BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF040H22

Length=568
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009619497.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    259   4e-81   Nicotiana tomentosiformis
ref|XP_006340651.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    258   7e-81   Solanum tuberosum [potatoes]
ref|XP_004232427.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      258   1e-80   Solanum lycopersicum
ref|XP_010029765.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      256   7e-80   Eucalyptus grandis [rose gum]
ref|XP_009762330.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    254   2e-79   Nicotiana sylvestris
ref|XP_008241714.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      253   5e-79   Prunus mume [ume]
emb|CDP01989.1|  unnamed protein product                                253   6e-79   Coffea canephora [robusta coffee]
ref|XP_003612065.1|  Mannan endo-1,4-beta-mannosidase                   253   1e-78   Medicago truncatula
gb|ABV32548.1|  endo-1,4-beta-mannosidase protein 2                     253   1e-78   Prunus persica
ref|XP_007202078.1|  hypothetical protein PRUPE_ppa005992mg             253   1e-78   Prunus persica
ref|XP_010254774.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    252   2e-78   Nelumbo nucifera [Indian lotus]
gb|ABY58035.1|  mannase                                                 252   3e-78   Prunus salicina [Japanese plum]
ref|XP_010113415.1|  Mannan endo-1,4-beta-mannosidase 7                 251   5e-78   Morus notabilis
ref|XP_007046870.1|  Glycosyl hydrolase superfamily protein isofo...    248   7e-77   
ref|XP_009347596.1|  PREDICTED: LOW QUALITY PROTEIN: mannan endo-...    248   7e-77   
ref|XP_003517214.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    248   1e-76   Glycine max [soybeans]
ref|XP_006466833.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    248   1e-76   Citrus sinensis [apfelsine]
gb|KDO70993.1|  hypothetical protein CISIN_1g013811mg                   248   1e-76   Citrus sinensis [apfelsine]
ref|XP_006425633.1|  hypothetical protein CICLE_v10025631mg             248   1e-76   
ref|XP_007156980.1|  hypothetical protein PHAVU_002G033500g             246   3e-76   Phaseolus vulgaris [French bean]
ref|XP_011083199.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      246   5e-76   Sesamum indicum [beniseed]
ref|XP_006383170.1|  (1-4)-beta-mannan endohydrolase family protein     246   6e-76   Populus trichocarpa [western balsam poplar]
gb|KHG22102.1|  Mannan endo-1,4-beta-mannosidase 7 -like protein        246   6e-76   Gossypium arboreum [tree cotton]
gb|ACU18982.1|  unknown                                                 246   7e-76   Glycine max [soybeans]
ref|XP_011015126.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    246   7e-76   Populus euphratica
ref|XP_011013722.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    246   7e-76   Populus euphratica
ref|XP_002264115.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      245   9e-76   Vitis vinifera
gb|KHN36084.1|  Mannan endo-1,4-beta-mannosidase 7                      245   1e-75   Glycine soja [wild soybean]
ref|XP_004512071.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    244   1e-75   Cicer arietinum [garbanzo]
ref|XP_009340713.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      245   1e-75   Pyrus x bretschneideri [bai li]
ref|XP_003537602.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    243   4e-75   Glycine max [soybeans]
ref|XP_006590696.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    243   4e-75   Glycine max [soybeans]
gb|KDP44593.1|  hypothetical protein JCGZ_22175                         243   4e-75   Jatropha curcas
ref|XP_002281804.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      243   6e-75   Vitis vinifera
ref|XP_010263608.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    243   7e-75   Nelumbo nucifera [Indian lotus]
ref|XP_002521547.1|  serine-threonine protein kinase, plant-type,...    251   2e-74   
gb|ACN78662.1|  endo-beta-mannanase                                     241   4e-74   Actinidia arguta
ref|XP_011025835.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      241   4e-74   Populus euphratica
ref|XP_011011941.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    240   7e-74   Populus euphratica
ref|XP_002310816.2|  hypothetical protein POPTR_0007s13190g             240   8e-74   
ref|XP_008338221.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    240   1e-73   
ref|XP_008338066.1|  PREDICTED: LOW QUALITY PROTEIN: mannan endo-...    239   1e-73   
gb|KJB43465.1|  hypothetical protein B456_007G201600                    249   3e-73   Gossypium raimondii
ref|XP_004143522.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    236   1e-72   Cucumis sativus [cucumbers]
ref|XP_010550422.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      236   2e-72   Tarenaya hassleriana [spider flower]
ref|XP_002865067.1|  predicted protein                                  236   2e-72   Arabidopsis lyrata subsp. lyrata
ref|XP_010444793.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      235   8e-72   Camelina sativa [gold-of-pleasure]
ref|XP_008440745.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      234   1e-71   Cucumis melo [Oriental melon]
ref|NP_201447.1|  mannan endo-1,4-beta-mannosidase 7                    233   3e-71   Arabidopsis thaliana [mouse-ear cress]
gb|KFK28321.1|  hypothetical protein AALP_AA8G500900                    233   4e-71   Arabis alpina [alpine rockcress]
ref|XP_010484638.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    233   6e-71   Camelina sativa [gold-of-pleasure]
ref|XP_009103527.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      232   9e-71   Brassica rapa
ref|XP_009112304.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    232   1e-70   Brassica rapa
ref|XP_006393839.1|  hypothetical protein EUTSA_v10004263mg             232   1e-70   Eutrema salsugineum [saltwater cress]
emb|CDY45231.1|  BnaA07g12590D                                          233   1e-70   Brassica napus [oilseed rape]
gb|AGG82699.1|  endo-1,4-beta-mannosidase                               231   2e-70   Morus alba var. multicaulis
ref|XP_010110051.1|  Mannan endo-1,4-beta-mannosidase 7                 231   2e-70   Morus notabilis
ref|XP_006279868.1|  hypothetical protein CARUB_v10028560mg             229   2e-69   Capsella rubella
ref|XP_010465469.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    229   2e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010679767.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      228   5e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003528027.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    227   6e-69   Glycine max [soybeans]
emb|CDX81394.1|  BnaC09g08050D                                          236   1e-68   
ref|XP_007136624.1|  hypothetical protein PHAVU_009G059700g             227   1e-68   Phaseolus vulgaris [French bean]
gb|KEH36174.1|  mannan endo-1,4-beta-mannosidase-like protein           225   3e-68   Medicago truncatula
ref|XP_008800703.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    225   6e-68   Phoenix dactylifera
emb|CDY68324.1|  BnaCnng58510D                                          233   7e-68   Brassica napus [oilseed rape]
ref|XP_003545272.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    224   1e-67   Glycine max [soybeans]
gb|KHN20963.1|  Mannan endo-1,4-beta-mannosidase 7                      223   2e-67   Glycine soja [wild soybean]
emb|CDY18606.1|  BnaA09g07890D                                          232   3e-67   Brassica napus [oilseed rape]
ref|XP_010924295.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    223   3e-67   Elaeis guineensis
gb|EMS54429.1|  Mannan endo-1,4-beta-mannosidase 1                      219   4e-67   Triticum urartu
ref|XP_009365114.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    221   1e-66   Pyrus x bretschneideri [bai li]
ref|XP_009336054.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    221   1e-66   Pyrus x bretschneideri [bai li]
gb|EMT30727.1|  Mannan endo-1,4-beta-mannosidase 1                      219   2e-66   
gb|ACN78666.1|  endo-beta-mannanase                                     220   4e-66   Vaccinium corymbosum [American blueberry]
gb|KCW68225.1|  hypothetical protein EUGRSUZ_F01879                     221   4e-66   Eucalyptus grandis [rose gum]
ref|NP_001280873.1|  mannan endo-1,4-beta-mannosidase 7-like prec...    220   6e-66   Malus domestica [apple tree]
ref|XP_008220834.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    219   6e-66   Prunus mume [ume]
ref|XP_009394803.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    219   1e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007222385.1|  hypothetical protein PRUPE_ppa006029mg             219   1e-65   Prunus persica
gb|KHN45867.1|  Mannan endo-1,4-beta-mannosidase 7                      219   1e-65   Glycine soja [wild soybean]
ref|XP_002510418.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    219   1e-65   Ricinus communis
ref|NP_001241893.1|  uncharacterized protein LOC100814337 precursor     219   1e-65   Glycine max [soybeans]
gb|ABV32547.1|  endo-1,4-beta-mannosidase protein 1                     219   1e-65   Prunus persica
ref|XP_010061294.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    219   2e-65   Eucalyptus grandis [rose gum]
ref|XP_003549439.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    218   3e-65   Glycine max [soybeans]
ref|XP_006841534.1|  hypothetical protein AMTR_s00003p00158370          218   4e-65   Amborella trichopoda
ref|XP_009395690.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    218   5e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010926118.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 1      217   7e-65   Elaeis guineensis
ref|XP_010673216.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    216   1e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007160733.1|  hypothetical protein PHAVU_001G012600g             216   2e-64   Phaseolus vulgaris [French bean]
ref|XP_004291857.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    216   2e-64   Fragaria vesca subsp. vesca
gb|KDP38537.1|  hypothetical protein JCGZ_04462                         216   2e-64   Jatropha curcas
gb|ACN78663.1|  endo-beta-mannanase                                     215   3e-64   Malus domestica [apple tree]
ref|XP_007017589.1|  Glycosyl hydrolase superfamily protein             215   4e-64   Theobroma cacao [chocolate]
gb|KJB58235.1|  hypothetical protein B456_009G200500                    213   2e-63   Gossypium raimondii
ref|XP_006841527.1|  hypothetical protein AMTR_s00003p00152240          213   2e-63   Amborella trichopoda
gb|ADN34185.1|  endo-beta-mannanase                                     213   2e-63   Cucumis melo subsp. melo
ref|XP_009406291.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    212   3e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008466539.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    213   7e-63   
ref|XP_011083658.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    212   7e-63   Sesamum indicum [beniseed]
gb|EYU45796.1|  hypothetical protein MIMGU_mgv1a0212341mg               203   1e-62   Erythranthe guttata [common monkey flower]
ref|XP_009407087.1|  PREDICTED: putative mannan endo-1,4-beta-man...    210   2e-62   
ref|XP_008797528.1|  PREDICTED: LOW QUALITY PROTEIN: mannan endo-...    210   2e-62   
gb|KGN59983.1|  hypothetical protein Csa_3G859700                       210   3e-62   Cucumis sativus [cucumbers]
ref|XP_004147857.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    209   4e-62   
ref|XP_004154850.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    209   4e-62   
ref|XP_009365529.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    209   4e-62   Pyrus x bretschneideri [bai li]
ref|XP_009602297.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    209   5e-62   Nicotiana tomentosiformis
ref|XP_011085841.1|  PREDICTED: putative mannan endo-1,4-beta-man...    209   6e-62   Sesamum indicum [beniseed]
ref|XP_006342222.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    208   1e-61   Solanum tuberosum [potatoes]
emb|CDP07490.1|  unnamed protein product                                207   3e-61   Coffea canephora [robusta coffee]
ref|XP_006644473.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    207   4e-61   
ref|XP_004238284.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    206   5e-61   Solanum lycopersicum
ref|XP_002515142.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    206   9e-61   Ricinus communis
gb|KDO84614.1|  hypothetical protein CISIN_1g014426mg                   206   1e-60   Citrus sinensis [apfelsine]
emb|CAC08442.1|  (1-4)-beta-mannan endohydrolase                        206   1e-60   Coffea arabica [arabica coffee]
ref|XP_009785219.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    206   1e-60   Nicotiana sylvestris
ref|XP_006473535.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    206   1e-60   Citrus sinensis [apfelsine]
emb|CDP19235.1|  unnamed protein product                                205   1e-60   Coffea canephora [robusta coffee]
gb|KHN12693.1|  Mannan endo-1,4-beta-mannosidase 7                      204   3e-60   Glycine soja [wild soybean]
ref|XP_006435034.1|  hypothetical protein CICLE_v10001262mg             204   4e-60   Citrus clementina [clementine]
ref|XP_009122559.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    204   6e-60   Brassica rapa
ref|XP_011007449.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    202   1e-59   Populus euphratica
ref|XP_003569504.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 1      202   2e-59   Brachypodium distachyon [annual false brome]
ref|XP_002306881.1|  hypothetical protein POPTR_0005s25120g             202   2e-59   
ref|XP_009416732.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    202   3e-59   
gb|EYU45780.1|  hypothetical protein MIMGU_mgv1a025011mg                201   3e-59   Erythranthe guttata [common monkey flower]
ref|XP_006441716.1|  hypothetical protein CICLE_v10023981mg             201   4e-59   
gb|KDO45466.1|  hypothetical protein CISIN_1g016140mg                   201   4e-59   Citrus sinensis [apfelsine]
gb|ABF69949.1|  (1-4)-beta-mannan endohydrolase (mannan endo-1,4-...    202   4e-59   Musa acuminata [banana]
ref|XP_006407494.1|  hypothetical protein EUTSA_v10020842mg             201   8e-59   Eutrema salsugineum [saltwater cress]
ref|XP_004969435.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    201   9e-59   Setaria italica
gb|EYU45779.1|  hypothetical protein MIMGU_mgv1a020287mg                200   9e-59   Erythranthe guttata [common monkey flower]
ref|XP_010914840.1|  PREDICTED: putative mannan endo-1,4-beta-man...    201   1e-58   Elaeis guineensis
gb|EYU45794.1|  hypothetical protein MIMGU_mgv1a011066mg                197   1e-58   Erythranthe guttata [common monkey flower]
ref|XP_008799989.1|  PREDICTED: putative mannan endo-1,4-beta-man...    199   3e-58   
ref|XP_004303778.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    199   3e-58   Fragaria vesca subsp. vesca
pdb|1RH9|A  Chain A, Family Gh5 Endo-Beta-Mannanase From Lycopers...    198   3e-58   Solanum lycopersicum
ref|XP_002884818.1|  predicted protein                                  199   5e-58   Arabidopsis lyrata subsp. lyrata
ref|NP_001234874.1|  inactive endo-beta-mannanase precursor             198   5e-58   
ref|NP_001234131.1|  mannan endo-1,4-beta-mannosidase 4 precursor       198   5e-58   Solanum lycopersicum
ref|NP_001234114.1|  mannan endo-1,4-beta-mannosidase precursor         198   5e-58   
ref|XP_006478472.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    198   6e-58   
ref|NP_001043785.1|  Os01g0663300                                       198   8e-58   
gb|KCW46730.1|  hypothetical protein EUGRSUZ_K00551                     196   9e-58   Eucalyptus grandis [rose gum]
ref|XP_010486712.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    197   1e-57   Camelina sativa [gold-of-pleasure]
sp|Q0JKM9.2|MAN1_ORYSJ  RecName: Full=Mannan endo-1,4-beta-mannos...    198   2e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007051341.1|  Glycosyl hydrolase superfamily protein isofo...    197   2e-57   Theobroma cacao [chocolate]
emb|CAC51690.3|  endo-beta-1,4-mannanase                                197   2e-57   Lactuca sativa [cultivated lettuce]
ref|XP_011468408.1|  PREDICTED: LOW QUALITY PROTEIN: mannan endo-...    196   2e-57   Fragaria vesca subsp. vesca
ref|XP_009631900.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    196   3e-57   Nicotiana tomentosiformis
ref|XP_006296763.1|  hypothetical protein CARUB_v10015594mg             197   3e-57   Capsella rubella
gb|KFK38477.1|  hypothetical protein AALP_AA3G118100                    196   3e-57   Arabis alpina [alpine rockcress]
ref|XP_010464779.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    196   3e-57   Camelina sativa [gold-of-pleasure]
gb|EEC71222.1|  hypothetical protein OsI_03157                          197   3e-57   Oryza sativa Indica Group [Indian rice]
ref|XP_010490811.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    196   4e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010035363.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    196   4e-57   Eucalyptus grandis [rose gum]
ref|XP_010490985.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    196   4e-57   Camelina sativa [gold-of-pleasure]
ref|NP_187701.1|  putative mannan endo-1,4-beta-mannosidase 4           196   6e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004495835.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    195   8e-57   Cicer arietinum [garbanzo]
gb|KEH43148.1|  mannan endo-1,4-beta-mannosidase-like protein           195   1e-56   Medicago truncatula
ref|XP_008245064.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    195   2e-56   Prunus mume [ume]
ref|XP_006300225.1|  hypothetical protein CARUB_v10016461mg             194   3e-56   
ref|XP_010490578.1|  PREDICTED: putative mannan endo-1,4-beta-man...    194   3e-56   
ref|XP_010468110.1|  PREDICTED: putative mannan endo-1,4-beta-man...    187   3e-56   
gb|KJB41765.1|  hypothetical protein B456_007G119100                    192   4e-56   Gossypium raimondii
ref|XP_004228885.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    193   6e-56   Solanum lycopersicum
ref|NP_187700.1|  mannan endo-1,4-beta-mannosidase 3                    193   8e-56   Arabidopsis thaliana [mouse-ear cress]
emb|CDX73899.1|  BnaA03g31480D                                          189   8e-56   
gb|KJB41764.1|  hypothetical protein B456_007G119100                    193   8e-56   Gossypium raimondii
gb|KJB41766.1|  hypothetical protein B456_007G119100                    193   8e-56   Gossypium raimondii
ref|XP_003553696.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    192   1e-55   Glycine max [soybeans]
gb|KHN14185.1|  Putative mannan endo-1,4-beta-mannosidase 9             192   2e-55   Glycine soja [wild soybean]
gb|EPS69785.1|  endo-beta-mannanase                                     195   2e-55   Genlisea aurea
ref|XP_003554587.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    191   2e-55   Glycine max [soybeans]
ref|XP_009391931.1|  PREDICTED: putative mannan endo-1,4-beta-man...    192   3e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001235608.1|  endo-1,4-beta-mannanase precursor                  191   3e-55   Glycine max [soybeans]
gb|KEH43147.1|  mannan endo-1,4-beta-mannosidase-like protein           191   3e-55   Medicago truncatula
ref|XP_002272344.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 5      191   3e-55   
gb|AES61540.2|  mannan endo-1,4-beta-mannosidase-like protein           190   4e-55   Medicago truncatula
ref|XP_010112044.1|  Mannan endo-1,4-beta-mannosidase 5                 191   4e-55   Morus notabilis
ref|XP_006841038.1|  hypothetical protein AMTR_s00085p00132560          183   5e-55   
sp|Q9LW44.3|MANP_ARATH  RecName: Full=Putative mannan endo-1,4-be...    191   5e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008805817.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    190   6e-55   
ref|XP_003591288.1|  Mannan endo-1,4-beta-mannosidase                   190   6e-55   Medicago truncatula
ref|XP_010490914.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    191   6e-55   
ref|NP_001234473.1|  (1-4)-beta-mannan endohydrolase precursor          191   7e-55   Solanum lycopersicum
emb|CAC08208.1|  (1-4)-beta-mannan endohydrolase                        191   8e-55   Coffea arabica [arabica coffee]
gb|AED01931.1|  Mannan endo-1,4-beta-mannosidase                        186   9e-55   Lepidium sativum
ref|XP_010911540.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    189   1e-54   Elaeis guineensis
ref|XP_002456093.1|  hypothetical protein SORBIDRAFT_03g030340          190   1e-54   Sorghum bicolor [broomcorn]
ref|XP_010038519.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    189   1e-54   Eucalyptus grandis [rose gum]
gb|KCW46726.1|  hypothetical protein EUGRSUZ_K00548                     189   1e-54   Eucalyptus grandis [rose gum]
gb|KHG12601.1|  Mannan endo-1,4-beta-mannosidase 4                      189   2e-54   Gossypium arboreum [tree cotton]
ref|XP_006444660.1|  hypothetical protein CICLE_v10020376mg             189   2e-54   Citrus clementina [clementine]
ref|XP_006491440.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    189   2e-54   Citrus sinensis [apfelsine]
gb|KCW46728.1|  hypothetical protein EUGRSUZ_K00551                     189   2e-54   Eucalyptus grandis [rose gum]
ref|XP_006356528.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    189   2e-54   Solanum tuberosum [potatoes]
ref|XP_006300114.1|  hypothetical protein CARUB_v10016343mg             189   2e-54   
ref|XP_009135138.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    189   3e-54   
ref|XP_009135139.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    189   3e-54   Brassica rapa
ref|XP_010464782.1|  PREDICTED: putative mannan endo-1,4-beta-man...    188   3e-54   Camelina sativa [gold-of-pleasure]
gb|EYU22710.1|  hypothetical protein MIMGU_mgv1a023976mg                188   3e-54   Erythranthe guttata [common monkey flower]
ref|XP_003591289.1|  NADH dehydrogenase subunit F                       191   5e-54   
ref|XP_003591290.1|  Mannan endo-1,4-beta-mannosidase                   189   6e-54   
ref|XP_009621242.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    187   7e-54   Nicotiana tomentosiformis
ref|XP_010064850.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    187   8e-54   Eucalyptus grandis [rose gum]
gb|KDP28371.1|  hypothetical protein JCGZ_14142                         187   9e-54   Jatropha curcas
ref|XP_008800333.1|  PREDICTED: putative mannan endo-1,4-beta-man...    187   9e-54   Phoenix dactylifera
ref|XP_009593808.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    187   1e-53   Nicotiana tomentosiformis
ref|XP_002454605.1|  hypothetical protein SORBIDRAFT_04g034200          187   1e-53   
emb|CBI17041.3|  unnamed protein product                                185   1e-53   Vitis vinifera
emb|CDP20125.1|  unnamed protein product                                187   2e-53   Coffea canephora [robusta coffee]
gb|EYU22711.1|  hypothetical protein MIMGU_mgv1a025294mg                187   2e-53   Erythranthe guttata [common monkey flower]
ref|XP_010246810.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    187   2e-53   Nelumbo nucifera [Indian lotus]
ref|XP_010943133.1|  PREDICTED: putative mannan endo-1,4-beta-man...    186   2e-53   
ref|XP_007216338.1|  hypothetical protein PRUPE_ppa020168mg             186   2e-53   
ref|XP_008805818.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    186   3e-53   
ref|XP_009789471.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    186   4e-53   Nicotiana sylvestris
emb|CDP11079.1|  unnamed protein product                                185   4e-53   Coffea canephora [robusta coffee]
ref|XP_008778491.1|  PREDICTED: putative mannan endo-1,4-beta-man...    186   5e-53   
ref|XP_008778492.1|  PREDICTED: putative mannan endo-1,4-beta-man...    186   5e-53   
ref|XP_002270023.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 5      185   6e-53   Vitis vinifera
ref|NP_001146694.1|  putative endo-1,4-beta-mannosidase family pr...    184   8e-53   Zea mays [maize]
ref|XP_003634618.1|  PREDICTED: LOW QUALITY PROTEIN: mannan endo-...    184   1e-52   
emb|CBI17044.3|  unnamed protein product                                185   1e-52   Vitis vinifera
ref|XP_009616037.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    185   1e-52   Nicotiana tomentosiformis
ref|XP_009785847.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    185   1e-52   Nicotiana sylvestris
ref|XP_009760858.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 1      184   1e-52   Nicotiana sylvestris
ref|XP_009779875.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    184   2e-52   Nicotiana sylvestris
ref|XP_008664308.1|  PREDICTED: LOW QUALITY PROTEIN: putative man...    184   2e-52   
gb|ACG41070.1|  1,4-beta-D-mannan endohydrolase precursor               184   3e-52   Zea mays [maize]
ref|XP_010038521.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    183   3e-52   Eucalyptus grandis [rose gum]
ref|XP_009616057.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 5      183   3e-52   Nicotiana tomentosiformis
ref|XP_009763332.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    183   4e-52   Nicotiana sylvestris
gb|EYU30896.1|  hypothetical protein MIMGU_mgv1a0228142mg               179   5e-52   Erythranthe guttata [common monkey flower]
ref|XP_006588317.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    182   6e-52   Glycine max [soybeans]
ref|XP_007163264.1|  hypothetical protein PHAVU_001G219800g             183   6e-52   Phaseolus vulgaris [French bean]
gb|AHA84179.1|  endo-1,4-beta-mannanase                                 183   6e-52   Phaseolus vulgaris [French bean]
ref|XP_003605853.1|  Mannan endo-1,4-beta-mannosidase                   182   6e-52   Medicago truncatula
ref|XP_009601553.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    182   7e-52   Nicotiana tomentosiformis
ref|XP_009785881.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 5      182   8e-52   Nicotiana sylvestris
gb|KCW46727.1|  hypothetical protein EUGRSUZ_K00550                     181   1e-51   Eucalyptus grandis [rose gum]
ref|XP_004962462.1|  PREDICTED: LOW QUALITY PROTEIN: putative man...    183   1e-51   
ref|XP_009621619.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    180   1e-51   Nicotiana tomentosiformis
ref|XP_011069567.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    182   1e-51   Sesamum indicum [beniseed]
tpg|DAA58240.1|  TPA: putative endo-1,4-beta-mannosidase family p...    182   2e-51   
gb|KHN12618.1|  Mannan endo-1,4-beta-mannosidase 4                      179   2e-51   Glycine soja [wild soybean]
ref|XP_004494942.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    181   2e-51   Cicer arietinum [garbanzo]
ref|NP_001234575.1|  mannan endo-1,4-beta-mannosidase 1 precursor       181   3e-51   Solanum lycopersicum
ref|XP_003540598.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    181   3e-51   Glycine max [soybeans]
ref|XP_002272567.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 5      180   5e-51   Vitis vinifera
ref|XP_004955228.1|  PREDICTED: putative mannan endo-1,4-beta-man...    180   5e-51   Setaria italica
ref|XP_002302695.1|  hypothetical protein POPTR_0002s18530g             180   6e-51   Populus trichocarpa [western balsam poplar]
ref|XP_006836841.1|  hypothetical protein AMTR_s00099p00070100          180   8e-51   Amborella trichopoda
ref|NP_001048226.2|  Os02g0766900                                       179   9e-51   
ref|NP_001145882.1|  uncharacterized protein LOC100279398 precursor     180   9e-51   Zea mays [maize]
ref|XP_011025293.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    179   1e-50   Populus euphratica
ref|XP_010313893.1|  PREDICTED: LOW QUALITY PROTEIN: mannan endo-...    179   1e-50   
ref|XP_010914857.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    180   1e-50   
sp|Q9FUQ6.1|MAN3_SOLLC  RecName: Full=Mannan endo-1,4-beta-mannos...    179   2e-50   Solanum lycopersicum
gb|AFK43830.1|  unknown                                                 179   2e-50   Lotus japonicus
ref|XP_006356570.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    179   2e-50   Solanum tuberosum [potatoes]
ref|XP_011090525.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    179   2e-50   Sesamum indicum [beniseed]
gb|KFK24691.1|  hypothetical protein AALP_AA8G012100                    172   3e-50   Arabis alpina [alpine rockcress]
ref|XP_006356569.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    178   4e-50   Solanum tuberosum [potatoes]
dbj|BAD17132.1|  putative (1-4)-beta-mannan endohydrolase               177   8e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008799988.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    177   8e-50   
ref|XP_004500999.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    169   1e-49   Cicer arietinum [garbanzo]
ref|XP_002269954.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 5      177   1e-49   
ref|XP_010496823.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    170   1e-49   Camelina sativa [gold-of-pleasure]
ref|XP_008459570.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    176   3e-49   Cucumis melo [Oriental melon]
ref|XP_002528703.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    177   4e-49   Ricinus communis
ref|XP_004141631.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    175   4e-49   
emb|CBI17039.3|  unnamed protein product                                176   4e-49   Vitis vinifera
emb|CDP06381.1|  unnamed protein product                                176   5e-49   Coffea canephora [robusta coffee]
emb|CAN71995.1|  hypothetical protein VITISV_023484                     175   7e-49   Vitis vinifera
ref|XP_006279332.1|  hypothetical protein CARUB_v10012718mg             175   9e-49   
ref|XP_009410508.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 8      175   1e-48   
ref|XP_003626162.1|  Mannan endo-1,4-beta-mannosidase                   174   1e-48   
ref|XP_010921182.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    174   1e-48   
ref|XP_008456477.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 6      175   1e-48   
ref|NP_001051777.1|  Os03g0828500                                       175   1e-48   
ref|XP_010921181.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    174   2e-48   
ref|XP_008804040.1|  PREDICTED: putative mannan endo-1,4-beta-man...    172   3e-48   
ref|XP_004149910.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    174   3e-48   
gb|KHN42134.1|  Mannan endo-1,4-beta-mannosidase 6                      173   3e-48   
ref|XP_010921180.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    174   4e-48   
gb|EMT21292.1|  Putative mannan endo-1,4-beta-mannosidase 9             172   4e-48   
ref|XP_008782689.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    173   4e-48   
ref|XP_006576282.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    173   5e-48   
ref|XP_004164540.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    172   5e-48   
ref|XP_003522088.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    173   5e-48   
ref|XP_003552321.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    173   7e-48   
ref|XP_002870892.1|  hypothetical protein ARALYDRAFT_349416             173   7e-48   
gb|ACU19893.1|  unknown                                                 173   8e-48   
ref|XP_006576280.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    173   8e-48   
ref|XP_006398561.1|  hypothetical protein EUTSA_v10013730mg             172   8e-48   
ref|NP_195813.1|  mannan endo-1,4-beta-mannosidase 6                    172   8e-48   
ref|XP_006576281.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    173   8e-48   
ref|XP_009614143.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    172   9e-48   
gb|KGN52650.1|  hypothetical protein Csa_5G648710                       172   9e-48   
ref|XP_004141536.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    172   9e-48   
ref|XP_009614144.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    172   1e-47   
ref|XP_009391672.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    172   1e-47   
gb|AAN34823.1|  endo-beta-mannanase                                     171   1e-47   
ref|XP_009614142.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    173   1e-47   
ref|XP_010327704.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    171   2e-47   
gb|KJB29839.1|  hypothetical protein B456_005G120600                    171   2e-47   
gb|EMT21291.1|  Putative mannan endo-1,4-beta-mannosidase 9             171   2e-47   
ref|XP_010327703.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    172   2e-47   
ref|XP_010922771.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    172   2e-47   
ref|XP_010424017.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    171   2e-47   
gb|KEH23283.1|  mannan endo-1,4-beta-mannosidase                        172   2e-47   
gb|KEH23282.1|  mannan endo-1,4-beta-mannosidase                        172   2e-47   
ref|XP_003548330.2|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    172   2e-47   
ref|XP_010922772.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    172   2e-47   
dbj|BAJ34043.1|  unnamed protein product                                172   2e-47   
ref|XP_002466346.1|  hypothetical protein SORBIDRAFT_01g006080          172   2e-47   
ref|XP_011018989.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    171   2e-47   
ref|XP_009774302.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    171   2e-47   
ref|XP_004249033.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    171   2e-47   
ref|XP_009774301.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    171   3e-47   
ref|XP_006599739.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    172   3e-47   
ref|XP_007134569.1|  hypothetical protein PHAVU_010G058300g             171   3e-47   
ref|XP_007134568.1|  hypothetical protein PHAVU_010G058300g             171   3e-47   
gb|KHN14221.1|  Mannan endo-1,4-beta-mannosidase 1                      170   3e-47   
ref|XP_002323680.2|  hypothetical protein POPTR_0016s14550g             171   3e-47   
ref|XP_010424015.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    171   3e-47   
ref|XP_009774303.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    170   4e-47   
gb|AFX59322.1|  endo-1,4-beta-mannanase                                 171   4e-47   
ref|XP_008359828.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    171   4e-47   
ref|XP_010424014.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    171   4e-47   
ref|XP_011018982.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    171   4e-47   
gb|EYU42036.1|  hypothetical protein MIMGU_mgv1a005847mg                171   4e-47   
ref|XP_010683461.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 6      171   4e-47   
ref|XP_010490492.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    171   4e-47   
gb|EPS60450.1|  mannan endo-1,4-beta-mannosidase 2                      164   4e-47   
ref|XP_011001681.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    171   5e-47   
gb|EYU42035.1|  hypothetical protein MIMGU_mgv1a005847mg                171   5e-47   
ref|XP_003521650.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    170   5e-47   
gb|KDP21853.1|  hypothetical protein JCGZ_00640                         171   5e-47   
gb|KHN29491.1|  Mannan endo-1,4-beta-mannosidase 6                      171   6e-47   
ref|XP_007033493.1|  Mannan endo-1,4-beta-mannosidase 6 isoform 2       168   6e-47   
emb|CDY11173.1|  BnaA03g00090D                                          170   6e-47   
ref|XP_009130618.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    171   6e-47   
ref|XP_009130619.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    170   7e-47   
ref|XP_011095155.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    170   7e-47   
gb|KDO64139.1|  hypothetical protein CISIN_1g012093mg                   169   8e-47   
ref|XP_006362338.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    170   8e-47   
gb|KDO64137.1|  hypothetical protein CISIN_1g012093mg                   169   9e-47   
ref|XP_008244712.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 6      170   1e-46   
ref|XP_011095154.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    170   1e-46   
gb|EEC76450.1|  hypothetical protein OsI_14158                          169   2e-46   
ref|XP_004492573.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    169   2e-46   
ref|XP_010653331.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    168   2e-46   
ref|XP_003534636.2|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    169   2e-46   
gb|KDO64138.1|  hypothetical protein CISIN_1g012093mg                   169   2e-46   
ref|XP_010543149.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    169   2e-46   
gb|KEH23290.1|  mannan endo-1,4-beta-mannosidase-like protein           168   2e-46   
ref|XP_004302566.2|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    169   2e-46   
ref|XP_011466411.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    168   3e-46   
ref|XP_007140064.1|  hypothetical protein PHAVU_008G081200g             169   3e-46   
gb|KJB71480.1|  hypothetical protein B456_011G124800                    169   3e-46   
ref|XP_006481220.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    168   3e-46   
ref|XP_002273389.2|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    169   4e-46   
ref|XP_010543148.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    169   4e-46   
ref|XP_006649074.1|  PREDICTED: putative mannan endo-1,4-beta-man...    167   4e-46   
ref|XP_010543147.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    169   4e-46   
ref|XP_010043514.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    167   4e-46   
ref|XP_011466409.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    168   4e-46   
emb|CBI18019.3|  unnamed protein product                                168   5e-46   
ref|XP_006429615.1|  hypothetical protein CICLE_v10011654mg             168   5e-46   
ref|XP_010653330.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    168   5e-46   
ref|XP_008665710.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    168   5e-46   
ref|XP_008665709.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    168   6e-46   
ref|XP_007033492.1|  Mannan endo-1,4-beta-mannosidase 6 isoform 1       168   7e-46   
gb|AAL79758.1|AC096687_22  putative endohydrolase                       167   7e-46   
ref|XP_002988915.1|  hypothetical protein SELMODRAFT_129038             166   9e-46   
ref|XP_008370275.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    167   9e-46   
ref|XP_008370277.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    167   1e-45   
gb|KHG08771.1|  Mannan endo-1,4-beta-mannosidase 6 -like protein        167   1e-45   
emb|CBI18021.3|  unnamed protein product                                166   1e-45   
gb|EAZ29139.1|  hypothetical protein OsJ_13202                          167   1e-45   
ref|XP_011018983.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    167   1e-45   
ref|XP_011018985.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    167   1e-45   
ref|XP_011018984.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    167   1e-45   
ref|XP_010043507.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    167   1e-45   
ref|XP_008788512.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    167   1e-45   
ref|XP_002309191.2|  hypothetical protein POPTR_0006s11040g             168   2e-45   
ref|XP_007163300.1|  hypothetical protein PHAVU_001G223100g             166   2e-45   
ref|XP_011018981.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    167   2e-45   
ref|XP_002463596.1|  hypothetical protein SORBIDRAFT_01g002630          166   2e-45   
dbj|BAK05001.1|  predicted protein                                      166   3e-45   
gb|AET01118.2|  mannan endo-1,4-beta-mannosidase-like protein           166   3e-45   
ref|XP_003626672.1|  Mannan endo-1,4-beta-mannosidase                   166   3e-45   
gb|KEH17803.1|  mannan endo-1,4-beta-mannosidase-like protein           166   3e-45   
ref|XP_003626642.1|  Mannan endo-1,4-beta-mannosidase                   166   3e-45   
gb|AET01148.2|  mannan endo-1,4-beta-mannosidase-like protein           166   4e-45   
ref|XP_002273230.2|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    166   4e-45   
ref|XP_009370901.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    166   4e-45   
ref|XP_009370900.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    166   4e-45   
ref|XP_003573047.1|  PREDICTED: putative mannan endo-1,4-beta-man...    164   6e-45   
ref|XP_010244546.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 6      166   7e-45   
ref|XP_002974905.1|  hypothetical protein SELMODRAFT_232427             164   8e-45   
gb|ABC87082.1|  1,4-beta-D-mannan endohydrolase precursor               163   9e-45   
ref|XP_009416974.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    165   1e-44   
ref|XP_009337787.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 6      164   2e-44   
gb|KHN43394.1|  Mannan endo-1,4-beta-mannosidase 4                      160   4e-44   
ref|XP_004981145.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    161   1e-43   
ref|XP_004510098.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    164   2e-43   
ref|XP_006655193.1|  PREDICTED: putative mannan endo-1,4-beta-man...    161   2e-43   
gb|KHN43366.1|  Mannan endo-1,4-beta-mannosidase 1                      158   4e-43   
ref|XP_006878501.1|  hypothetical protein AMTR_s00011p00202020          159   4e-43   
ref|XP_009407060.1|  PREDICTED: LOW QUALITY PROTEIN: mannan endo-...    156   8e-43   
ref|XP_010227426.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    159   1e-42   
ref|XP_004977393.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    158   1e-42   
dbj|BAK02230.1|  predicted protein                                      159   2e-42   
ref|XP_002884819.1|  hypothetical protein ARALYDRAFT_478424             157   3e-42   
gb|AFW74407.1|  putative endo-1,4-beta-mannosidase family protein       158   4e-42   
gb|EEE63239.1|  hypothetical protein OsJ_18049                          157   5e-42   
ref|XP_008648425.1|  PREDICTED: LOW QUALITY PROTEIN: putative man...    157   9e-42   
ref|XP_010522866.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    156   1e-41   
gb|AAV44080.1|  hypothetical protein                                    157   1e-41   
ref|XP_001784893.1|  predicted protein                                  156   1e-41   
sp|Q5W6G0.2|MAN5_ORYSJ  RecName: Full=Putative mannan endo-1,4-be...    157   1e-41   
ref|XP_010522865.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    156   1e-41   
gb|EMS67718.1|  Mannan endo-1,4-beta-mannosidase 2                      156   2e-41   
ref|NP_001065595.1|  Os11g0118200                                       149   3e-41   
ref|XP_006663750.1|  PREDICTED: LOW QUALITY PROTEIN: mannan endo-...    153   4e-41   
ref|XP_006839096.1|  hypothetical protein AMTR_s00090p00128510          154   6e-41   
ref|NP_001173695.1|  Os03g0828300                                       147   9e-41   
emb|CDP11090.1|  unnamed protein product                                152   1e-40   
ref|XP_006644697.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    153   1e-40   
dbj|BAJ87988.1|  predicted protein                                      153   2e-40   
ref|XP_006662680.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    149   2e-40   
gb|KHN46504.1|  Mannan endo-1,4-beta-mannosidase 5                      150   2e-40   
ref|XP_009405187.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    151   4e-40   
gb|EAZ13519.1|  hypothetical protein OsJ_03436                          152   4e-40   
ref|XP_001760262.1|  predicted protein                                  152   4e-40   
ref|NP_001044230.2|  Os01g0746700                                       152   4e-40   
ref|XP_003569799.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    152   4e-40   
gb|EAY75800.1|  hypothetical protein OsI_03716                          152   4e-40   
emb|CDP20988.1|  unnamed protein product                                151   5e-40   
ref|XP_008669933.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    151   7e-40   
ref|XP_002983364.1|  hypothetical protein SELMODRAFT_234217             149   1e-39   
ref|XP_009119647.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 1      150   1e-39   
emb|CDP21695.1|  unnamed protein product                                150   1e-39   
ref|XP_004978522.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    148   1e-39   
sp|Q2RBB1.3|MAN7_ORYSJ  RecName: Full=Mannan endo-1,4-beta-mannos...    149   1e-39   
gb|EAZ19452.1|  hypothetical protein OsJ_35013                          149   1e-39   
ref|XP_006662679.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    149   3e-39   
gb|EAY92423.1|  hypothetical protein OsI_14157                          149   4e-39   
ref|NP_001176761.1|  Os12g0117250                                       147   5e-39   
emb|CDX89985.1|  BnaA10g00970D                                          148   5e-39   
sp|Q0IQJ7.2|MAN8_ORYSJ  RecName: Full=Mannan endo-1,4-beta-mannos...    147   6e-39   
gb|KHG04578.1|  Mannan endo-1,4-beta-mannosidase 2 -like protein        149   6e-39   
gb|KJB31674.1|  hypothetical protein B456_005G201100                    149   7e-39   
gb|EEE52650.1|  hypothetical protein OsJ_35012                          147   7e-39   
gb|EEC68738.1|  hypothetical protein OsI_37245                          148   7e-39   
gb|EEC67554.1|  hypothetical protein OsI_34887                          147   7e-39   
ref|XP_002892099.1|  hypothetical protein ARALYDRAFT_470192             148   8e-39   
gb|KHN31990.1|  Mannan endo-1,4-beta-mannosidase 2                      147   1e-38   
ref|XP_002450155.1|  hypothetical protein SORBIDRAFT_05g001260          147   1e-38   
sp|Q0DM48.2|MAN3_ORYSJ  RecName: Full=Mannan endo-1,4-beta-mannos...    148   1e-38   
gb|KHN35251.1|  Mannan endo-1,4-beta-mannosidase 2                      147   2e-38   
gb|EMT06168.1|  Mannan endo-1,4-beta-mannosidase 7                      146   2e-38   
ref|XP_003539924.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    147   3e-38   
ref|XP_007132717.1|  hypothetical protein PHAVU_011G118900g             147   3e-38   
ref|XP_003527431.2|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    147   3e-38   
ref|NP_171733.2|  mannan endo-1,4-beta-mannosidase 1                    146   3e-38   
ref|XP_006412972.1|  hypothetical protein EUTSA_v10025261mg             147   3e-38   
emb|CDY15229.1|  BnaC05g01080D                                          146   3e-38   
ref|XP_002960673.1|  hypothetical protein SELMODRAFT_403117             146   3e-38   
ref|XP_010260197.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    146   4e-38   
ref|XP_010260194.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    147   4e-38   
ref|XP_010260196.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    146   4e-38   
ref|XP_002458478.1|  hypothetical protein SORBIDRAFT_03g034420          146   5e-38   
ref|XP_006304532.1|  hypothetical protein CARUB_v10011405mg             145   5e-38   
ref|XP_004487276.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    145   7e-38   
ref|XP_004969933.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    146   7e-38   
ref|XP_006418357.1|  hypothetical protein EUTSA_v10007769mg             145   8e-38   
ref|XP_009803520.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    144   1e-37   
ref|XP_010457203.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    145   1e-37   
gb|EMS49637.1|  Mannan endo-1,4-beta-mannosidase 7                      144   1e-37   
ref|XP_001756296.1|  predicted protein                                  145   1e-37   
gb|KJB79973.1|  hypothetical protein B456_013G075700                    145   1e-37   
gb|KFK35900.1|  hypothetical protein AALP_AA4G051000                    145   2e-37   
ref|XP_007043603.1|  Glycosyl hydrolase superfamily protein             145   2e-37   
ref|XP_004505577.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    144   2e-37   
gb|KDP24127.1|  hypothetical protein JCGZ_25784                         144   2e-37   
ref|XP_010540874.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 2      144   3e-37   
ref|XP_009793291.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    144   3e-37   
ref|XP_010480869.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 1      144   3e-37   
ref|XP_009590206.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    144   4e-37   
ref|XP_009144379.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    144   4e-37   
emb|CDY18983.1|  BnaC01g20850D                                          143   5e-37   
ref|XP_010089553.1|  Mannan endo-1,4-beta-mannosidase 2                 143   5e-37   
ref|NP_001130322.1|  uncharacterized protein LOC100191416               144   6e-37   



