BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF040H20

Length=522
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011090165.1|  PREDICTED: serine--glyoxylate aminotransferase     252   6e-79   Sesamum indicum [beniseed]
emb|CDP08481.1|  unnamed protein product                                251   2e-78   Coffea canephora [robusta coffee]
gb|EPS59280.1|  serine-glyoxylate aminotransferase                      249   4e-78   Genlisea aurea
ref|XP_010277598.1|  PREDICTED: serine--glyoxylate aminotransferase     249   6e-78   Nelumbo nucifera [Indian lotus]
ref|XP_006584642.1|  PREDICTED: enzymatic resistance protein isof...    249   7e-78   Glycine max [soybeans]
ref|XP_003600160.1|  Alanine glyoxylate aminotransferase                249   8e-78   
gb|ACJ61247.1|  serine glyoxylate aminotransferase 3                    249   9e-78   Glycine max [soybeans]
ref|XP_011080387.1|  PREDICTED: serine--glyoxylate aminotransfera...    249   1e-77   Sesamum indicum [beniseed]
ref|NP_001237048.1|  enzymatic resistance protein                       249   1e-77   
ref|XP_003600159.1|  Alanine glyoxylate aminotransferase                248   1e-77   Medicago truncatula
ref|XP_004499480.1|  PREDICTED: serine--glyoxylate aminotransfera...    248   2e-77   
dbj|BAJ33858.1|  unnamed protein product                                249   2e-77   Eutrema halophilum
gb|AGV54322.1|  serine glyoxylate aminotransferase 2                    247   3e-77   Phaseolus vulgaris [French bean]
ref|XP_007146302.1|  hypothetical protein PHAVU_006G029100g             247   3e-77   Phaseolus vulgaris [French bean]
gb|KDO44954.1|  hypothetical protein CISIN_1g0157291mg                  246   3e-77   Citrus sinensis [apfelsine]
gb|AFK40703.1|  unknown                                                 247   5e-77   Medicago truncatula
gb|KHN28521.1|  Serine--glyoxylate aminotransferase                     246   7e-77   Glycine soja [wild soybean]
gb|ACJ61246.1|  serine glyoxylate aminotransferase 2                    246   7e-77   Glycine max [soybeans]
gb|KDO44953.1|  hypothetical protein CISIN_1g0157291mg                  246   7e-77   Citrus sinensis [apfelsine]
ref|NP_001276276.1|  serine--glyoxylate aminotransferase-like           246   7e-77   Glycine max [soybeans]
ref|XP_006409690.1|  hypothetical protein EUTSA_v10022711mg             246   7e-77   
ref|XP_006470731.1|  PREDICTED: serine--glyoxylate aminotransfera...    246   8e-77   Citrus sinensis [apfelsine]
emb|CDY37208.1|  BnaA09g08290D                                          246   9e-77   Brassica napus [oilseed rape]
ref|XP_009112244.1|  PREDICTED: serine--glyoxylate aminotransferase     246   9e-77   Brassica rapa
ref|XP_006446249.1|  hypothetical protein CICLE_v10015490mg             246   1e-76   Citrus clementina [clementine]
emb|CDX81443.1|  BnaC09g08540D                                          246   2e-76   
ref|XP_008812510.1|  PREDICTED: serine--glyoxylate aminotransferase     245   2e-76   Phoenix dactylifera
ref|XP_010045046.1|  PREDICTED: serine--glyoxylate aminotransferase     245   2e-76   Eucalyptus grandis [rose gum]
gb|ABA00460.1|  serine-glyoxylate aminotransferase                      245   3e-76   Spirodela polyrhiza
emb|CDX89604.1|  BnaC03g45180D                                          245   3e-76   
ref|XP_006349776.1|  PREDICTED: serine--glyoxylate aminotransfera...    245   3e-76   Solanum tuberosum [potatoes]
ref|XP_009136209.1|  PREDICTED: serine--glyoxylate aminotransfera...    245   3e-76   Brassica rapa
