sbjct  14   VLSRNLALLLCFASFCAGMFFTNRMWMLPDGK  45



>ref|XP_010522341.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010522342.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010522343.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Tarenaya hassleriana]
Length=408

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +SKK T LLC+  FCAG+FFT+RMW VPE K
Sbjct  16   VSKKLTYLLCLGCFCAGMFFTDRMWKVPELK  46



>ref|XP_010092200.1| putative beta-1,3-galactosyltransferase 2 [Morus notabilis]
 gb|EXB50426.1| putative beta-1,3-galactosyltransferase 2 [Morus notabilis]
Length=407

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++S+ WTL LC   F AGVFFTNRMW VPE++
Sbjct  18   VLSRNWTLFLCFVCFYAGVFFTNRMWMVPEAR  49



>ref|XP_010522344.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Tarenaya hassleriana]
Length=405

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +SKK T LLC+  FCAG+FFT+RMW VPE K
Sbjct  16   VSKKLTYLLCLGCFCAGMFFTDRMWKVPELK  46



>ref|XP_010534019.1| PREDICTED: probable beta-1,3-galactosyltransferase 1 [Tarenaya 
hassleriana]
Length=441

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +IS+ W   LC+ SFC G+FFTNR+W VPE +
Sbjct  18   VISRNWAFFLCLASFCLGMFFTNRLWIVPEGR  49



>ref|XP_004172861.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like, partial 
[Cucumis sativus]
Length=250

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPE  445
            +S+KWT L CI  FCAG+ F++RMW VPE
Sbjct  17   VSRKWTFLFCIGCFCAGMLFSDRMWAVPE  45



>ref|XP_006346208.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Solanum 
tuberosum]
Length=408

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            + S+K T+LLCI  FC G+ FT+RMWTVPE+K
Sbjct  18   VFSRKLTVLLCIGCFCVGMLFTDRMWTVPEAK  49



>ref|XP_004244109.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Solanum 
lycopersicum]
Length=408

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            + S+K T+LLCI  FC G+ FT+RMWTVPE+K
Sbjct  18   VFSRKLTVLLCIGCFCVGMLFTDRMWTVPEAK  49



>ref|XP_010438679.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X1 [Camelina sativa]
Length=409

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +SKKWTL LCI  FCAG+ F++RMW  PE+ 
Sbjct  21   VSKKWTLFLCIGFFCAGILFSDRMWPEPEAN  51



>ref|XP_010438680.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X2 [Camelina sativa]
Length=408

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +SKKWTL LCI  FCAG+ F++RMW  PE+ 
Sbjct  21   VSKKWTLFLCIGFFCAGILFSDRMWPEPEAN  51



>ref|XP_010433424.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 [Camelina 
sativa]
Length=408

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +SKKWTL LCI  FCAG+ F++RMW  PE+ 
Sbjct  20   VSKKWTLFLCIGFFCAGILFSDRMWPEPEAN  50



>ref|XP_010448195.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X2 [Camelina sativa]
Length=408

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +SKKWTL LCI  FCAG+ F++RMW  PE+ 
Sbjct  21   VSKKWTLFLCIGFFCAGILFSDRMWPEPEAN  51



>ref|XP_010448194.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X1 [Camelina sativa]
Length=409

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +SKKWTL LCI  FCAG+ F++RMW  PE+ 
Sbjct  21   VSKKWTLFLCIGFFCAGILFSDRMWPEPEAN  51



>ref|XP_002867534.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43793.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=407

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +SKKWTL LCI  FCAG+ F++RMW  PE+ 
Sbjct  19   VSKKWTLFLCIGFFCAGILFSDRMWPEPEAN  49



>ref|XP_009338707.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Pyrus x bretschneideri]
Length=410

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +S+KWTLL CI  FCAG+ F++R W+VPE K
Sbjct  23   VSRKWTLLFCIGCFCAGMLFSDRRWSVPEIK  53



>ref|XP_002518474.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
 gb|EEF43861.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
Length=388

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPE  445
            + K W LLLCI SF AG FFTNRMW +PE
Sbjct  20   VPKNWALLLCISSFFAGTFFTNRMWNMPE  48



>ref|XP_009338706.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Pyrus x bretschneideri]
Length=411

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +S+KWTLL CI  FCAG+ F++R W+VPE K
Sbjct  23   VSRKWTLLFCIGCFCAGMLFSDRRWSVPEIK  53



>gb|ACG42389.1| beta-1,3-galactosyltransferase sqv-2 [Zea mays]
Length=385

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++++W LLLC+ SFC G+ FT+RMW++PE+ 
Sbjct  12   VARRWVLLLCVGSFCLGLLFTDRMWSLPEAD  42



>ref|XP_004149353.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
 gb|KGN56118.1| hypothetical protein Csa_3G076540 [Cucumis sativus]
Length=407

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPE  445
            +S+KWT L CI  FCAG+ F++RMW VPE
Sbjct  17   VSRKWTFLFCIGCFCAGMLFSDRMWAVPE  45



>ref|XP_008463407.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-1,3-galactosyltransferase 
3 [Cucumis melo]
Length=412