>ref|XP_009619497.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Nicotiana 
tomentosiformis]
Length=434

 Score =   259 bits (662),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+GFI+TRGIHFM+NG  FYANGFNAYWLMYVASDPSQR KVS AFR ASSHGLTVART
Sbjct  26   AGDGFIRTRGIHFMLNGDLFYANGFNAYWLMYVASDPSQRSKVSAAFREASSHGLTVART  85

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAFSDGGY+ LQYAPGSYNED+FKGLDFVI+EAR+YG+KV+LSLANNYESFGGKKQYV+W
Sbjct  86   WAFSDGGYKPLQYAPGSYNEDMFKGLDFVISEARRYGIKVVLSLANNYESFGGKKQYVNW  145

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR  GQYL SDDDFFRN +VKG+
Sbjct  146  ARSHGQYLNSDDDFFRNPVVKGY  168



>ref|XP_006340651.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Solanum tuberosum]
Length=433

 Score =   258 bits (660),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 140/156 (90%), Gaps = 1/156 (1%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
             +QQ  L   V+A G+GFI+TRGIHFM+NG  FYANGFNAYWLMY+A+DPSQR KV++AF
Sbjct  14   LLQQVCLFVQVEA-GDGFIRTRGIHFMLNGDPFYANGFNAYWLMYIAADPSQRSKVTDAF  72

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            R ASSHGLTVARTWAFSDGGYR LQYAPGSYNED+FKGLDFVI+EAR++G+KVILS ANN
Sbjct  73   REASSHGLTVARTWAFSDGGYRPLQYAPGSYNEDMFKGLDFVISEARRHGIKVILSFANN  132

Query  460  YESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            YESFGGKKQYV+WAR  GQYL SDD+FFRNS+VKG+
Sbjct  133  YESFGGKKQYVNWARSHGQYLNSDDEFFRNSVVKGY  168



>ref|XP_004232427.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Solanum lycopersicum]
Length=434

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 139/156 (89%), Gaps = 1/156 (1%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
             +Q   L   V+A G+GFI+TRGIHFM+NG  FYANGFNAYWLMY+A+DPSQR KV++AF
Sbjct  14   LLQHVCLFVQVEA-GDGFIRTRGIHFMLNGDPFYANGFNAYWLMYIAADPSQRSKVTDAF  72

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            R ASSHGLTVARTWAFSDGGYR LQYAPGSYNED+FKGLDFVI+EAR+YG+KVILS ANN
Sbjct  73   REASSHGLTVARTWAFSDGGYRPLQYAPGSYNEDMFKGLDFVISEARRYGIKVILSFANN  132

Query  460  YESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            YESFGGKKQYV+WAR  GQYL SDDDFF+NS+VKG+
Sbjct  133  YESFGGKKQYVNWARSHGQYLNSDDDFFKNSVVKGY  168



>ref|XP_010029765.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Eucalyptus grandis]
 gb|KCW56722.1| hypothetical protein EUGRSUZ_I02413 [Eucalyptus grandis]
Length=427

 Score =   256 bits (653),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +1

Query  103  VQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFR  282
            + Q+     +  AG+GF++ RGIHFM+NG  +YANGFNAYWLMY+ASDPSQR++VS AFR
Sbjct  14   IHQACFHARLVEAGDGFVRARGIHFMLNGSPYYANGFNAYWLMYMASDPSQRHQVSAAFR  73

Query  283  GASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNY  462
             ASSHGLTVARTWAFSDGGYR LQY+PGSYNE +F+GLDFVIAEAR+YG+K+ILSL N+Y
Sbjct  74   EASSHGLTVARTWAFSDGGYRPLQYSPGSYNEQMFQGLDFVIAEARRYGIKLILSLVNDY  133

Query  463  ESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            E+FGGKKQYV+WAR +GQYLTSDDDFFRN +VKGF
Sbjct  134  ENFGGKKQYVNWARSRGQYLTSDDDFFRNPVVKGF  168



>ref|XP_009762330.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Nicotiana 
sylvestris]
Length=434

 Score =   254 bits (650),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+GFI+TRGIHFM+NG  FYANGFNAYWLMYVASDPSQR KVS AF+ ASSHGLTVART
Sbjct  26   AGDGFIRTRGIHFMLNGDPFYANGFNAYWLMYVASDPSQRSKVSAAFKEASSHGLTVART  85

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAFSDGGY+ LQYAPGSYN D+FKGLDFVI+EAR+YG+KV+LSLANNYESFGGKKQYV W
Sbjct  86   WAFSDGGYKPLQYAPGSYNADMFKGLDFVISEARRYGMKVVLSLANNYESFGGKKQYVKW  145

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR  GQYL SDDDFFRN +VKG+
Sbjct  146  ARSHGQYLNSDDDFFRNPVVKGY  168



>ref|XP_008241714.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Prunus mume]
Length=433

 Score =   253 bits (647),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+GFI+TRG+HF++NG  +YANGFN YWLMYVASDPSQRYKVS  FR A+SHGLTVART
Sbjct  25   AGDGFIRTRGVHFLLNGSPYYANGFNGYWLMYVASDPSQRYKVSSVFREATSHGLTVART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAFSDGGYR LQY+PGSYNE +FKGLDFVIAEAR+YG+K+ILSL NNYESFGG+KQYV+W
Sbjct  85   WAFSDGGYRPLQYSPGSYNEQMFKGLDFVIAEARRYGIKLILSLVNNYESFGGRKQYVNW  144

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +GQYLTSDDDF+RN +VKG+
Sbjct  145  ARSRGQYLTSDDDFYRNPVVKGY  167



>emb|CDP01989.1| unnamed protein product [Coffea canephora]
Length=432

 Score =   253 bits (647),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+GF++T GIHFM+N   +YANGFNAYWLMYVASDPSQR KVS AFR ASSHGLTVART
Sbjct  25   AGDGFVRTGGIHFMLNNGPYYANGFNAYWLMYVASDPSQRSKVSAAFREASSHGLTVART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAF+DGGYRALQYAPG+YNE  FKGLDFV+AEAR+YG+K+ILSLANNYESFGGKKQYVDW
Sbjct  85   WAFNDGGYRALQYAPGAYNEQTFKGLDFVVAEARRYGIKLILSLANNYESFGGKKQYVDW  144

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +GQYL+SDDDFFRNS+VKG+
Sbjct  145  ARSRGQYLSSDDDFFRNSVVKGY  167



>ref|XP_003612065.1| Mannan endo-1,4-beta-mannosidase [Medicago truncatula]
 gb|AES95023.1| mannan endo-1,4-beta-mannosidase-like protein [Medicago truncatula]
Length=438

 Score =   253 bits (646),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 137/157 (87%), Gaps = 1/157 (1%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
             V Q   + +V+AAG+GF++TRGIHFM+NG  +YANGFNAYWLMY ASDPSQR+KVS AF
Sbjct  14   LVHQECFNINVEAAGDGFVRTRGIHFMLNGNPYYANGFNAYWLMYTASDPSQRFKVSNAF  73

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            R A+SHGLTVARTWAFSDGGY  LQY+PG YNE +FKGLDFVI+EARK+G+K+ILSL NN
Sbjct  74   REATSHGLTVARTWAFSDGGYSPLQYSPGFYNEQMFKGLDFVISEARKHGIKLILSLVNN  133

Query  460  YESFGGKKQYVDWAR-GKGQYLTSDDDFFRNSLVKGF  567
            YESFGGKKQYV+WAR   GQYLTSDDDFFRN +VKGF
Sbjct  134  YESFGGKKQYVNWARSNNGQYLTSDDDFFRNPVVKGF  170



>gb|ABV32548.1| endo-1,4-beta-mannosidase protein 2 [Prunus persica]
Length=433

 Score =   253 bits (645),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+GFI+TRG+HF++NG  +YANGFN YWLMYVASDPSQRYKVS  FR A+SHGLTVART
Sbjct  25   AGDGFIRTRGVHFLLNGSPYYANGFNGYWLMYVASDPSQRYKVSSVFREATSHGLTVART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAFSDGGYR LQY+PGSYNE +FKGLDFVIAEAR+YG+K+ILSL NNYESFGG+KQYV+W
Sbjct  85   WAFSDGGYRPLQYSPGSYNEQMFKGLDFVIAEARRYGIKLILSLVNNYESFGGRKQYVNW  144

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +GQYLTSDDDF+RN +VKG+
Sbjct  145  ARSQGQYLTSDDDFYRNPVVKGY  167



>ref|XP_007202078.1| hypothetical protein PRUPE_ppa005992mg [Prunus persica]
 gb|EMJ03277.1| hypothetical protein PRUPE_ppa005992mg [Prunus persica]
Length=433

 Score =   253 bits (645),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+GFI+TRG+HF++NG  +YANGFN YWLMYVASDPSQRYKVS  FR A+SHGLTVART
Sbjct  25   AGDGFIRTRGVHFLLNGSPYYANGFNGYWLMYVASDPSQRYKVSSVFREATSHGLTVART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAFSDGGYR LQY+PGSYNE +FKGLDFVIAEAR+YG+K+ILSL NNYESFGG+KQYV+W
Sbjct  85   WAFSDGGYRPLQYSPGSYNEQMFKGLDFVIAEARRYGIKLILSLVNNYESFGGRKQYVNW  144

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +GQYLTSDDDF+RN +VKG+
Sbjct  145  ARSQGQYLTSDDDFYRNPVVKGY  167



>ref|XP_010254774.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Nelumbo nucifera]
Length=433

 Score =   252 bits (644),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 139/155 (90%), Gaps = 1/155 (1%)
 Frame = +1

Query  103  VQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFR  282
            +QQ +    V+A  +GF++TRG+ FM+NG  +YANGFNAYWLMYVASDPSQR KVS AF+
Sbjct  14   IQQRNFLIQVEAQ-DGFVRTRGMRFMLNGSPYYANGFNAYWLMYVASDPSQRSKVSSAFQ  72

Query  283  GASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNY  462
             ASSHGLTVARTWAFSDGGY+ LQYAPGSYNE++FKGLDFVI+EAR+YG+K+ILSLANNY
Sbjct  73   QASSHGLTVARTWAFSDGGYKPLQYAPGSYNEEMFKGLDFVISEARRYGIKLILSLANNY  132

Query  463  ESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            ESFGGKKQYV+WAR +GQYLTSDDDFFRN +VKG+
Sbjct  133  ESFGGKKQYVNWARNQGQYLTSDDDFFRNPVVKGY  167



>gb|ABY58035.1| mannase [Prunus salicina]
Length=433

 Score =   252 bits (643),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+GFI+TRG+HF++NG  +YANGFN YWLMYVASDPSQRYKVS  FR A+SHGLTVART
Sbjct  25   AGDGFIRTRGVHFLLNGSPYYANGFNGYWLMYVASDPSQRYKVSSVFREATSHGLTVART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAFSDGGYR LQY+PGSYNE +FKGLDFVIAEAR+YG+K+ILSL NNYESFGG+KQYV+W
Sbjct  85   WAFSDGGYRPLQYSPGSYNEQLFKGLDFVIAEARRYGIKLILSLVNNYESFGGRKQYVNW  144

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
             R +GQYLTSDDDF+RN +VKG+
Sbjct  145  TRSRGQYLTSDDDFYRNPVVKGY  167



>ref|XP_010113415.1| Mannan endo-1,4-beta-mannosidase 7 [Morus notabilis]
 gb|EXC35442.1| Mannan endo-1,4-beta-mannosidase 7 [Morus notabilis]
Length=436

 Score =   251 bits (641),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 142/170 (84%), Gaps = 0/170 (0%)
 Frame = +1

Query  58   MKHlgllaallailFVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYV  237
            MKH  L   L+ IL  QQ SL   V+A  +GFI+T G HF++NG  +YANGFNAYWLMY+
Sbjct  1    MKHFRLAILLVVILVHQQISLHSFVEARNDGFIRTWGHHFVLNGNPYYANGFNAYWLMYM  60

Query  238  ASDPSQRYKVSEAFRGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEA  417
            ASDPSQRY VS A + ASSHGLTVARTWAFSDGGYR LQYAPGSYNE  FKGLDFV+AEA
Sbjct  61   ASDPSQRYLVSNALKEASSHGLTVARTWAFSDGGYRPLQYAPGSYNEQTFKGLDFVVAEA  120

Query  418  RKYGLKVILSLANNYESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            RK+G+K+ILSL NNYE+FGGKKQYV+WAR  GQYLTSDDDFFRNS+VKG+
Sbjct  121  RKHGIKLILSLVNNYENFGGKKQYVNWARSHGQYLTSDDDFFRNSVVKGY  170



>ref|XP_007046870.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007046871.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007046872.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007046873.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX91027.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX91028.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX91029.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX91030.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
Length=433

 Score =   248 bits (633),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 136/153 (89%), Gaps = 1/153 (1%)
 Frame = +1

Query  109  QSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGA  288
            Q  LS  V+A  + FI+TRG+HF++NG  +YANGFNAYWLMYVASDPSQR KVS +FR A
Sbjct  16   QHLLSVQVEARDD-FIRTRGVHFLLNGNPYYANGFNAYWLMYVASDPSQRPKVSASFREA  74

Query  289  SSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYES  468
            ++HGLTVARTWAFSDGGYR LQYAPGSYNE +FKGLDFVIAEAR+Y +K+ILSLANNYES
Sbjct  75   AAHGLTVARTWAFSDGGYRPLQYAPGSYNEQMFKGLDFVIAEARRYRIKLILSLANNYES  134

Query  469  FGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            FGGKKQYV+WAR +GQYLTSDDDFFRN +VKG+
Sbjct  135  FGGKKQYVNWARSQGQYLTSDDDFFRNPVVKGY  167



>ref|XP_009347596.1| PREDICTED: LOW QUALITY PROTEIN: mannan endo-1,4-beta-mannosidase 
7-like [Pyrus x bretschneideri]
 ref|XP_009347607.1| PREDICTED: LOW QUALITY PROTEIN: mannan endo-1,4-beta-mannosidase 
7-like [Pyrus x bretschneideri]
Length=436

 Score =   248 bits (633),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 135/155 (87%), Gaps = 1/155 (1%)
 Frame = +1

Query  106  QQSSLSG-SVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFR  282
            QQ  +S   V AAG+ FI+ RG+HF++NG  +YANGFN YWLMYVASDPSQR+KVS AFR
Sbjct  16   QQCFISPIHVSAAGDDFIRVRGVHFLLNGSPYYANGFNGYWLMYVASDPSQRHKVSSAFR  75

Query  283  GASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNY  462
             A+SHGLTVARTWAFSDGGYR LQ++PGSYNE +FKGLDFVIAEAR+YG+K+ILSL NNY
Sbjct  76   EATSHGLTVARTWAFSDGGYRPLQFSPGSYNEQMFKGLDFVIAEARRYGIKLILSLVNNY  135

Query  463  ESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            ESFGG+KQYV+WAR KGQ  TSDDDFFRN +VKG+
Sbjct  136  ESFGGRKQYVNWARRKGQNFTSDDDFFRNPVVKGY  170



>ref|XP_003517214.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Glycine max]
Length=431

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 134/156 (86%), Gaps = 1/156 (1%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
             V Q     SV+A  + F++TRGIHFM+NGY +YANGFNAYWLMY ASDPSQR+KVS AF
Sbjct  13   LVPQECFHVSVEARDD-FVRTRGIHFMLNGYPYYANGFNAYWLMYTASDPSQRFKVSNAF  71

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            R A+SHGLTVARTWAFSDGGYR LQY+PG YNE +F GLDFV++EARKYG+K+ILSL NN
Sbjct  72   REAASHGLTVARTWAFSDGGYRPLQYSPGFYNEQMFTGLDFVVSEARKYGIKLILSLVNN  131

Query  460  YESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            YE+FGGKKQYV+WAR  GQYLTSDDDFFR+ +VKG+
Sbjct  132  YENFGGKKQYVNWARSHGQYLTSDDDFFRSPVVKGY  167



>ref|XP_006466833.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Citrus sinensis]
Length=436

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
            F+ + S +     AG+GFI+TRG HF++NG  ++ANGFNAYWLMYVASDPSQR KVS AF
Sbjct  15   FIHRQSFNVLHVEAGDGFIRTRGSHFLLNGNLYFANGFNAYWLMYVASDPSQRSKVSTAF  74

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
              A+SHGLTVARTWAFSDGGYR LQ +PGSYNE +FKGLDFVIAEARKYG+K+ILSLANN
Sbjct  75   HEAASHGLTVARTWAFSDGGYRPLQRSPGSYNEQMFKGLDFVIAEARKYGIKLILSLANN  134

Query  460  YESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            Y+SFGGKKQYV+WAR +GQ+LTSDDDFFRN +VKG+
Sbjct  135  YDSFGGKKQYVNWARSQGQFLTSDDDFFRNPVVKGY  170



>gb|KDO70993.1| hypothetical protein CISIN_1g013811mg [Citrus sinensis]
Length=436

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
            F+ + S +     AG+GFI+TRG HF++NG  ++ANGFNAYWLMYVASDPSQR KVS AF
Sbjct  15   FIHRQSFNVLHVEAGDGFIRTRGSHFLLNGNLYFANGFNAYWLMYVASDPSQRSKVSTAF  74

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
              A+SHGLTVARTWAFSDGGYR LQ +PGSYNE +FKGLDFVIAEARKYG+K+ILSLANN
Sbjct  75   HEAASHGLTVARTWAFSDGGYRPLQRSPGSYNEQMFKGLDFVIAEARKYGIKLILSLANN  134

Query  460  YESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            Y+SFGGKKQYV+WAR +GQ+LTSDDDFFRN +VKG+
Sbjct  135  YDSFGGKKQYVNWARSQGQFLTSDDDFFRNPVVKGY  170



>ref|XP_006425633.1| hypothetical protein CICLE_v10025631mg [Citrus clementina]
 gb|ESR38873.1| hypothetical protein CICLE_v10025631mg [Citrus clementina]
Length=436

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
            F+ + S +     AG+GFI+TRG HF++NG  ++ANGFNAYWLMYVASDPSQR KVS AF
Sbjct  15   FIHRQSFNVLHVEAGDGFIRTRGSHFLLNGNLYFANGFNAYWLMYVASDPSQRSKVSTAF  74

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
              A+SHGLTVARTWAFSDGGYR LQ +PGSYNE +FKGLDFVIAEARKYG+K+ILSLANN
Sbjct  75   HEAASHGLTVARTWAFSDGGYRPLQRSPGSYNEQMFKGLDFVIAEARKYGIKLILSLANN  134

Query  460  YESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            Y+SFGGKKQYV+WAR +GQ+LTSDDDFFRN +VKG+
Sbjct  135  YDSFGGKKQYVNWARSQGQFLTSDDDFFRNPVVKGY  170



>ref|XP_007156980.1| hypothetical protein PHAVU_002G033500g [Phaseolus vulgaris]
 gb|ESW28974.1| hypothetical protein PHAVU_002G033500g [Phaseolus vulgaris]
Length=431

 Score =   246 bits (628),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 134/153 (88%), Gaps = 1/153 (1%)
 Frame = +1

Query  109  QSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGA  288
            Q     +V+A  +GF++TRGIHFM+NGY +Y NGFNAYWLMY ASDPSQR+KVS AFR A
Sbjct  16   QECFHATVEAR-DGFVRTRGIHFMLNGYPYYVNGFNAYWLMYTASDPSQRFKVSNAFREA  74

Query  289  SSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYES  468
            +SHGLTVARTWAFSDGGYR LQY+PG YN+ +F GLDFVI+EARKYG+K+ILSL NNYE+
Sbjct  75   ASHGLTVARTWAFSDGGYRPLQYSPGFYNDQMFMGLDFVISEARKYGIKLILSLVNNYEN  134

Query  469  FGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            FGGKKQYV+WAR +GQYLTSDDDFFR+ +VKG+
Sbjct  135  FGGKKQYVNWARSQGQYLTSDDDFFRSPVVKGY  167



>ref|XP_011083199.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Sesamum indicum]
Length=433

 Score =   246 bits (628),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A + FI+TRGIHF +NG  FYANGFNAYWLMY+ASDPSQR KVS  FR A++HGLTVART
Sbjct  24   AADMFIRTRGIHFFLNGTPFYANGFNAYWLMYLASDPSQRPKVSAVFRQAAAHGLTVART  83

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAFSDGGYR LQY+PG+YN+ +FKGLDFV+AEAR++G+K+ILSLANNY+SFGGKKQYV+W
Sbjct  84   WAFSDGGYRPLQYSPGAYNQQMFKGLDFVVAEARRHGIKLILSLANNYDSFGGKKQYVNW  143

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +GQYLTSDDDFFRNS+VKGF
Sbjct  144  ARNRGQYLTSDDDFFRNSVVKGF  166



>ref|XP_006383170.1| (1-4)-beta-mannan endohydrolase family protein [Populus trichocarpa]
 gb|ABK95661.1| unknown [Populus trichocarpa]
 gb|ERP60967.1| (1-4)-beta-mannan endohydrolase family protein [Populus trichocarpa]
Length=435

 Score =   246 bits (627),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+GFI+TRG+HF++NG  +YANGFNAYWLMY ASDPSQR KVS AFR A+SHGLTVART
Sbjct  25   AGDGFIRTRGVHFLLNGSPYYANGFNAYWLMYTASDPSQRPKVSAAFREAASHGLTVART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAFSDGGYR LQY+PGSYNE +FKGLDFV+AEAR YG+K+ILS ANNY+SFGGKKQYV+W
Sbjct  85   WAFSDGGYRPLQYSPGSYNEQMFKGLDFVVAEARSYGIKLILSFANNYDSFGGKKQYVNW  144

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +GQYL+SDDDFFR+ +VKG+
Sbjct  145  ARSRGQYLSSDDDFFRHPVVKGY  167



>gb|KHG22102.1| Mannan endo-1,4-beta-mannosidase 7 -like protein [Gossypium arboreum]
Length=434

 Score =   246 bits (627),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 136/153 (89%), Gaps = 1/153 (1%)
 Frame = +1

Query  109  QSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGA  288
            Q+ L+  V+A G+ F++TR +HF +NG  ++ANGFNAYWLMYVASDPSQR KVS AFR A
Sbjct  17   QNLLTVHVEA-GDDFVRTRRVHFFLNGNPYFANGFNAYWLMYVASDPSQRPKVSAAFREA  75

Query  289  SSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYES  468
            ++HGLTVARTWAFSDGGYR LQYAPGSYNE +FKGLDFVIAEARKY +K+ILSLANNYES
Sbjct  76   AAHGLTVARTWAFSDGGYRPLQYAPGSYNEQMFKGLDFVIAEARKYRIKLILSLANNYES  135

Query  469  FGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            FGGKKQYV+WAR +GQYLTSDDDFFRN +VKG+
Sbjct  136  FGGKKQYVNWARSQGQYLTSDDDFFRNPVVKGY  168



>gb|ACU18982.1| unknown [Glycine max]
Length=431

 Score =   246 bits (627),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 133/156 (85%), Gaps = 1/156 (1%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
             V Q     SV+A  + F++ RGIHFM+NGY +YANGFNAYWLMY ASDPSQR+KVS AF
Sbjct  13   LVPQECFHVSVEARDD-FVRARGIHFMLNGYPYYANGFNAYWLMYTASDPSQRFKVSNAF  71

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            R A+SHGLTVARTWAFSDGGYR LQY+PG YNE +F GLDFV++EARKYG+K+ILSL NN
Sbjct  72   REAASHGLTVARTWAFSDGGYRPLQYSPGFYNEQMFTGLDFVVSEARKYGIKLILSLVNN  131

Query  460  YESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            YE+FGGKKQYV+WAR  GQYLTSDDDFFR+ +VKG+
Sbjct  132  YENFGGKKQYVNWARSHGQYLTSDDDFFRSPVVKGY  167



>ref|XP_011015126.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Populus euphratica]
Length=435

 Score =   246 bits (627),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+GFI+TRG+HF++NG  +YANGFNAYWLMY ASDPSQR KVS AFR A+SHGLTVART
Sbjct  25   AGDGFIRTRGVHFLLNGSPYYANGFNAYWLMYTASDPSQRPKVSAAFREAASHGLTVART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAFSDGGYR LQY+PGSYNE +FKGLDFV+AEAR YG+K+ILS ANNY+SFGGKKQYV+W
Sbjct  85   WAFSDGGYRPLQYSPGSYNEQMFKGLDFVVAEARSYGIKLILSFANNYDSFGGKKQYVNW  144

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +GQYL+SDDDFFR+ +VKG+
Sbjct  145  ARSRGQYLSSDDDFFRHPVVKGY  167



>ref|XP_011013722.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Populus euphratica]
Length=435

 Score =   246 bits (627),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+GFI+TRG+HF++NG  +YANGFNAYWLMY ASDPSQR KVS AFR A+SHGLTVART
Sbjct  25   AGDGFIRTRGVHFLLNGSPYYANGFNAYWLMYTASDPSQRPKVSAAFREAASHGLTVART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAFSDGGYR LQY+PGSYNE +FKGLDFV+AEAR YG+K+ILS ANNY+SFGGKKQYV+W
Sbjct  85   WAFSDGGYRPLQYSPGSYNEQMFKGLDFVVAEARSYGIKLILSFANNYDSFGGKKQYVNW  144

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +GQYL+SDDDFFR+ +VKG+
Sbjct  145  ARSRGQYLSSDDDFFRHPVVKGY  167



>ref|XP_002264115.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Vitis vinifera]
 emb|CBI17484.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   245 bits (626),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+GFI+TRG+HF++NG  +YANGFNAYWLMY+ASDPSQR KVS AFR ASSHGLTVART
Sbjct  25   AGDGFIRTRGVHFVMNGSPYYANGFNAYWLMYLASDPSQRAKVSAAFREASSHGLTVART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAFSDGGYR LQY+PG YN+ +FKGLDFV+AEAR+YG+K+ILSL NNYESFGGKKQYV+W
Sbjct  85   WAFSDGGYRPLQYSPGFYNQQMFKGLDFVVAEARRYGIKLILSLVNNYESFGGKKQYVNW  144

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +GQ+L+S+DDFFRN +VKG+
Sbjct  145  ARSRGQHLSSEDDFFRNPVVKGY  167



>gb|KHN36084.1| Mannan endo-1,4-beta-mannosidase 7 [Glycine soja]
Length=431

 Score =   245 bits (625),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 133/156 (85%), Gaps = 1/156 (1%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
             V Q     SV+A  + F++TRGIHF +NGY +YANGFNAYWLMY ASDPSQR+KVS AF
Sbjct  13   LVPQECFHVSVEARDD-FVRTRGIHFTLNGYPYYANGFNAYWLMYTASDPSQRFKVSNAF  71

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            R A+SHGLTVARTWAFSDGGYR LQY+PG YNE +F GLDFV++EARKYG+K+ILSL NN
Sbjct  72   REAASHGLTVARTWAFSDGGYRPLQYSPGFYNEQMFTGLDFVVSEARKYGIKLILSLVNN  131

Query  460  YESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            YE+FGGKKQYV+WAR  GQYLTSDDDFFR+ +VKG+
Sbjct  132  YENFGGKKQYVNWARSHGQYLTSDDDFFRSPVVKGY  167



>ref|XP_004512071.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Cicer arietinum]
Length=424

 Score =   244 bits (624),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 132/149 (89%), Gaps = 2/149 (1%)
 Frame = +1

Query  124  GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGL  303
            GSV+A G+GF++TRGIHFM+NG  +YANGFNAYWLMY ASDPSQRYKVS AF  A+SHGL
Sbjct  17   GSVEA-GDGFVRTRGIHFMLNGNPYYANGFNAYWLMYTASDPSQRYKVSNAFHEATSHGL  75

Query  304  TVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKK  483
            TVARTWAFSDGGY  LQY+PG YNE +FKGLDFVI+EARKY +K+ILSL NNYESFGGKK
Sbjct  76   TVARTWAFSDGGYSPLQYSPGFYNEQMFKGLDFVISEARKYKIKLILSLVNNYESFGGKK  135

Query  484  QYVDWAR-GKGQYLTSDDDFFRNSLVKGF  567
            QYV+WAR   GQYLTSDDDFFRN +VKGF
Sbjct  136  QYVNWARTNNGQYLTSDDDFFRNPVVKGF  164



>ref|XP_009340713.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Pyrus x bretschneideri]
Length=436

 Score =   245 bits (625),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = +1

Query  130  VKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTV  309
            V AA + FI+ RG+HF++NG  +YANGFN YWLMYVASDPSQR+KVS  FR A+SHGLTV
Sbjct  25   VSAAVDNFIRVRGVHFLLNGSPYYANGFNGYWLMYVASDPSQRHKVSSVFREATSHGLTV  84

Query  310  ARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQY  489
            ARTWAFSDGGYR LQ++PG YNE +FKGLDFVIAEAR+YG+K+ILSL NNYESFGG+KQY
Sbjct  85   ARTWAFSDGGYRPLQFSPGLYNEQMFKGLDFVIAEARRYGIKLILSLVNNYESFGGRKQY  144

Query  490  VDWARGKGQYLTSDDDFFRNSLVKGF  567
            V+WAR +GQ+LTSDDDFFRN +VKG+
Sbjct  145  VNWARSQGQHLTSDDDFFRNPVVKGY  170



>ref|XP_003537602.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like isoform X1 
[Glycine max]
 gb|KHN41948.1| Mannan endo-1,4-beta-mannosidase 7 [Glycine soja]
Length=425

 Score =   243 bits (621),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 132/156 (85%), Gaps = 1/156 (1%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
             V Q     SV+A  + F++TRGIHFM NGY +YANGFNAYWLMY ASDPSQR+KVS AF
Sbjct  13   LVPQECFHVSVEARDD-FVRTRGIHFMQNGYPYYANGFNAYWLMYTASDPSQRFKVSNAF  71