ref|NP_001265946.1|  Hop-interacting protein THI032                     245   3e-76   Solanum lycopersicum
ref|XP_008449670.1|  PREDICTED: serine--glyoxylate aminotransfera...    244   6e-76   Cucumis melo [Oriental melon]
gb|ABQ81925.1|  aminotransferase 2                                      244   6e-76   Cucumis melo [Oriental melon]
gb|AAL62332.1|AF461048_1  aminotransferase 2                            244   7e-76   Cucumis melo [Oriental melon]
ref|NP_001284445.1|  serine--glyoxylate aminotransferase-like           244   8e-76   Cucumis melo [Oriental melon]
ref|XP_009619693.1|  PREDICTED: serine--glyoxylate aminotransferase     244   8e-76   Nicotiana tomentosiformis
ref|XP_009342610.1|  PREDICTED: serine--glyoxylate aminotransferase     244   8e-76   Pyrus x bretschneideri [bai li]
ref|XP_009775939.1|  PREDICTED: serine--glyoxylate aminotransferase     244   9e-76   Nicotiana sylvestris
ref|XP_008363560.1|  PREDICTED: serine--glyoxylate aminotransferase     244   9e-76   Malus domestica [apple tree]
gb|ABQ81922.1|  aminotransferase 2                                      243   2e-75   Cucumis sativus [cucumbers]
ref|XP_004140203.1|  PREDICTED: serine--glyoxylate aminotransfera...    243   2e-75   Cucumis sativus [cucumbers]
ref|XP_007015204.1|  Alanine:glyoxylate aminotransferase isoform 1      243   2e-75   
ref|XP_004139054.1|  PREDICTED: serine--glyoxylate aminotransfera...    243   2e-75   Cucumis sativus [cucumbers]
gb|AGT38285.1|  serine--glyoxylate aminotransferase                     242   3e-75   Gossypium hirsutum [American cotton]
gb|AAL47679.1|  aminotransferase 1                                      242   3e-75   Cucumis melo [Oriental melon]
ref|XP_006843377.1|  hypothetical protein AMTR_s00053p00093890          242   3e-75   Amborella trichopoda
ref|XP_008359496.1|  PREDICTED: serine--glyoxylate aminotransferase     242   4e-75   
gb|AAQ56192.1|  aminotransferase 1                                      242   4e-75   Cucumis melo [Oriental melon]
gb|KHG29969.1|  Serine--glyoxylate aminotransferase -like protein       242   5e-75   Gossypium arboreum [tree cotton]
ref|XP_010938608.1|  PREDICTED: serine--glyoxylate aminotransfera...    242   5e-75   Elaeis guineensis
ref|XP_009410322.1|  PREDICTED: serine--glyoxylate aminotransfera...    241   5e-75   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010094254.1|  Serine--glyoxylate aminotransferase                240   6e-75   Morus notabilis
ref|XP_008227244.1|  PREDICTED: serine--glyoxylate aminotransferase     241   6e-75   Prunus mume [ume]
gb|ABQ81924.1|  aminotransferase 2                                      241   7e-75   Cucumis sativus [cucumbers]
gb|ABR26028.1|  serine-glyoxylate aminotransferase                      234   7e-75   Oryza sativa Indica Group [Indian rice]
ref|XP_002885871.1|  hypothetical protein ARALYDRAFT_480305             241   8e-75   
ref|XP_010488837.1|  PREDICTED: serine--glyoxylate aminotransfera...    241   1e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010518509.1|  PREDICTED: serine--glyoxylate aminotransfera...    241   1e-74   Camelina sativa [gold-of-pleasure]
ref|XP_006369572.1|  hypothetical protein POPTR_0001s26020g             238   1e-74   
ref|NP_001284450.1|  serine--glyoxylate aminotransferase                241   1e-74   Cucumis melo [Oriental melon]
ref|XP_010467178.1|  PREDICTED: serine--glyoxylate aminotransfera...    242   1e-74   Camelina sativa [gold-of-pleasure]
ref|XP_009338530.1|  PREDICTED: serine--glyoxylate aminotransfera...    240   2e-74   
ref|XP_010557501.1|  PREDICTED: serine--glyoxylate aminotransferase     240   2e-74   Tarenaya hassleriana [spider flower]