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPE  445
            +S+KWT L CI  FCAG+ F++RMW VPE
Sbjct  17   VSRKWTFLFCIGCFCAGMLFSDRMWAVPE  45



>ref|XP_007026088.1| Galactosyltransferase family protein isoform 1 [Theobroma cacao]
 gb|EOY28710.1| Galactosyltransferase family protein isoform 1 [Theobroma cacao]
Length=415

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++S+   LLLC  SFCAG+FFTNRMW +P+ K
Sbjct  14   VLSRNLALLLCFASFCAGMFFTNRMWMLPDGK  45



>ref|XP_002974972.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ23757.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=402

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPES  448
            +S KW L+LC+ SFC G+ FTNRMW  PE 
Sbjct  11   VSGKWMLVLCVGSFCVGMLFTNRMWNSPED  40



>gb|KCW88781.1| hypothetical protein EUGRSUZ_A01123 [Eucalyptus grandis]
Length=325

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 1/31 (3%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +S+KWTLLLC+  FCAG+  T+R WTVPESK
Sbjct  15   VSRKWTLLLCVGCFCAGMLITSR-WTVPESK  44



>ref|NP_001136834.1| beta-1,3-galactosyltransferase sqv-2 [Zea mays]
 gb|ACF82732.1| unknown [Zea mays]
 gb|AFW68972.1| beta-1,3-galactosyltransferase sqv-2 [Zea mays]
Length=401

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++++W LLLC+ SFC G+ FT+RMW++PE+ 
Sbjct  12   VARRWVLLLCVGSFCLGLLFTDRMWSLPEAD  42



>ref|XP_002977391.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ21395.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=402

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPES  448
            +S KW L+LC+ SFC G+ FTNRMW  PE 
Sbjct  11   VSGKWMLVLCVGSFCVGMLFTNRMWNSPED  40



>emb|CDP05735.1| unnamed protein product [Coffea canephora]
Length=403

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++S++ T+ LCI  FCAG+ FT+RMWTVPE+K
Sbjct  16   VVSRRLTVWLCIGCFCAGMLFTDRMWTVPEAK  47



>ref|XP_010046417.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Eucalyptus 
grandis]
 gb|KCW88779.1| hypothetical protein EUGRSUZ_A01123 [Eucalyptus grandis]
 gb|KCW88780.1| hypothetical protein EUGRSUZ_A01123 [Eucalyptus grandis]
Length=407

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 1/31 (3%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +S+KWTLLLC+  FCAG+  T+R WTVPESK
Sbjct  15   VSRKWTLLLCVGCFCAGMLITSR-WTVPESK  44



>emb|CDY68943.1| BnaAnng28870D, partial [Brassica napus]
Length=353

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +SKKWT LLCI  FCAG  F++RMW  PE+ 
Sbjct  32   VSKKWTFLLCISFFCAGTLFSDRMWPEPEAN  62



>gb|EYU27344.1| hypothetical protein MIMGU_mgv1a007546mg [Erythranthe guttata]
Length=404

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++S+K ++ LCI  FCAG+ FT+RMW VPE+K
Sbjct  15   VVSRKLSIFLCIGCFCAGMLFTDRMWAVPEAK  46



>emb|CDY46675.1| BnaA03g48330D [Brassica napus]
Length=410

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +SKKWT LLCI  FCAG  F++RMW  PE+ 
Sbjct  21   VSKKWTFLLCIGFFCAGTLFSDRMWPEPEAN  51



>ref|XP_006365959.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Solanum 
tuberosum]
Length=395

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            + S   T+LLCI  FCAG+FFT+R+WTVPE+K
Sbjct  17   VTSPNLTILLCIGCFCAGMFFTHRVWTVPEAK  48



>ref|XP_009137625.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-1,3-galactosyltransferase 
4 [Brassica rapa]
Length=411

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +SKKWT LLCI  FCAG  F++RMW  PE+ 
Sbjct  21   VSKKWTFLLCIGFFCAGTLFSDRMWPEPEAN  51



>ref|XP_009774309.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Nicotiana 
sylvestris]
Length=409

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            + S K T+LLCI  FC G+ FT+RMWTVPE+K
Sbjct  19   VFSPKLTILLCIGCFCVGMLFTDRMWTVPEAK  50



>ref|XP_009610750.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 [Nicotiana 
tomentosiformis]
Length=409

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            + S K T+LLCI  FC G+ FT+RMWTVPE+K
Sbjct  19   VFSPKLTILLCIGCFCVGMLFTDRMWTVPEAK  50



>gb|EPS64736.1| hypothetical protein M569_10045, partial [Genlisea aurea]
Length=183

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  359  ISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            +S+K T LLCI  FCAG+ FT+R+WT+PE K
Sbjct  17   VSRKHTALLCICCFCAGMVFTDRIWTLPEEK  47



>ref|XP_009357459.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Pyrus x 
bretschneideri]
Length=401

 Score = 47.8 bits (112),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 1/32 (3%)
 Frame = +2

Query  356  LISKKWTLLLCIXSFCAGVFFTNRMWTVPESK  451
            ++S+ W LLLC  SFCAGV FTNR+W +PES+
Sbjct  17   VMSRNWALLLCFCSFCAGVLFTNRLW-IPESR  47



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 553272586920