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            R A+SHGLTVARTWAFSDGGYR LQY PG YNE +F GLDFV++EARKYG+K+ILSL NN
Sbjct  72   REAASHGLTVARTWAFSDGGYRPLQYFPGFYNEQMFTGLDFVVSEARKYGIKLILSLVNN  131

Query  460  YESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            YE+FGGKKQYV+WAR  GQYLTSDDDFFR+ +VKG+
Sbjct  132  YENFGGKKQYVNWARSHGQYLTSDDDFFRSPVVKGY  167



>ref|XP_006590696.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like isoform X2 
[Glycine max]
Length=423

 Score =   243 bits (621),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 132/156 (85%), Gaps = 1/156 (1%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
             V Q     SV+A  + F++TRGIHFM NGY +YANGFNAYWLMY ASDPSQR+KVS AF
Sbjct  13   LVPQECFHVSVEARDD-FVRTRGIHFMQNGYPYYANGFNAYWLMYTASDPSQRFKVSNAF  71

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            R A+SHGLTVARTWAFSDGGYR LQY PG YNE +F GLDFV++EARKYG+K+ILSL NN
Sbjct  72   REAASHGLTVARTWAFSDGGYRPLQYFPGFYNEQMFTGLDFVVSEARKYGIKLILSLVNN  131

Query  460  YESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            YE+FGGKKQYV+WAR  GQYLTSDDDFFR+ +VKG+
Sbjct  132  YENFGGKKQYVNWARSHGQYLTSDDDFFRSPVVKGY  167



>gb|KDP44593.1| hypothetical protein JCGZ_22175 [Jatropha curcas]
Length=434

 Score =   243 bits (621),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 134/154 (87%), Gaps = 1/154 (1%)
 Frame = +1

Query  106  QQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRG  285
            QQ +    VKA G+ FI+TRG HF +NG  +YANGFNAYWLMY+ASDPSQRYKVS AF  
Sbjct  16   QQGNFHIHVKA-GDSFIRTRGTHFFLNGNPYYANGFNAYWLMYIASDPSQRYKVSSAFHE  74

Query  286  ASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYE  465
            A+SHGL+VARTWAFSDGGYR LQY+PGSYNE +FKGLDFVIAEARKYG+K+ILSLANNYE
Sbjct  75   AASHGLSVARTWAFSDGGYRPLQYSPGSYNEQMFKGLDFVIAEARKYGIKLILSLANNYE  134

Query  466  SFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            SFGGKKQYV+WA+ +G YL+SDDDFFR+ +VK +
Sbjct  135  SFGGKKQYVNWAKNEGLYLSSDDDFFRHPVVKNY  168



>ref|XP_002281804.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Vitis vinifera]
 emb|CBI19729.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   243 bits (620),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 137/156 (88%), Gaps = 1/156 (1%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
            F+Q+      V+AA +GF+KT G+HF++NG  ++ANGFNAYWLMYVASDPSQR K+S AF
Sbjct  13   FIQKQGNFLQVEAA-DGFVKTSGMHFVLNGLPYHANGFNAYWLMYVASDPSQRSKISSAF  71

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
              A+ HGLT+ARTWAFSDGGYR LQY+PGSYNE +F+GLDFV++EA KYG+K++LSLANN
Sbjct  72   AEAAGHGLTIARTWAFSDGGYRPLQYSPGSYNEQMFQGLDFVVSEAGKYGIKLVLSLANN  131

Query  460  YESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            YESFGGKKQYVDWARG+GQYLTSDDDFFRNS+ KG+
Sbjct  132  YESFGGKKQYVDWARGQGQYLTSDDDFFRNSVAKGY  167



>ref|XP_010263608.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Nelumbo nucifera]
Length=451

 Score =   243 bits (621),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GF++T G HF++NG  +YANGFNAYWLMY+ASDPSQR KVS AF+ AS+HGLTVART
Sbjct  43   AQSGFVRTSGPHFVLNGSPYYANGFNAYWLMYMASDPSQRSKVSSAFQEASTHGLTVART  102

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAFSDGGY+ LQY+PGSYNE +F+GLDFVIAEAR+YG+K+ILSLANNYE+FGGKKQYV+W
Sbjct  103  WAFSDGGYKPLQYSPGSYNEQMFRGLDFVIAEARRYGIKLILSLANNYENFGGKKQYVEW  162

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +GQYLTSDDDFFRN +VKG+
Sbjct  163  ARNQGQYLTSDDDFFRNPVVKGY  185



>ref|XP_002521547.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF40818.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=874

 Score =   251 bits (641),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+GFI+TRG+HF +NG  +YANGFNAYWLMY+ASDPSQR+KVS AFR A+SHGLTVART
Sbjct  25   AGDGFIRTRGVHFFLNGNPYYANGFNAYWLMYIASDPSQRHKVSTAFREAASHGLTVART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAFSDGGYR LQY+P SYNE +FKGLDFVIAEAR+YG+K+ILSL NNYE+FGGKKQYV+W
Sbjct  85   WAFSDGGYRPLQYSPASYNEQMFKGLDFVIAEARRYGIKLILSLVNNYETFGGKKQYVNW  144

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +GQYL+SDDDFFR+ +VKG+
Sbjct  145  ARSRGQYLSSDDDFFRHPVVKGY  167



>gb|ACN78662.1| endo-beta-mannanase [Actinidia arguta]
Length=433

 Score =   241 bits (615),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+ FI+TRG HFM+NG  +YANGFNAYWLMY A+DPSQR KVS AFR AS+HGL+VART
Sbjct  25   AGDDFIRTRGTHFMLNGSPYYANGFNAYWLMYFATDPSQRGKVSAAFREASNHGLSVART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAFSDGGYR LQ++PG YNE  FKGLDFV+AEAR+YG+K++LSL NNYESFGGKKQYV+W
Sbjct  85   WAFSDGGYRPLQFSPGYYNEQAFKGLDFVVAEARRYGIKLVLSLVNNYESFGGKKQYVNW  144

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +GQYL+SDDDFFRN LVKG+
Sbjct  145  ARSQGQYLSSDDDFFRNPLVKGY  167



>ref|XP_011025835.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Populus euphratica]
Length=435

 Score =   241 bits (615),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+GFI+ RG+ F++NG  +YANGFNAYWLMY ASDPSQR KVS AFR A+SHGLTVART
Sbjct  25   AGDGFIRARGVQFLLNGSPYYANGFNAYWLMYTASDPSQRSKVSAAFREAASHGLTVART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAFSDGGY  LQY+PGSYNE +FKGLDFVIAEAR+YG+K+ILSLANNY+SFGGKKQYV+W
Sbjct  85   WAFSDGGYSPLQYSPGSYNEQMFKGLDFVIAEARRYGIKLILSLANNYDSFGGKKQYVNW  144

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +GQYLTS+DDFFR+ +VKG+
Sbjct  145  ARSRGQYLTSEDDFFRHPVVKGY  167



>ref|XP_011011941.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Populus euphratica]
Length=435

 Score =   240 bits (613),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+GFI+ RG+ F++NG  +YANGFNAYWLMY ASDPSQR KVS AFR A+SHGLTVART
Sbjct  25   AGDGFIRARGVQFLLNGSPYYANGFNAYWLMYTASDPSQRSKVSAAFREAASHGLTVART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAFSDGGYR LQY+PGSYNE +FKGLDFV+AEAR YG+K+ILS ANNY+SFGGKKQYV+W
Sbjct  85   WAFSDGGYRPLQYSPGSYNEQMFKGLDFVVAEARSYGIKLILSFANNYDSFGGKKQYVNW  144

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +GQYL+SDDDFFR+ +VKG+
Sbjct  145  ARSRGQYLSSDDDFFRHPVVKGY  167



>ref|XP_002310816.2| hypothetical protein POPTR_0007s13190g [Populus trichocarpa]
 gb|EEE91266.2| hypothetical protein POPTR_0007s13190g [Populus trichocarpa]
Length=435

 Score =   240 bits (613),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+GFI+ RG+ F++NG  +YANGFNAYWLMY ASDPSQR KVS AFR A+SHGLTVART
Sbjct  25   AGDGFIRARGVQFLLNGSPYYANGFNAYWLMYTASDPSQRSKVSAAFREAASHGLTVART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAFSDGGY  LQY+PGSYNE +FKGLDFVIAEAR+YG+K+ILSLANNY+SFGGKKQYV+W
Sbjct  85   WAFSDGGYSPLQYSPGSYNEQMFKGLDFVIAEARRYGIKLILSLANNYDSFGGKKQYVNW  144

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            A  +GQYLTSDDDFFR+ +VKG+
Sbjct  145  ATSRGQYLTSDDDFFRHPVVKGY  167



>ref|XP_008338221.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Malus domestica]
Length=436

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +1

Query  130  VKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTV  309
            V AAG+ FI+ RG+HF++NG  +YANGFN YWLMYVASD SQR+KVS  F  A+SHGLTV
Sbjct  25   VSAAGDNFIRVRGVHFLLNGSPYYANGFNGYWLMYVASDXSQRHKVSSVFSEATSHGLTV  84

Query  310  ARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQY  489
            ARTWAFSDGGY  LQ +PGSYNE +FKGLDFVIAEAR+YG+K+ILSL NNYESFGG+KQY
Sbjct  85   ARTWAFSDGGYXPLQLSPGSYNEQMFKGLDFVIAEARRYGIKLILSLVNNYESFGGRKQY  144

Query  490  VDWARGKGQYLTSDDDFFRNSLVKGF  567
            V+WAR KGQYL SDDDFFRN +VKG+
Sbjct  145  VNWARSKGQYLASDDDFFRNPVVKGY  170



>ref|XP_008338066.1| PREDICTED: LOW QUALITY PROTEIN: mannan endo-1,4-beta-mannosidase 
7 [Malus domestica]
Length=430

 Score =   239 bits (611),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 133/155 (86%), Gaps = 1/155 (1%)
 Frame = +1

Query  106  QQSSLSG-SVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFR  282
            QQ  +S   V AAG+ FI+ RG+HF++NG  +YANGFN YWLMYVASDPS+R+KVS AFR
Sbjct  16   QQCFISPIHVSAAGDDFIRVRGVHFLLNGNPYYANGFNGYWLMYVASDPSRRHKVSSAFR  75

Query  283  GASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNY  462
             A+  GLTVARTWAFSDGGY  LQ++PGSYNE +FKGLDFVIAEAR+Y +K+ILSL NNY
Sbjct  76   EATXDGLTVARTWAFSDGGYMPLQFSPGSYNEHMFKGLDFVIAEARRYEIKMILSLVNNY  135

Query  463  ESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            E+FGG+KQYV+WAR KGQYLTSDDDFFRN +VKG+
Sbjct  136  ENFGGRKQYVNWARRKGQYLTSDDDFFRNPVVKGY  170



>gb|KJB43465.1| hypothetical protein B456_007G201600 [Gossypium raimondii]
Length=1149

 Score =   249 bits (637),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 136/153 (89%), Gaps = 1/153 (1%)
 Frame = +1

Query  109  QSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGA  288
            Q+ L+  V+A G+ F++TR +HF +NG  ++ANGFNAYWLMYVASDPSQR KVS AFR A
Sbjct  17   QNLLTVHVEA-GDDFVRTRRVHFFLNGNPYFANGFNAYWLMYVASDPSQRPKVSTAFREA  75

Query  289  SSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYES  468
            ++HGLTVARTWAFSDGGYR LQYAPGSYNE +FKGLDFVIAEARKY +K+ILSLANNYES
Sbjct  76   AAHGLTVARTWAFSDGGYRPLQYAPGSYNEQMFKGLDFVIAEARKYRIKLILSLANNYES  135

Query  469  FGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            FGGKKQYV+WAR +GQYLTSDDDFFRN +VKG+
Sbjct  136  FGGKKQYVNWARSQGQYLTSDDDFFRNPVVKGY  168



>ref|XP_004143522.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Cucumis sativus]
 ref|XP_004167742.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Cucumis sativus]
 gb|KGN48849.1| Endo-1,4-beta-mannosidase protein 2 [Cucumis sativus]
Length=418

 Score =   236 bits (603),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
            A G+GF++T    F++NG  +YANGFNAYWLMYVASDPSQR KVS  FR ASSHGLTVAR
Sbjct  18   AGGDGFVRTGRTRFLLNGSPYYANGFNAYWLMYVASDPSQRSKVSAVFREASSHGLTVAR  77

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVD  495
            TWAFSDGGYR LQY+PG+YNE +F+G+DFV+AEAR++G+K+ILSL NNYE+FGGKKQYV+
Sbjct  78   TWAFSDGGYRPLQYSPGNYNEQMFQGMDFVVAEARRFGIKLILSLVNNYENFGGKKQYVN  137

Query  496  WARGKGQYLTSDDDFFRNSLVKGF  567
            WAR KGQYL SDDDFFRN +VKGF
Sbjct  138  WARSKGQYLNSDDDFFRNPVVKGF  161



>ref|XP_010550422.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Tarenaya hassleriana]
Length=426

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = +1

Query  145  NGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWA  324
            +GF++TRG+ F+INGY +YANGFNAYWLMY ASDPSQR+K+S+AFR AS  GL+VARTWA
Sbjct  29   DGFVRTRGVQFLINGYPYYANGFNAYWLMYEASDPSQRFKISDAFRDASRRGLSVARTWA  88

Query  325  FSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWAR  504
            FSD GYR LQ++PGSYNE +F+GLDFVI+EAR+YG+K+ILSL NNY+SFGGKKQYVDWAR
Sbjct  89   FSDAGYRPLQFSPGSYNEQMFQGLDFVISEARRYGIKLILSLVNNYDSFGGKKQYVDWAR  148

Query  505  GKGQYLTSDDDFFRNSLVKGF  567
             +GQYLTS+DDFF N +VK F
Sbjct  149  SRGQYLTSEDDFFTNPVVKDF  169



>ref|XP_002865067.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41326.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=431

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = +1

Query  124  GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGL  303
            G+   + NGF++T+G+ F +NGY +YANGFNAYWLMYVASDPSQR K+S AF+ AS HGL
Sbjct  22   GADALSSNGFVRTKGVQFSLNGYPYYANGFNAYWLMYVASDPSQRSKISTAFQDASRHGL  81

Query  304  TVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKK  483
            TVARTWAFSDGGYRALQY+PGSYNED+F+GLDF +AEAR++G+K+ILS ANNYESFGG+K
Sbjct  82   TVARTWAFSDGGYRALQYSPGSYNEDMFQGLDFALAEARRHGIKIILSFANNYESFGGRK  141

Query  484  QYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            QYVDWAR +G+ ++S+DDFF +SLVK F
Sbjct  142  QYVDWARSRGRPVSSEDDFFTDSLVKDF  169



>ref|XP_010444793.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Camelina sativa]
Length=434

 Score =   235 bits (599),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 133/156 (85%), Gaps = 1/156 (1%)
 Frame = +1

Query  103  VQQSSLS-GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
            +QQS L  G+     +GF++T+G+ F +NGY FYANGFNAYWLMYV+SDPSQR K+S A 
Sbjct  14   IQQSCLELGADALPNDGFVRTKGVQFSLNGYPFYANGFNAYWLMYVSSDPSQRSKISAAL  73

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            + AS HGLTVARTWAFSDGGYRALQ +PGSYNED+F+GLDF IAEAR++G+K+ILS ANN
Sbjct  74   QDASRHGLTVARTWAFSDGGYRALQSSPGSYNEDMFQGLDFAIAEARRHGIKIILSFANN  133

Query  460  YESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            Y+SFGGKKQYVDWAR +G+ ++S+DDFF +SLVK F
Sbjct  134  YDSFGGKKQYVDWARSRGRPVSSEDDFFTDSLVKDF  169



>ref|XP_008440745.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Cucumis melo]
Length=418

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
            A G+GF++T    F++NG  +YANGFNAYWLMYVASDPSQR KVS  FR ASSHGLTVAR
Sbjct  18   AGGDGFVRTGRTRFLLNGSPYYANGFNAYWLMYVASDPSQRSKVSSVFREASSHGLTVAR  77

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVD  495
            TWAFSDGGYR LQY+PG+YNE +F+G+DFV+AEAR++G+K+ILSL NNYE+FGGKKQYV+
Sbjct  78   TWAFSDGGYRPLQYSPGNYNEQMFQGMDFVVAEARRFGIKLILSLVNNYENFGGKKQYVN  137

Query  496  WARGKGQYLTSDDDFFRNSLVKGF  567
            WAR KGQYL SDDDFFRN +VK F
Sbjct  138  WARSKGQYLNSDDDFFRNQVVKEF  161



>ref|NP_201447.1| mannan endo-1,4-beta-mannosidase 7 [Arabidopsis thaliana]
 sp|Q9FJZ3.1|MAN7_ARATH RecName: Full=Mannan endo-1,4-beta-mannosidase 7; AltName: Full=Beta-mannanase 
7; AltName: Full=Endo-beta-1,4-mannanase 7; 
Short=AtMAN7; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10922.1| mannan endo-1,4-beta-mannosidase [Arabidopsis thaliana]
 gb|AAN17429.1| mannan endo-1,4-beta-mannosidase [Arabidopsis thaliana]
 gb|AAP49511.1| At5g66460 [Arabidopsis thaliana]
 gb|AED98217.1| mannan endo-1,4-beta-mannosidase 7 [Arabidopsis thaliana]
Length=431

 Score =   233 bits (595),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = +1

Query  124  GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGL  303
            G+      GF++T+G+ F +NGY +YANGFNAYWLMYVASDPSQR K+S AF+ AS HGL
Sbjct  22   GTDALPSGGFVRTKGVQFSLNGYPYYANGFNAYWLMYVASDPSQRSKISTAFQDASRHGL  81

Query  304  TVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKK  483
            TVARTWAFSDGGYRALQY+PGSYNED+F+GLDF +AEAR++G+K+ILS ANNYESFGG+K
Sbjct  82   TVARTWAFSDGGYRALQYSPGSYNEDMFQGLDFALAEARRHGIKIILSFANNYESFGGRK  141

Query  484  QYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            QYVDWAR +G+ ++S+DDFF +SLVK F
Sbjct  142  QYVDWARSRGRPVSSEDDFFTDSLVKDF  169



>gb|KFK28321.1| hypothetical protein AALP_AA8G500900 [Arabis alpina]
Length=433

 Score =   233 bits (594),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 133/156 (85%), Gaps = 1/156 (1%)
 Frame = +1

Query  103  VQQSSLSGSVKAAG-NGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
            +QQS     V A+  +GF++T+G+ F +NGY +YANGFNAYWLMYVASDPSQR K+S AF
Sbjct  14   IQQSYWDLRVDASSRDGFVRTKGVQFTLNGYPYYANGFNAYWLMYVASDPSQRPKISAAF  73

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            + ASSHGLTVARTWAFSDGGYR LQY+PGSYNED+F+GLDF IAEAR++G+K+ILS ANN
Sbjct  74   QEASSHGLTVARTWAFSDGGYRPLQYSPGSYNEDMFQGLDFAIAEARRHGIKIILSFANN  133

Query  460  YESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            Y SFGGKK YVDWAR +G+ ++S+DDFF +SLVK F
Sbjct  134  YVSFGGKKAYVDWARSRGRPVSSEDDFFTDSLVKEF  169



>ref|XP_010484638.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Camelina 
sativa]
Length=434

 Score =   233 bits (593),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 131/156 (84%), Gaps = 1/156 (1%)
 Frame = +1

Query  103  VQQSSLS-GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
            +QQS L  G+     +GF++T+G+ F +NGY FYANG NAYWLMYV+SDPSQR K+S A 
Sbjct  14   IQQSCLELGADALPNDGFVRTKGVQFSLNGYPFYANGVNAYWLMYVSSDPSQRSKISAAL  73

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            + AS HGLTVARTWAFSDGGYRALQ +PGSYNED+F+GLDF IAEAR +G+KVILS ANN
Sbjct  74   QDASRHGLTVARTWAFSDGGYRALQSSPGSYNEDMFQGLDFAIAEARSHGIKVILSCANN  133

Query  460  YESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            Y+SFGGKKQYVDWAR +G+ ++S+DDFF +SLVK F
Sbjct  134  YDSFGGKKQYVDWARSRGRPVSSEDDFFTDSLVKDF  169



>ref|XP_009103527.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Brassica rapa]
Length=426

 Score =   232 bits (592),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 133/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  100  FVQQSSLS-GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEA  276
             +QQS L  G+   + +GF++T+G+ F +NGY +YANGFNAYWLMYVASDPSQR K+S A
Sbjct  13   LIQQSYLKLGTDAFSRDGFVRTKGVQFSLNGYPYYANGFNAYWLMYVASDPSQRPKISAA  72

Query  277  FRGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLAN  456
            F+ AS HGLTVARTWAFSDGGYR LQY+PGSYNED+F+GLDF IAEAR++G+K+ILS A 
Sbjct  73   FQEASRHGLTVARTWAFSDGGYRPLQYSPGSYNEDMFQGLDFAIAEARRHGIKIILSFAT  132

Query  457  NYESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            NY SFGGKKQYVDWAR +G+ ++S+DDFF +SLVK F
Sbjct  133  NYVSFGGKKQYVDWARSRGRPVSSEDDFFTDSLVKDF  169



>ref|XP_009112304.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Brassica 
rapa]
Length=431

 Score =   232 bits (592),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 134/156 (86%), Gaps = 1/156 (1%)
 Frame = +1

Query  103  VQQSSLS-GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
            +QQS L  G+  ++ +GF++T+G+ F +NGY +YANGFNAYWLMYVASDP+QR K+S AF
Sbjct  14   IQQSYLKLGADASSRDGFVRTKGVQFSLNGYPYYANGFNAYWLMYVASDPTQRPKISAAF  73

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            + AS HGLTVARTWAFSDGGYR LQY+PGSYNED+F+GLDF IAEAR+ G+K+ILS ANN
Sbjct  74   QEASRHGLTVARTWAFSDGGYRPLQYSPGSYNEDMFQGLDFAIAEARRNGIKIILSFANN  133

Query  460  YESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            Y SFGGKKQYVDWAR +G+ ++S+DDFF +SLVK F
Sbjct  134  YVSFGGKKQYVDWARNQGRPVSSEDDFFTDSLVKDF  169



>ref|XP_006393839.1| hypothetical protein EUTSA_v10004263mg [Eutrema salsugineum]
 gb|ABB45852.1| hypothetical protein [Eutrema halophilum]
 gb|ESQ31125.1| hypothetical protein EUTSA_v10004263mg [Eutrema salsugineum]
Length=431

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 132/156 (85%), Gaps = 1/156 (1%)
 Frame = +1

Query  103  VQQSSLS-GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
            +QQS    G+   + +GF++T+G+ F +NGY +YANGFNAYWLMYVASDPSQR K+S AF
Sbjct  14   IQQSYWELGADAFSSDGFVRTKGVQFSLNGYPYYANGFNAYWLMYVASDPSQRSKISAAF  73

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            + AS HGLTVARTWAFSDGGYR LQY PGSYNED+F+GLDF IAEAR++G+KVILS ANN
Sbjct  74   QEASRHGLTVARTWAFSDGGYRPLQYTPGSYNEDMFQGLDFAIAEARRHGIKVILSFANN  133

Query  460  YESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            Y SFGGKKQYVDWAR +G+ ++S+DDFF +SLVK F
Sbjct  134  YVSFGGKKQYVDWARSRGRPVSSEDDFFTDSLVKDF  169



>emb|CDY45231.1| BnaA07g12590D [Brassica napus]
Length=469

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 133/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  100  FVQQSSLS-GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEA  276
             +QQS L  G+   + +GF++T+G+ F +NGY +YANGFNAYWLMYVASDPSQR K+S A
Sbjct  13   LIQQSYLKLGTDAFSRDGFVRTKGVQFSLNGYPYYANGFNAYWLMYVASDPSQRPKISAA  72

Query  277  FRGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLAN  456
            F+ AS HGLTVARTWAFSDGGYR LQY+PGSYNED+F+GLDF IAEAR++G+K+ILS AN
Sbjct  73   FQEASRHGLTVARTWAFSDGGYRPLQYSPGSYNEDMFQGLDFAIAEARRHGIKIILSFAN  132

Query  457  NYESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            NY SFGGKKQYVDWAR +G+ + S+DDFF +SLVK F
Sbjct  133  NYVSFGGKKQYVDWARSRGRPVYSEDDFFTDSLVKDF  169



>gb|AGG82699.1| endo-1,4-beta-mannosidase [Morus alba var. multicaulis]
Length=420

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GF+KTRG+  ++NGY FYANGFNAYWLMY+ASDPSQR KVS AF+ A +HGL++ART
Sbjct  21   AEDGFVKTRGVQLVLNGYPFYANGFNAYWLMYIASDPSQRDKVSSAFQEAKNHGLSIART  80

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAFSDGGY  LQY+PGSYNE VF+GLDFV++EARKYG+K++LS  NNYE+FGGKKQYV+W
Sbjct  81   WAFSDGGYMPLQYSPGSYNEKVFQGLDFVVSEARKYGIKLVLSFVNNYENFGGKKQYVEW  140

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +GQ ++SDDDFF N +VK F
Sbjct  141  ARNQGQSISSDDDFFSNPVVKQF  163



>ref|XP_010110051.1| Mannan endo-1,4-beta-mannosidase 7 [Morus notabilis]
 gb|EXC25069.1| Mannan endo-1,4-beta-mannosidase 7 [Morus notabilis]
Length=420

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GF+KTRG+  ++NGY FYANGFNAYWLMY+ASDPSQR KVS AF+ A +HGL++ART
Sbjct  21   AEDGFVKTRGVQLVLNGYPFYANGFNAYWLMYIASDPSQRDKVSSAFQEAKNHGLSIART  80

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAFSDGGY  LQY+PGSYNE VF+GLDFV++EARKYG+K++LS  NNYE+FGGKKQYV+W
Sbjct  81   WAFSDGGYMPLQYSPGSYNEKVFQGLDFVVSEARKYGIKLVLSFVNNYENFGGKKQYVEW  140

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +GQ ++SDDDFF N +VK F
Sbjct  141  ARNQGQSISSDDDFFSNPVVKQF  163



>ref|XP_006279868.1| hypothetical protein CARUB_v10028560mg [Capsella rubella]
 gb|EOA12766.1| hypothetical protein CARUB_v10028560mg [Capsella rubella]
Length=432

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = +1

Query  100  FVQQSSLS-GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEA  276
             +QQS L  G+   + +GF++ +G+ F +NGY +YANGFNAYWLMYV+SDPSQR K+  A
Sbjct  13   LIQQSCLELGADALSSDGFVRAKGVQFTLNGYPYYANGFNAYWLMYVSSDPSQRSKLPAA  72

Query  277  FRGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLAN  456
            F+ AS HGLTVARTWAFSDGGYRALQ +PGSYNED+F+GLDF IAEAR++G+K+ILS AN
Sbjct  73   FQDASRHGLTVARTWAFSDGGYRALQSSPGSYNEDMFQGLDFAIAEARRHGIKLILSFAN  132

Query  457  NYESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            NY+ FGGKKQYVDWAR +G+ ++S+DDFF +SLVK F
Sbjct  133  NYDIFGGKKQYVDWARSRGRPVSSEDDFFTDSLVKDF  169



>ref|XP_010465469.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Camelina 
sativa]
Length=433

 Score =   229 bits (583),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 131/156 (84%), Gaps = 1/156 (1%)
 Frame = +1

Query  103  VQQSSLS-GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
            +QQSSL  G+     +GF++T+G+ F +NGY FYANGFNAYWLMY ++DPSQR K+S A 
Sbjct  15   IQQSSLELGADALPNDGFVRTKGVQFNLNGYPFYANGFNAYWLMYESADPSQRSKISAAL  74

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            + AS HGLTVARTWAFSDGGYR LQ +PGSYNED+F+GLDF IAEAR +G+K+ILS ANN
Sbjct  75   QDASRHGLTVARTWAFSDGGYRPLQSSPGSYNEDMFQGLDFAIAEARSHGIKIILSFANN  134

Query  460  YESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            Y+SFGG+KQYVDWAR +G+ ++S+DDFF +SLVK F
Sbjct  135  YDSFGGRKQYVDWARSQGRPVSSEDDFFTDSLVKDF  170



>ref|XP_010679767.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Beta vulgaris 
subsp. vulgaris]
Length=431

 Score =   228 bits (580),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 129/159 (81%), Gaps = 4/159 (3%)
 Frame = +1

Query  103  VQQSSLSGSVKA----AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVS  270
            +QQ  L   V+A     GN FI+ RG  F++NG  +YANGFNAYWLMY+AS+PSQR+ VS
Sbjct  14   IQQCHLFFKVEANGRRVGNDFIRVRGTRFLLNGSPYYANGFNAYWLMYMASNPSQRHFVS  73

Query  271  EAFRGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSL  450
              F  ASSH L+VARTWAF+DGG RALQ +PGSY+E VF+GLDFVIAEARKYG+K+ILS 
Sbjct  74   NVFHEASSHSLSVARTWAFNDGGDRALQLSPGSYDEHVFQGLDFVIAEARKYGIKLILSF  133

Query  451  ANNYESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            ANNYES GGKKQYV+WA+ +GQYLTSDDDFF N +VKGF
Sbjct  134  ANNYESMGGKKQYVNWAKNQGQYLTSDDDFFTNPVVKGF  172



>ref|XP_003528027.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Glycine max]
Length=420

 Score =   227 bits (579),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 129/154 (84%), Gaps = 1/154 (1%)
 Frame = +1

Query  106  QQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRG  285
            +QS L   V+A G GF+KTRG+  M+NG  +YANGFNAYWLMY+ASDPSQR K+S  F+ 
Sbjct  19   EQSKLLHHVEADG-GFVKTRGVQLMLNGSPYYANGFNAYWLMYLASDPSQRNKISSVFQQ  77

Query  286  ASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYE  465
            AS+HGL +ARTWAFSDGGY+ LQY+PGSYN+ +F+GLDF IAEARKYG+K++LSL NNYE
Sbjct  78   ASNHGLNIARTWAFSDGGYQPLQYSPGSYNDQMFQGLDFAIAEARKYGIKMVLSLVNNYE  137

Query  466  SFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            + GGKKQYV+WAR +GQ + S+DDFF N +VKG+
Sbjct  138  NMGGKKQYVEWARSQGQSINSEDDFFTNPVVKGY  171



>emb|CDX81394.1| BnaC09g08050D [Brassica napus]
Length=1046

 Score =   236 bits (602),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 133/156 (85%), Gaps = 1/156 (1%)
 Frame = +1

Query  103  VQQSSLSGSVKAAG-NGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
            +QQS L   V A+  +GF++T+G+ F +NGY +YANGFNAYWLMYVASDP QR K+S AF
Sbjct  14   IQQSYLKLGVDASSRDGFVRTKGVQFSLNGYPYYANGFNAYWLMYVASDPIQRPKISAAF  73

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            + ASSHGLTVARTWAFSDGGYR LQY+PGSYNED+F+GLDF IAEAR+ G+K+ILS ANN
Sbjct  74   QEASSHGLTVARTWAFSDGGYRPLQYSPGSYNEDMFQGLDFAIAEARRNGIKIILSFANN  133

Query  460  YESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            Y SFGGKKQYVDWAR +G+ ++S+DDFF +SLVK F
Sbjct  134  YVSFGGKKQYVDWARSQGRPVSSEDDFFTDSLVKDF  169



>ref|XP_007136624.1| hypothetical protein PHAVU_009G059700g [Phaseolus vulgaris]
 gb|ESW08618.1| hypothetical protein PHAVU_009G059700g [Phaseolus vulgaris]
Length=432

 Score =   227 bits (578),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = +1

Query  103  VQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFR  282
            V+QS +       G  F+KTRG+  ++NG  +YANGFNAYWLMY+ASDPSQR KVS AF+
Sbjct  18   VEQSKVLKVEADDGGAFVKTRGVQLILNGSPYYANGFNAYWLMYIASDPSQRNKVSSAFQ  77

Query  283  GASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNY  462
             AS+HGL +ARTWAFSDGGY  LQY+PGSYNE VF+GLDF IAEARKYG+K++LSL NNY
Sbjct  78   QASNHGLNIARTWAFSDGGYNPLQYSPGSYNEQVFQGLDFAIAEARKYGMKLVLSLVNNY  137

Query  463  ESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            E+ GGKKQYV+WAR +GQ ++S+DDFF N + KGF
Sbjct  138  ENMGGKKQYVEWARSQGQSISSEDDFFTNPVAKGF  172



>gb|KEH36174.1| mannan endo-1,4-beta-mannosidase-like protein [Medicago truncatula]
Length=410

 Score =   225 bits (573),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A + F+KTRG+  M+NG  +YANG+NAYWLMY ASDPSQR KVS  F+ AS HGL +ART
Sbjct  22   ADDEFVKTRGVQLMLNGSPYYANGYNAYWLMYFASDPSQRNKVSSTFQEASYHGLNIART  81

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAFSDGGY+ LQY+PGSYNE++F+GLDFV+AEARKYG+KVILSL NNYE FGGKKQYV+W
Sbjct  82   WAFSDGGYKPLQYSPGSYNEEMFQGLDFVLAEARKYGIKVILSLVNNYEDFGGKKQYVEW  141

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +GQ + S+DDFF N +VKG+
Sbjct  142  ARSQGQSINSEDDFFTNPVVKGY  164



>ref|XP_008800703.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Phoenix dactylifera]
Length=430

 Score =   225 bits (573),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = +1

Query  130  VKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTV  309
            V+A G GF++T+G+HF+++G  F+ANGFNAYWL YVASDPSQRYKVS AFR ASSHGL+V
Sbjct  21   VEAKG-GFVRTKGLHFVLHGNPFFANGFNAYWLTYVASDPSQRYKVSNAFREASSHGLSV  79

Query  310  ARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQY  489
            ARTWAF+DGG  ALQY+PGSYNE +FKGLDFV++EARKY +++ILSL NNY+SFGGKKQY
Sbjct  80   ARTWAFNDGGSTALQYSPGSYNEQMFKGLDFVVSEARKYKIRLILSLVNNYDSFGGKKQY  139

Query  490  VDWARGKGQYLTSDDDFFRNSLVKGF  567
            V WAR +GQ + SDD FF N  VKGF
Sbjct  140  VQWARNQGQNIASDDGFFTNPTVKGF  165



>emb|CDY68324.1| BnaCnng58510D [Brassica napus]
Length=823

 Score =   233 bits (593),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 133/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  100  FVQQSSLS-GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEA  276
             +QQS L  G+   + +GF++T+G+ F +NGY +YANGFNAYWLMYVASDPSQR K+S A
Sbjct  13   LIQQSYLKLGADAFSRDGFVRTKGVQFSLNGYPYYANGFNAYWLMYVASDPSQRPKISAA  72

Query  277  FRGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLAN  456
            F+ AS HGLTVARTWAFSDGGYR LQY+PGSYNED+F+GLDF IAEAR++G+K+ILS AN
Sbjct  73   FQEASRHGLTVARTWAFSDGGYRPLQYSPGSYNEDMFQGLDFAIAEARRHGIKIILSFAN  132

Query  457  NYESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            NY SFGGKKQYVDWAR +G+ ++S+DDFF + LVK F
Sbjct  133  NYVSFGGKKQYVDWARSRGRPVSSEDDFFTDFLVKDF  169



>ref|XP_003545272.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Glycine max]
Length=429

 Score =   224 bits (571),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
            AA +GF+K RG+  M+NG  +YANG+NAYWLMY+ASDPSQR KVS  F+  ++HGL +AR
Sbjct  29   AAADGFVKVRGVQLMLNGRPYYANGYNAYWLMYMASDPSQRNKVSSVFQKGTNHGLNIAR  88

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVD  495
            TWAFSDGGY+ LQY+PGSYNED+F+GLDFVI+EAR+YG K++LSL NNY++FGGKKQYVD
Sbjct  89   TWAFSDGGYKPLQYSPGSYNEDMFRGLDFVISEARRYGTKLVLSLVNNYDNFGGKKQYVD  148

Query  496  WARGKGQYLTSDDDFFRNSLVKGF  567
            WAR +GQ + S+DDFF N LVK +
Sbjct  149  WARSEGQAIDSEDDFFTNPLVKEY  172



>gb|KHN20963.1| Mannan endo-1,4-beta-mannosidase 7 [Glycine soja]
Length=417

 Score =   223 bits (568),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
            AA +GF+K +G+  M+NG  +YANG+NAYWLMY+ASDPSQR KVS  F+  ++HGL +AR
Sbjct  16   AAADGFVKVKGVQLMLNGRPYYANGYNAYWLMYMASDPSQRNKVSSVFQKGTNHGLNIAR  75

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVD  495
            TWAFSDGGY+ LQY+PGSYNED+F+GLDFVI+EAR+YG K++LSL NNY++FGGKKQYVD
Sbjct  76   TWAFSDGGYKPLQYSPGSYNEDMFRGLDFVISEARRYGTKLVLSLVNNYDNFGGKKQYVD  135