gb|AGL09527.1|  alanine-glyoxylate aminotransferase                     236   2e-74   Piper nigrum
ref|XP_010909203.1|  PREDICTED: serine--glyoxylate aminotransferase     240   3e-74   Elaeis guineensis
ref|XP_009415566.1|  PREDICTED: serine--glyoxylate aminotransferase     239   3e-74   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB54389.1|  hypothetical protein B456_009G074800                    239   3e-74   Gossypium raimondii
ref|XP_006297832.1|  hypothetical protein CARUB_v10013869mg             239   3e-74   Capsella rubella
ref|NP_178969.1|  alanine--glyoxylate aminotransferase                  239   3e-74   Arabidopsis thaliana [mouse-ear cress]
gb|KHG14448.1|  Serine--glyoxylate aminotransferase -like protein       239   5e-74   Gossypium arboreum [tree cotton]
ref|XP_011032100.1|  PREDICTED: serine--glyoxylate aminotransfera...    239   5e-74   Populus euphratica
ref|XP_004291746.1|  PREDICTED: serine--glyoxylate aminotransferase     239   5e-74   Fragaria vesca subsp. vesca
ref|XP_002313371.1|  aminotransferase 2 family protein                  239   5e-74   
gb|AAQ56193.1|  aminotransferase 2                                      239   6e-74   Cucumis melo [Oriental melon]
ref|XP_007212264.1|  hypothetical protein PRUPE_ppa006653mg             238   8e-74   Prunus persica
ref|XP_011043786.1|  PREDICTED: serine--glyoxylate aminotransferase     238   9e-74   Populus euphratica
gb|KDP35982.1|  hypothetical protein JCGZ_08377                         238   1e-73   Jatropha curcas
gb|AGL09526.1|  alanine-glyoxylate aminotransferase                     234   1e-73   Peperomia prostrata
ref|XP_002298306.1|  hypothetical protein POPTR_0001s26020g             238   1e-73   Populus trichocarpa [western balsam poplar]
ref|XP_006369573.1|  hypothetical protein POPTR_0001s26020g             237   2e-73   
gb|ABK96624.1|  unknown                                                 237   3e-73   Populus trichocarpa x Populus deltoides
ref|XP_002531124.1|  serine-pyruvate aminotransferase, putative         237   4e-73   Ricinus communis
gb|AGL09530.1|  alanine-glyoxylate aminotransferase                     233   4e-73   Xymalos monospora
gb|AAB95218.1|  putative serine-glyoxylate aminotransferase             236   5e-73   Fritillaria agrestis
gb|AGL09524.1|  alanine-glyoxylate aminotransferase                     232   1e-72   Calycanthus occidentalis [California-allspice]
dbj|BAJ90006.1|  predicted protein                                      236   1e-72   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001062170.1|  Os08g0502700                                       236   1e-72   
ref|XP_006659561.1|  PREDICTED: serine--glyoxylate aminotransfera...    235   1e-72   Oryza brachyantha
ref|XP_003574732.2|  PREDICTED: serine--glyoxylate aminotransferase     236   2e-72   Brachypodium distachyon [annual false brome]
gb|EMS66805.1|  Serine--glyoxylate aminotransferase                     234   3e-72   Triticum urartu
gb|AGL09523.1|  alanine-glyoxylate aminotransferase                     230   5e-72   Asarum caudatum
ref|XP_002444789.1|  hypothetical protein SORBIDRAFT_07g028080          233   2e-71   Sorghum bicolor [broomcorn]
ref|XP_010673724.1|  PREDICTED: serine--glyoxylate aminotransferase     231   4e-71   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004973838.1|  PREDICTED: serine--glyoxylate aminotransfera...    231   4e-71   Setaria italica
ref|XP_004973837.1|  PREDICTED: serine--glyoxylate aminotransfera...    231   1e-70   
ref|XP_002279236.1|  PREDICTED: serine--glyoxylate aminotransferase     229   3e-70   Vitis vinifera
emb|CAN84001.1|  hypothetical protein VITISV_007680                     229   3e-70   Vitis vinifera
tpg|DAA47863.1|  TPA: hypothetical protein ZEAMMB73_595389              227   1e-69   
ref|NP_001148339.1|  LOC100281949                                       228   1e-69   Zea mays [maize]
ref|XP_003617296.1|  Alanine glyoxylate aminotransferase                223   1e-67   Medicago truncatula
ref|XP_004491262.1|  PREDICTED: serine--glyoxylate aminotransfera...    223   1e-67   Cicer arietinum [garbanzo]
gb|ADO24297.1|  aminotransferase                                        212   3e-67   Valeriana jatamansi
gb|ABF70331.1|  aminotransferase 1                                      221   5e-67   Cucumis sativus [cucumbers]
gb|ADG26437.1|  putative aminotransferase                               206   5e-65   Valeriana jatamansi
gb|AGL09528.1|  alanine-glyoxylate aminotransferase                     211   1e-64   Saururus cernuus [swamp lily]
gb|EMT09291.1|  Serine--glyoxylate aminotransferase                     210   4e-64   
ref|XP_008666464.1|  PREDICTED: serine--glyoxylate aminotransfera...    202   6e-62   Zea mays [maize]
tpg|DAA47874.1|  TPA: hypothetical protein ZEAMMB73_131074              202   4e-61   
gb|ABR16109.1|  unknown                                                 198   9e-59   Picea sitchensis
gb|ACN39798.1|  unknown                                                 199   1e-58   Picea sitchensis
gb|ABK24112.1|  unknown                                                 199   2e-58   Picea sitchensis
ref|XP_001755667.1|  predicted protein                                  198   5e-58   
ref|XP_001783551.1|  predicted protein                                  197   1e-57   
gb|AGL09525.1|  alanine-glyoxylate aminotransferase                     191   4e-57   Manekia incurva
gb|AGL09529.1|  alanine-glyoxylate aminotransferase                     189   3e-56   Thottea sp. JN-2013
ref|XP_002983655.1|  hypothetical protein SELMODRAFT_228964             193   3e-56   
ref|XP_002990557.1|  hypothetical protein SELMODRAFT_448066             193   3e-56   Selaginella moellendorffii
gb|AGL09531.1|  alanine-glyoxylate aminotransferase                     186   3e-55   Zippelia begoniifolia
gb|ACN36238.1|  unknown                                                 188   5e-55   Zea mays [maize]
ref|XP_001763095.1|  predicted protein                                  186   1e-53   
emb|CBI24214.3|  unnamed protein product                                184   4e-53   Vitis vinifera
gb|AEX09293.1|  alanine glyoxylate aminotransferase                     177   2e-50   Peperomia rupiseda
gb|AEX09308.1|  alanine glyoxylate aminotransferase                     176   3e-50   Peperomia polycephala
gb|AEX09252.1|  alanine glyoxylate aminotransferase                     176   4e-50   Peperomia exclamationis
gb|AEX09255.1|  alanine glyoxylate aminotransferase                     176   5e-50   Peperomia bracteata
gb|AEX09262.1|  alanine glyoxylate aminotransferase                     175   6e-50   Peperomia aff. ovatopeltata JN-2011
gb|AEX09251.1|  alanine glyoxylate aminotransferase                     175   6e-50   Peperomia schizandra
gb|AEX09248.1|  alanine glyoxylate aminotransferase                     175   7e-50   Peperomia questionis
gb|AEX09268.1|  alanine glyoxylate aminotransferase                     175   8e-50   Peperomia peruviana
gb|AEX09305.1|  alanine glyoxylate aminotransferase                     175   9e-50   Peperomia pseudoverruculosa