Query  496  WARGKGQYLTSDDDFFRNSLVKGF  567
            WAR +GQ + S+DDFF N LVK +
Sbjct  136  WARSEGQAIDSEDDFFTNPLVKEY  159



>emb|CDY18606.1| BnaA09g07890D [Brassica napus]
Length=1113

 Score =   232 bits (592),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 133/156 (85%), Gaps = 1/156 (1%)
 Frame = +1

Query  103  VQQSSLS-GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
            +QQS L  G+  ++ +GF++T+G+ F +NGY +YANGFNAYWLMYVASDP QR K+S AF
Sbjct  14   IQQSYLKLGADASSRDGFVRTKGVQFSLNGYPYYANGFNAYWLMYVASDPIQRPKISAAF  73

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            + AS HGLTVARTWAFSDGGYR LQY+PGSYNED+F+GLDF IAEAR+ G+K+ILS ANN
Sbjct  74   QEASRHGLTVARTWAFSDGGYRPLQYSPGSYNEDMFQGLDFAIAEARRNGIKIILSFANN  133

Query  460  YESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            Y SFGG+KQYVDWAR +G+ ++S+DDFF +SLVK F
Sbjct  134  YVSFGGRKQYVDWARNQGRPVSSEDDFFTDSLVKDF  169



>ref|XP_010924295.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like isoform X1 
[Elaeis guineensis]
Length=430

 Score =   223 bits (568),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 127/146 (87%), Gaps = 1/146 (1%)
 Frame = +1

Query  130  VKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTV  309
            V+A G GFI+T+G+HF++N Y F+ANGFNAYWL YVAS PSQRYKVS AFR ASSHGL+V
Sbjct  21   VEAKG-GFIRTKGLHFVLNRYPFFANGFNAYWLTYVASVPSQRYKVSNAFREASSHGLSV  79

Query  310  ARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQY  489
            ARTWAF+DGG  ALQY+PGSYNE +FKGLDFV++EARKY +++ILSL NNY+++GGKKQY
Sbjct  80   ARTWAFNDGGSTALQYSPGSYNEQMFKGLDFVVSEARKYKIRLILSLVNNYDNYGGKKQY  139

Query  490  VDWARGKGQYLTSDDDFFRNSLVKGF  567
            V WAR +GQ + SDD+FF N +VKGF
Sbjct  140  VQWARNQGQNIVSDDEFFTNHVVKGF  165



>gb|EMS54429.1| Mannan endo-1,4-beta-mannosidase 1 [Triticum urartu]
Length=320

 Score =   219 bits (559),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  133  KAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVA  312
            +AAG GF++ +G  F+ING  +YANGFNAYWLM +A+DP+QR KV+ A   A++ GL+VA
Sbjct  26   EAAGGGFVRAQGPRFVINGSPYYANGFNAYWLMTMAADPAQRGKVTSALSQAAARGLSVA  85

Query  313  RTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYV  492
            RTWAFSDGG  ALQYAPGSYNE+ FKGLDFV++EARK G+KVILSL NNY++FGGKKQYV
Sbjct  86   RTWAFSDGGSNALQYAPGSYNENTFKGLDFVLSEARKNGIKVILSLVNNYDTFGGKKQYV  145

Query  493  DWARGKGQYLTSDDDFFRNSLVKGF  567
            +WARG+GQ + S+DDFF NSLVKGF
Sbjct  146  EWARGRGQAVGSEDDFFTNSLVKGF  170



>ref|XP_009365114.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Pyrus x bretschneideri]
Length=429

 Score =   221 bits (564),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GF+KTRG+  ++NG  +Y NGFNAYWLMY+A+DPS+R KVS AFR A+ +GLT+ART
Sbjct  23   AEDGFVKTRGVQLVLNGVPYYGNGFNAYWLMYMATDPSEREKVSSAFREATKNGLTIART  82

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAF+DGGYRALQ +PGSY+E  F+GLDFVIAEA+K G+KV+LSL NNY++FGGKKQYV+W
Sbjct  83   WAFADGGYRALQTSPGSYDEKTFQGLDFVIAEAKKNGIKVMLSLVNNYDNFGGKKQYVEW  142

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +GQ L+S+DDFF NSLVKGF
Sbjct  143  ARSQGQSLSSEDDFFTNSLVKGF  165



>ref|XP_009336054.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Pyrus x bretschneideri]
Length=429

 Score =   221 bits (564),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GF+KTRG+  ++NG  +Y NGFNAYWLMY+A+DPS+R KVS AFR A+ +GLT+ART
Sbjct  23   AEDGFVKTRGVQLVLNGVPYYGNGFNAYWLMYMATDPSEREKVSSAFREATKNGLTIART  82

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAF+DGGYRALQ +PGSY+E  F+GLDFVIAEA+K G+KV+LSL NNY++FGGKKQYV+W
Sbjct  83   WAFADGGYRALQTSPGSYDEKTFQGLDFVIAEAKKNGIKVMLSLVNNYDNFGGKKQYVEW  142

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +GQ L+S+DDFF NSLVKGF
Sbjct  143  ARSQGQSLSSEDDFFTNSLVKGF  165



>gb|EMT30727.1| Mannan endo-1,4-beta-mannosidase 1 [Aegilops tauschii]
Length=348

 Score =   219 bits (557),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  133  KAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVA  312
            +AAG GF++ +G  F+ING  +YANGFNAYWLM +A+DP+QR KV+ A   A++ GL+VA
Sbjct  26   EAAGGGFVRAQGTRFVINGSPYYANGFNAYWLMTMAADPAQRGKVTSALSQAAARGLSVA  85

Query  313  RTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYV  492
            RTWAFSDGG  ALQYAPGSYNE+ FKGLDFV++EARK G+KVILSL NNY++FGGKKQYV
Sbjct  86   RTWAFSDGGSNALQYAPGSYNENTFKGLDFVLSEARKNGIKVILSLVNNYDTFGGKKQYV  145

Query  493  DWARGKGQYLTSDDDFFRNSLVKGF  567
            +WARG+GQ + S+DDFF NS+VKGF
Sbjct  146  EWARGRGQAVGSEDDFFTNSVVKGF  170



>gb|ACN78666.1| endo-beta-mannanase [Vaccinium corymbosum]
Length=425

 Score =   220 bits (561),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 123/144 (85%), Gaps = 1/144 (1%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+GFIKTRG+ F++NG  +YANGFNAYWLMYVA+DPS+R KVS  F+ ASS GLT+ART
Sbjct  22   AGDGFIKTRGVQFVLNGSPYYANGFNAYWLMYVATDPSERNKVSSVFQEASSRGLTLART  81

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAF DGGYRALQ +PGSYNE  F+GLDFVI+EA +YG+K+ILSL NNYE  GGKKQYVDW
Sbjct  82   WAFGDGGYRALQNSPGSYNEQTFQGLDFVISEAGRYGVKLILSLVNNYEDLGGKKQYVDW  141

Query  499  ARGKG-QYLTSDDDFFRNSLVKGF  567
            AR +G Q + S+DDFF NS+VKG+
Sbjct  142  ARSQGAQNIASEDDFFSNSVVKGY  165



>gb|KCW68225.1| hypothetical protein EUGRSUZ_F01879 [Eucalyptus grandis]
Length=464

 Score =   221 bits (563),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 139/174 (80%), Gaps = 0/174 (0%)
 Frame = +1

Query  46   AQQRMKHlgllaallailFVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYW  225
            A++ MKHL LL  L  +L  ++ S   +    G GF+KT G+HFM+NG  FYANGFNAYW
Sbjct  35   ARENMKHLRLLFFLALVLVQERRSHFAAKAEDGGGFVKTEGVHFMLNGSPFYANGFNAYW  94

Query  226  LMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFV  405
            LM++AS PSQR KV+ AF+ A+SHGL++ARTWAFSDGGY  LQ +PGSYNE +F+GLDFV
Sbjct  95   LMFLASYPSQRAKVTSAFQEATSHGLSIARTWAFSDGGYMPLQSSPGSYNEQMFQGLDFV  154

Query  406  IAEARKYGLKVILSLANNYESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            I+EA+K+G+K++LSL +NYE+ GGKK+YV+WAR +GQ + SDDDFF N +VKG+
Sbjct  155  ISEAKKFGIKLVLSLVDNYEALGGKKRYVEWARSQGQPIASDDDFFTNPVVKGY  208



>ref|NP_001280873.1| mannan endo-1,4-beta-mannosidase 7-like precursor [Malus domestica]
 gb|ACN78664.1| endo-beta-mannanase [Malus domestica]
Length=429

 Score =   220 bits (560),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GF+KTRG+  ++NG  +Y NGFNAYWLMY+A+DPS+R KVS AFR A+ +GLT+ART
Sbjct  23   AEDGFVKTRGVQLVLNGVPYYGNGFNAYWLMYMATDPSEREKVSSAFREATKNGLTIART  82

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAF+DGGYRALQ +PGSY+E  F+GLDFVIAEA+K G+KV+LSL NNY+ FGGKKQYV+W
Sbjct  83   WAFADGGYRALQTSPGSYDEKTFQGLDFVIAEAKKNGIKVMLSLVNNYDDFGGKKQYVEW  142

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +GQ L+S+DDFF NS+VKGF
Sbjct  143  ARSQGQSLSSEDDFFTNSVVKGF  165



>ref|XP_008220834.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Prunus mume]
Length=431

 Score =   219 bits (559),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 128/156 (82%), Gaps = 1/156 (1%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
             +Q   +   V+A  +GF+KTRG+  ++NG  +YANGFNAYWLMYVA+DPSQR K+S AF
Sbjct  13   LIQNQGILKPVEAE-DGFVKTRGLQLVLNGIPYYANGFNAYWLMYVATDPSQRDKISSAF  71

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            + A+ HGL++ARTWAFSDGGYR LQ +PGSYNE  F+GLDF I+EA+K+G+K+ILSL NN
Sbjct  72   QEATQHGLSIARTWAFSDGGYRPLQSSPGSYNEQTFQGLDFAISEAKKHGIKLILSLMNN  131

Query  460  YESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            YE+FGG+KQYV+WAR +GQ + S+DDF+ NS+VK F
Sbjct  132  YENFGGRKQYVEWARSQGQSIKSEDDFYTNSVVKDF  167



>ref|XP_009394803.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Musa acuminata 
subsp. malaccensis]
Length=426

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG GFIKTRG++F+++G  F+ANGFNAYWLM +ASDPSQR KVS AF  ASSHGL VART
Sbjct  23   AGGGFIKTRGLNFVLDGNPFFANGFNAYWLMTLASDPSQRSKVSSAFGDASSHGLYVART  82

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAFSDGG  ALQY+PGSYNE  F+GLDFVI+EAR+Y +++ILSLANNY++FGGKKQYV W
Sbjct  83   WAFSDGGSNALQYSPGSYNEQTFRGLDFVISEARRYRIRLILSLANNYDTFGGKKQYVQW  142

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +GQY+ SDD FF +S+VKG+
Sbjct  143  ARNQGQYIASDDGFFTDSVVKGY  165



>ref|XP_007222385.1| hypothetical protein PRUPE_ppa006029mg [Prunus persica]
 gb|EMJ23584.1| hypothetical protein PRUPE_ppa006029mg [Prunus persica]
Length=431

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 128/156 (82%), Gaps = 1/156 (1%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
             +Q   +   V+A  +GF+KTRG+  ++NG  +YA+GFNAYWLMYVA+DPSQR K+  AF
Sbjct  13   LIQSPGILKPVEAE-DGFVKTRGLQLVLNGVPYYAHGFNAYWLMYVATDPSQRDKILSAF  71

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            + A+ HGL++ARTWAFSDGGYR LQ +PGSYNE  F+GLDF I+EA+K+G+K+ILSL NN
Sbjct  72   QEATKHGLSIARTWAFSDGGYRPLQSSPGSYNEQTFQGLDFAISEAKKHGIKLILSLVNN  131

Query  460  YESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            YE+FGG+KQYVDWAR +GQ +TS+DDF+ NS+VK F
Sbjct  132  YENFGGRKQYVDWARSQGQSITSEDDFYTNSVVKDF  167



>gb|KHN45867.1| Mannan endo-1,4-beta-mannosidase 7 [Glycine soja]
Length=417

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = +1

Query  130  VKAAGN-GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLT  306
            V+A G+ GF++TRG+  M+NG  +YANGFNAYWLMY+ASDPSQR KVS  F+ AS+HGL 
Sbjct  20   VEADGSVGFVRTRGVQLMLNGSPYYANGFNAYWLMYLASDPSQRNKVSSVFQQASNHGLN  79

Query  307  VARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQ  486
            +ARTWAFSDGGY+ LQY+PGSYN  +F+GLDF IAEARKYG+K++LSL NNYE+ GGKKQ
Sbjct  80   IARTWAFSDGGYQPLQYSPGSYNYQMFQGLDFAIAEARKYGIKMVLSLVNNYENMGGKKQ  139

Query  487  YVDWARGKGQYLTSDDDFFRNSLVKGF  567
            YV+WA+ +GQ + S+DDFF N +VKG+
Sbjct  140  YVEWAKSQGQSINSEDDFFTNPVVKGY  166



>ref|XP_002510418.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF52605.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=432

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = +1

Query  106  QQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRG  285
            Q+  +   VKAA +GF+ T+G+ FM+NG  FYANGFNAYWLMY A+D S R KVS  F+ 
Sbjct  15   QKQGMFLQVKAADDGFVSTKGVQFMLNGSPFYANGFNAYWLMYFATDNSMRNKVSSVFQE  74

Query  286  ASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYE  465
            A +HGLT+ARTWAF+DG  RALQY+PGSYNE  F+GLDFVI+EA++ G+K++LSL NNYE
Sbjct  75   ARNHGLTLARTWAFNDGQDRALQYSPGSYNEQAFQGLDFVISEAKRNGIKLVLSLVNNYE  134

Query  466  SFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            SFGGKKQYV+WAR +GQ ++SDDDFF NS+VKG+
Sbjct  135  SFGGKKQYVNWARSQGQSISSDDDFFTNSVVKGY  168



>ref|NP_001241893.1| uncharacterized protein LOC100814337 precursor [Glycine max]
 gb|ACU17987.1| unknown [Glycine max]
Length=418

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = +1

Query  130  VKAAGNG-FIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLT  306
            V+A G+G F++TRG+  M+NG  +YANGFNAYWLMY+ASDPSQR KVS  F+ AS+HGL 
Sbjct  21   VEADGSGGFVRTRGVQLMLNGSPYYANGFNAYWLMYLASDPSQRNKVSSVFQQASNHGLN  80

Query  307  VARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQ  486
            +ARTWAFSDGGY+ LQY+PGSYN  +F+GLDF IAEARKYG+K++LSL NNYE+ GGKKQ
Sbjct  81   IARTWAFSDGGYQPLQYSPGSYNYQMFQGLDFAIAEARKYGIKMVLSLVNNYENMGGKKQ  140

Query  487  YVDWARGKGQYLTSDDDFFRNSLVKGF  567
            YV+WA+ +GQ + S+DDFF N +VKG+
Sbjct  141  YVEWAKSQGQSINSEDDFFTNPVVKGY  167



>gb|ABV32547.1| endo-1,4-beta-mannosidase protein 1 [Prunus persica]
Length=431

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 128/156 (82%), Gaps = 1/156 (1%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
             +Q   +   V+A  +GF+KTRG+  ++NG  +YA+GFNAYWLMYVA+DPSQR K+  AF
Sbjct  13   LIQSPGILRPVEAE-DGFVKTRGLQLVLNGVPYYAHGFNAYWLMYVATDPSQRDKILSAF  71

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            + A+ HGL++ARTWAFSDGGYR LQ +PGSYNE  F+GLDF I+EA+K+G+K+ILSL NN
Sbjct  72   QEATKHGLSIARTWAFSDGGYRPLQSSPGSYNEQTFQGLDFAISEAKKHGIKLILSLVNN  131

Query  460  YESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            YE+FGG+KQYVDWAR +GQ +TS+DDF+ NS+VK F
Sbjct  132  YENFGGRKQYVDWARSQGQSITSEDDFYTNSVVKDF  167



>ref|XP_010061294.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Eucalyptus 
grandis]
Length=426

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  142  GNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTW  321
            G GF+KT G+HFM+NG  FYANGFNAYWLM++AS PSQR KV+ AF+ A+SHGL++ARTW
Sbjct  29   GGGFVKTEGVHFMLNGSPFYANGFNAYWLMFLASYPSQRAKVTSAFQEATSHGLSIARTW  88

Query  322  AFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWA  501
            AFSDGGY  LQ +PGSYNE +F+GLDFVI+EA+K+G+K++LSL +NYE+ GGKK+YV+WA
Sbjct  89   AFSDGGYMPLQSSPGSYNEQMFQGLDFVISEAKKFGIKLVLSLVDNYEALGGKKRYVEWA  148

Query  502  RGKGQYLTSDDDFFRNSLVKGF  567
            R +GQ + SDDDFF N +VKG+
Sbjct  149  RSQGQPIASDDDFFTNPVVKGY  170



>ref|XP_003549439.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Glycine max]
Length=432

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  145  NGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWA  324
            +GF+K RG+  M+NG  +YANG+NAYWLMY+ASDPSQR KVS  F+  ++HGL +ARTWA
Sbjct  33   DGFVKVRGVQLMLNGSPYYANGYNAYWLMYMASDPSQRNKVSSVFQKGTNHGLNIARTWA  92

Query  325  FSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWAR  504
            FSDGGY+ LQY+PG YNED+F GLDFVI+EAR+YG K++LSL NNY++FGGKKQYVDWAR
Sbjct  93   FSDGGYKPLQYSPGFYNEDLFLGLDFVISEARRYGTKLVLSLVNNYDNFGGKKQYVDWAR  152

Query  505  GKGQYLTSDDDFFRNSLVKGF  567
             +GQ + S+DDFF N +VKG+
Sbjct  153  SEGQTIDSEDDFFTNPIVKGY  173



>ref|XP_006841534.1| hypothetical protein AMTR_s00003p00158370 [Amborella trichopoda]
 gb|ERN03209.1| hypothetical protein AMTR_s00003p00158370 [Amborella trichopoda]
Length=427

 Score =   218 bits (554),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GF+KTRG HFM+NG  FY NGFNAYWL  +ASDPS R KV+  F+ ASS+GLTVART
Sbjct  29   AQSGFVKTRGTHFMVNGSPFYVNGFNAYWLTQMASDPSTRGKVTSVFQQASSYGLTVART  88

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAFSDGGYR LQ +PGSYNED+FKGLDFVI+EAR+YG+++ILS  NNY+  GG+ QYV W
Sbjct  89   WAFSDGGYRPLQISPGSYNEDMFKGLDFVISEARRYGVRLILSFVNNYKDLGGRPQYVQW  148

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +GQ L SDDDF+ N +VKG+
Sbjct  149  ARNQGQSLNSDDDFYTNPVVKGY  171



>ref|XP_009395690.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Musa acuminata 
subsp. malaccensis]
Length=432

 Score =   218 bits (554),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 125/146 (86%), Gaps = 1/146 (1%)
 Frame = +1

Query  130  VKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTV  309
            V+AAG GFI+TRG++F+++G  F+ANGFNAYWLM +ASDPSQR KVS AFR ASSHGL V
Sbjct  21   VEAAG-GFIRTRGLNFVLDGNPFFANGFNAYWLMTLASDPSQRGKVSSAFREASSHGLLV  79

Query  310  ARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQY  489
            ARTWAFSDGG  ALQY+PG YN   F GLDFV++EAR+YG+++ILSLANNY++FGGKKQY
Sbjct  80   ARTWAFSDGGGNALQYSPGHYNGQTFTGLDFVVSEARRYGIRLILSLANNYDTFGGKKQY  139

Query  490  VDWARGKGQYLTSDDDFFRNSLVKGF  567
            V WAR +GQY+ SDD+FF N +V GF
Sbjct  140  VQWARNQGQYIASDDEFFTNPVVGGF  165



>ref|XP_010926118.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1 [Elaeis guineensis]
Length=430

 Score =   217 bits (552),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 123/146 (84%), Gaps = 1/146 (1%)
 Frame = +1

Query  130  VKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTV  309
            V+A G GFI+T G+HF++NG  F+ANGFNAYWL  VASDPSQRYK+S AF  ASS GL+V
Sbjct  21   VEAQG-GFIRTSGLHFVLNGSPFFANGFNAYWLTCVASDPSQRYKISNAFMEASSRGLSV  79

Query  310  ARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQY  489
            ARTWAF+DGG  ALQY+PGSYNE +FKGLDFV++EA KY +++ILSL NNY+SFGGKKQY
Sbjct  80   ARTWAFNDGGSTALQYSPGSYNEQMFKGLDFVVSEAGKYNIRLILSLVNNYDSFGGKKQY  139

Query  490  VDWARGKGQYLTSDDDFFRNSLVKGF  567
            V WAR +GQ + SDD+FF N +VKGF
Sbjct  140  VQWARNQGQNIASDDEFFTNPVVKGF  165



>ref|XP_010673216.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Beta vulgaris 
subsp. vulgaris]
Length=418

 Score =   216 bits (549),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  145  NGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWA  324
            N FI T+G+   +NG  FY NGFNAYWLMY  SDPS+R+KVS  F+ AS+HGLT+ARTWA
Sbjct  35   NEFITTKGVKMWLNGNPFYGNGFNAYWLMYEGSDPSERHKVSSVFQEASNHGLTIARTWA  94

Query  325  FSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWAR  504
            FSDGGYR LQY PG YNE +F+GLDFV++EA+KYG+K++LSL NNYE FGGKKQYV+WA+
Sbjct  95   FSDGGYRPLQYFPGFYNEQMFQGLDFVVSEAKKYGIKLVLSLVNNYEDFGGKKQYVEWAK  154

Query  505  GKGQYLTSDDDFFRNSLVKGF  567
             KG+ ++S+DDFF NS+VKGF
Sbjct  155  SKGESISSEDDFFTNSVVKGF  175



>ref|XP_007160733.1| hypothetical protein PHAVU_001G012600g [Phaseolus vulgaris]
 gb|ESW32727.1| hypothetical protein PHAVU_001G012600g [Phaseolus vulgaris]
Length=415

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +1

Query  142  GNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTW  321
            G+ F+K RG+  ++N   +YANG+NAYWLMY+ASDPSQR KV+ AF+ A++HGL++ARTW
Sbjct  29   GDEFVKVRGVQLVLNERPYYANGYNAYWLMYMASDPSQRNKVTSAFQVAANHGLSIARTW  88

Query  322  AFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWA  501
            AFSDGG R LQY+PGSYNED+F GLDFVI+EAR+YG K++LSL NNY++FGGKKQYV+WA
Sbjct  89   AFSDGGDRPLQYSPGSYNEDMFLGLDFVISEARRYGTKLVLSLVNNYDNFGGKKQYVEWA  148

Query  502  RGKGQYLTSDDDFFRNSLVKGF  567
            + +GQ L S+DDFF N LVKGF
Sbjct  149  KSEGQSLHSEDDFFTNPLVKGF  170



>ref|XP_004291857.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Fragaria 
vesca subsp. vesca]
Length=433

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 125/144 (87%), Gaps = 1/144 (1%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A + F+KT+G+ FM+NG  +YANGFNAYWLMY+ASDPSQR  VS AF+ AS +GLT+ART
Sbjct  26   AEDDFVKTKGVQFMLNGTPYYANGFNAYWLMYMASDPSQRNLVSSAFQQASKNGLTIART  85

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAF+DG YRALQY+PGSYNE  F+GLDFV++EARKYG+K++LSL N+YE+FGG+KQYV+W
Sbjct  86   WAFNDGDYRALQYSPGSYNEQSFQGLDFVVSEARKYGIKLVLSLVNSYENFGGRKQYVEW  145

Query  499  ARGKG-QYLTSDDDFFRNSLVKGF  567
            AR +G Q + S+DDFF NS+VKG+
Sbjct  146  ARSQGHQSINSEDDFFTNSVVKGY  169



>gb|KDP38537.1| hypothetical protein JCGZ_04462 [Jatropha curcas]
Length=431

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GF+ T+G+ FM+NG  FYANGFNAYWLMY A+DPS R KVS  F+ A +HGL +ART
Sbjct  25   AEDGFVTTKGVQFMLNGSPFYANGFNAYWLMYFANDPSTRNKVSSVFQEAKAHGLALART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAF+DG  RALQY+PGSYNE  F+GLDFVI+EA++ G+K++LSL NNYE+FGGKKQYV+W
Sbjct  85   WAFNDGQDRALQYSPGSYNEQAFQGLDFVISEAKRNGIKLVLSLVNNYENFGGKKQYVNW  144

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +GQ ++SDDDFF NS+VKGF
Sbjct  145  ARSQGQSVSSDDDFFTNSVVKGF  167



>gb|ACN78663.1| endo-beta-mannanase, partial [Malus domestica]
Length=428

 Score =   215 bits (548),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A  GF+KTRG+  ++NG  +Y +GFNAYWLMY+ +DPS+R KVS A R A  HGLT+ART
Sbjct  22   AEEGFMKTRGVQLLLNGVPYYGHGFNAYWLMYMGTDPSERVKVSSALREAKEHGLTIART  81

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAF+DGGYRALQ +PGSY+E  F+GLDFVI+EA+K G+KVILSL NNYE++GGKKQYV+W
Sbjct  82   WAFADGGYRALQTSPGSYDEKTFRGLDFVISEAKKSGIKVILSLVNNYENYGGKKQYVEW  141

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +GQ L+S+DDF+ NS VKGF
Sbjct  142  ARSQGQSLSSEDDFYTNSRVKGF  164



>ref|XP_007017589.1| Glycosyl hydrolase superfamily protein [Theobroma cacao]
 gb|EOY14814.1| Glycosyl hydrolase superfamily protein [Theobroma cacao]
Length=431

 Score =   215 bits (547),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GF+KT+G+  M++G  FYANGFNAYWLMY+A+DPSQR KVS AF+ A  HGL +ART
Sbjct  25   ADDGFVKTKGMQLMLDGSPFYANGFNAYWLMYMAADPSQRSKVSTAFQEAKQHGLNIART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAFSDGG R LQY+PGSYNE +F+GLDFV++EA++YG+K+ILS  NNY+ FGGKKQYV+W
Sbjct  85   WAFSDGGDRPLQYSPGSYNEQMFQGLDFVVSEAKRYGIKLILSFVNNYDQFGGKKQYVNW  144

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +GQ L SD+DFF NS+VK +
Sbjct  145  ARNQGQSLGSDEDFFTNSVVKEY  167



>gb|KJB58235.1| hypothetical protein B456_009G200500 [Gossypium raimondii]
 gb|KJB58236.1| hypothetical protein B456_009G200500 [Gossypium raimondii]
Length=431

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 126/154 (82%), Gaps = 1/154 (1%)
 Frame = +1

Query  106  QQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRG  285
            QQ +    VKA  + FIKT+G+  M++G  FYANGFNAYWLMY+A+D SQR KVS AF+ 
Sbjct  15   QQGNFLLRVKA-DDEFIKTKGLQLMLHGSPFYANGFNAYWLMYMAADSSQRSKVSSAFQQ  73

Query  286  ASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYE  465
            A  HGLT+ARTWAFSDGG R LQY+PGSYNE +F+GLDFV++EA++YG+K++LS ANNY+
Sbjct  74   AKEHGLTIARTWAFSDGGDRPLQYSPGSYNEQMFQGLDFVVSEAKRYGIKLVLSFANNYD  133

Query  466  SFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
             FGGKKQYV+WAR +GQ + SDDDFF NS+VK +
Sbjct  134  QFGGKKQYVNWARNEGQSIGSDDDFFTNSVVKEY  167



>ref|XP_006841527.1| hypothetical protein AMTR_s00003p00152240 [Amborella trichopoda]
 gb|ERN03202.1| hypothetical protein AMTR_s00003p00152240 [Amborella trichopoda]
Length=427

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GF+KT+GIHF++NG  FY NGFNAYWLM +ASDPS R KV+  F+ ASS+GLTVART
Sbjct  29   AQSGFVKTKGIHFIVNGSPFYVNGFNAYWLMQMASDPSTRGKVTSVFQQASSYGLTVART  88

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAFSDGGYR LQ +PGSYNED+F GLDFVI+EAR+YG+++ILS  NNY+  GG+ QYV W
Sbjct  89   WAFSDGGYRPLQISPGSYNEDMFNGLDFVISEARRYGVRLILSFVNNYKDLGGRPQYVQW  148

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            A  +GQ L SDDDF+ N +VKG+
Sbjct  149  AGNQGQSLNSDDDFYTNPVVKGY  171



>gb|ADN34185.1| endo-beta-mannanase [Cucumis melo subsp. melo]
Length=425

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GF++T+G   ++NG  FYANGFNAYWLMY ASDPS + KVS AF+ A  HGL++ RT
Sbjct  21   ADDGFVRTKGQQLILNGTPFYANGFNAYWLMYFASDPSLKPKVSSAFQQAVDHGLSIGRT  80

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAF+DGGY  LQY+PG YNE +F+GLDFV+AEARKYG+K+ILSL NNYES GGKKQYV+W
Sbjct  81   WAFNDGGYSPLQYSPGQYNEKMFQGLDFVVAEARKYGIKLILSLVNNYESMGGKKQYVEW  140

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +GQ ++S+D+FF N +VKGF
Sbjct  141  ARSQGQAISSEDEFFTNPVVKGF  163



>ref|XP_009406291.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Musa acuminata 
subsp. malaccensis]
Length=408

 Score =   212 bits (539),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 124/146 (85%), Gaps = 1/146 (1%)
 Frame = +1

Query  130  VKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTV  309
            V+AAG GFI+TRG+HF++NG  F+ANGFNAYW+M +ASDPS+R KVS A   AS HGL+V
Sbjct  21   VEAAG-GFIETRGLHFVLNGNPFFANGFNAYWMMTLASDPSRRDKVSSALSDASRHGLSV  79

Query  310  ARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQY  489
            ARTWAFSDGG  ALQ +PG+Y+E +F+GLDFV++EAR YG+K+ILSL NNY+SFGGKKQY
Sbjct  80   ARTWAFSDGGSNALQNSPGAYSEQIFQGLDFVVSEARNYGIKLILSLVNNYDSFGGKKQY  139

Query  490  VDWARGKGQYLTSDDDFFRNSLVKGF  567
            V WAR +G+ + SDD+FF N +VKG+
Sbjct  140  VQWARDQGENIGSDDEFFTNPVVKGY  165



>ref|XP_008466539.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Cucumis melo]
Length=476

 Score =   213 bits (542),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GF++T+G   ++NG  FYANGFNAYWLMY ASDPS + KVS AF+ A  HGL++ RT
Sbjct  72   ADDGFVRTKGQQLILNGTPFYANGFNAYWLMYFASDPSLKPKVSSAFQQAVDHGLSIGRT  131

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAF+DGGY  LQY+PG YNE +F+GLDFV+AEARKYG+K+ILSL NNYES GGKKQYV+W
Sbjct  132  WAFNDGGYSPLQYSPGQYNEKMFQGLDFVVAEARKYGIKLILSLVNNYESMGGKKQYVEW  191

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +GQ ++S+D+FF N +VKGF
Sbjct  192  ARSQGQAISSEDEFFTNPVVKGF  214



>ref|XP_011083658.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Sesamum indicum]
Length=425

 Score =   212 bits (539),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
             A +GFI     HF++NG  +Y +GFN+YWLMYVASDPSQR+K+S AF+ A++HGL +AR
Sbjct  42   TAEDGFITVEREHFILNGSRYYGHGFNSYWLMYVASDPSQRFKISSAFQQAANHGLEIAR  101

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVD  495
            TWAF DGG+  LQY+PGSYNE +F+GLDFV++EA KYG+K+ILSL NNYE  GGKKQYV+
Sbjct  102  TWAFRDGGFSPLQYSPGSYNEHMFQGLDFVVSEAGKYGIKLILSLVNNYEDSGGKKQYVN  161

Query  496  WARGKGQYLTSDDDFFRNSLVKGF  567
            WAR +GQ L+SDDDFF NS VKG+
Sbjct  162  WARNQGQNLSSDDDFFTNSAVKGY  185



>gb|EYU45796.1| hypothetical protein MIMGU_mgv1a0212341mg, partial [Erythranthe 
guttata]
Length=161

 Score =   203 bits (516),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 118/144 (82%), Gaps = 0/144 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
            A  + FI TRG  F++NG  FY NGFN+YWLMY+ASDPS R KV++ F  AS +G+ +AR
Sbjct  12   ARDDNFIGTRGSQFVMNGRPFYFNGFNSYWLMYMASDPSTRDKVTDTFAQASEYGMNLAR  71

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVD  495
            TWAFSDGGYRALQ +PGSYNED+FKGLDFV+AEA+K+G+ ++L+L NN+E FGGK+QYV 
Sbjct  72   TWAFSDGGYRALQTSPGSYNEDMFKGLDFVVAEAKKHGIYLLLTLVNNWEGFGGKRQYVQ  131

Query  496  WARGKGQYLTSDDDFFRNSLVKGF  567
            WA+ KG YL +DDDFF NS+VK +
Sbjct  132  WAKDKGHYLNNDDDFFTNSIVKQY  155



>ref|XP_009407087.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 9 [Musa 
acuminata subsp. malaccensis]
Length=395

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 117/144 (81%), Gaps = 0/144 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
            AA + F KTRG HF+I+   FY+NGFN+YWLMY A+DP+++ KVS A   AS+ GL V R
Sbjct  12   AADDDFAKTRGTHFVIDDRPFYSNGFNSYWLMYTAADPAEKDKVSSALEQASTLGLRVIR  71

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVD  495
            TWAFSDGGYR LQY+PG YNE++FK LDFVI+EA+KYG+ +ILSL NN+E FGGKKQYV 
Sbjct  72   TWAFSDGGYRPLQYSPGVYNENMFKALDFVISEAKKYGVHLILSLVNNWEGFGGKKQYVQ  131

Query  496  WARGKGQYLTSDDDFFRNSLVKGF  567
            WAR KGQYL S+DDFFRN +VK F
Sbjct  132  WARDKGQYLGSEDDFFRNEVVKQF  155



>ref|XP_008797528.1| PREDICTED: LOW QUALITY PROTEIN: mannan endo-1,4-beta-mannosidase 
1-like [Phoenix dactylifera]
Length=430

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 122/146 (84%), Gaps = 1/146 (1%)
 Frame = +1

Query  130  VKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTV  309
            V+A G+ FI+T G+ F++NG  F+ANGFNAYWL Y+ASDPSQ YKVS AFR A+S GL+V
Sbjct  21   VEAKGS-FIRTNGLQFVLNGSPFFANGFNAYWLTYMASDPSQSYKVSNAFREATSRGLSV  79

Query  310  ARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQY  489
            ARTWAF+DGG  ALQY+PGSYNE +FK LDFV++EA KY +++ILSL NNY+SFGGKKQY
Sbjct  80   ARTWAFNDGGSAALQYSPGSYNEQMFKSLDFVVSEAGKYNIRLILSLVNNYDSFGGKKQY  139

Query  490  VDWARGKGQYLTSDDDFFRNSLVKGF  567
            V WAR +GQ + SDD+FF N +VKGF
Sbjct  140  VQWARNQGQNIASDDEFFTNPVVKGF  165



>gb|KGN59983.1| hypothetical protein Csa_3G859700 [Cucumis sativus]
Length=425

 Score =   210 bits (534),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 116/140 (83%), Gaps = 0/140 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF+ T+G   ++NG  FYANGFNAYWLMY ASDPSQ  KVS AF+ A +HGL++ RTWAF
Sbjct  24   GFVSTKGQQLILNGSPFYANGFNAYWLMYFASDPSQAPKVSSAFQQAVNHGLSIGRTWAF  83

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARG  507
            +DGGY  LQY+PG YNE +F+GLDFV+AEARKYG+K+ILSL NNY S GGKKQYV+WAR 
Sbjct  84   NDGGYSPLQYSPGQYNEKMFQGLDFVVAEARKYGIKLILSLVNNYASMGGKKQYVEWARS  143

Query  508  KGQYLTSDDDFFRNSLVKGF  567
            +GQ ++S+D+FF N +VKGF
Sbjct  144  QGQAISSEDEFFTNPVVKGF  163



>ref|XP_004147857.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Cucumis sativus]
Length=424

 Score =   209 bits (533),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 116/140 (83%), Gaps = 0/140 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF+ T+G   ++NG  FYANGFNAYWLMY ASDPSQ  KVS AF+ A +HGL++ RTWAF
Sbjct  23   GFVSTKGQQLILNGSPFYANGFNAYWLMYFASDPSQAPKVSSAFQQAVNHGLSIGRTWAF  82