gb|AEX09266.1|  alanine glyoxylate aminotransferase                     175   1e-49   Peperomia peruviana
gb|AEX09274.1|  alanine glyoxylate aminotransferase                     175   1e-49   Peperomia peruviana
gb|AEX09301.1|  alanine glyoxylate aminotransferase                     175   1e-49   Peperomia sp. JN-2011
gb|AEX09306.1|  alanine glyoxylate aminotransferase                     175   1e-49   Peperomia peruviana
gb|AEX09250.1|  alanine glyoxylate aminotransferase                     175   1e-49   Peperomia schizandra
gb|AEX09283.1|  alanine glyoxylate aminotransferase                     174   1e-49   Peperomia peruviana
gb|AEX09302.1|  alanine glyoxylate aminotransferase                     174   1e-49   Peperomia sp. JN-2011
gb|AEX09246.1|  alanine glyoxylate aminotransferase                     174   2e-49   Peperomia elatior
gb|AEX09310.1|  alanine glyoxylate aminotransferase                     174   2e-49   Peperomia wernerrauhii
gb|AEX09309.1|  alanine glyoxylate aminotransferase                     174   2e-49   Peperomia wernerrauhii
gb|AEX09288.1|  alanine glyoxylate aminotransferase                     174   2e-49   Peperomia parvisagittata
gb|AEX09263.1|  alanine glyoxylate aminotransferase                     174   2e-49   Peperomia putlaensis
gb|AEX09256.1|  alanine glyoxylate aminotransferase                     174   2e-49   Peperomia bracteata
gb|AEX09282.1|  alanine glyoxylate aminotransferase                     174   2e-49   Peperomia cerrateae
gb|AEX09287.1|  alanine glyoxylate aminotransferase                     173   2e-49   Peperomia cerrateae
gb|AEX09244.1|  alanine glyoxylate aminotransferase                     173   2e-49   Peperomia basiradicans
gb|AEX09300.1|  alanine glyoxylate aminotransferase                     174   2e-49   Peperomia parvifolia
gb|AEX09286.1|  alanine glyoxylate aminotransferase                     174   2e-49   Peperomia cyclaminoides
gb|AEX09249.1|  alanine glyoxylate aminotransferase                     174   2e-49   Peperomia aff. gracillima JN-2011
ref|XP_002970880.1|  hypothetical protein SELMODRAFT_147375             175   3e-49   Selaginella moellendorffii
gb|AEX09277.1|  alanine glyoxylate aminotransferase                     174   3e-49   Peperomia cyclaminoides
gb|AEX09295.1|  alanine glyoxylate aminotransferase                     174   3e-49   Peperomia pugnicaudex
gb|AEX09245.1|  alanine glyoxylate aminotransferase                     174   3e-49   Peperomia putlaensis
ref|XP_002969615.1|  hypothetical protein SELMODRAFT_267279             175   3e-49   Selaginella moellendorffii
gb|AEX09260.1|  alanine glyoxylate aminotransferase                     173   3e-49   Peperomia aff. ovatopeltata JN-2011
gb|AEX09311.1|  alanine glyoxylate aminotransferase                     174   3e-49   Peperomia andina
gb|AEX09275.1|  alanine glyoxylate aminotransferase                     174   3e-49   Peperomia parvisagittata
gb|AEX09257.1|  alanine glyoxylate aminotransferase                     174   3e-49   Peperomia bracteata
gb|AEX09298.1|  alanine glyoxylate aminotransferase                     174   3e-49   Peperomia cerrateae
gb|AEX09270.1|  alanine glyoxylate aminotransferase                     174   3e-49   Peperomia verruculosa
gb|AEX09253.1|  alanine glyoxylate aminotransferase                     174   3e-49   Peperomia bracteata
gb|AEX09294.1|  alanine glyoxylate aminotransferase                     173   3e-49   Peperomia sp. JN-2011
gb|AEX09273.1|  alanine glyoxylate aminotransferase                     174   4e-49   Peperomia cerrateae