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARG  507
            +DGGY  LQY+PG YNE +F+GLDFV+AEARKYG+K+ILSL NNY S GGKKQYV+WAR 
Sbjct  83   NDGGYSPLQYSPGQYNEKMFQGLDFVVAEARKYGIKLILSLVNNYASMGGKKQYVEWARS  142

Query  508  KGQYLTSDDDFFRNSLVKGF  567
            +GQ ++S+D+FF N +VKGF
Sbjct  143  QGQAISSEDEFFTNPVVKGF  162



>ref|XP_004154850.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Cucumis sativus]
Length=425

 Score =   209 bits (533),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 116/140 (83%), Gaps = 0/140 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF+ T+G   ++NG  FYANGFNAYWLMY ASDPSQ  KVS AF+ A +HGL++ RTWAF
Sbjct  24   GFVSTKGQQLILNGSPFYANGFNAYWLMYFASDPSQAPKVSSAFQQAVNHGLSIGRTWAF  83

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARG  507
            +DGGY  LQY+PG YNE +F+GLDFV+AEARKYG+K+ILSL NNY S GGKKQYV+WAR 
Sbjct  84   NDGGYSPLQYSPGQYNEKMFQGLDFVVAEARKYGIKLILSLVNNYASMGGKKQYVEWARS  143

Query  508  KGQYLTSDDDFFRNSLVKGF  567
            +GQ ++S+D+FF N +VKGF
Sbjct  144  QGQAISSEDEFFTNPVVKGF  163



>ref|XP_009365529.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Pyrus x bretschneideri]
Length=429

 Score =   209 bits (533),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GF+KTRG+  ++NG  +Y +GFNAYWLMY+ +DPS+R KVS A R A  HGLT+ART
Sbjct  23   AEDGFMKTRGVQLVLNGVPYYGHGFNAYWLMYMGTDPSERVKVSSALREAKEHGLTIART  82

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAF+DGGYRALQ +PGSY+E  F+GLDFVI+EA+K G+K+ILSL NNY ++GGKKQYV+W
Sbjct  83   WAFADGGYRALQTSPGSYDERTFRGLDFVISEAKKNGIKLILSLVNNYYNYGGKKQYVEW  142

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +GQ L+S+DDF+ N LVKGF
Sbjct  143  ARSQGQSLSSEDDFYTNFLVKGF  165



>ref|XP_009602297.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Nicotiana 
tomentosiformis]
Length=419

 Score =   209 bits (532),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  145  NGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWA  324
            +GFI T+ +HFM+N   FYANGFNAYWLMY+ASD SQR KVS AF+ A++HGLTV RTWA
Sbjct  24   DGFITTKDVHFMLNDSPFYANGFNAYWLMYIASDSSQRDKVSSAFQEAANHGLTVGRTWA  83

Query  325  FSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWAR  504
            FSDGGY  LQY PGSYNE +F+GLDF I+EA K G+K+ILSLANNY+ FGG+KQYV+WA+
Sbjct  84   FSDGGYSPLQYYPGSYNEKMFQGLDFAISEAGKNGMKLILSLANNYKDFGGRKQYVEWAK  143

Query  505  GKGQYLTSDDDFFRNSLVKGF  567
             +G+ L S+DDFF N++VKG+
Sbjct  144  SQGESLQSEDDFFSNNVVKGY  164



>ref|XP_011085841.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 9 [Sesamum 
indicum]
Length=400

 Score =   209 bits (531),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +1

Query  133  KAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVA  312
            +A   GF+ TRG  F++NG  FY NGFN+YWLMY+ASDPS R KVS+ F  A+ +G+ VA
Sbjct  23   RAVRGGFVGTRGSQFVVNGRPFYFNGFNSYWLMYMASDPSTRVKVSDTFVQAAKYGMNVA  82

Query  313  RTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYV  492
            RTWAFSDGGYRALQ APGSYNED+FKGLDFV++EA+K+G+ +ILSL NN+E FGGKKQYV
Sbjct  83   RTWAFSDGGYRALQTAPGSYNEDMFKGLDFVVSEAKKHGIYLILSLVNNWEGFGGKKQYV  142

Query  493  DWARGKGQYLTSDDDFFRNSLVKGF  567
             WAR +GQYL ++D+FF N +VK +
Sbjct  143  QWARERGQYLNNEDEFFTNPIVKNY  167



>ref|XP_006342222.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Solanum tuberosum]
Length=413

 Score =   208 bits (529),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = +1

Query  142  GNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTW  321
             + FIKT+G+HFM+N   FYANGFNAYWLM + SDPSQR+KVS   + A+SHGLTV RTW
Sbjct  23   NDDFIKTKGVHFMLNESPFYANGFNAYWLMLIGSDPSQRHKVSSVLQDAASHGLTVGRTW  82

Query  322  AFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWA  501
            AFSD GY  LQ++PG YNE++F+GLD+ I EA K G+K+ILSL NNY  FGGK QYV+WA
Sbjct  83   AFSDAGYSPLQFSPGVYNENMFQGLDYAIHEAGKNGIKLILSLVNNYNDFGGKNQYVNWA  142

Query  502  RGKGQYLTSDDDFFRNSLVKGF  567
            + +GQ LTSDDDF+ NS+VKG+
Sbjct  143  KSQGQSLTSDDDFYTNSVVKGY  164



>emb|CDP07490.1| unnamed protein product [Coffea canephora]
Length=426

 Score =   207 bits (528),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 123/156 (79%), Gaps = 0/156 (0%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
            F+  +  + S  +A + FI+T G+ F+  G  FYANGFNAYWLM   SDPS++ KVS AF
Sbjct  14   FLIHNRRTSSEVSAQDEFIRTEGVQFLEEGSPFYANGFNAYWLMIFGSDPSKQNKVSTAF  73

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
              A SHGLTVARTWAF+DGG   LQ++PG+YNE +F+GLD VI+EARKYG+++ILSL NN
Sbjct  74   EEAVSHGLTVARTWAFNDGGDFPLQFSPGNYNEKMFQGLDLVISEARKYGIRLILSLVNN  133

Query  460  YESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            Y++FGGKKQYVDWAR KG+ L SDDDFF N++VKG+
Sbjct  134  YDNFGGKKQYVDWARSKGENLNSDDDFFTNAVVKGY  169



>ref|XP_006644473.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Oryza brachyantha]
Length=430

 Score =   207 bits (527),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 121/143 (85%), Gaps = 1/143 (1%)
 Frame = +1

Query  142  GNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTW  321
            G+GF++ +G  F++NG  +YANGFNAYWLM +A+DPSQR KV+ A   A+ HGLTVARTW
Sbjct  34   GDGFVRAQGTRFVLNGSPYYANGFNAYWLMSMAADPSQRGKVTAALSEAAGHGLTVARTW  93

Query  322  AFSDGG-YRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            AFSDGG   ALQY+PG+YNE+ FKGLDFV++EARKYG+KVILSL N+Y+SFGG+KQYV+W
Sbjct  94   AFSDGGGTNALQYSPGNYNENTFKGLDFVLSEARKYGIKVILSLVNSYDSFGGRKQYVNW  153

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +GQ + SDD+FF N +VKGF
Sbjct  154  ARAQGQGIGSDDEFFTNPVVKGF  176



>ref|XP_004238284.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Solanum lycopersicum]
Length=413

 Score =   206 bits (525),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 119/149 (80%), Gaps = 2/149 (1%)
 Frame = +1

Query  127  SVKA--AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHG  300
            +VKA    + FIKT+G+HFM+N   FYANGFNAYWLM + SDPSQR+KVS  F+ A++HG
Sbjct  16   NVKANVINDDFIKTKGVHFMLNDSPFYANGFNAYWLMLIGSDPSQRHKVSSVFQDAANHG  75

Query  301  LTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGK  480
            LTV RTWAFSD GY  LQ++PG YNE +F+GLD+ I EA K G+K+ILSL NNY  FGGK
Sbjct  76   LTVGRTWAFSDAGYSPLQFSPGFYNEIMFQGLDYAIHEAGKNGIKLILSLVNNYNDFGGK  135

Query  481  KQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
             QYV+WA+ +GQ LTSDDDF+ NS+VKG+
Sbjct  136  NQYVNWAKSQGQSLTSDDDFYTNSVVKGY  164



>ref|XP_002515142.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF47126.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=404

 Score =   206 bits (523),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +1

Query  151  FIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFS  330
            F KT G HF++N  + Y NGFNAYW+MY+ASDPS R KV+ AF+ A+ +G+ +ARTWAFS
Sbjct  36   FAKTNGTHFVMNNKSLYLNGFNAYWMMYMASDPSTREKVTSAFQQAAKNGMNIARTWAFS  95

Query  331  DGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARGK  510
            DGGYRALQ +PGSYN+D+FKGLDFVI+EARKYG+ VIL L NNY+ FGG+ QYV WAR +
Sbjct  96   DGGYRALQISPGSYNQDMFKGLDFVISEARKYGIYVILCLVNNYKDFGGRPQYVQWARER  155

Query  511  GQYLTSDDDFFRNSLVKGF  567
            GQ LT+DDDF+ N +VK +
Sbjct  156  GQQLTADDDFYTNPIVKAY  174



>gb|KDO84614.1| hypothetical protein CISIN_1g014426mg [Citrus sinensis]
Length=425

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GFI  +G+H M+NG  FYANGFNAYWLM   ++P  + KVS  F+ A  HGL++ART
Sbjct  19   ADDGFITAKGVHLMLNGSPFYANGFNAYWLMNTGANPYLKDKVSSVFQQAKEHGLSMART  78

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAFSDGG   LQY+PGSYNE +F+GLDFVI+EARKYG+K++LS+ NNY+ FGGKKQYV+W
Sbjct  79   WAFSDGGDSPLQYSPGSYNEQMFQGLDFVISEARKYGIKLVLSMVNNYDQFGGKKQYVNW  138

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            ARG+GQ ++SDDDFF NS+VK +
Sbjct  139  ARGQGQSISSDDDFFTNSVVKQY  161



>emb|CAC08442.1| (1-4)-beta-mannan endohydrolase [Coffea arabica]
Length=416

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = +1

Query  154  IKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFSD  333
            +KTRG  F++NG   Y NGFNAYWLMY+ASDPS R KVS  F+ AS +G+  ARTWAFSD
Sbjct  45   VKTRGTEFVMNGRPLYLNGFNAYWLMYMASDPSTRTKVSTTFQQASKYGMNAARTWAFSD  104

Query  334  GGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARGKG  513
            GGYRALQ +PGSYNED+FKGLDFV++EA+KYG+ +IL+L NN+E +GGKKQYV WAR +G
Sbjct  105  GGYRALQQSPGSYNEDMFKGLDFVVSEAKKYGIHLILTLVNNWEGYGGKKQYVQWARDQG  164

Query  514  QYLTSDDDFFRNSLVKGF  567
             YL +DDDFF + +V+G+
Sbjct  165  HYLNNDDDFFTDPIVRGY  182



>ref|XP_009785219.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Nicotiana 
sylvestris]
Length=419

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = +1

Query  145  NGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWA  324
            +GFI T+ +HFM+N   FYANGFNAYWLMY+ASD SQR KVS A + A++HGLTV RTWA
Sbjct  24   DGFITTKDVHFMLNESPFYANGFNAYWLMYIASDSSQRDKVSSALQEAANHGLTVGRTWA  83

Query  325  FSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWAR  504
            FSDGGY  LQY PGSYNE +F+GLDF I+EA K G+K+ILSL NNY+ FGG+KQYV+WA+
Sbjct  84   FSDGGYSPLQYYPGSYNEKMFQGLDFAISEAGKNGIKLILSLVNNYKDFGGRKQYVEWAK  143

Query  505  GKGQYLTSDDDFFRNSLVKGF  567
             +G+ L S+DDFF N++VKG+
Sbjct  144  SQGESLQSEDDFFSNNVVKGY  164



>ref|XP_006473535.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Citrus sinensis]
Length=425

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GFI  +G+H M+NG  FYANGFNAYWLM   ++P  + KVS  F+ A  HGL++ART
Sbjct  19   ADDGFITAKGVHLMLNGSPFYANGFNAYWLMNTGANPYLKDKVSSVFQQAKEHGLSMART  78

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAFSDGG   LQY+PGSYNE +F+GLDFVI+EARKYG+K++LS+ NNY+ FGGKKQYV+W
Sbjct  79   WAFSDGGDSPLQYSPGSYNEQMFQGLDFVISEARKYGIKLVLSMVNNYDQFGGKKQYVNW  138

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            ARG+GQ ++SDDDFF NS+VK +
Sbjct  139  ARGQGQSISSDDDFFTNSVVKQY  161



>emb|CDP19235.1| unnamed protein product [Coffea canephora]
Length=416

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = +1

Query  154  IKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFSD  333
            +KTRG  F++NG   Y NGFNAYWLMY+ASDPS R KVS  F+ AS +G+  ARTWAFSD
Sbjct  45   VKTRGTEFVMNGRPLYLNGFNAYWLMYMASDPSTRTKVSTTFQQASKYGMNAARTWAFSD  104

Query  334  GGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARGKG  513
            GGYRALQ +PGSYNED+FKGLDFV++EA+KYG+ +IL+L NN+E +GGKKQYV WAR +G
Sbjct  105  GGYRALQQSPGSYNEDMFKGLDFVVSEAKKYGIHLILTLVNNWEGYGGKKQYVQWARDQG  164

Query  514  QYLTSDDDFFRNSLVKGF  567
             YL +DDDFF + +V+G+
Sbjct  165  HYLNNDDDFFTDPIVRGY  182



>gb|KHN12693.1| Mannan endo-1,4-beta-mannosidase 7 [Glycine soja]
Length=389

 Score =   204 bits (518),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  MINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFSDGGYRALQY  357
            M+NG  +YANG+NAYWLMY+ASDPSQR KVS  F+  ++HGL +ARTWAFSDGGY+ LQY
Sbjct  1    MLNGSPYYANGYNAYWLMYMASDPSQRNKVSSVFQKGTNHGLNIARTWAFSDGGYKPLQY  60

Query  358  APGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARGKGQYLTSDDD  537
            +PG YNED+F GLDFVI+EAR+YG K++LSL NNY++FGGKKQYVDWAR +GQ + S+DD
Sbjct  61   SPGFYNEDLFLGLDFVISEARRYGTKLVLSLVNNYDNFGGKKQYVDWARSEGQTIDSEDD  120

Query  538  FFRNSLVKGF  567
            FF N +VKG+
Sbjct  121  FFTNPIVKGY  130



>ref|XP_006435034.1| hypothetical protein CICLE_v10001262mg [Citrus clementina]
 gb|ESR48274.1| hypothetical protein CICLE_v10001262mg [Citrus clementina]
Length=425

 Score =   204 bits (520),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GFI  +G+H M+NG  FYANGFNAYWLM   ++P  + KVS  F+ A  HGL++ART
Sbjct  19   ADDGFITAKGVHLMLNGSPFYANGFNAYWLMNTGANPYLKDKVSSVFQQAKEHGLSMART  78

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAFSDGG   LQY+PGSYNE +F+GLDFVI+EARKYG+K++LS+ NNY+ FGGKKQYV W
Sbjct  79   WAFSDGGDSPLQYSPGSYNEQMFQGLDFVISEARKYGIKLVLSMVNNYDQFGGKKQYVIW  138

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            ARG+GQ ++SDDDFF NS+VK +
Sbjct  139  ARGQGQSISSDDDFFTNSVVKQY  161



>ref|XP_009122559.1| PREDICTED: mannan endo-1,4-beta-mannosidase 3-like [Brassica 
rapa]
 emb|CDY36280.1| BnaA01g31380D [Brassica napus]
Length=415

 Score =   204 bits (518),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 118/148 (80%), Gaps = 0/148 (0%)
 Frame = +1

Query  124  GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGL  303
            G   A+GNGF++ +G+ F++NG  FYANGFNAYWL Y A+DP+ R+K++ AF+ A+SHGL
Sbjct  22   GVEAASGNGFVRRKGVQFILNGKPFYANGFNAYWLTYEATDPATRFKITYAFQNATSHGL  81

Query  304  TVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKK  483
            TVARTW F DGGYRALQ APG Y+E  F+GLDF IAEA++ G+K+I++  NNY  FGG+K
Sbjct  82   TVARTWGFRDGGYRALQTAPGRYDELTFQGLDFAIAEAKRLGIKMIITFVNNYSDFGGRK  141

Query  484  QYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            QYV+WA+ +GQ + S+DDF+ N LVK F
Sbjct  142  QYVEWAKSQGQVVNSEDDFYTNPLVKQF  169



>ref|XP_011007449.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Populus euphratica]
Length=406

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GFI+T+G+ F++NG  FYANGFNAYWLMY A+D SQR KV+  F+ A  HGLT+ART
Sbjct  25   ADDGFIRTKGVQFLLNGSPFYANGFNAYWLMYFATDTSQRDKVTSVFQDAKQHGLTLART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAF+DG  RALQ +PG YNE  F+GLDFVI+EA+K G+K+ILSL NNYE+FGG++QYV+W
Sbjct  85   WAFNDGQDRALQVSPGYYNEQTFQGLDFVISEAKKNGIKLILSLVNNYENFGGRQQYVNW  144

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            A  +GQ ++S DDF+ NS+VKG+
Sbjct  145  ASSQGQSISSLDDFYTNSIVKGY  167



>ref|XP_003569504.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1 [Brachypodium distachyon]
Length=417

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 121/146 (83%), Gaps = 1/146 (1%)
 Frame = +1

Query  133  KAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVA  312
            +AAG GF++ +G  F+ING  +YANGFNAYWLM +A+DP+QR KV+     A++ GL+VA
Sbjct  20   EAAGGGFVRAQGTRFVINGSPYYANGFNAYWLMTMAADPAQRGKVTSTLSQAAARGLSVA  79

Query  313  RTWAFSDGGYR-ALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQY  489
            RTWAFSDGG   ALQY+PG+YNE+ FKGLDFV++E RK+ +KVILSL NNY+SFGGKKQY
Sbjct  80   RTWAFSDGGSNNALQYSPGNYNENTFKGLDFVLSEVRKHEVKVILSLVNNYDSFGGKKQY  139

Query  490  VDWARGKGQYLTSDDDFFRNSLVKGF  567
            V+WAR +GQ + SDD+FF N++VKGF
Sbjct  140  VNWARAQGQAIGSDDEFFTNAVVKGF  165



>ref|XP_002306881.1| hypothetical protein POPTR_0005s25120g [Populus trichocarpa]
 gb|EEE93877.1| hypothetical protein POPTR_0005s25120g [Populus trichocarpa]
Length=420

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GFI+T+G+ F++NG  FYANGFN YWLMY A+D SQR KV+  F+ A  HGLT+ART
Sbjct  25   ADDGFIRTKGVQFLLNGSPFYANGFNGYWLMYFATDTSQRDKVTSVFQDAKQHGLTLART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAF+DG  RALQ +PG YNE  F+GLDFVI+EA+K G+K+ILSL NNYE+FGG+KQYV+W
Sbjct  85   WAFNDGQDRALQVSPGHYNEQTFQGLDFVISEAKKNGIKLILSLVNNYENFGGRKQYVNW  144

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            A  +GQ ++S DDF+ NS+VKG+
Sbjct  145  ASSQGQSISSLDDFYTNSVVKGY  167



>ref|XP_009416732.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Musa acuminata 
subsp. malaccensis]
Length=426

 Score =   202 bits (514),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +1

Query  130  VKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTV  309
            V+AAG  FI   G+HF++NG  F+ANGFNAYWLM +ASDPSQR KVS A   ASSH L+V
Sbjct  18   VEAAGGEFIGISGLHFVLNGNPFFANGFNAYWLMTLASDPSQRDKVSSALSDASSHELSV  77

Query  310  ARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQY  489
            ARTWAFSDGG  ALQY+PGSYNE  F+GLDFV++EA KYG+++ILSL N+Y+++GG+KQY
Sbjct  78   ARTWAFSDGGSNALQYSPGSYNEQTFQGLDFVVSEAGKYGIRLILSLVNSYDNYGGRKQY  137

Query  490  VDWARGKGQYLTSDDDFFRNSLVKGF  567
            V WAR +G  + S+D+FF + +VKG+
Sbjct  138  VQWARDQGHEIGSEDEFFTDPVVKGY  163



>gb|EYU45780.1| hypothetical protein MIMGU_mgv1a025011mg [Erythranthe guttata]
Length=394

 Score =   201 bits (512),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 118/148 (80%), Gaps = 0/148 (0%)
 Frame = +1

Query  124  GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGL  303
            G  + A + FI TRG  F++NG  FY NGFN+YWLMY+ASDPS R KV++ F  AS +G+
Sbjct  5    GEAEGARDNFIGTRGSQFVMNGRPFYFNGFNSYWLMYMASDPSTRDKVTDTFAQASKYGM  64

Query  304  TVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKK  483
             +ARTWAFSDGGYRALQ +PG YN+D+FKGLDFV++EA+K+G+ ++LSL NN+E FGGK+
Sbjct  65   NLARTWAFSDGGYRALQTSPGVYNDDMFKGLDFVVSEAKKHGIYLLLSLVNNWEGFGGKR  124

Query  484  QYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            QYV WA+ KG YL +DDDFF N +VK +
Sbjct  125  QYVQWAKDKGHYLNNDDDFFTNPIVKDY  152



>ref|XP_006441716.1| hypothetical protein CICLE_v10023981mg, partial [Citrus clementina]
 gb|ESR54956.1| hypothetical protein CICLE_v10023981mg, partial [Citrus clementina]
Length=400

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = +1

Query  121  SGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHG  300
            S     A  GF++TRG  F++NG  F  NGFN+YW+M VAS PSQRYKVS+ FR A++ G
Sbjct  1    SAQTLPAQAGFVQTRGTQFVLNGSPFLFNGFNSYWMMNVASQPSQRYKVSDVFRQAAAAG  60

Query  301  LTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGK  480
            L+V RTWAFSDGGY ALQ +PG YNE VF+GLDFVI+EARKYG+++ILSL+NNY  FGG+
Sbjct  61   LSVCRTWAFSDGGYGALQQSPGVYNEPVFQGLDFVISEARKYGIRLILSLSNNYHDFGGR  120

Query  481  KQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
             QYV+WAR  G  + SDD+F+ N++VKG+
Sbjct  121  PQYVNWARAAGASVNSDDEFYTNAIVKGY  149



>gb|KDO45466.1| hypothetical protein CISIN_1g016140mg [Citrus sinensis]
Length=394

 Score =   201 bits (511),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = +1

Query  121  SGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHG  300
            S     A  GF++TRG  F++NG  F  NGFN+YW+M VAS PSQRYKVS+ FR A++ G
Sbjct  22   SAQTLPAQAGFVQTRGTQFVLNGSPFLFNGFNSYWMMNVASQPSQRYKVSDVFRQAAAAG  81

Query  301  LTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGK  480
            L+V RTWAFSDGGY ALQ +PG YNE VF+GLDFVI+EARKYG+++ILSL+NNY  FGG+
Sbjct  82   LSVCRTWAFSDGGYGALQQSPGVYNEPVFQGLDFVISEARKYGIRLILSLSNNYHDFGGR  141

Query  481  KQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
             QYV+WAR  G  + SDD+F+ N++VKG+
Sbjct  142  PQYVNWARAAGASVNSDDEFYTNAIVKGY  170



>gb|ABF69949.1| (1-4)-beta-mannan endohydrolase (mannan endo-1,4-beta-mannosidase), 
putative [Musa acuminata]
Length=428

 Score =   202 bits (513),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +1

Query  130  VKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTV  309
            V+AAG  FI   G+HF++NG  F+ANGFNAYWLM +ASDPSQR KVS A   ASSH L+V
Sbjct  18   VEAAGGEFIGISGLHFVLNGNPFFANGFNAYWLMTLASDPSQRDKVSSALSDASSHELSV  77

Query  310  ARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQY  489
            ARTWAFSDGG  ALQY+PGSYNE  F+GLDFV++EA KYG+++ILSL N+Y+++GG+KQY
Sbjct  78   ARTWAFSDGGSNALQYSPGSYNEQTFQGLDFVVSEAGKYGIRLILSLVNSYDNYGGRKQY  137

Query  490  VDWARGKGQYLTSDDDFFRNSLVKGF  567
            V WAR +G  + S+D+FF + +VKG+
Sbjct  138  VQWARDQGHEIGSEDEFFTDPVVKGY  163



>ref|XP_006407494.1| hypothetical protein EUTSA_v10020842mg [Eutrema salsugineum]
 gb|ESQ48947.1| hypothetical protein EUTSA_v10020842mg [Eutrema salsugineum]
Length=408

 Score =   201 bits (510),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = +1

Query  124  GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGL  303
            G   A+ + F+  +G+ F++NG  FYANGFNAYWL Y A+DP+ R+KV+ A + A+ HGL
Sbjct  22   GVESASSDAFVSRKGLQFILNGKPFYANGFNAYWLTYEATDPATRFKVTFALQNATIHGL  81

Query  304  TVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKK  483
            T+ARTW F DGGYRALQ APGSYNE  F+GLDF IAEA++ G+K+I++  NNY  FGG+K
Sbjct  82   TIARTWGFHDGGYRALQTAPGSYNELAFQGLDFAIAEAKRLGIKMIITFVNNYSDFGGRK  141

Query  484  QYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            QYVDWA+ KGQ +TS+DDF+ N LVK F
Sbjct  142  QYVDWAKSKGQSVTSEDDFYTNPLVKQF  169



>ref|XP_004969435.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Setaria italica]
Length=428

 Score =   201 bits (511),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 118/144 (82%), Gaps = 0/144 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
            A G+GF++ +G  F++NG  F+ANGFNAYWLM + +DP+QR KV+ A   A+  GLTVAR
Sbjct  24   ARGDGFVRVQGTRFVLNGSPFFANGFNAYWLMSLGADPAQRGKVTSALSQAAGAGLTVAR  83

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVD  495
            TWAFSDGG  ALQY+PG YNE+ F+GLDFV++EARK+G+K+ILSL N+Y+SFGG+KQYV 
Sbjct  84   TWAFSDGGSNALQYSPGRYNENTFQGLDFVLSEARKHGIKMILSLVNSYDSFGGRKQYVQ  143

Query  496  WARGKGQYLTSDDDFFRNSLVKGF  567
            WAR +GQ + SDD+FF N +VKGF
Sbjct  144  WAREQGQSIGSDDEFFTNPVVKGF  167



>gb|EYU45779.1| hypothetical protein MIMGU_mgv1a020287mg [Erythranthe guttata]
Length=392

 Score =   200 bits (508),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 118/148 (80%), Gaps = 0/148 (0%)
 Frame = +1

Query  124  GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGL  303
            G  + A   FI TRG  F++NG +FY NGFN+YWLMY+ASDPS + KV++ F  AS +G+
Sbjct  5    GEAEVAREDFIGTRGSQFVMNGRSFYFNGFNSYWLMYMASDPSTKVKVTDTFAQASEYGM  64

Query  304  TVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKK  483
             +ARTWAFSDGGYRALQ +PG YNED+FKGLDFV++EA+K+G+ ++L+L NN+E FGGK+
Sbjct  65   NLARTWAFSDGGYRALQTSPGLYNEDMFKGLDFVVSEAKKHGIYLLLTLVNNWEGFGGKR  124

Query  484  QYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            QYV WA+ +G YL +DDDFF N +VK +
Sbjct  125  QYVQWAKDQGHYLNNDDDFFTNPIVKQY  152



>ref|XP_010914840.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 9 [Elaeis 
guineensis]
Length=425

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  151  FIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFS  330
            F+ T G  F++NG  FY+NGFNAYWLMY+ASDP+ R KVS AF+ ASSHG+ V RTWAFS
Sbjct  32   FVTTNGTGFVMNGRPFYSNGFNAYWLMYMASDPAGRSKVSSAFQQASSHGMKVVRTWAFS  91

Query  331  DGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARGK  510
            DGG++ALQ +PGSY+E++F+GLDFVI+EARKYG+ +ILSL NN+E FGGK+QYV WAR +
Sbjct  92   DGGHKALQCSPGSYDENMFQGLDFVISEARKYGVYLILSLVNNHEDFGGKRQYVRWARDE  151

Query  511  GQYLTSDDDFFRNSLVKGF  567
            G+   SDDDFF+N +VK F
Sbjct  152  GRSTGSDDDFFQNDVVKSF  170



>gb|EYU45794.1| hypothetical protein MIMGU_mgv1a011066mg [Erythranthe guttata]
Length=293

 Score =   197 bits (500),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 116/151 (77%), Gaps = 0/151 (0%)
 Frame = +1

Query  115  SLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASS  294
            +  G  + A   F+ TRG  F++NG  FY NGFN+YWLMY+ASDP  + KV+E F  AS 
Sbjct  18   ACGGEARLARESFVGTRGTQFVVNGRPFYFNGFNSYWLMYMASDPLTKEKVTETFAQASE  77

Query  295  HGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFG  474
            +G+ +ARTWAFSDGG R LQ +PG YNED+FKGLDFV++EA+K+G+ +ILSL NN+E +G
Sbjct  78   YGMNLARTWAFSDGGNRPLQKSPGLYNEDMFKGLDFVVSEAKKHGIYLILSLVNNWEGYG  137

Query  475  GKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            GKKQYV WAR +GQ L ++DDFF N +VKG+
Sbjct  138  GKKQYVQWARDQGQNLNNEDDFFTNPIVKGY  168



>ref|XP_008799989.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 9 [Phoenix 
dactylifera]
Length=424

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 115/140 (82%), Gaps = 0/140 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF+ T G  F++NG  FYANGFNAYWLM +AS+P+ R KVS AF+ ASSHG+TV RTWAF
Sbjct  28   GFVTTNGTGFVVNGRPFYANGFNAYWLMDMASEPAGRSKVSSAFQQASSHGMTVVRTWAF  87

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARG  507
            SDGG++ALQ +PGSY++D+F+GLDFVI+EARKYG+ +ILSL NN+E +GGKKQYV WAR 
Sbjct  88   SDGGHQALQRSPGSYDDDMFEGLDFVISEARKYGVYLILSLVNNHEDYGGKKQYVQWARD  147

Query  508  KGQYLTSDDDFFRNSLVKGF  567
             GQ   SDDDFF N +VK F
Sbjct  148  MGQAAGSDDDFFWNDVVKTF  167



>ref|XP_004303778.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Fragaria 
vesca subsp. vesca]
Length=418

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 119/149 (80%), Gaps = 1/149 (1%)
 Frame = +1

Query  124  GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGL  303
            G  +AA + F +T+G HF +NG +FY NGFNAYW+MY+ASDP  R KV+  F+ AS +G+
Sbjct  27   GETQAASSSFAQTQGNHFFMNGRSFYLNGFNAYWMMYMASDPYTRAKVTSVFQQASRYGM  86

Query  304  TVARTWAFSDG-GYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGK  480
             +ARTWAFSDG  YR LQ +PGSYNED+FKGLDFVI+EAR YG+ VILSL NN++ +GG+
Sbjct  87   NIARTWAFSDGVSYRPLQSSPGSYNEDMFKGLDFVISEARNYGVHVILSLVNNFDDYGGR  146

Query  481  KQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            KQYV WA+ +GQ + +DDDF+ N++VKG+
Sbjct  147  KQYVQWAKERGQAINNDDDFYNNTVVKGY  175



>pdb|1RH9|A Chain A, Family Gh5 Endo-Beta-Mannanase From Lycopersicon Esculentum 
(Tomato)
Length=373

 Score =   198 bits (504),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 112/143 (78%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            + N F+ T G HF +NG + Y NGFNAYWLMY+A DPS R KV+  F+ AS + + VART
Sbjct  2    SNNNFVYTDGTHFALNGKSLYINGFNAYWLMYIAYDPSTRIKVTNTFQQASKYKMNVART  61

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAFS GG R LQ APG YNE +F+GLDFVI+EA+KYG+ +I+SL NN+++FGGKKQYV+W
Sbjct  62   WAFSHGGSRPLQSAPGVYNEQMFQGLDFVISEAKKYGIHLIMSLVNNWDAFGGKKQYVEW  121

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            A  +GQ LTSDDDFF N +VKGF
Sbjct  122  AVQRGQKLTSDDDFFTNPMVKGF  144



>ref|XP_002884818.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61077.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=415

 Score =   199 bits (505),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = +1

Query  106  QQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRG  285
            Q SS  G    + +GF+  +G+ F++NG  FYANGFNAYWL Y A+DP+ R+K++  F+ 
Sbjct  16   QNSSYLGVKAVSSDGFVSRKGVQFILNGKPFYANGFNAYWLAYEATDPTTRFKITYVFQN  75

Query  286  ASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYE  465
            A+ HGLT+ARTW F DGGYRALQ APG Y+E  F+GLDF IAEA++ G+K+I++  NNY 
Sbjct  76   ATIHGLTIARTWGFRDGGYRALQIAPGVYDEKTFQGLDFAIAEAKRLGIKMIITFVNNYS  135

Query  466  SFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
             FGG+KQYVDWA+  GQ ++SDDDF+ N LVK +
Sbjct  136  DFGGRKQYVDWAKTTGQNVSSDDDFYTNPLVKQY  169



>ref|NP_001234874.1| inactive endo-beta-mannanase precursor [Solanum lycopersicum]
 gb|AAK97759.2| inactive endo-beta-mannanase [Solanum lycopersicum]
Length=395

 Score =   198 bits (504),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 112/143 (78%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            + N F+ T G HF +NG + Y NGFNAYWLMY+A DPS R KV+  F+ AS + + VART
Sbjct  28   SNNNFVYTDGTHFALNGKSLYINGFNAYWLMYIAYDPSTRIKVTNTFQQASKYKMNVART  87

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAFS GG R LQ APG YNE +F+GLDFVI+EA+KYG+ +I+SL NN+++FGGKKQYV+W
Sbjct  88   WAFSHGGSRPLQSAPGVYNEQMFQGLDFVISEAKKYGIHLIMSLVNNWDAFGGKKQYVEW  147

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            A  +GQ LTSDDDFF N +VKGF
Sbjct  148  AVQRGQKLTSDDDFFTNPMVKGF  170



>ref|NP_001234131.1| mannan endo-1,4-beta-mannosidase 4 precursor [Solanum lycopersicum]
 ref|XP_010323731.1| PREDICTED: mannan endo-1,4-beta-mannosidase isoform X1 [Solanum 
lycopersicum]
 sp|Q8L5J1.2|MAN4_SOLLC RecName: Full=Mannan endo-1,4-beta-mannosidase 4; AltName: Full=Beta-mannanase 
4; AltName: Full=Endo-beta-1,4-mannanase 4; 
AltName: Full=LeMAN4a; AltName: Full=LeMAN4i; Flags: Precursor 
[Solanum lycopersicum]
 gb|AAK97760.1| endo-beta-mannanase [Solanum lycopersicum]
Length=399

 Score =   198 bits (504),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 112/143 (78%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            + N F+ T G HF +NG + Y NGFNAYWLMY+A DPS R KV+  F+ AS + + VART
Sbjct  28   SNNNFVYTDGTHFALNGKSLYINGFNAYWLMYIAYDPSTRIKVTNTFQQASKYKMNVART  87

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAFS GG R LQ APG YNE +F+GLDFVI+EA+KYG+ +I+SL NN+++FGGKKQYV+W
Sbjct  88   WAFSHGGSRPLQSAPGVYNEQMFQGLDFVISEAKKYGIHLIMSLVNNWDAFGGKKQYVEW  147

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            A  +GQ LTSDDDFF N +VKGF
Sbjct  148  AVQRGQKLTSDDDFFTNPMVKGF  170



>ref|NP_001234114.1| mannan endo-1,4-beta-mannosidase precursor [Solanum lycopersicum]
 gb|AAK56557.1| mannan endo-1,4-beta-mannosidase [Solanum lycopersicum]
Length=395

 Score =   198 bits (504),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 112/143 (78%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            + N F+ T G HF +NG + Y NGFNAYWLMY+A DPS R KV+  F+ AS + + VART
Sbjct  28   SNNNFVYTDGTHFALNGKSLYINGFNAYWLMYIAYDPSTRIKVTNTFQQASKYKMNVART  87

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAFS GG R LQ APG YNE +F+GLDFVI+EA+KYG+ +I+SL NN+++FGGKKQYV+W
Sbjct  88   WAFSHGGSRPLQSAPGVYNEQMFQGLDFVISEAKKYGIHLIMSLVNNWDAFGGKKQYVEW  147

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            A  +GQ LTSDDDFF N +VKGF
Sbjct  148  AVQRGQKLTSDDDFFTNPMVKGF  170



>ref|XP_006478472.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5-like [Citrus sinensis]
Length=410

 Score =   198 bits (504),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = +1

Query  130  VKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTV  309
            +  A   F++TRG  F++NG  F  NGFN+YW+M VAS PSQRYKVS+ FR A++ GL+V
Sbjct  14   ILPAQASFVQTRGTQFVLNGSPFLFNGFNSYWMMNVASQPSQRYKVSDVFRQAAAAGLSV  73

Query  310  ARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQY  489
             RTWAFSDGGY ALQ +PG YNE VF+GLDFV +EARKYG+++ILSL+NNY  FGG+ QY
Sbjct  74   CRTWAFSDGGYGALQQSPGVYNEPVFQGLDFVTSEARKYGIRLILSLSNNYHDFGGRPQY  133

Query  490  VDWARGKGQYLTSDDDFFRNSLVKGF  567
            V+WAR  G  + SDDDF+ N++VKG+
Sbjct  134  VNWARAAGASVNSDDDFYTNAIVKGY  159



>ref|NP_001043785.1| Os01g0663300 [Oryza sativa Japonica Group]
 dbj|BAF05699.1| Os01g0663300 [Oryza sativa Japonica Group]
Length=403

 Score =   198 bits (503),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 117/140 (84%), Gaps = 1/140 (1%)
 Frame = +1

Query  151  FIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFS  330
            F++ +G  F+++G  +YANGFNAYWLM +A+DPSQR KVS A   A+ HGLTVARTWAFS
Sbjct  37   FVRAQGTRFVLDGNPYYANGFNAYWLMLLAADPSQRGKVSAALGEAAGHGLTVARTWAFS  96

Query  331  DGGY-RALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARG  507
            DGG   ALQ +PG+YNE+ FKGLDFV++EARKYG+KVILSL +NY+SFGG+KQYV+WAR 
Sbjct  97   DGGGGNALQLSPGNYNENTFKGLDFVLSEARKYGIKVILSLVDNYDSFGGRKQYVNWARA  156

Query  508  KGQYLTSDDDFFRNSLVKGF  567
            +GQ + SDD+FF N +VKGF
Sbjct  157  QGQGIGSDDEFFTNPVVKGF  176



>gb|KCW46730.1| hypothetical protein EUGRSUZ_K00551 [Eucalyptus grandis]
Length=337

 Score =   196 bits (498),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = +1

Query  142  GNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTW  321
            G+GF +T GIHF+ NG   Y NGFNAYW+MY+ASDPS R KV+ A + A+ +G+ +ARTW
Sbjct  28   GSGFARTNGIHFVANGKPLYLNGFNAYWMMYMASDPSTRDKVTSALQEAAKNGMNIARTW  87

Query  322  AFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWA  501
            AFSDGGYRALQ +PG YN+D+FKGLDFVI+EA K G+ +ILSLANN+  FGG+ QYV WA
Sbjct  88   AFSDGGYRALQTSPGVYNQDMFKGLDFVISEAGKNGVYLILSLANNWNDFGGRHQYVQWA  147

Query  502  RGKGQYLTSDDDFFRNSLVKGF  567
            R  GQ L +DD+FF NS+ K +
Sbjct  148  RNSGQSLNNDDEFFTNSVTKAY  169



>ref|XP_010486712.1| PREDICTED: mannan endo-1,4-beta-mannosidase 3-like [Camelina 
sativa]
Length=407

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 117/153 (76%), Gaps = 1/153 (1%)
 Frame = +1

Query  112  SSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGAS  291
            S L G   A+ NGF+  +GI F+ NG  FYANGFNAYWL Y A+DP+ R+K++ AF+ A+
Sbjct  19   SDLEGVEAASSNGFVSRKGIQFIFNGKPFYANGFNAYWLAYEATDPTTRFKITYAFQNAT  78

Query  292  SHGLTVARTWAFSDGG-YRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYES  468
            SHGLT+ARTW F DG  YR LQ +PGSY+E  F+GLDFVIAEA++ G+K+I++  NNY  
Sbjct  79   SHGLTIARTWGFRDGAIYRGLQTSPGSYDEKTFQGLDFVIAEAKRLGIKMIITFVNNYSD  138

Query  469  FGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            FGG+KQYV WA+ KGQ ++SDDDF+ N LVK +
Sbjct  139  FGGRKQYVGWAKSKGQNVSSDDDFYTNPLVKQY  171



>sp|Q0JKM9.2|MAN1_ORYSJ RecName: Full=Mannan endo-1,4-beta-mannosidase 1; AltName: Full=Beta-mannanase 
1; AltName: Full=Endo-beta-1,4-mannanase 1; 
AltName: Full=OsMAN1; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAB91747.1| putative (1-4)-beta-mannan endohydrolase [Oryza sativa Japonica 
Group]
 gb|EAZ12991.1| hypothetical protein OsJ_02911 [Oryza sativa Japonica Group]
Length=432

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 117/140 (84%), Gaps = 1/140 (1%)
 Frame = +1

Query  151  FIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFS  330
            F++ +G  F+++G  +YANGFNAYWLM +A+DPSQR KVS A   A+ HGLTVARTWAFS
Sbjct  37   FVRAQGTRFVLDGNPYYANGFNAYWLMLLAADPSQRGKVSAALGEAAGHGLTVARTWAFS  96

Query  331  DGGY-RALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARG  507
            DGG   ALQ +PG+YNE+ FKGLDFV++EARKYG+KVILSL +NY+SFGG+KQYV+WAR 
Sbjct  97   DGGGGNALQLSPGNYNENTFKGLDFVLSEARKYGIKVILSLVDNYDSFGGRKQYVNWARA  156

Query  508  KGQYLTSDDDFFRNSLVKGF  567
            +GQ + SDD+FF N +VKGF
Sbjct  157  QGQGIGSDDEFFTNPVVKGF  176



>ref|XP_007051341.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007051342.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX95498.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX95499.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
Length=412

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +1

Query  151  FIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFS  330
            F++TRG +F++NG  FY NGFNAYW+M  ASDPS R KV++ FR AS +G+ VAR WAF+
Sbjct  39   FVQTRGTNFVMNGKPFYLNGFNAYWMMMFASDPSTRIKVTDTFREASKYGMNVARVWAFN  98

Query  331  DGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARGK  510
            DG Y+ LQ +PGSYNEDVFKGLDFV+AEA+KYG+ +ILSL NN++ FGGK +YV WA+ +
Sbjct  99   DGDYKPLQNSPGSYNEDVFKGLDFVVAEAKKYGIHLILSLVNNFKDFGGKDKYVQWAKQQ  158

Query  511  GQYLTSDDDFFRNSLVKGF  567
            GQ L+++DDF+ NSLVK +
Sbjct  159  GQSLSNEDDFYTNSLVKQY  177



>emb|CAC51690.3| endo-beta-1,4-mannanase [Lactuca sativa]
Length=410

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 114/147 (78%), Gaps = 1/147 (1%)
 Frame = +1

Query  130  VKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTV  309
            +    + F++TR  HFM+NG   Y NGFNAYWLM +ASDPS R KV++AF+ +S  G+ +
Sbjct  19   LSTINDSFVETRTHHFMVNGKPLYFNGFNAYWLMCMASDPSTRVKVTDAFQESSKIGMNL  78

Query  310  ARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQY  489
             RTWAFSDGG + LQ +PG YNED+FKGLDFVI+EA+KYG+ +ILSL NN++ FGGKKQY
Sbjct  79   VRTWAFSDGGNKPLQTSPGFYNEDMFKGLDFVISEAKKYGIHLILSLVNNWDDFGGKKQY  138

Query  490  VDWARGK-GQYLTSDDDFFRNSLVKGF  567
            V WAR   GQYL SDDDFF N +VKG+
Sbjct  139  VQWARDHGGQYLNSDDDFFTNVVVKGY  165



>ref|XP_011468408.1| PREDICTED: LOW QUALITY PROTEIN: mannan endo-1,4-beta-mannosidase 
4-like [Fragaria vesca subsp. vesca]
Length=381

 Score =   196 bits (499),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+ F  T G  F++NG  FY NGFNAYW+MY+ASDPS +  V+ AF+ AS + + VART
Sbjct  6    AGSSFGGTTGTRFVMNGKPFYMNGFNAYWMMYMASDPSTQLMVTSAFQQASKYKMNVART  65

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            W FSDGG R LQ +PGSYNE++FKGLDFVI+EA+KYG+ +ILSL NNYE+FGG KQYV W
Sbjct  66   WGFSDGGDRPLQISPGSYNENMFKGLDFVISEAKKYGVYLILSLVNNYEAFGGXKQYVQW  125

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +GQ L+SDDDF+ N +VKGF
Sbjct  126  AREQGQSLSSDDDFYSNVVVKGF  148



>ref|XP_009631900.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Nicotiana 
tomentosiformis]
Length=409

 Score =   196 bits (499),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 116/148 (78%), Gaps = 1/148 (1%)
 Frame = +1

Query  127  SVKAAGN-GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGL  303
            S+KA  N  ++ T G HF + G  FY NGFNAYWLMY+ASDPS R KV+  F+ AS +G+
Sbjct  24   SIKAFSNPSYVYTDGTHFALEGKPFYLNGFNAYWLMYMASDPSTRNKVTTTFQQASKYGM  83

Query  304  TVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKK  483
             VARTWAF+DGG R LQ +PG YNE +F+GLDFVI+EA+KYG+++IL L NN++  GGKK
Sbjct  84   NVARTWAFTDGGSRPLQSSPGVYNEQMFEGLDFVISEAQKYGIRLILGLVNNWDILGGKK  143

Query  484  QYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            QYV+WA+ +GQ LTS+DDFF N +VKGF
Sbjct  144  QYVEWAQERGQQLTSEDDFFTNPMVKGF  171



>ref|XP_006296763.1| hypothetical protein CARUB_v10015594mg [Capsella rubella]
 gb|EOA29661.1| hypothetical protein CARUB_v10015594mg [Capsella rubella]
Length=416

 Score =   197 bits (500),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 118/157 (75%), Gaps = 1/157 (1%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
              Q  S  G   A+  GF+  +G+ F++NG  FYANGFNAYWL Y A+DP+ RYK++  F
Sbjct  14   IAQNYSDLGVEAASSGGFVSRKGVQFILNGKPFYANGFNAYWLTYEATDPTARYKITHGF  73

Query  280  RGASSHGLTVARTWAFSDGG-YRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLAN  456
              A+S GLT+ARTW F+DG  YRALQ APGSY+E+ F+GLDFVI+EA++ GLK+I+ L N
Sbjct  74   ENATSRGLTIARTWGFNDGASYRALQTAPGSYDENTFQGLDFVISEAKRVGLKMIIPLVN  133

Query  457  NYESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            N+  +GGKKQYVDWA+ KG+ ++SDDDF+ NSL K F
Sbjct  134  NWSDYGGKKQYVDWAKSKGEKVSSDDDFYTNSLTKQF  170



>gb|KFK38477.1| hypothetical protein AALP_AA3G118100 [Arabis alpina]
Length=413

 Score =   196 bits (499),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = +1

Query  142  GNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTW  321
             +GF+  +G+ F++NG  F+ANGFNAYWLMY A+DP+ R+K++ AF+ A+ HGLT+ARTW
Sbjct  25   ADGFVSRKGVQFILNGKPFHANGFNAYWLMYEATDPATRFKITYAFQNATMHGLTIARTW  84

Query  322  AFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWA  501
             F DGGYRALQ APG Y+E  FKGLDF IAEA++ G+K+I++  NNY  FGG+KQYV+WA
Sbjct  85   GFHDGGYRALQIAPGIYDELTFKGLDFAIAEAKRLGIKMIITFVNNYSDFGGRKQYVEWA  144

Query  502  RGKGQYLTSDDDFFRNSLVKGF  567
            +  GQ ++SDDDF+ N L+K +
Sbjct  145  KTTGQNVSSDDDFYTNPLIKQY  166



>ref|XP_010464779.1| PREDICTED: mannan endo-1,4-beta-mannosidase 3-like [Camelina 
sativa]
Length=417

 Score =   196 bits (499),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 117/153 (76%), Gaps = 1/153 (1%)
 Frame = +1

Query  112  SSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGAS  291
            S L G   A+ NGF+  +G+ F+ NG  FYANGFNAYWL Y A+DP+ R+K++ AF+ A+
Sbjct  19   SDLGGVEAASSNGFVTRKGVQFIFNGKPFYANGFNAYWLTYEATDPTTRFKITYAFQNAT  78

Query  292  SHGLTVARTWAFSDGG-YRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYES  468
            SHGLT+ARTW F DG  YR LQ +PGSY+E  F+GLDFVIAEA++ G+K+I++  NNY  
Sbjct  79   SHGLTIARTWGFRDGAIYRGLQTSPGSYHEKTFQGLDFVIAEAKRLGIKMIITFVNNYSD  138

Query  469  FGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            FGG+KQYV WA+ KGQ ++SDDDF+ N LVK +
Sbjct  139  FGGRKQYVGWAKSKGQNVSSDDDFYTNPLVKQY  171



>gb|EEC71222.1| hypothetical protein OsI_03157 [Oryza sativa Indica Group]
Length=432

 Score =   197 bits (500),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 117/140 (84%), Gaps = 1/140 (1%)
 Frame = +1

Query  151  FIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFS  330
            F++ +G  F+++G  +YANGFNAYWLM +A+DPSQR KV+ A   A+ HGLTVARTWAFS
Sbjct  37   FVRAQGTRFVLDGNPYYANGFNAYWLMLLAADPSQRGKVTAALGEAAGHGLTVARTWAFS  96

Query  331  DGGY-RALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARG  507
            DGG   ALQ +PG+YNE+ FKGLDFV++EARKYG+KVILSL +NY+SFGG+KQYV+WAR 
Sbjct  97   DGGGGNALQLSPGNYNENTFKGLDFVLSEARKYGIKVILSLVDNYDSFGGRKQYVNWARA  156

Query  508  KGQYLTSDDDFFRNSLVKGF  567
            +GQ + SDD+FF N +VKGF
Sbjct  157  QGQGIGSDDEFFTNPVVKGF  176



>ref|XP_010490811.1| PREDICTED: mannan endo-1,4-beta-mannosidase 3-like [Camelina 
sativa]
Length=417

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 117/153 (76%), Gaps = 1/153 (1%)
 Frame = +1

Query  112  SSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGAS  291
            S L G   A+ NGF+  +G+ F+ NG  FYANGFNAYWL Y A+DP+ R+K++ AF+ A+
Sbjct  19   SDLGGVEAASSNGFVTRKGVQFIFNGKPFYANGFNAYWLTYEATDPTTRFKITYAFQNAT  78

Query  292  SHGLTVARTWAFSDGG-YRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYES  468
            SHGLT+ARTW F DG  YR LQ +PGSY+E  F+GLDFVIAEA++ G+K+I++  NNY  
Sbjct  79   SHGLTIARTWGFRDGAIYRGLQTSPGSYHEKTFQGLDFVIAEAKRLGIKMIITFVNNYSD  138

Query  469  FGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            FGG+KQYV WA+ KGQ ++SDDDF+ N LVK +
Sbjct  139  FGGRKQYVGWAKSKGQNVSSDDDFYTNPLVKQY  171



>ref|XP_010035363.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Eucalyptus 
grandis]
 gb|KCW46729.1| hypothetical protein EUGRSUZ_K00551 [Eucalyptus grandis]
Length=402

 Score =   196 bits (498),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = +1

Query  142  GNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTW  321
            G+GF +T GIHF+ NG   Y NGFNAYW+MY+ASDPS R KV+ A + A+ +G+ +ARTW
Sbjct  28   GSGFARTNGIHFVANGKPLYLNGFNAYWMMYMASDPSTRDKVTSALQEAAKNGMNIARTW  87

Query  322  AFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWA  501
            AFSDGGYRALQ +PG YN+D+FKGLDFVI+EA K G+ +ILSLANN+  FGG+ QYV WA
Sbjct  88   AFSDGGYRALQTSPGVYNQDMFKGLDFVISEAGKNGVYLILSLANNWNDFGGRHQYVQWA  147

Query  502  RGKGQYLTSDDDFFRNSLVKGF  567
            R  GQ L +DD+FF NS+ K +
Sbjct  148  RNSGQSLNNDDEFFTNSVTKAY  169



>ref|XP_010490985.1| PREDICTED: mannan endo-1,4-beta-mannosidase 3-like isoform X2 
[Camelina sativa]
Length=417

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 117/153 (76%), Gaps = 1/153 (1%)
 Frame = +1

Query  112  SSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGAS  291
            S L G   A+ NGF+  +G+ F+ NG  FYANGFNAYWL Y A+DP+ R+K++ AF+ A+
Sbjct  19   SDLGGVEAASSNGFVTRKGVQFIFNGKPFYANGFNAYWLAYEATDPTTRFKITYAFQNAT  78

Query  292  SHGLTVARTWAFSDGG-YRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYES  468
            SHGLT+ARTW F DG  YR LQ +PGSY+E  F+GLDFVIAEA++ G+K+I++  NNY  
Sbjct  79   SHGLTIARTWGFRDGAIYRGLQTSPGSYDEKTFQGLDFVIAEAKRLGIKMIITFVNNYSD  138

Query  469  FGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            FGG+KQYV WA+ KGQ ++SDDDF+ N LVK +
Sbjct  139  FGGRKQYVGWAKSKGQNVSSDDDFYTNPLVKQY  171



>ref|NP_187701.1| putative mannan endo-1,4-beta-mannosidase 4 [Arabidopsis thaliana]
 sp|Q9SG95.1|MAN4_ARATH RecName: Full=Putative mannan endo-1,4-beta-mannosidase 4; AltName: 
Full=Beta-mannanase 4; AltName: Full=Endo-beta-1,4-mannanase 
4; Short=AtMAN4; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF19559.1|AC011708_2 putative (1-4)-beta-mannan endohydrolase [Arabidopsis thaliana]
 gb|AEE74968.1| putative mannan endo-1,4-beta-mannosidase 4 [Arabidopsis thaliana]
Length=408

 Score =   196 bits (497),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 118/157 (75%), Gaps = 1/157 (1%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
             V   S  G   A  +GF+   G+ F++NG  FYANGFNAYWL Y A+DP+ R+K++  F
Sbjct  12   IVIAQSYVGVEAAPSDGFVSRNGVQFILNGKPFYANGFNAYWLAYEATDPTTRFKITNVF  71

Query  280  RGASSHGLTVARTWAFSDGG-YRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLAN  456
            + A+S GLT+ARTW F DG  YRALQ APGSY+E  F+GLDFVIAEA++ G+K+I+ L N
Sbjct  72   QNATSLGLTIARTWGFRDGAIYRALQTAPGSYDEQTFQGLDFVIAEAKRIGIKLIILLVN  131

Query  457  NYESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            N++ +GGKKQYVDWAR KG+ ++S+DDF+RN ++K F
Sbjct  132  NWDDYGGKKQYVDWARSKGEVVSSNDDFYRNPVIKDF  168



>ref|XP_004495835.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Cicer arietinum]
Length=401

 Score =   195 bits (496),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
               GF++ +GIHF++NG T Y NGFN+YWLMY+ASDPS R KV+  F+ AS HGL V RT
Sbjct  28   VATGFVERKGIHFILNGKTHYVNGFNSYWLMYMASDPSTRSKVTSTFQQASQHGLNVGRT  87

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
             AF+DG YRALQ +PGSY+E+VF+GLDFVI+EARKY +++ILSL NN+ +FGGK +YV W
Sbjct  88   MAFNDGCYRALQISPGSYDENVFRGLDFVISEARKYKIQLILSLVNNWNNFGGKNKYVQW  147

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +GQ + ++DDFF + +VK +
Sbjct  148  ARERGQSVKTEDDFFTHPIVKQY  170



>gb|KEH43148.1| mannan endo-1,4-beta-mannosidase-like protein [Medicago truncatula]
Length=403

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 112/143 (78%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
             G GF++ +G HF++NG  +Y NGFN+YWLM +ASDPS R KV+  F+ AS HGL V RT
Sbjct  28   VGAGFVQRKGTHFILNGKPYYLNGFNSYWLMTMASDPSTRVKVTSNFQQASQHGLNVGRT  87

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAF+DG  + LQ +PGSY+E+VFKGLDFVI+EARKYG+K+ILSL NN+  FGGKK+YV W
Sbjct  88   WAFNDGDSKPLQISPGSYDENVFKGLDFVISEARKYGVKLILSLVNNWNDFGGKKKYVQW  147

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +GQ +  +DDFF N LVK +
Sbjct  148  ARERGQNVKIEDDFFINPLVKQY  170



>ref|XP_008245064.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Prunus mume]
Length=429

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 118/160 (74%), Gaps = 4/160 (3%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNG--FIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSE  273
            F+Q     G    A NG  F +T G  F++NG  FY NGFNAYW+MY+ASDPS R KV+ 
Sbjct  27   FIQHGDCKGEANHASNGGAFARTEGTRFVMNGRPFYINGFNAYWMMYMASDPSSRAKVTS  86

Query  274  AFRGASSHGLTVARTWAFSDGG--YRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILS  447
            AF+ AS +G+ VARTWAF+DG    R LQ +PGSYNED FKGLDFVI+EA+K+G+ +ILS
Sbjct  87   AFQQASRYGMNVARTWAFNDGSGTDRPLQPSPGSYNEDTFKGLDFVISEAKKFGVHLILS  146

Query  448  LANNYESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
              NN+  FGG+KQY  WAR +GQ ++SDDDF+ N+++KG+
Sbjct  147  FVNNFSDFGGRKQYAQWARDRGQPISSDDDFYSNAVIKGY  186



>ref|XP_006300225.1| hypothetical protein CARUB_v10016461mg [Capsella rubella]
 gb|EOA33123.1| hypothetical protein CARUB_v10016461mg [Capsella rubella]
Length=434

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 117/154 (76%), Gaps = 1/154 (1%)
 Frame = +1

Query  109  QSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGA  288
             + L G   A+ +GF+  +G+ F++NG  FYANGFNAYWL Y A+DP+ R+K++ AF+ A
Sbjct  18   HTDLGGVEAASSDGFVGRKGVQFILNGKPFYANGFNAYWLTYEATDPTARFKITYAFQNA  77

Query  289  SSHGLTVARTWAFSDGG-YRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYE  465
            +SHGL +ARTW F DG  YR LQ APG+Y+E  F+GLDFVIAEA++ GLK+I++  NNY 
Sbjct  78   TSHGLAIARTWGFRDGAIYRGLQTAPGTYDEKSFQGLDFVIAEAKRLGLKMIITFVNNYS  137

Query  466  SFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
             FGG+KQYVDWA+  GQ ++SDDDF+ N LVK +
Sbjct  138  DFGGRKQYVDWAKTSGQNVSSDDDFYTNPLVKQY  171



>ref|XP_010490578.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 4 [Camelina 
sativa]
Length=408

 Score =   194 bits (492),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 115/149 (77%), Gaps = 1/149 (1%)
 Frame = +1

Query  124  GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGL  303
            G   A+ NGF+  +G+ F++NG  FYANGFNAYWL Y A+DP+ RYK++ AF+ A SHGL
Sbjct  23   GVEAASNNGFVTRKGVQFILNGKPFYANGFNAYWLTYEATDPTARYKITHAFQDAISHGL  82

Query  304  TVARTWAFSDGG-YRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGK  480
            T+ARTW F DG  YRALQ +PG Y+E  F+GLDFVIAEA++ G+K+I+ L NN+  +GG+
Sbjct  83   TIARTWGFHDGAIYRALQTSPGIYDEKTFQGLDFVIAEAKRLGIKLIIPLVNNWSDYGGR  142

Query  481  KQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            KQYV WA+ KG+ ++SDDDF+ NSL K F
Sbjct  143  KQYVAWAQSKGEKVSSDDDFYTNSLTKQF  171



>ref|XP_010468110.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 4 [Camelina 
sativa]
Length=182

 Score =   187 bits (475),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 114/148 (77%), Gaps = 2/148 (1%)
 Frame = +1

Query  130  VKAAGN-GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLT  306
            V+A  N GF+   G+ F++NG  FYANGFNAYWL Y A+DP+ RYK++ AF+ A SHGLT
Sbjct  24   VEAVPNDGFVTRNGLQFILNGKPFYANGFNAYWLTYEATDPTARYKITNAFQDAISHGLT  83

Query  307  VARTWAFSDGG-YRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKK  483
            +ARTW F DG  YRALQ +PG Y+E  F+GLDFVIAEA++ G+K+I+ L NN+  +GG+K
Sbjct  84   IARTWGFHDGAIYRALQTSPGIYDEQTFQGLDFVIAEAKRLGIKMIMPLVNNWSDYGGRK  143

Query  484  QYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            QYV WA+ +G+ ++SDDDF+ NSL K F
Sbjct  144  QYVAWAQSRGEKVSSDDDFYTNSLTKQF  171



>gb|KJB41765.1| hypothetical protein B456_007G119100 [Gossypium raimondii]
Length=370

 Score =   192 bits (489),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 114/144 (79%), Gaps = 0/144 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
            A G GF++T    F+ING  FY NGFNAYW+M  ASD S R KV++AFR AS +G+ +AR
Sbjct  33   AGGTGFVQTTATKFVINGKPFYLNGFNAYWMMMFASDNSTRSKVTDAFREASKYGMNIAR  92

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVD  495
            TWAF+DG Y+ LQ +PGSYNEDVFKGLDFV+AEA KYG+ +ILSLANN++ FGGK +YV 
Sbjct  93   TWAFNDGDYKPLQNSPGSYNEDVFKGLDFVVAEANKYGIHLILSLANNFKDFGGKDKYVQ  152

Query  496  WARGKGQYLTSDDDFFRNSLVKGF  567
            WA+ +G+ L+ +DDFF +S+VK +
Sbjct  153  WAKQRGRNLSKEDDFFTDSVVKKY  176



>ref|XP_004228885.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Solanum lycopersicum]
Length=401

 Score =   193 bits (490),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 115/153 (75%), Gaps = 1/153 (1%)
 Frame = +1

Query  112  SSLSGSVKAA-GNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGA  288
            +  S  +KA+  + F+   G HF + G  FY NGFN+YWLMY+ASDPS R KV+  F+ A
Sbjct  20   NEFSNPIKASLDSNFVYIDGTHFALEGKPFYLNGFNSYWLMYMASDPSTRNKVTNIFQQA  79

Query  289  SSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYES  468
            S + + VARTWAF+DGG R LQ APG YNE +F+GLDFVI+EA+ YG+ +ILSL +N+E+
Sbjct  80   SKYKMNVARTWAFADGGSRPLQSAPGVYNEQMFQGLDFVISEAKNYGIHLILSLVDNFEA  139

Query  469  FGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            FGGKKQYV+WA  KGQ LTSDDDFF N +VK F
Sbjct  140  FGGKKQYVEWAVQKGQKLTSDDDFFTNPMVKKF  172



>ref|NP_187700.1| mannan endo-1,4-beta-mannosidase 3 [Arabidopsis thaliana]
 sp|Q9SG94.1|MAN3_ARATH RecName: Full=Mannan endo-1,4-beta-mannosidase 3; AltName: Full=Beta-mannanase 
3; AltName: Full=Endo-beta-1,4-mannanase 3; 
Short=AtMAN3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF19560.1|AC011708_3 putative (1-4)-beta-mannan endohydrolase [Arabidopsis thaliana]
 gb|AEE74967.1| mannan endo-1,4-beta-mannosidase 3 [Arabidopsis thaliana]
Length=414

 Score =   193 bits (490),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 114/156 (73%), Gaps = 0/156 (0%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
              Q SS  G   A+ +GF+  +G+ F++NG  FYANGFNAYWL Y A+D + R+K++  F
Sbjct  14   IAQNSSDLGVKSASSDGFVSRKGVQFILNGKPFYANGFNAYWLAYEATDSTTRFKITYVF  73

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            + A+ H LT+ RTW F DGGYRALQ APG Y+E  F+GLDF IAEA++ G+K+I++  NN
Sbjct  74   QNATIHDLTIVRTWGFRDGGYRALQIAPGVYDEKTFQGLDFAIAEAKRLGIKMIITFVNN  133

Query  460  YESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            Y  FGG+KQYVDWA+  GQ ++SDDDF+ N LVK +
Sbjct  134  YSDFGGRKQYVDWAKNTGQNVSSDDDFYTNPLVKQY  169



>emb|CDX73899.1| BnaA03g31480D [Brassica napus]
Length=285

 Score =   189 bits (481),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
            A+ +GF+  +G+ F++NG  FYANGFNAYWLMY A+DP+ RYKV+ A   A+  GLT+AR
Sbjct  26   ASSDGFVSRKGVQFILNGEPFYANGFNAYWLMYEATDPNTRYKVTHALENAAGQGLTIAR  85

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVD  495
            TW F DGGYRALQ   GSY+E  F+GLDF IAEA++ G+K+I++  NN+  FGGKKQY+ 
Sbjct  86   TWGFRDGGYRALQTNLGSYDEQTFQGLDFSIAEAKRVGIKMIIAFVNNFPDFGGKKQYMA  145

Query  496  WARGKGQYLTSDDDFFRNSLVK  561
            WA+ KGQ +TS+DDF+ N+L+K
Sbjct  146  WAKDKGQAVTSEDDFYTNALLK  167



>gb|KJB41764.1| hypothetical protein B456_007G119100 [Gossypium raimondii]
Length=411

 Score =   193 bits (490),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 114/144 (79%), Gaps = 0/144 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
            A G GF++T    F+ING  FY NGFNAYW+M  ASD S R KV++AFR AS +G+ +AR
Sbjct  33   AGGTGFVQTTATKFVINGKPFYLNGFNAYWMMMFASDNSTRSKVTDAFREASKYGMNIAR  92

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVD  495
            TWAF+DG Y+ LQ +PGSYNEDVFKGLDFV+AEA KYG+ +ILSLANN++ FGGK +YV 
Sbjct  93   TWAFNDGDYKPLQNSPGSYNEDVFKGLDFVVAEANKYGIHLILSLANNFKDFGGKDKYVQ  152

Query  496  WARGKGQYLTSDDDFFRNSLVKGF  567
            WA+ +G+ L+ +DDFF +S+VK +
Sbjct  153  WAKQRGRNLSKEDDFFTDSVVKKY  176



>gb|KJB41766.1| hypothetical protein B456_007G119100 [Gossypium raimondii]
Length=411

 Score =   193 bits (490),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 114/144 (79%), Gaps = 0/144 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
            A G GF++T    F+ING  FY NGFNAYW+M  ASD S R KV++AFR AS +G+ +AR
Sbjct  33   AGGTGFVQTTATKFVINGKPFYLNGFNAYWMMMFASDNSTRSKVTDAFREASKYGMNIAR  92

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVD  495
            TWAF+DG Y+ LQ +PGSYNEDVFKGLDFV+AEA KYG+ +ILSLANN++ FGGK +YV 
Sbjct  93   TWAFNDGDYKPLQNSPGSYNEDVFKGLDFVVAEANKYGIHLILSLANNFKDFGGKDKYVQ  152

Query  496  WARGKGQYLTSDDDFFRNSLVKGF  567
            WA+ +G+ L+ +DDFF +S+VK +
Sbjct  153  WAKQRGRNLSKEDDFFTDSVVKKY  176



>ref|XP_003553696.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Glycine max]
Length=419

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 113/156 (72%), Gaps = 0/156 (0%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
            F   S  + + K    GFI+    HF +NG   Y NGFN+YWLM VASDPS   KVS  F
Sbjct  32   FHHHSHKNLTTKKLHGGFIERSNTHFYLNGKPHYLNGFNSYWLMNVASDPSTSSKVSITF  91

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            + AS HGL VARTWAF+DGGY ALQ +PGSYNE+VFKGLDFVI+EA K G+++ILSL NN
Sbjct  92   QEASQHGLNVARTWAFNDGGYNALQISPGSYNENVFKGLDFVISEAGKNGVRLILSLVNN  151

Query  460  YESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            +  +GGK QYV WAR +GQY+ +DDDFF + +VK +
Sbjct  152  WNDYGGKSQYVQWARERGQYVNNDDDFFSHPIVKEY  187



>gb|KHN14185.1| Putative mannan endo-1,4-beta-mannosidase 9 [Glycine soja]
Length=394

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 111/138 (80%), Gaps = 0/138 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF++  G +F+++   FY NGFNAYWLMY+ASDP+ R KV+   + ASSHGLTVARTWAF
Sbjct  24   GFVQRSGTNFVLSNRHFYFNGFNAYWLMYMASDPATRPKVTAVLQQASSHGLTVARTWAF  83

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARG  507
            SDGGYRALQ +PGSY+E VF+GLDFV++EA KYG+++ILSL NN++ FGGK QYV W + 
Sbjct  84   SDGGYRALQVSPGSYDEKVFRGLDFVVSEAGKYGVRLILSLVNNWKDFGGKNQYVQWVKE  143

Query  508  KGQYLTSDDDFFRNSLVK  561
             GQY+ S+DDFF + + K
Sbjct  144  HGQYVNSEDDFFSHPIAK  161



>gb|EPS69785.1| endo-beta-mannanase [Genlisea aurea]
Length=565

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 108/135 (80%), Gaps = 0/135 (0%)
 Frame = +1

Query  163  RGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFSDGGY  342
             G+ F+++G  FYANGFNAYWLM VASDP+QRY+VS AF+ A +HGL V+RTWAFSDGGY
Sbjct  32   EGLSFVLDGIPFYANGFNAYWLMIVASDPAQRYRVSTAFQEAKAHGLNVSRTWAFSDGGY  91

Query  343  RALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARGKGQYL  522
             ALQ +PG Y E  F+GLDFV+ EA K+G+K+ILSL NNY  FGGK QYV W R +GQ L
Sbjct  92   FALQASPGCYIEKTFQGLDFVVQEAGKHGIKLILSLVNNYNDFGGKNQYVKWGRNRGQNL  151

Query  523  TSDDDFFRNSLVKGF  567
            +SDDDFF NS VKG+
Sbjct  152  SSDDDFFTNSAVKGY  166



>ref|XP_003554587.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Glycine max]
Length=410

 Score =   191 bits (486),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 110/138 (80%), Gaps = 0/138 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF++    +F++N   FY NGFNAYWLMY+ASDPS R KV+   + AS+HGLTVARTWAF
Sbjct  40   GFVQRSSTNFVLNNKRFYFNGFNAYWLMYMASDPSTRPKVTAVLQQASNHGLTVARTWAF  99

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARG  507
            SDGGYRALQ +PGSY+E VF+GLDFV++EA KYG+++ILSL NN++ FGGK QYV W + 
Sbjct  100  SDGGYRALQVSPGSYDEKVFRGLDFVVSEAGKYGVRLILSLVNNWKDFGGKNQYVQWVKE  159

Query  508  KGQYLTSDDDFFRNSLVK  561
             GQY+ S+DDFF + + K
Sbjct  160  HGQYVNSEDDFFSHPIAK  177



>ref|XP_009391931.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 9 [Musa 
acuminata subsp. malaccensis]
Length=446

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 114/142 (80%), Gaps = 1/142 (1%)
 Frame = +1

Query  145  NGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQ-RYKVSEAFRGASSHGLTVARTW  321
             GF++T   HF++N   F  NGFNAYWLMYVAS P + R  VS AF+ AS+HGLT+ARTW
Sbjct  27   TGFVRTNMTHFLVNRRPFSLNGFNAYWLMYVASFPEEGRSMVSSAFQEASTHGLTLARTW  86

Query  322  AFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWA  501
            AF DGGY+ LQ +PG Y+ED+F+GLDFVI+EA+KYG+ ++LSL NN+ESFGG+ QY+ WA
Sbjct  87   AFRDGGYKPLQRSPGVYDEDMFQGLDFVISEAKKYGIYLVLSLVNNFESFGGRTQYIQWA  146

Query  502  RGKGQYLTSDDDFFRNSLVKGF  567
            R +G +L+SDDDF+R+ +VK +
Sbjct  147  RDEGGHLSSDDDFYRDEVVKSY  168



>ref|NP_001235608.1| endo-1,4-beta-mannanase precursor [Glycine max]
 ref|XP_006576270.1| PREDICTED: endo-1,4-beta-mannanase isoform X1 [Glycine max]
 ref|XP_006576271.1| PREDICTED: endo-1,4-beta-mannanase isoform X2 [Glycine max]
 gb|ABG88068.1| endo-1,4-beta-mannanase [Glycine max]
Length=410

 Score =   191 bits (486),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 111/138 (80%), Gaps = 0/138 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF++  G +F+++   FY NGFNAYWLMY+ASDP+ R KV+   + ASSHGLTVARTWAF
Sbjct  40   GFVQRSGTNFVLSNRHFYFNGFNAYWLMYMASDPATRPKVTAVLQQASSHGLTVARTWAF  99

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARG  507
            SDGGYRALQ +PGSY+E VF+GLDFV++EA KYG+++ILSL NN++ FGGK QYV W + 
Sbjct  100  SDGGYRALQVSPGSYDEKVFRGLDFVVSEAGKYGVRLILSLVNNWKDFGGKNQYVQWVKE  159