gb|AEX09254.1|  alanine glyoxylate aminotransferase                     173   5e-49   Peperomia bracteata
gb|AEX09304.1|  alanine glyoxylate aminotransferase                     172   8e-49   Peperomia chutanka
gb|AEX09258.1|  alanine glyoxylate aminotransferase                     172   9e-49   Peperomia bracteata
gb|AEX09299.1|  alanine glyoxylate aminotransferase                     172   1e-48   Peperomia cerrateae
gb|AEX09292.1|  alanine glyoxylate aminotransferase                     171   1e-48   Peperomia klopfensteinii
gb|ADO24296.1|  aminotransferase                                        164   2e-48   Valeriana jatamansi
gb|AEX09242.1|  alanine glyoxylate aminotransferase                     171   2e-48   Peperomia aff. pinoi JN-2011
gb|AEX09267.1|  alanine glyoxylate aminotransferase                     170   1e-47   Peperomia radiatinervosa
gb|AEX09276.1|  alanine glyoxylate aminotransferase                     169   2e-47   Peperomia parvisagittata
gb|ACJ84853.1|  unknown                                                 158   3e-46   Medicago truncatula
ref|XP_005648727.1|  serine glyoxylate aminotransferase                 159   3e-43   Coccomyxa subellipsoidea C-169
gb|EYU35937.1|  hypothetical protein MIMGU_mgv1a026291mg                157   5e-43   Erythranthe guttata [common monkey flower]
ref|XP_003617694.1|  Alanine glyoxylate aminotransferase                157   6e-43   
ref|WP_017485211.1|  serine--glyoxylate aminotransferase                157   1e-42   Methylobacterium sp. MB200
ref|WP_018410273.1|  serine--glyoxylate aminotransferase                156   4e-42   Methyloversatilis thermotolerans
gb|AEX09303.1|  alanine glyoxylate aminotransferase                     155   4e-42   Peperomia ayacuchoana
ref|WP_015950680.1|  serine--glyoxylate aminotransferase                156   5e-42   Methylorubrum extorquens
ref|WP_012453656.1|  serine--glyoxylate aminotransferase                155   9e-42   Methylorubrum populi
gb|AEX09259.1|  alanine glyoxylate aminotransferase                     154   1e-41   Peperomia bracteata
ref|WP_003597639.1|  serine--glyoxylate aminotransferase                154   1e-41   Methylobacteriaceae
ref|WP_012253362.1|  serine--glyoxylate aminotransferase                154   1e-41   Methylobacteriaceae
gb|AEX09264.1|  alanine glyoxylate aminotransferase                     153   2e-41   Peperomia radiatinervosa
gb|AEX09307.1|  alanine glyoxylate aminotransferase                     153   2e-41   Peperomia verruculosa
gb|AEX09284.1|  alanine glyoxylate aminotransferase                     153   2e-41   Peperomia peruviana
ref|XP_005709273.1|  serine--glyoxylate transaminase                    154   3e-41   Galdieria sulphuraria
gb|AEX09291.1|  alanine glyoxylate aminotransferase                     152   3e-41   Peperomia jalcaensis
dbj|BAQ46928.1|  serine--glyoxylate aminotransferase                    153   4e-41   Methylobacterium aquaticum
gb|AEX09272.1|  alanine glyoxylate aminotransferase                     152   5e-41   Peperomia cyclaminoides
ref|WP_041930245.1|  serine--glyoxylate aminotransferase                152   6e-41   
gb|ABM96214.1|  serine-glyoxylate aminotransferase                      153   6e-41   Methylibium petroleiphilum PM1
gb|AEX09265.1|  alanine glyoxylate aminotransferase                     152   7e-41   Peperomia radiatinervosa
ref|WP_036230592.1|  MULTISPECIES: serine--glyoxylate aminotransf...    152   9e-41   Methylibium
ref|WP_040580464.1|  serine--glyoxylate aminotransferase                152   1e-40   