Query  508  KGQYLTSDDDFFRNSLVK  561
             GQY+ S+DDFF + + K
Sbjct  160  HGQYVNSEDDFFSHPIAK  177



>gb|KEH43147.1| mannan endo-1,4-beta-mannosidase-like protein [Medicago truncatula]
Length=403

 Score =   191 bits (485),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 110/143 (77%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
             G GF++ +G HF++NG T Y NGFN+YWLM +ASDPS R KV+  F+ AS HGL V RT
Sbjct  28   VGGGFVQRKGTHFILNGKTHYVNGFNSYWLMTMASDPSTRVKVTSNFQQASQHGLNVGRT  87

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
             AF+DG Y+ LQ +PG Y+E+VFKGLDFVI+EA KYG+K+ILSL NN+  FGGKK+YV W
Sbjct  88   LAFNDGDYKPLQISPGKYDENVFKGLDFVISEANKYGVKLILSLVNNWNDFGGKKKYVQW  147

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +GQ +  +DDFF N LVK +
Sbjct  148  ARERGQNVKIEDDFFINPLVKQY  170



>ref|XP_002272344.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5 [Vitis vinifera]
 emb|CBI17040.3| unnamed protein product [Vitis vinifera]
Length=402

 Score =   191 bits (485),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  145  NGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWA  324
            +GF++TR   F++NG  F+ NGFN+YWLM+++++PSQR KVS+ FR AS+ GL+V RTWA
Sbjct  29   SGFVQTRNTQFILNGSPFFFNGFNSYWLMHISAEPSQRNKVSDVFRQASAAGLSVCRTWA  88

Query  325  FSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWAR  504
            FSDGGY+ALQ +PG Y+E VF+GLDFVI+EARK G++++L+L+NNY+ FGG+ QYV+WA+
Sbjct  89   FSDGGYQALQISPGVYDERVFQGLDFVISEARKNGIRLVLTLSNNYQDFGGRPQYVNWAK  148

Query  505  GKGQYLTSDDDFFRNSLVKGF  567
              G  + +DDDF+ N+++KG+
Sbjct  149  SAGVSVNNDDDFYINAVIKGY  169



>gb|AES61540.2| mannan endo-1,4-beta-mannosidase-like protein [Medicago truncatula]
Length=387

 Score =   190 bits (483),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 113/143 (79%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
             G GF++ +GIHF++NG T Y NGFN++WLM +A+D S R KV+ AF+ AS HGL V RT
Sbjct  27   VGVGFVQRKGIHFLMNGKTHYVNGFNSHWLMIMAADLSTRPKVTSAFQQASQHGLNVGRT  86

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAF+DGGY+ALQ +PG Y+E VF+GLDFVI+EA KYG+K+ILSLANN+ +FGGK +YV W
Sbjct  87   WAFNDGGYKALQISPGFYDETVFQGLDFVISEASKYGVKLILSLANNWNNFGGKNKYVQW  146

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR  G  + +DDDFF + LVK +
Sbjct  147  AREHGHNIKNDDDFFTHPLVKQY  169



>ref|XP_010112044.1| Mannan endo-1,4-beta-mannosidase 5 [Morus notabilis]
 gb|EXC32463.1| Mannan endo-1,4-beta-mannosidase 5 [Morus notabilis]
Length=403

 Score =   191 bits (484),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
               +GF++TRG  F+++G  F  NGFN+YW+M VAS PSQR K+S+ FR A++ GLTV R
Sbjct  26   VVSSGFVETRGTGFIVDGSPFLFNGFNSYWMMTVASQPSQRSKISDVFREAAAAGLTVCR  85

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVD  495
            TWAFSDGG RALQ +P  YNE VF+GLDFVI+EARKYG+K+ILSL+NNYE +GGK QYV 
Sbjct  86   TWAFSDGGDRALQMSPRLYNEAVFQGLDFVISEARKYGVKLILSLSNNYEDYGGKAQYVQ  145

Query  496  WARGKGQYLTSDDDFFRNSLVKGF  567
            WAR  G  ++ +DDF+ N++VK +
Sbjct  146  WARNAGVPVSGEDDFYTNAVVKSY  169



>ref|XP_006841038.1| hypothetical protein AMTR_s00085p00132560 [Amborella trichopoda]
 gb|ERN02713.1| hypothetical protein AMTR_s00085p00132560 [Amborella trichopoda]
Length=162

 Score =   183 bits (465),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 109/139 (78%), Gaps = 3/139 (2%)
 Frame = +1

Query  127  SVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLT  306
            ++  A  GF++TRG HF++NG  FY NGFN YW++ +AS+PS R KV+  F+ ASS+GLT
Sbjct  25   NLALAQGGFVQTRGTHFIVNGSPFYVNGFNVYWMVQMASNPSTRGKVTSVFQQASSYGLT  84

Query  307  VARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQ  486
             ARTWAFSDGGYR LQ +PGSYNED+ KGLDFVI+EAR+YG+ ++LS  NNY+  GG+ Q
Sbjct  85   EARTWAFSDGGYRPLQISPGSYNEDMVKGLDFVISEARRYGVCLMLSFVNNYKDLGGRPQ  144

Query  487  YVDWARGKGQYLTSDDDFF  543
               WAR +GQ L+SDDD+F
Sbjct  145  ---WARNQGQSLSSDDDYF  160



>sp|Q9LW44.3|MANP_ARATH RecName: Full=Putative mannan endo-1,4-beta-mannosidase P; AltName: 
Full=Beta-mannanase P; AltName: Full=Endo-beta-1,4-mannanase 
P; Short=AtMANP; Flags: Precursor [Arabidopsis thaliana]
Length=408

 Score =   191 bits (484),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 117/157 (75%), Gaps = 1/157 (1%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
             V   S  G   A  +GF+   G+ F++NG  FYANGFNAYWL Y A+DP+ R+K++  F
Sbjct  12   IVIAQSYVGVEAAPSDGFVSRNGVQFILNGKPFYANGFNAYWLAYEATDPATRFKITNVF  71

Query  280  RGASSHGLTVARTWAFSDGG-YRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLAN  456
            + A+S GLT+ARTW F +G  YRALQ APGSY+E  F+GLDF IAEA++ G+K+I+ L N
Sbjct  72   QNATSLGLTIARTWGFRNGAIYRALQTAPGSYDEQTFQGLDFGIAEAKRVGIKLIIPLVN  131

Query  457  NYESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            N++ +GGKKQYVDWAR KG+ ++S+DDF+RN ++K F
Sbjct  132  NWDDYGGKKQYVDWARSKGEMVSSNDDFYRNPVIKEF  168



>ref|XP_008805817.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Phoenix dactylifera]
Length=390

 Score =   190 bits (483),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 118/150 (79%), Gaps = 0/150 (0%)
 Frame = +1

Query  118  LSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSH  297
            L G    AG+ F++T G HF+++G +FY+NGFNAYWLM +ASDP+QRYKVS   + AS +
Sbjct  18   LQGCSAYAGSSFVRTSGTHFVLDGRSFYSNGFNAYWLMLMASDPTQRYKVSSVLQQASDY  77

Query  298  GLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            G++V RTWAFSDGG   LQY+PG YNE++F+GLDFVI+EA+K+G+ +ILSL NNY  FGG
Sbjct  78   GMSVVRTWAFSDGGSNPLQYSPGYYNENMFQGLDFVISEAKKHGVFLILSLVNNYADFGG  137

Query  478  KKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            +KQYV WA+ +G  +  D+DF+ + +VKG+
Sbjct  138  RKQYVQWAKERGADVYWDNDFYWHEVVKGY  167



>ref|XP_003591288.1| Mannan endo-1,4-beta-mannosidase [Medicago truncatula]
 gb|AES61539.1| mannan endo-1,4-beta-mannosidase-like protein [Medicago truncatula]
Length=402

 Score =   190 bits (483),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 110/140 (79%), Gaps = 0/140 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF++ +G HF++NG T Y NGFN+YWL  +ASDPS   KV+  F+ AS HGL V RTWAF
Sbjct  28   GFVQRKGTHFILNGKTHYVNGFNSYWLTTMASDPSTSSKVTSTFQQASQHGLNVGRTWAF  87

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARG  507
            +DGGY+ALQ +PGSY+E+VFK LDFVI+EA KYG+K+ILSL NN+  FGGK +YV WA+ 
Sbjct  88   NDGGYKALQISPGSYDENVFKALDFVISEASKYGVKLILSLVNNWNDFGGKNKYVQWAKE  147

Query  508  KGQYLTSDDDFFRNSLVKGF  567
            +GQ + +DDDFF + +VK +
Sbjct  148  RGQNIKNDDDFFTHPVVKQY  167



>ref|XP_010490914.1| PREDICTED: mannan endo-1,4-beta-mannosidase 3-like isoform X1 
[Camelina sativa]
Length=417

 Score =   191 bits (484),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 115/153 (75%), Gaps = 1/153 (1%)
 Frame = +1

Query  112  SSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGAS  291
            S L G   A+ NGF+  +G+ F+ NG  FYANGFNAYWL Y A+DP+ R+K++ AF+ A+
Sbjct  19   SDLGGVEAASSNGFVTRKGVQFIFNGKPFYANGFNAYWLAYEATDPTTRFKITYAFQNAT  78

Query  292  SHGLTVARTWAFSDGG-YRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYES  468
            SHGLT+ARTW F DG  YR LQ +PGSY+E  F+GLDFVIAEA++ G+K+I++  NNY  
Sbjct  79   SHGLTIARTWGFRDGAIYRGLQTSPGSYDEKTFQGLDFVIAEAKRLGIKMIITFVNNYAD  138

Query  469  FGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            FGG+ QYV WA+  GQ ++SDDDF+ N LVK +
Sbjct  139  FGGRIQYVVWAKSIGQNVSSDDDFYTNPLVKQY  171



>ref|NP_001234473.1| (1-4)-beta-mannan endohydrolase precursor [Solanum lycopersicum]
 sp|Q6YM50.1|MAN5_SOLLC RecName: Full=Mannan endo-1,4-beta-mannosidase 5; AltName: Full=Beta-mannanase 
5; AltName: Full=Endo-beta-1,4-mannanase 5; 
AltName: Full=LeMAN5; Flags: Precursor [Solanum lycopersicum]
 sp|Q9FZ03.2|MAN2_SOLLC RecName: Full=Mannan endo-1,4-beta-mannosidase 2; AltName: Full=Beta-mannanase 
2; AltName: Full=Endo-beta-1,4-mannanase 2; 
AltName: Full=LeMAN2; Flags: Precursor [Solanum lycopersicum]
 gb|AAG00315.2|AF184238_1 (1-4)-beta-mannan endohydrolase precursor [Solanum lycopersicum]
 gb|AAM26920.1| mannan endo-1,4-beta-mannanase precursor [Solanum lycopersicum]
Length=414

 Score =   191 bits (484),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 108/144 (75%), Gaps = 0/144 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
            A   GF++  G HF +NG  F  NGFN+YWLM+VA++PS+RYKVSE  R ASS GL+V R
Sbjct  34   ANDQGFVRVNGAHFELNGSPFLFNGFNSYWLMHVAAEPSERYKVSEVLREASSAGLSVCR  93

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVD  495
            TWAFSDGG RALQ +PG Y+E VF+GLDFVI+EA+KYG+++ILS  NNY  FGGK QYV 
Sbjct  94   TWAFSDGGDRALQISPGVYDERVFQGLDFVISEAKKYGIRLILSFVNNYNDFGGKAQYVQ  153

Query  496  WARGKGQYLTSDDDFFRNSLVKGF  567
            WAR  G  +  DDDF+ N + K +
Sbjct  154  WARNAGAQINGDDDFYTNYITKNY  177



>emb|CAC08208.1| (1-4)-beta-mannan endohydrolase [Coffea arabica]
Length=427

 Score =   191 bits (484),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = +1

Query  130  VKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTV  309
            V ++ + FI+TRG  F++ GY F+ NGFN+YW+M+VA++PS+R+K+S  FR A++ GLTV
Sbjct  31   VSSSASRFIQTRGTRFVLGGYPFFFNGFNSYWMMHVAAEPSERHKISNVFREAAATGLTV  90

Query  310  ARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQY  489
             RTWAFSDGG RALQ +PG Y+E VF+ LDFV++EARKYG+ +ILSL NNY+ FGG+ QY
Sbjct  91   CRTWAFSDGGDRALQMSPGVYDERVFQALDFVVSEARKYGVHLILSLTNNYKDFGGRTQY  150

Query  490  VDWARGKGQYLTSDDDFFRNSLVKGF  567
            V WA+  G  + SDDDF+  + VKG+
Sbjct  151  VTWAKNAGVQVNSDDDFYTKNAVKGY  176



>gb|AED01931.1| Mannan endo-1,4-beta-mannosidase [Lepidium sativum]
Length=256

 Score =   186 bits (471),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = +1

Query  229  MYVASDPSQRYKVSEAFRGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVI  408
            MYVASDPSQR K+S AF+ AS HGLTVARTWAFSDGGYR LQ++PG+YNED+F+GLDF I
Sbjct  1    MYVASDPSQRPKISSAFQEASRHGLTVARTWAFSDGGYRPLQHSPGAYNEDMFQGLDFAI  60

Query  409  AEARKYGLKVILSLANNYESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            AEAR++GLK+ILS ANNY SFGGKKQYVDWAR +G  ++SDDDFF +SLVK F
Sbjct  61   AEARRHGLKMILSFANNYVSFGGKKQYVDWARSRGSPVSSDDDFFTDSLVKEF  113



>ref|XP_010911540.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Elaeis guineensis]
Length=390

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 117/150 (78%), Gaps = 0/150 (0%)
 Frame = +1

Query  118  LSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSH  297
            L G     G+GF++T G HF+++G  FY+NGFNAYWLM +ASDP+QRYKVS   + AS +
Sbjct  18   LQGGGAYVGSGFVRTSGTHFVLDGRPFYSNGFNAYWLMLMASDPTQRYKVSSVLQQASDY  77

Query  298  GLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            G++V RTWAFSDGG   LQY+PG YNE++F+GLDFVI+EA+K+G+ +ILSL NNY  FGG
Sbjct  78   GMSVVRTWAFSDGGSNPLQYSPGYYNENMFQGLDFVISEAKKHGVFLILSLVNNYADFGG  137

Query  478  KKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            +KQYV WA+ +G  +  D+DF+ + +VKG+
Sbjct  138  RKQYVQWAKERGADVHWDNDFYWHEVVKGY  167



>ref|XP_002456093.1| hypothetical protein SORBIDRAFT_03g030340 [Sorghum bicolor]
 gb|EES01213.1| hypothetical protein SORBIDRAFT_03g030340 [Sorghum bicolor]
Length=432

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 114/146 (78%), Gaps = 2/146 (1%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
            A G+ F++ +G  F+ NG  F+ANGFNAYWLM + +DP+QR KV+ A   A+  GL+VAR
Sbjct  28   AGGDAFVRVQGTRFVHNGKPFFANGFNAYWLMTLGADPAQRGKVTSALSQAAGAGLSVAR  87

Query  316  TWAFSDGGYR--ALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQY  489
            TWAF+DGG    ALQY+PG YNE+ F+GLDFV+AEARKYG+K+ILSL NNY+SFGG+KQY
Sbjct  88   TWAFNDGGGSSGALQYSPGRYNENTFQGLDFVLAEARKYGIKMILSLVNNYDSFGGRKQY  147

Query  490  VDWARGKGQYLTSDDDFFRNSLVKGF  567
            V WAR +GQ + SDD+FF N + KG 
Sbjct  148  VQWAREQGQAIGSDDEFFTNPVAKGL  173



>ref|XP_010038519.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Eucalyptus 
grandis]
Length=403

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 109/140 (78%), Gaps = 0/140 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF+ T GIHF+ NG   Y NGFNAYW+MY+ASDPS R KV+  F+ A+ +G+ +ARTWAF
Sbjct  30   GFVGTNGIHFVANGKPLYLNGFNAYWMMYMASDPSTRDKVASVFQEAAKNGMNMARTWAF  89

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARG  507
            SDG  RALQ +PG YNED+FKGLDFVI+EAR+ G+ +I+SL NN+  FGGK QYV WAR 
Sbjct  90   SDGVNRALQISPGIYNEDMFKGLDFVISEARRNGVYLIVSLVNNWNEFGGKNQYVRWARD  149

Query  508  KGQYLTSDDDFFRNSLVKGF  567
             GQ L +DD+FF NS+ +G+
Sbjct  150  SGQSLNNDDEFFTNSVTRGY  169



>gb|KCW46726.1| hypothetical protein EUGRSUZ_K00548, partial [Eucalyptus grandis]
Length=380

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 109/140 (78%), Gaps = 0/140 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF+ T GIHF+ NG   Y NGFNAYW+MY+ASDPS R KV+  F+ A+ +G+ +ARTWAF
Sbjct  7    GFVGTNGIHFVANGKPLYLNGFNAYWMMYMASDPSTRDKVASVFQEAAKNGMNMARTWAF  66

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARG  507
            SDG  RALQ +PG YNED+FKGLDFVI+EAR+ G+ +I+SL NN+  FGGK QYV WAR 
Sbjct  67   SDGVNRALQISPGIYNEDMFKGLDFVISEARRNGVYLIVSLVNNWNEFGGKNQYVRWARD  126

Query  508  KGQYLTSDDDFFRNSLVKGF  567
             GQ L +DD+FF NS+ +G+
Sbjct  127  SGQSLNNDDEFFTNSVTRGY  146



>gb|KHG12601.1| Mannan endo-1,4-beta-mannosidase 4 [Gossypium arboreum]
Length=411

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
            A G GF++T    F+ING  FY NGFNAYW+M  ASD S R KV++AFR AS +G+ +AR
Sbjct  33   AGGTGFVQTTATKFVINGKPFYLNGFNAYWMMMFASDNSTRSKVTDAFREASKYGMNIAR  92

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVD  495
            TWAF+DG Y+ LQ +PGSYNEDVFKGLDFV+AEA KYG+ +ILSLANN++ +GGK +YV 
Sbjct  93   TWAFNDGDYKPLQNSPGSYNEDVFKGLDFVVAEANKYGIHLILSLANNFKDYGGKDKYVQ  152

Query  496  WARGKGQYLTSDDDFFRNSLVKGF  567
            WA+ + + L+ +DDFF +S+VK +
Sbjct  153  WAKQRSRNLSKEDDFFTDSVVKKY  176



>ref|XP_006444660.1| hypothetical protein CICLE_v10020376mg [Citrus clementina]
 gb|ESR57900.1| hypothetical protein CICLE_v10020376mg [Citrus clementina]
 gb|KDO86723.1| hypothetical protein CISIN_1g015179mg [Citrus sinensis]
Length=412

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +1

Query  151  FIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFS  330
            F +T G HF +NG   Y NGFNAYW++Y A DPS + KV+ AF+ A+ +G+ +ARTWAFS
Sbjct  36   FAQTNGSHFAVNGKPLYLNGFNAYWMLYYAGDPSTKAKVTAAFQQATKYGMNIARTWAFS  95

Query  331  DGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARGK  510
            DGGYRALQ +PGSYNED FK LDFV+AEAR+YG+ VILSL NN++ +GG+ +YV+WAR +
Sbjct  96   DGGYRALQVSPGSYNEDTFKALDFVVAEAREYGVYVILSLVNNFKEYGGRPRYVEWARER  155

Query  511  GQYLTSDDDFFRNSLVKGF  567
            GQ L ++DDF+ N++VK +
Sbjct  156  GQSLKNEDDFYTNAVVKQY  174



>ref|XP_006491440.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Citrus sinensis]
Length=412

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +1

Query  151  FIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFS  330
            F +T G HF +NG   Y NGFNAYW++Y A DPS + KV+ AF+ A+ +G+ +ARTWAFS
Sbjct  36   FAQTNGSHFAVNGKPLYLNGFNAYWMLYYAGDPSTKAKVTAAFQQATKYGMNIARTWAFS  95

Query  331  DGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARGK  510
            DGGYRALQ +PGSYNED FK LDFV+AEAR+YG+ VILSL NN++ +GG+ +YV+WAR +
Sbjct  96   DGGYRALQVSPGSYNEDTFKALDFVVAEAREYGVYVILSLVNNFKEYGGRPRYVEWARER  155

Query  511  GQYLTSDDDFFRNSLVKGF  567
            GQ L ++DDF+ N++VK +
Sbjct  156  GQSLKNEDDFYTNAVVKQY  174



>gb|KCW46728.1| hypothetical protein EUGRSUZ_K00551 [Eucalyptus grandis]
Length=387

 Score =   189 bits (479),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = +1

Query  142  GNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTW  321
            G+GF +T GIHF+ NG   Y NGFNAYW+MY+ASDPS R KV+ A + A+ +G+ +ARTW
Sbjct  28   GSGFARTNGIHFVANGKPLYLNGFNAYWMMYMASDPSTRDKVTSALQEAAKNGMNIARTW  87

Query  322  AFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWA  501
            AFSDGGYRALQ +PG YN+D+FKGLDFVI+EA K G+ +ILSL NN++ +G KKQYV WA
Sbjct  88   AFSDGGYRALQTSPGVYNQDMFKGLDFVISEAGKNGVYLILSLVNNWKVYGAKKQYVQWA  147

Query  502  RGKGQYLTSDDDFFRNSLVKGF  567
            +  GQ + +D++FF +S+ KG+
Sbjct  148  QSNGQSIKNDNEFFTSSVTKGY  169



>ref|XP_006356528.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5-like [Solanum tuberosum]
Length=413

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 108/144 (75%), Gaps = 0/144 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
            A   GF++  G HF +NG  F  NGFN+YWLM+VA++PS+RYKV+E  R ASS GL+V R
Sbjct  33   ANDQGFVRVNGAHFELNGSPFLFNGFNSYWLMHVAAEPSERYKVTEVLREASSAGLSVCR  92

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVD  495
            TWAFSDGG RALQ +PG Y+E VF+GLDFVI+EA+KYG+++ILS  NNY  FGGK QYV 
Sbjct  93   TWAFSDGGDRALQISPGVYDERVFQGLDFVISEAKKYGVRLILSFVNNYNDFGGKAQYVQ  152

Query  496  WARGKGQYLTSDDDFFRNSLVKGF  567
            WAR  G  +  DDDF+ N + K +
Sbjct  153  WARNAGAQINGDDDFYTNYITKDY  176



>ref|XP_006300114.1| hypothetical protein CARUB_v10016343mg [Capsella rubella]
 gb|EOA33012.1| hypothetical protein CARUB_v10016343mg [Capsella rubella]
Length=416

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 113/149 (76%), Gaps = 1/149 (1%)
 Frame = +1

Query  124  GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGL  303
            G    +  GF+  +G+ F++NG  FYA+GFNAYWL Y A+DP+ RYK++ A   A  HGL
Sbjct  22   GVEATSSEGFVSRKGVQFILNGKPFYADGFNAYWLTYEATDPTARYKITHACENAIRHGL  81

Query  304  TVARTWAFSDGG-YRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGK  480
            T+ARTW F+DG  YRALQ APG Y+E+ F+GLDFVI+EA++ GLK+I++  NN+  +GGK
Sbjct  82   TIARTWGFNDGASYRALQTAPGFYDENTFQGLDFVISEAKRVGLKMIITFVNNWSDYGGK  141

Query  481  KQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            KQYVDWA+ KG+ ++SDDDF+ NSL K F
Sbjct  142  KQYVDWAKSKGEKVSSDDDFYTNSLTKQF  170



>ref|XP_009135138.1| PREDICTED: mannan endo-1,4-beta-mannosidase 3-like isoform X1 
[Brassica rapa]
Length=415

 Score =   189 bits (480),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
             + +GF+  +G+ F++NG  FYANGFNAYWLMY A+DP+ RYKV+ A   A+  GLT+AR
Sbjct  26   VSSDGFVSRKGVQFILNGEPFYANGFNAYWLMYEATDPNTRYKVTHALENAAGQGLTIAR  85

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVD  495
            TW F DGGYRALQ   GSY+E  F+GLDF IAEA++ G+K+I++  NN+  FGGKKQY+ 
Sbjct  86   TWGFRDGGYRALQTNLGSYDEQTFQGLDFAIAEAKRVGIKMIIAFVNNFPDFGGKKQYMA  145

Query  496  WARGKGQYLTSDDDFFRNSLVK  561
            WA+ KGQ +TS+DDF+ N+L+K
Sbjct  146  WAKDKGQAVTSEDDFYTNALLK  167



>ref|XP_009135139.1| PREDICTED: mannan endo-1,4-beta-mannosidase 3-like isoform X2 
[Brassica rapa]
Length=414

 Score =   189 bits (480),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
             + +GF+  +G+ F++NG  FYANGFNAYWLMY A+DP+ RYKV+ A   A+  GLT+AR
Sbjct  25   VSSDGFVSRKGVQFILNGEPFYANGFNAYWLMYEATDPNTRYKVTHALENAAGQGLTIAR  84

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVD  495
            TW F DGGYRALQ   GSY+E  F+GLDF IAEA++ G+K+I++  NN+  FGGKKQY+ 
Sbjct  85   TWGFRDGGYRALQTNLGSYDEQTFQGLDFAIAEAKRVGIKMIIAFVNNFPDFGGKKQYMA  144

Query  496  WARGKGQYLTSDDDFFRNSLVK  561
            WA+ KGQ +TS+DDF+ N+L+K
Sbjct  145  WAKDKGQAVTSEDDFYTNALLK  166



>ref|XP_010464782.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 4 [Camelina 
sativa]
Length=406

 Score =   188 bits (478),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 114/148 (77%), Gaps = 2/148 (1%)
 Frame = +1

Query  130  VKAAGN-GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLT  306
            V+A  N GF+   G+ F++NG  FYANGFNAYWL Y A+DP+ RYK++ AF+ A SHGLT
Sbjct  24   VEAVPNDGFVTRNGLQFILNGKPFYANGFNAYWLTYEATDPTARYKITNAFQDAISHGLT  83

Query  307  VARTWAFSDGG-YRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKK  483
            +ARTW F DG  YRALQ +PG Y+E  F+GLDFVIAEA++ G+K+I+ L NN+  +GG+K
Sbjct  84   IARTWGFHDGAIYRALQTSPGIYDEQTFQGLDFVIAEAKRLGIKMIMPLVNNWSDYGGRK  143

Query  484  QYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            QYV WA+ +G+ ++SDDDF+ NSL K F
Sbjct  144  QYVAWAQSRGEKVSSDDDFYTNSLTKQF  171



>gb|EYU22710.1| hypothetical protein MIMGU_mgv1a023976mg, partial [Erythranthe 
guttata]
Length=383

 Score =   188 bits (477),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 110/139 (79%), Gaps = 0/139 (0%)
 Frame = +1

Query  151  FIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFS  330
            F++TRG HF+++G  F  NGFN+YW+M+VA+DP+QRYKVSE FR AS+ GL+V RTWAFS
Sbjct  12   FVRTRGSHFVLHGSPFLFNGFNSYWMMHVAADPNQRYKVSEVFREASAAGLSVCRTWAFS  71

Query  331  DGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARGK  510
            DGG   LQ +PG+Y+E VF+GLDFV++EARKYG+++ILSL NNY  FGG+ QY  W R  
Sbjct  72   DGGDLPLQISPGTYDERVFQGLDFVVSEARKYGIRLILSLVNNYNDFGGRPQYAKWGRNA  131

Query  511  GQYLTSDDDFFRNSLVKGF  567
            G  + +DDDF+ + L+K +
Sbjct  132  GAQINTDDDFYTHPLLKDY  150



>ref|XP_003591289.1| NADH dehydrogenase subunit F [Medicago truncatula]
Length=560

 Score =   191 bits (486),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 113/143 (79%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
             G GF++ +GIHF++NG T Y NGFN++WLM +A+D S R KV+ AF+ AS HGL V RT
Sbjct  27   VGVGFVQRKGIHFLMNGKTHYVNGFNSHWLMIMAADLSTRPKVTSAFQQASQHGLNVGRT  86

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAF+DGGY+ALQ +PG Y+E VF+GLDFVI+EA KYG+K+ILSLANN+ +FGGK +YV W
Sbjct  87   WAFNDGGYKALQISPGFYDETVFQGLDFVISEASKYGVKLILSLANNWNNFGGKNKYVQW  146

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR  G  + +DDDFF + LVK +
Sbjct  147  AREHGHNIKNDDDFFTHPLVKPY  169



>ref|XP_003591290.1| Mannan endo-1,4-beta-mannosidase [Medicago truncatula]
 gb|AES61541.1| mannan endo-1,4-beta-mannosidase-like protein [Medicago truncatula]
Length=458

 Score =   189 bits (480),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 112/143 (78%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
             G GF++ +G HF++NG T Y NGFN+YWLM +ASDPS   KV+  F+ AS HGL V RT
Sbjct  85   VGGGFVQRKGTHFILNGKTHYVNGFNSYWLMIMASDPSTSSKVTSNFQQASRHGLNVGRT  144

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WA +DGGY+ALQ +PG Y+E+VF+GLDFVI+E++KYG+++IL L NN+ + GGK +YV W
Sbjct  145  WACNDGGYKALQISPGKYDENVFRGLDFVISESKKYGVQLILGLVNNWNALGGKHKYVQW  204

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +GQ++ SDDDFF + +VK +
Sbjct  205  ARERGQHVKSDDDFFTHPVVKQY  227



>ref|XP_009621242.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009621243.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1 isoform X2 [Nicotiana 
tomentosiformis]
Length=411

 Score =   187 bits (476),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 111/145 (77%), Gaps = 0/145 (0%)
 Frame = +1

Query  133  KAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVA  312
            + A  GFI  +G HF +NG  F  NGFN+YWLM+VA++PS+RYKV+E F+ AS+ GL+V 
Sbjct  27   RNANVGFIAVKGAHFELNGSPFLFNGFNSYWLMHVAAEPSERYKVTEVFKDASAAGLSVC  86

Query  313  RTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYV  492
            RTWAFSDGG RALQ +PG Y+E VF+GLDFVI+EA+KYG+++ILS  NN+  FGGK QY 
Sbjct  87   RTWAFSDGGDRALQISPGIYDERVFQGLDFVISEAKKYGVRLILSFVNNWNDFGGKAQYA  146

Query  493  DWARGKGQYLTSDDDFFRNSLVKGF  567
             WAR  G  + SDDDF+ + ++K +
Sbjct  147  QWARNAGAQINSDDDFYTHPMLKSY  171



>ref|XP_010064850.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5-like [Eucalyptus 
grandis]
 gb|KCW69494.1| hypothetical protein EUGRSUZ_F02943 [Eucalyptus grandis]
Length=405

 Score =   187 bits (476),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 112/143 (78%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GF++ RG  F++N   F  NGFN+YW+M VA++PS R KVS  FR A++ GL+V RT
Sbjct  27   APSGFVQVRGTQFILNSSPFLFNGFNSYWMMNVATEPSDRIKVSNVFREATAAGLSVCRT  86

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAFSDGG RALQ +PG Y+E VF+ LDF+I+EAR+YG+++ILSL+NNY +FGG+ QYV W
Sbjct  87   WAFSDGGDRALQTSPGVYDEHVFQALDFMISEARRYGVRLILSLSNNYHNFGGRPQYVQW  146

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR  G  + SDDDF+ N++VKG+
Sbjct  147  ARNAGVAINSDDDFYTNAVVKGY  169



>gb|KDP28371.1| hypothetical protein JCGZ_14142 [Jatropha curcas]
Length=401

 Score =   187 bits (475),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 108/140 (77%), Gaps = 1/140 (1%)
 Frame = +1

Query  151  FIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFS  330
            F KT G HF IN    Y NGFNAYW+MY+ASDPS R KV+ A++ AS +G+ +ARTWAFS
Sbjct  33   FAKTTGTHFTINNKPLYLNGFNAYWMMYMASDPSTRAKVTSAYQQASKNGMNIARTWAFS  92

Query  331  DGGY-RALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARG  507
            DGG  R LQ +PGSYNE  FKGLDFVI+EA K+G+ VILSL NN++ +GGK QYV+WAR 
Sbjct  93   DGGTDRPLQISPGSYNEVTFKGLDFVISEAGKHGMYVILSLVNNFKEYGGKAQYVEWARQ  152

Query  508  KGQYLTSDDDFFRNSLVKGF  567
            +GQ L+SDDDF+ N  VK +
Sbjct  153  RGQQLSSDDDFYTNPTVKAY  172



>ref|XP_008800333.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 9 [Phoenix 
dactylifera]
Length=398

 Score =   187 bits (475),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 109/141 (77%), Gaps = 0/141 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A + F +T G HF++NG  F++NGFNAYWLM  ASDP+QR  VS  F+ AS +G++V RT
Sbjct  25   ASSSFARTSGTHFVVNGGPFFSNGFNAYWLMLKASDPTQRDTVSSTFQQASGYGMSVIRT  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAFSDGG  ALQY+PGSYNE++FKGLDFVI+EA+ +G+ +ILS  NNY  FGG+KQYV W
Sbjct  85   WAFSDGGDSALQYSPGSYNEEMFKGLDFVISEAKNHGVYLILSFVNNYADFGGRKQYVRW  144

Query  499  ARGKGQYLTSDDDFFRNSLVK  561
            A   GQ L+SDDDF+ N  VK
Sbjct  145  ATDMGQSLSSDDDFYSNDAVK  165



>ref|XP_009593808.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Nicotiana 
tomentosiformis]
Length=409

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 110/145 (76%), Gaps = 0/145 (0%)
 Frame = +1

Query  133  KAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVA  312
            + A  GFI   G HF +NG  F  NGFN+YWLM+VA+DP++RYKV+E  R AS+ GL++ 
Sbjct  27   RNANAGFIAVNGAHFELNGSPFLFNGFNSYWLMHVAADPTERYKVTEVLRDASAAGLSIC  86

Query  313  RTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYV  492
            RTWAFSDGG RALQ +PG Y+E VF+GLDFVI+EA+KYG+++ILS  NN+  FGGK QYV
Sbjct  87   RTWAFSDGGDRALQISPGVYDEHVFQGLDFVISEAKKYGVRLILSFVNNWNDFGGKAQYV  146

Query  493  DWARGKGQYLTSDDDFFRNSLVKGF  567
             WAR  G  ++ DDDF+ + ++K +
Sbjct  147  QWARNVGAQISGDDDFYTHPMLKDY  171



>ref|XP_002454605.1| hypothetical protein SORBIDRAFT_04g034200 [Sorghum bicolor]
 gb|EES07581.1| hypothetical protein SORBIDRAFT_04g034200 [Sorghum bicolor]
Length=411

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 111/149 (74%), Gaps = 1/149 (1%)
 Frame = +1

Query  124  GSVKAAGNG-FIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHG  300
            G+ + AGN  F K  G  F + G  FY+NGFNAYWLMY+ASDP+ R K + A   A+  G
Sbjct  28   GAGELAGNAAFAKASGTRFTLGGRPFYSNGFNAYWLMYMASDPADRSKATAALDEAARVG  87

Query  301  LTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGK  480
             T+ RTWAFSDGGYRALQ +PG YNE VF+GLD+VI+EA+K G+ +ILSL NN++ +GGK
Sbjct  88   ATLVRTWAFSDGGYRALQVSPGVYNEQVFRGLDYVISEAKKRGIHLILSLVNNWDGYGGK  147

Query  481  KQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            KQYV WAR +G  L SDDDFF NS+ KGF
Sbjct  148  KQYVQWARTQGHNLNSDDDFFTNSVTKGF  176



>emb|CBI17041.3| unnamed protein product [Vitis vinifera]
Length=339

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 113/151 (75%), Gaps = 0/151 (0%)
 Frame = +1

Query  115  SLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASS  294
            +    V    +GF++TR   F +NG  F+ NGFN+YW+M VA+DPSQR KVS+ F  A++
Sbjct  20   ACEARVLLQSSGFVQTRNTQFTLNGSPFFFNGFNSYWMMNVAADPSQRSKVSDVFSQAAA  79

Query  295  HGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFG  474
              L+V RTWAF+DGG +ALQ +PG Y+E VF+GLDFVI+EARK G+++ILSL+NNY+ FG
Sbjct  80   VRLSVCRTWAFNDGGTQALQISPGVYDERVFQGLDFVISEARKNGVRLILSLSNNYKDFG  139

Query  475  GKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            G+ QYV WAR  G  + SDDDF+ N +VKG+
Sbjct  140  GRPQYVSWARNAGAPVNSDDDFYTNEVVKGY  170



>emb|CDP20125.1| unnamed protein product [Coffea canephora]
Length=427

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = +1

Query  130  VKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTV  309
            V ++ + FI+TRG  F++ G  F+ NGFN+YW+M+VA++PS+R+K+S  FR A++ GLTV
Sbjct  31   VSSSASRFIQTRGTRFVLGGSPFFFNGFNSYWMMHVAAEPSERHKISNVFREAAAAGLTV  90

Query  310  ARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQY  489
             RTWAFSDGG RALQ +PG Y+E VF+ LDFV++EARKYG+ +ILSL NNY+ FGG+ QY
Sbjct  91   CRTWAFSDGGDRALQMSPGVYDERVFQALDFVVSEARKYGVHLILSLTNNYKDFGGRAQY  150

Query  490  VDWARGKGQYLTSDDDFFRNSLVKGF  567
            V WA+  G  + SDDDF+  + VKG+
Sbjct  151  VTWAKNAGVQVNSDDDFYTKNAVKGY  176



>gb|EYU22711.1| hypothetical protein MIMGU_mgv1a025294mg [Erythranthe guttata]
Length=406

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 112/141 (79%), Gaps = 2/141 (1%)
 Frame = +1

Query  151  FIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFS  330
            F++TRG  FM++   F  NGFNAYW+M+VASDP+QRYKVS   R +++ GL+V RTWAF+
Sbjct  29   FVQTRGTQFMLDNSPFLFNGFNAYWMMHVASDPTQRYKVSNVLRESAAAGLSVCRTWAFN  88

Query  331  DGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARGK  510
            DGG +ALQ +PG Y+E+VF+ LDFV++EARKY +++I+SL+NNY+ FGG+ QYV+WAR  
Sbjct  89   DGGSQALQISPGVYDENVFQALDFVVSEARKYKIRLIMSLSNNYQDFGGRAQYVNWARNA  148

Query  511  GQYLTS--DDDFFRNSLVKGF  567
            G  LTS  DDDF+ N  VKG+
Sbjct  149  GVQLTSAGDDDFYTNQAVKGY  169



>ref|XP_010246810.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Nelumbo nucifera]
Length=423

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 116/158 (73%), Gaps = 2/158 (1%)
 Frame = +1

Query  100  FVQQSSLSGSVKA--AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSE  273
            F Q       V+A  A   F++  G+HF  NG  FY NGFNAYWLM +ASDP +R  V+ 
Sbjct  26   FFQDHQQGNRVRADDAAGVFVRRSGVHFTKNGNPFYFNGFNAYWLMLMASDPLERGNVTS  85

Query  274  AFRGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLA  453
             F+ A+++G+TVARTWAFSDGG   LQ +PG+YNE++FKGLD VI+EA KYG+ +ILSL 
Sbjct  86   VFQEATNYGMTVARTWAFSDGGSSPLQSSPGTYNEEMFKGLDLVISEAGKYGISLILSLV  145

Query  454  NNYESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            NNY  FGG+KQYV WA  +G+ L+S+DDF+ N+LVKG+
Sbjct  146  NNYPDFGGRKQYVQWAMDRGEDLSSEDDFYTNALVKGY  183



>ref|XP_010943133.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 9 [Elaeis 
guineensis]
Length=411

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 108/140 (77%), Gaps = 0/140 (0%)
 Frame = +1

Query  142  GNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTW  321
            G GFIK  GIHF+I+   FY+NGFNAYWLMY+ASDP+ R KVS   + A+S GL V RTW
Sbjct  26   GMGFIKPSGIHFIIDSQPFYSNGFNAYWLMYMASDPNDRTKVSPTLQKAASLGLKVIRTW  85

Query  322  AFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWA  501
            AF+DGGYRALQ +PG YNE  F+GLD+VI+EA+K G+ +IL+L NN+  FGGK +YV WA
Sbjct  86   AFNDGGYRALQESPGQYNEATFQGLDYVISEAKKNGVYLILTLVNNWGDFGGKSKYVQWA  145

Query  502  RGKGQYLTSDDDFFRNSLVK  561
            R +GQ ++SDD FF N + K
Sbjct  146  RDQGQTISSDDGFFSNEVAK  165



>ref|XP_007216338.1| hypothetical protein PRUPE_ppa020168mg, partial [Prunus persica]
 gb|EMJ17537.1| hypothetical protein PRUPE_ppa020168mg, partial [Prunus persica]
Length=391

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 109/137 (80%), Gaps = 2/137 (1%)
 Frame = +1

Query  163  RGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFSDG--  336
             G  F++NG  FY NGFNAYW+MY+ASDPS R KV+ AF+ AS +G+ VARTWAF+DG  
Sbjct  25   EGTRFVMNGRPFYINGFNAYWMMYMASDPSSRAKVTSAFQQASRYGMNVARTWAFNDGRG  84

Query  337  GYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARGKGQ  516
              R LQ +PGSYNED FKGLDFVI+EA+K+G+ VILS  NN+  FGG+KQYV WAR +GQ
Sbjct  85   KDRPLQPSPGSYNEDTFKGLDFVISEAKKFGVHVILSFVNNFSDFGGRKQYVQWARDRGQ  144

Query  517  YLTSDDDFFRNSLVKGF  567
             ++SDDDF+ N+++KG+
Sbjct  145  PISSDDDFYSNAVIKGY  161



>ref|XP_008805818.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Phoenix dactylifera]
Length=390

 Score =   186 bits (471),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 116/150 (77%), Gaps = 0/150 (0%)
 Frame = +1

Query  118  LSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSH  297
            L G    AG+ F++T G HF+++G +FY+NGFNAYWLM +ASDP+QRYKVS   + AS +
Sbjct  18   LQGGSAYAGSSFVRTSGTHFVLDGRSFYSNGFNAYWLMLMASDPTQRYKVSSVLQQASDY  77

Query  298  GLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            G++V RTWAFSDGG   LQY+P  YNE++F+GLDFVI+EA+K+G+ +ILSL NNY  FGG
Sbjct  78   GMSVVRTWAFSDGGSNPLQYSPAYYNENMFQGLDFVISEAKKHGVFLILSLVNNYADFGG  137

Query  478  KKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            +KQYV WA+ +G  +  D+DF+ + +VK +
Sbjct  138  RKQYVQWAKERGADVYWDNDFYWHEVVKSY  167



>ref|XP_009789471.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like isoform X1 
[Nicotiana sylvestris]
Length=407

 Score =   186 bits (472),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 110/145 (76%), Gaps = 0/145 (0%)
 Frame = +1

Query  133  KAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVA  312
            K A  GFI   G HF +NG +F  NGFN+YWLM+VA++PS+RYKV+E  + AS+ GL+V 
Sbjct  27   KNANVGFIAVNGAHFELNGSSFLFNGFNSYWLMHVAAEPSERYKVTEVLKDASAAGLSVC  86

Query  313  RTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYV  492
            RTWAFSDGG RALQ +PG Y+E VF+GLDFVI+EA+KYG+++ILS  NN+  FGGK QYV
Sbjct  87   RTWAFSDGGDRALQISPGVYDERVFQGLDFVISEAKKYGVRLILSFVNNWNDFGGKAQYV  146

Query  493  DWARGKGQYLTSDDDFFRNSLVKGF  567
             WAR  G  +  DDDF+ + ++K +
Sbjct  147  QWARNVGAQINGDDDFYTHPMLKDY  171



>emb|CDP11079.1| unnamed protein product [Coffea canephora]
Length=391

 Score =   185 bits (470),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 109/145 (75%), Gaps = 0/145 (0%)
 Frame = +1

Query  127  SVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLT  306
            +V   G GF++T+G  F++NG  F  NGFN+YWLM+VA+DP +RYKVSE  R AS+ GL+
Sbjct  34   TVPRNGAGFVRTQGPRFVLNGSPFLFNGFNSYWLMHVAADPKERYKVSEVLRDASAAGLS  93

Query  307  VARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQ  486
            V RTWAF DGG RALQ +PG Y+E VF+ LDFVI+EA K+G+++ILS  NNY  FGGK Q
Sbjct  94   VCRTWAFGDGGDRALQISPGIYDERVFQALDFVISEANKHGIRLILSFVNNYNDFGGKGQ  153

Query  487  YVDWARGKGQYLTSDDDFFRNSLVK  561
            Y  WAR  G ++ SDDDF+ +S +K
Sbjct  154  YAQWARNAGAHVNSDDDFYTHSTIK  178



>ref|XP_008778491.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 9 [Phoenix 
dactylifera]
Length=451

 Score =   186 bits (473),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 108/140 (77%), Gaps = 0/140 (0%)
 Frame = +1

Query  142  GNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTW  321
            G GF+K  G HF+I+G  FY+NGFNAYWLMY+ASDP+ R KVS   + ASS GL V RTW
Sbjct  66   GTGFVKPNGNHFVIDGQPFYSNGFNAYWLMYMASDPNDRAKVSPTLQQASSLGLKVIRTW  125

Query  322  AFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWA  501
            AF+DGG RALQ +PG YNE  F+GLD+VI+EA+K G+ +IL+L NN+  FGGK +YV WA
Sbjct  126  AFNDGGSRALQESPGQYNEATFQGLDYVISEAKKNGVYLILTLVNNWGDFGGKSKYVQWA  185

Query  502  RGKGQYLTSDDDFFRNSLVK  561
            R +GQ ++SDDDFF N + K
Sbjct  186  RDQGQSISSDDDFFSNEVAK  205



>ref|XP_008778492.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 9 [Phoenix 
dactylifera]
Length=411

 Score =   186 bits (471),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 108/140 (77%), Gaps = 0/140 (0%)
 Frame = +1

Query  142  GNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTW  321
            G GF+K  G HF+I+G  FY+NGFNAYWLMY+ASDP+ R KVS   + ASS GL V RTW
Sbjct  26   GTGFVKPNGNHFVIDGQPFYSNGFNAYWLMYMASDPNDRAKVSPTLQQASSLGLKVIRTW  85

Query  322  AFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWA  501
            AF+DGG RALQ +PG YNE  F+GLD+VI+EA+K G+ +IL+L NN+  FGGK +YV WA
Sbjct  86   AFNDGGSRALQESPGQYNEATFQGLDYVISEAKKNGVYLILTLVNNWGDFGGKSKYVQWA  145

Query  502  RGKGQYLTSDDDFFRNSLVK  561
            R +GQ ++SDDDFF N + K
Sbjct  146  RDQGQSISSDDDFFSNEVAK  165



>ref|XP_002270023.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5 [Vitis vinifera]
 emb|CBI17043.3| unnamed protein product [Vitis vinifera]
Length=403

 Score =   185 bits (470),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = +1

Query  130  VKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTV  309
            V    +GF++TR   F++NG  F+ NGFN+YW+M VA+DPSQR KVS+ F  A++  L+V
Sbjct  25   VLLQSSGFVQTRNTQFILNGSPFFFNGFNSYWMMNVAADPSQRSKVSDVFSQATAARLSV  84

Query  310  ARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQY  489
             RTWAF+DGG +ALQ +PG Y+E VF+GLDFVI+EARK G+ +ILSL+NNY+ FGG+ QY
Sbjct  85   CRTWAFNDGGSQALQISPGVYDERVFQGLDFVISEARKNGVHLILSLSNNYKDFGGRPQY  144

Query  490  VDWARGKGQYLTSDDDFFRNSLVKGF  567
            V WAR  G  + SDDDF+ N +VKG+
Sbjct  145  VSWARNAGAPVNSDDDFYTNEVVKGY  170



>ref|NP_001146694.1| putative endo-1,4-beta-mannosidase family protein precursor [Zea 
mays]
 gb|ACL54560.1| unknown [Zea mays]
 gb|AFW64344.1| putative endo-1,4-beta-mannosidase family protein [Zea mays]
Length=388

 Score =   184 bits (468),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 107/143 (75%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A   F +  G  F I G  FY+NGFNAYWLMY+ASDP+ R K + A   A+  G T+ RT
Sbjct  30   ADAAFARASGTRFTIGGRPFYSNGFNAYWLMYMASDPADRSKATAALDEAARLGATLVRT  89

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAFSDGGYRALQ +PG Y+E+VF+GLD+VI+EA+K G+ +ILSL NN++ +GGKKQYV W
Sbjct  90   WAFSDGGYRALQVSPGVYDEEVFRGLDYVISEAKKRGIHLILSLVNNWDGYGGKKQYVQW  149

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +G  L SDDDFF +S+ KGF
Sbjct  150  ARTQGHSLNSDDDFFTDSVTKGF  172



>ref|XP_003634618.1| PREDICTED: LOW QUALITY PROTEIN: mannan endo-1,4-beta-mannosidase 
5-like [Vitis vinifera]
Length=403

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = +1

Query  130  VKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTV  309
            V    +GF++TR   F +NG  F+ NGFN+YW+M VA+DPSQR KVS+ F  A++  L+V
Sbjct  25   VLLQSSGFVQTRNTQFTLNGSPFFFNGFNSYWMMNVAADPSQRSKVSDVFSQAAAVRLSV  84

Query  310  ARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQY  489
             RTWAF+DGG +ALQ +PG Y+E VF+GLDFVI+EARK G+++ILSL+NNY+ FGG+ QY
Sbjct  85   CRTWAFNDGGTQALQISPGVYDERVFQGLDFVISEARKNGVRLILSLSNNYKDFGGRPQY  144

Query  490  VDWARGKGQYLTSDDDFFRNSLVKGF  567
            V WAR  G  + SDDDF+ N +VKG+
Sbjct  145  VSWARNAGAPVNSDDDFYTNEVVKGY  170



>emb|CBI17044.3| unnamed protein product [Vitis vinifera]
Length=449

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 119/156 (76%), Gaps = 4/156 (3%)
 Frame = +1

Query  112  SSLSGSVKA----AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
            SS S + +A      +GF++TR   F++NG  F+ NGFN+YW+M VA+DPSQR KVS+ F
Sbjct  78   SSCSPTCEARVLLQSSGFVQTRNTQFILNGSPFFFNGFNSYWMMNVAADPSQRSKVSDVF  137

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
              A++  L+V RTWAF+DGG +ALQ +PG Y+E VF+GLDFVI+EA+K G+++ILSL+NN
Sbjct  138  SQAAAARLSVCRTWAFNDGGTQALQISPGVYDERVFQGLDFVISEAKKNGVRLILSLSNN  197

Query  460  YESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            Y+ FGG+ QYV+WAR  G  + SDDDF+ N +VKG+
Sbjct  198  YKDFGGRPQYVNWARNAGAPVNSDDDFYANEVVKGY  233



>ref|XP_009616037.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5-like [Nicotiana 
tomentosiformis]
Length=440

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 110/140 (79%), Gaps = 0/140 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF++T+G HF++NG  F  NGFN+YWLM+VA+DP++RYKVSE F+ AS+  L+V RTWAF
Sbjct  33   GFVRTKGAHFVLNGSPFLFNGFNSYWLMHVAADPTERYKVSEVFQEASAASLSVCRTWAF  92

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARG  507
            SDGG  ALQ +PG Y+E VF GLDFVI+EARKYG+++ILS  NNY+ FGG+ QY  W + 
Sbjct  93   SDGGDTALQISPGVYDERVFLGLDFVISEARKYGIRLILSFVNNYKDFGGRSQYAQWGKN  152

Query  508  KGQYLTSDDDFFRNSLVKGF  567
             G  + SDDDF+ +S++K +
Sbjct  153  AGIQINSDDDFYTHSVLKDY  172



>ref|XP_009785847.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5-like [Nicotiana 
sylvestris]
Length=443

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 110/140 (79%), Gaps = 0/140 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF++T+G HF++NG  F  NGFN+YWLM+VA+DP++RYKVSE F+ AS+  L+V RTWAF
Sbjct  31   GFVRTKGAHFVLNGSPFLFNGFNSYWLMHVAADPTERYKVSEVFQEASAASLSVCRTWAF  90

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARG  507
            SDGG  ALQ +PG Y+E VF+GLDFVI+EA+KYG+++ILS  NNY+ FGG+ QY  W R 
Sbjct  91   SDGGDTALQISPGVYDERVFQGLDFVISEAKKYGIRLILSFVNNYKDFGGRNQYAQWGRN  150

Query  508  KGQYLTSDDDFFRNSLVKGF  567
             G  + SDDDF+ + ++K +
Sbjct  151  AGIQINSDDDFYTHPVLKDY  170



>ref|XP_009760858.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1 [Nicotiana sylvestris]
Length=411

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 107/140 (76%), Gaps = 0/140 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GFI  +G HF +NG  F  NGFN+YWLM+VA++PS+RYKV+E  + AS+ GL+V RTWAF
Sbjct  32   GFIAVKGAHFELNGLPFLFNGFNSYWLMHVAAEPSERYKVTEVLKDASAAGLSVCRTWAF  91

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARG  507
            SDGG RALQ +PG Y+E VF+GLDFVI+EA+KYG+++ILS  NN+  FGGK QY  WAR 
Sbjct  92   SDGGDRALQISPGVYDERVFQGLDFVISEAKKYGVRLILSFVNNWNDFGGKAQYAQWARN  151

Query  508  KGQYLTSDDDFFRNSLVKGF  567
             G  +  DDDF+ + ++K +
Sbjct  152  AGAQINGDDDFYTHPMLKSY  171



>ref|XP_009779875.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Nicotiana 
sylvestris]
Length=411

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 107/140 (76%), Gaps = 0/140 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GFI   G HF +NG  F  NGFN+YWLM+VA++PS+RYKV+E  + AS+ GL+V RTWAF
Sbjct  32   GFIAVNGAHFELNGSPFLFNGFNSYWLMHVAAEPSERYKVTEVLKDASAAGLSVCRTWAF  91

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARG  507
            SDGG RALQ +PG Y+E VF+GLDFVI+EA+KYG+++ILS  NN+  FGGK QYV WAR 
Sbjct  92   SDGGDRALQISPGVYDERVFQGLDFVISEAKKYGVRLILSFVNNWNDFGGKAQYVQWARN  151

Query  508  KGQYLTSDDDFFRNSLVKGF  567
             G  +  DDDF+ + ++K +
Sbjct  152  AGAQINGDDDFYTHPMLKDY  171



>ref|XP_008664308.1| PREDICTED: LOW QUALITY PROTEIN: putative mannan endo-1,4-beta-mannosidase 
9 [Zea mays]
Length=418

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 107/143 (75%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A   F +  G  F I G  FY+NGFNAYWLMY+ASDP+ R K + A   A+  G T+ RT
Sbjct  30   ADAAFARASGTRFTIGGRPFYSNGFNAYWLMYMASDPADRSKATAALDEAARLGATLVRT  89

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAFSDGGYRALQ +PG Y+E+VF+GLD+VI+EA+K G+ +ILSL NN++ +GGKKQYV W
Sbjct  90   WAFSDGGYRALQVSPGVYDEEVFRGLDYVISEAKKRGIHLILSLVNNWDGYGGKKQYVQW  149

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +G  L SDDDFF +S+ KGF
Sbjct  150  ARTQGHSLNSDDDFFTDSVTKGF  172



>gb|ACG41070.1| 1,4-beta-D-mannan endohydrolase precursor [Zea mays]
Length=406

 Score =   184 bits (466),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 107/143 (75%), Gaps = 0/143 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A   F +  G  F I G  FY+NGFNAYWLMY+ASDP+ R K + A   A+  G T+ RT
Sbjct  30   ADAAFARASGTRFTIGGRPFYSNGFNAYWLMYMASDPADRSKATAALDEAARLGATLVRT  89

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            WAFSDGGYRALQ +PG Y+E+VF+GLD+VI+EA+K G+ +ILSL NN++ +GGKKQYV W
Sbjct  90   WAFSDGGYRALQVSPGVYDEEVFRGLDYVISEAKKRGIHLILSLVNNWDGYGGKKQYVQW  149

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR +G  L SDDDFF +S+ KGF
Sbjct  150  ARTQGHSLNSDDDFFTDSVTKGF  172



>ref|XP_010038521.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Eucalyptus 
grandis]
Length=402

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 107/142 (75%), Gaps = 0/142 (0%)
 Frame = +1

Query  142  GNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTW  321
            G+GF+ T+GI F+ NG   Y NGFNAYW+MY+ASD S R KV+  F+ A  +G+ +ART 
Sbjct  28   GSGFVGTKGIRFVANGKPLYLNGFNAYWMMYLASDLSTRDKVTSTFQEAVKNGMNIARTL  87

Query  322  AFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWA  501
            AFSDG  RALQ  PG YNE++FKGLDFVI+EARK G+ +ILSL NN+  FGGK QYV WA
Sbjct  88   AFSDGVDRALQITPGVYNEEMFKGLDFVISEARKNGVYLILSLVNNWNDFGGKHQYVQWA  147

Query  502  RGKGQYLTSDDDFFRNSLVKGF  567
            R  GQ L +DDDFF NS+ KG+
Sbjct  148  RNSGQSLDNDDDFFTNSVTKGY  169



>ref|XP_009616057.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5 [Nicotiana tomentosiformis]
Length=411

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 107/144 (74%), Gaps = 0/144 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
            A   GF+   G HF +NG  F  NGFN+YWLM+ A++PS+RYKV+E  + ASS GL+V R
Sbjct  31   ANNEGFVGVNGAHFELNGSPFLFNGFNSYWLMHAAAEPSERYKVTEVLQEASSSGLSVCR  90

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVD  495
            TWAFSDGG RALQ +PG Y+E VF+GLDFVI+EA+KYG+++ILS  NNY  FGGK QY  
Sbjct  91   TWAFSDGGDRALQISPGVYDERVFQGLDFVISEAKKYGVRLILSFVNNYNDFGGKAQYAQ  150

Query  496  WARGKGQYLTSDDDFFRNSLVKGF  567
            WAR  G  +  DDDF+ +S++K +
Sbjct  151  WARNVGAQIIGDDDFYTHSVIKDY  174



>ref|XP_009763332.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5-like [Nicotiana 
sylvestris]
Length=409

 Score =   183 bits (465),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 107/140 (76%), Gaps = 0/140 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF++T G HF++N   F  NGFN+YWLM+VASDPS+RYKVSE F+ AS+  L+V RTWAF
Sbjct  33   GFVRTNGAHFVLNRSPFLFNGFNSYWLMHVASDPSERYKVSEVFQEASAARLSVCRTWAF  92

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARG  507
            SDGG  ALQ +PG Y+E VF+GLDFVI EARKYG+++ILS  NNY  FGG+ QY  WAR 
Sbjct  93   SDGGDTALQISPGVYDERVFQGLDFVITEARKYGIRLILSFVNNYNDFGGRAQYAQWARN  152

Query  508  KGQYLTSDDDFFRNSLVKGF  567
             G  + S+DDF+ + ++K +
Sbjct  153  AGVRINSEDDFYTHPVLKDY  172



>gb|EYU30896.1| hypothetical protein MIMGU_mgv1a0228142mg, partial [Erythranthe 
guttata]
Length=266

 Score =   179 bits (454),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 106/140 (76%), Gaps = 1/140 (1%)
 Frame = +1

Query  151  FIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFS  330
            FIKT G  F+ +G  FY NGFNAYWLM  AS+ + RYKVS+ F  AS +G+ VAR WAFS
Sbjct  15   FIKTSGNKFVRDGRPFYFNGFNAYWLMTTASNSTTRYKVSDVFSEASKNGMNVARAWAFS  74

Query  331  DGG-YRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARG  507
            DGG Y  LQ  PG+YN+  F GLDFV+AEA+KYG+ +ILSL NN+  +GGKKQYV+W R 
Sbjct  75   DGGSYSPLQTYPGNYNQQTFSGLDFVVAEAKKYGIYLILSLVNNWNDYGGKKQYVEWGRS  134

Query  508  KGQYLTSDDDFFRNSLVKGF  567
            KGQ L +DD+FF NS+VKGF
Sbjct  135  KGQSLKNDDEFFTNSVVKGF  154



>ref|XP_006588317.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5-like [Glycine max]
 gb|KHN11733.1| Mannan endo-1,4-beta-mannosidase 5 [Glycine soja]
Length=407

 Score =   182 bits (463),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 107/140 (76%), Gaps = 0/140 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF++T+G   ++N   F  NGFN+YW+M VA+DP+QRYKVS  FR AS+ GLTV RTWAF
Sbjct  33   GFVETKGTELVLNDSPFLFNGFNSYWMMNVAADPNQRYKVSNVFREASAIGLTVCRTWAF  92

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARG  507
            SDGG ++LQ +PG YNE +F+ LDFV+AEARKY +++ILSL NNY  FGG+ +YV WA  
Sbjct  93   SDGGNQSLQISPGLYNEAMFQALDFVVAEARKYRVRLILSLVNNYNDFGGRPRYVQWANS  152

Query  508  KGQYLTSDDDFFRNSLVKGF  567
             G  + +DDDF+ N +VKG+
Sbjct  153  SGVPVANDDDFYTNPVVKGY  172



>ref|XP_007163264.1| hypothetical protein PHAVU_001G219800g [Phaseolus vulgaris]
 gb|ESW35258.1| hypothetical protein PHAVU_001G219800g [Phaseolus vulgaris]
Length=415

 Score =   183 bits (464),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 111/139 (80%), Gaps = 1/139 (1%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF++  G +F++N   FY NGFNAYWLM++ASDPS R KV+   + ASSHGLTVARTWAF
Sbjct  47   GFVRRSGTNFVLNNKRFYFNGFNAYWLMFMASDPSTRPKVASILQEASSHGLTVARTWAF  106

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARG  507
            +DG YRALQ +PGSY+E VF+GLDFVI+EA K G+++ILSL NN++ FGGK QYV+W + 
Sbjct  107  NDGAYRALQVSPGSYDEKVFRGLDFVISEAGKNGVRLILSLVNNWKDFGGKNQYVEWVKK  166

Query  508  K-GQYLTSDDDFFRNSLVK  561
            + G+Y+ S+DDFF + + K
Sbjct  167  EHGEYVNSEDDFFTHPVAK  185



>gb|AHA84179.1| endo-1,4-beta-mannanase [Phaseolus vulgaris]
Length=415

 Score =   183 bits (464),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 111/139 (80%), Gaps = 1/139 (1%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF++  G +F++N   FY NGFNAYWLM++ASDPS R KV+   + ASSHGLTVARTWAF
Sbjct  47   GFVRRSGTNFVLNNKRFYFNGFNAYWLMFMASDPSTRPKVASILQEASSHGLTVARTWAF  106

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARG  507
            +DG YRALQ +PGSY+E VF+GLDFVI+EA K G+++ILSL NN++ FGGK QYV+W + 
Sbjct  107  NDGAYRALQVSPGSYDEKVFRGLDFVISEAGKNGVRLILSLVNNWKDFGGKNQYVEWVKK  166

Query  508  K-GQYLTSDDDFFRNSLVK  561
            + G+Y+ S+DDFF + + K
Sbjct  167  EHGEYVNSEDDFFTHPVAK  185



>ref|XP_003605853.1| Mannan endo-1,4-beta-mannosidase [Medicago truncatula]
 gb|AES88050.1| mannan endo-1,4-beta-mannosidase-like protein [Medicago truncatula]
Length=411

 Score =   182 bits (463),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 112/147 (76%), Gaps = 1/147 (1%)
 Frame = +1

Query  127  SVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLT  306
            S++   N F++ +G  FM+NG  F  NGFN+YW+M VASDP+QRY+VS  F+ AS+ GLT
Sbjct  27   SLRVTPN-FVQRKGTEFMLNGSPFLFNGFNSYWMMNVASDPNQRYRVSNVFQKASAAGLT  85

Query  307  VARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQ  486
            + RTWAFSDGG ++LQ +PG YNE +F+ LDFVI EA+K G+++ILSL NNY+ FGG+ Q
Sbjct  86   ICRTWAFSDGGNQSLQISPGLYNEQMFQALDFVIGEAKKNGVRLILSLVNNYKDFGGRPQ  145

Query  487  YVDWARGKGQYLTSDDDFFRNSLVKGF  567
            YV+WA   G  + +DDDF+ N ++KG+
Sbjct  146  YVEWANSTGIPVNNDDDFYTNHVIKGY  172



>ref|XP_009601553.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5-like [Nicotiana 
tomentosiformis]
Length=416

 Score =   182 bits (463),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 108/141 (77%), Gaps = 1/141 (1%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF++T G HF++N   F  NGFN+YWLM+VASDPS+RYKVSE F+ AS+  L+V RTWAF
Sbjct  33   GFVRTNGAHFVLNRSPFLFNGFNSYWLMHVASDPSERYKVSEVFQEASAARLSVCRTWAF  92

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARG  507
            SDGG  ALQ +PG YNE VF+GLDFVIAEARKYG+++ILS  NNY  FGG+ QY  WAR 
Sbjct  93   SDGGDTALQISPGVYNERVFQGLDFVIAEARKYGIRLILSFVNNYNDFGGRAQYAQWARN  152

Query  508  KGQY-LTSDDDFFRNSLVKGF  567
             G   + S+DDF+ + ++K +
Sbjct  153  AGVLQINSEDDFYTHPVLKDY  173



>ref|XP_009785881.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5 [Nicotiana sylvestris]
Length=405

 Score =   182 bits (462),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 107/140 (76%), Gaps = 0/140 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GFI   G HF +NG  F  NGFN+YWLM+ A++PS+RYKV+E  + ASS GL+V RTWAF
Sbjct  29   GFIGVNGAHFELNGSPFLFNGFNSYWLMHAAAEPSERYKVTEVLQEASSSGLSVCRTWAF  88

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARG  507
            SDGG RALQ +PG Y+E VF+GLDFVI+EA+KYG+++ILS  NNY +FGGK QY  WAR 
Sbjct  89   SDGGDRALQISPGIYDERVFQGLDFVISEAKKYGVRLILSFVNNYNNFGGKAQYAQWARN  148

Query  508  KGQYLTSDDDFFRNSLVKGF  567
             G  +  +DDF+ +S++K +
Sbjct  149  VGAQINGEDDFYTHSMIKDY  168



>gb|KCW46727.1| hypothetical protein EUGRSUZ_K00550, partial [Eucalyptus grandis]
Length=373

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 105/140 (75%), Gaps = 0/140 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF+ T+GI F+ NG   Y NGFNAYW+MY+ASD S R KV+  F+ A  +G+ +ART AF
Sbjct  1    GFVGTKGIRFVANGKPLYLNGFNAYWMMYLASDLSTRDKVTSTFQEAVKNGMNIARTLAF  60

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARG  507
            SDG  RALQ  PG YNE++FKGLDFVI+EARK G+ +ILSL NN+  FGGK QYV WAR 
Sbjct  61   SDGVDRALQITPGVYNEEMFKGLDFVISEARKNGVYLILSLVNNWNDFGGKHQYVQWARN  120

Query  508  KGQYLTSDDDFFRNSLVKGF  567
             GQ L +DDDFF NS+ KG+
Sbjct  121  SGQSLDNDDDFFTNSVTKGY  140



>ref|XP_004962462.1| PREDICTED: LOW QUALITY PROTEIN: putative mannan endo-1,4-beta-mannosidase 
5-like [Setaria italica]
Length=475

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 115/157 (73%), Gaps = 2/157 (1%)
 Frame = +1

Query  103  VQQSSLSGS--VKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEA  276
            VQ+ +++GS  ++      +KTRG  F+I    FY NGFNAYWLM +A DPS R KV+E 
Sbjct  54   VQRPNVNGSEMIRDEQWRMVKTRGSQFVIGDKPFYVNGFNAYWLMILAVDPSTRGKVTEV  113

Query  277  FRGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLAN  456
            F+  ++ GLTV RTW+F+DGG+RALQ +P  Y E+VFK LDFV++EARKY +++ILSL N
Sbjct  114  FQQVAAVGLTVCRTWSFNDGGWRALQKSPAVYEENVFKALDFVVSEARKYRIRLILSLIN  173

Query  457  NYESFGGKKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            N++ +GGK QYV WAR  G  LTSDDDFF +  VKG+
Sbjct  174  NWDGYGGKAQYVKWARDAGLNLTSDDDFFSDETVKGY  210



>ref|XP_009621619.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like, partial [Nicotiana 
tomentosiformis]
Length=336

 Score =   180 bits (456),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 108/145 (74%), Gaps = 0/145 (0%)
 Frame = +1

Query  133  KAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVA  312
            + A  GFI  +G HF +NG  F  NGFN+YWLM+VA++ S+RYKV+E  +  S+ GL+V 
Sbjct  27   RNANVGFIAVKGAHFELNGSPFLFNGFNSYWLMHVAAESSERYKVTEVLKDGSAAGLSVC  86

Query  313  RTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYV  492
            RTWAFSDGG RALQ +PG Y+E VF+GLDFVI+EA+KYG+++ILS  NN+  FGGK QY 
Sbjct  87   RTWAFSDGGDRALQISPGVYDERVFQGLDFVISEAKKYGVRLILSFVNNWNDFGGKAQYA  146

Query  493  DWARGKGQYLTSDDDFFRNSLVKGF  567
             WAR  G  + SDDDF+ + ++K +
Sbjct  147  QWARNAGAQINSDDDFYTHPMLKSY  171



>ref|XP_011069567.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5-like [Sesamum indicum]
Length=412

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 110/143 (77%), Gaps = 1/143 (1%)
 Frame = +1

Query  142  GNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTW  321
             +GF++TRG HF+++   F  NGFNAYW+M VA+ PSQRYKVS  FR A++ GLTV RTW
Sbjct  33   ASGFVQTRGTHFVLDNSLFLFNGFNAYWMMQVAAQPSQRYKVSNVFREAAAAGLTVCRTW  92

Query  322  AFSDGGYR-ALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDW  498
            AFSDGG + ALQ +PG Y+E+VF+ LDFV++EA K  +++ILSL NNY+ FGG+ QYVDW
Sbjct  93   AFSDGGNKLALQISPGVYDENVFQALDFVVSEAAKNKVRLILSLVNNYQDFGGRPQYVDW  152

Query  499  ARGKGQYLTSDDDFFRNSLVKGF  567
            AR  G   ++DDDF+ N +VK +
Sbjct  153  ARNAGIRTSTDDDFYTNVVVKQY  175



>tpg|DAA58240.1| TPA: putative endo-1,4-beta-mannosidase family protein isoform 
1 [Zea mays]
 tpg|DAA58241.1| TPA: putative endo-1,4-beta-mannosidase family protein isoform 
2 [Zea mays]
Length=426

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 115/150 (77%), Gaps = 3/150 (2%)
 Frame = +1

Query  127  SVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLT  306
            + +A G+ F++ +G  F+ +G  F+ANGFNAYWLM   +DP++R KV+ A   A+  GL+
Sbjct  22   AAEAGGDAFVRVQGTRFVQDGKPFFANGFNAYWLMTFGADPARRGKVTSALSQAAGAGLS  81

Query  307  VARTWAFSDGGYR---ALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            VARTWAFSDGG     ALQY+PG YNE+ F+GLDFV++EARK+G+K+ILSL NNY+SFGG
Sbjct  82   VARTWAFSDGGGGGGSALQYSPGRYNENTFQGLDFVLSEARKHGIKMILSLVNNYDSFGG  141

Query  478  KKQYVDWARGKGQYLTSDDDFFRNSLVKGF  567
            +KQYV WAR +GQ + SDD+FF N  VKG 
Sbjct  142  RKQYVQWARERGQTIGSDDEFFTNPFVKGI  171



>gb|KHN12618.1| Mannan endo-1,4-beta-mannosidase 4, partial [Glycine soja]
Length=323

 Score =   179 bits (454),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 105/135 (78%), Gaps = 1/135 (1%)
 Frame = +1

Query  166  GIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFSDGGYR  345
            G HF +NG + Y NGFN+YWLM +ASDP    KV+  F+ AS HGL VARTWAF+DGGY 
Sbjct  2    GTHFYLNGKSHYLNGFNSYWLMNIASDPFTSSKVTTTFQEASQHGLNVARTWAFNDGGYN  61

Query  346  -ALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARGKGQYL  522
             ALQ +PGSYNE+VFKGLDF+I+EA K G+++ILSL NN+  +GGK QYV WAR +GQY+
Sbjct  62   NALQISPGSYNENVFKGLDFIISEAGKNGIRLILSLVNNWNDYGGKSQYVQWARERGQYV  121

Query  523  TSDDDFFRNSLVKGF  567
             +DDDFF + +VK +
Sbjct  122  NNDDDFFTHPIVKEY  136



>ref|XP_004494942.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Cicer arietinum]
Length=422

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 110/140 (79%), Gaps = 0/140 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF++  GIHF++NG + Y NGFN+Y+LM +A+DPS + KV+  F+  S HGL +ARTWAF
Sbjct  53   GFVQRSGIHFILNGKSLYLNGFNSYFLMNIATDPSTKSKVTTIFQETSKHGLNLARTWAF  112

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGGKKQYVDWARG  507
            +DG Y+ LQ +PG+Y+EDVFKGLDFV++EA KYG+K+ILSL NN+  +GGK +YV W + 
Sbjct  113  NDGDYKPLQISPGTYDEDVFKGLDFVVSEAGKYGVKLILSLVNNWNDYGGKNKYVKWGKE  172

Query  508  KGQYLTSDDDFFRNSLVKGF  567
            +GQ + +DDDF+ N +VK +
Sbjct  173  RGQNVNNDDDFYINPVVKQY  192



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 672416417960