ref|WP_028223486.1|  serine--glyoxylate aminotransferase                152   2e-40   Paraburkholderia oxyphila
ref|WP_036271184.1|  serine--glyoxylate aminotransferase                151   3e-40   Methyloversatilis universalis
ref|WP_026362994.1|  serine--glyoxylate aminotransferase                150   6e-40   Methylopila sp. M107
ref|WP_026597137.1|  serine--glyoxylate aminotransferase                150   6e-40   Methylobacterium sp. 77
ref|WP_028212654.1|  serine--glyoxylate aminotransferase                150   7e-40   Paraburkholderia mimosarum
ref|WP_007559580.1|  serine--glyoxylate aminotransferase                150   7e-40   Methylobacterium
ref|WP_026175686.1|  serine--glyoxylate aminotransferase                150   9e-40   Methylobacterium sp. 88A
ref|WP_014149643.1|  serine--glyoxylate aminotransferase                149   9e-40   Methylomicrobium alcaliphilum
ref|WP_020188076.1|  hypothetical protein                               150   9e-40   Methylopila sp. 73B
ref|WP_027172630.1|  serine--glyoxylate aminotransferase                149   1e-39   Methylobacterium
ref|WP_008058631.1|  serine--glyoxylate aminotransferase                149   1e-39   Methyloversatilis universalis
gb|AEX09285.1|  alanine glyoxylate aminotransferase                     148   1e-39   Peperomia radiatinervosa
ref|WP_035937801.1|  serine--glyoxylate aminotransferase                149   1e-39   Caballeronia glathei
ref|WP_017840623.1|  serine--glyoxylate aminotransferase                149   1e-39   Methylomicrobium buryatense
ref|WP_026610206.1|  serine--glyoxylate aminotransferase                149   1e-39   Methylocaldum szegediense
ref|WP_035525480.1|  serine--glyoxylate aminotransferase                149   2e-39   Paraburkholderia sacchari
ref|WP_029644281.1|  serine--glyoxylate aminotransferase                149   2e-39   Methyloversatilis discipulorum
ref|WP_043363897.1|  serine--glyoxylate aminotransferase                149   2e-39   Methyloversatilis discipulorum
ref|WP_012590731.1|  serine--glyoxylate aminotransferase                148   2e-39   Methylocella silvestris
ref|WP_012320605.1|  MULTISPECIES: serine--glyoxylate aminotransf...    148   3e-39   Methylobacterium
ref|WP_027156802.1|  serine--glyoxylate aminotransferase                147   6e-39   Methylobacter luteus
ref|WP_007585769.1|  serine--glyoxylate aminotransferase                148   6e-39   Paraburkholderia hospita
ref|WP_007742731.1|  serine--glyoxylate aminotransferase                147   7e-39   Burkholderiaceae
ref|WP_042306504.1|  serine--glyoxylate aminotransferase                147   7e-39   Paraburkholderia terrae
ref|WP_035994918.1|  serine--glyoxylate aminotransferase                147   8e-39   Paraburkholderia caribensis
ref|WP_010960683.1|  serine--glyoxylate aminotransferase                147   8e-39   Methylococcus capsulatus
ref|WP_042673896.1|  serine--glyoxylate aminotransferase                147   1e-38   Methylobacterium sp. B34
ref|WP_020092657.1|  serine--glyoxylate aminotransferase                147   1e-38   Methylobacterium
ref|WP_037429329.1|  hypothetical protein                               140   1e-38   
ref|WP_043385155.1|  MULTISPECIES: serine--glyoxylate aminotransf...    147   1e-38   Methylobacterium
gb|AIQ91949.1|  Aminotransferase class V                                147   1e-38   Methylobacterium oryzae CBMB20
ref|WP_010687105.1|  Aminotransferase class V                           147   1e-38   Methylobacterium mesophilicum
ref|WP_037399714.1|  serine--glyoxylate aminotransferase                139   1e-38   
ref|WP_037437029.1|  hypothetical protein                               140   1e-38   
ref|WP_028367172.1|  serine--glyoxylate aminotransferase                146   2e-38   Burkholderia sp. UYPR1.413
ref|WP_043355705.1|  serine--glyoxylate aminotransferase                146   3e-38   Methylobacterium
ref|WP_027147316.1|  MULTISPECIES: serine--glyoxylate aminotransf...    145   3e-38   Methylobacter
ref|WP_036253086.1|  serine--glyoxylate aminotransferase                145   3e-38   Methylobacter sp. BBA5.1
ref|WP_026608295.1|  serine--glyoxylate aminotransferase                145   4e-38   Methylocapsa acidiphila
ref|WP_015933415.1|  serine--glyoxylate aminotransferase                145   4e-38   Methylobacterium nodulans
ref|WP_012405153.1|  serine--glyoxylate aminotransferase                145   4e-38   Paraburkholderia phymatum
ref|WP_014762956.1|  serine--glyoxylate aminotransferase                145   5e-38   Sinorhizobium fredii
ref|WP_018238561.1|  serine--glyoxylate aminotransferase                145   5e-38   Ensifer sp. BR816
gb|AEX09271.1|  alanine glyoxylate aminotransferase                     143   6e-38   Peperomia peruviana
ref|WP_031434945.1|  serine--glyoxylate aminotransferase                144   7e-38   Methylomarinum vadi
ref|WP_005371842.1|  MULTISPECIES: serine--glyoxylate aminotransf...    144   8e-38   Methylomicrobium agile
ref|WP_026190999.1|  serine--glyoxylate aminotransferase                145   8e-38   Methylobacterium sp. WSM2598
ref|WP_012336184.1|  serine--glyoxylate aminotransferase                145   8e-38   Methylobacterium sp. 4-46
ref|WP_006890572.1|  serine--glyoxylate aminotransferase                144   1e-37   Methylobacter tundripaludum
ref|WP_031437003.1|  serine--glyoxylate aminotransferase                144   1e-37   Methylobacter tundripaludum
ref|WP_027168976.1|  serine--glyoxylate aminotransferase                144   1e-37   Mesorhizobium sp. WSM3224
ref|XP_002953765.1|  hypothetical protein VOLCADRAFT_75980              144   2e-37   Volvox carteri f. nagariensis
ref|WP_036260471.1|  serine--glyoxylate aminotransferase                144   2e-37   Methylocapsa aurea
ref|WP_003535479.1|  serine--glyoxylate aminotransferase                143   2e-37   Sinorhizobium meliloti
ref|WP_024298006.1|  serine--glyoxylate aminotransferase                143   2e-37   Methylosarcina lacus
ref|WP_006203221.1|  serine--glyoxylate aminotransferase                143   2e-37   Mesorhizobium amorphae
ref|WP_028755163.1|  serine--glyoxylate aminotransferase                143   3e-37   Rhizobium leucaenae
ref|WP_026622911.1|  serine--glyoxylate aminotransferase                142   4e-37   Ensifer sp. WSM1721
ref|WP_026223456.1|  serine--glyoxylate aminotransferase                142   4e-37   Methylosarcina fibrata
ref|WP_034858116.1|  serine--glyoxylate aminotransferase                142   4e-37   Ensifer sojae
ref|WP_027999163.1|  serine--glyoxylate aminotransferase                142   4e-37   Sinorhizobium arboris
ref|WP_027061369.1|  serine--glyoxylate aminotransferase                142   4e-37   Mesorhizobium loti
ref|XP_001702107.1|  serine glyoxylate aminotransferase                 143   4e-37   Chlamydomonas reinhardtii
ref|XP_001702106.1|  serine glyoxylate aminotransferase                 143   5e-37   Chlamydomonas reinhardtii
ref|WP_027029542.1|  serine--glyoxylate aminotransferase                142   5e-37   Mesorhizobium loti
ref|WP_013819317.1|  serine--glyoxylate aminotransferase                142   6e-37   Methylomonas methanica
ref|WP_018267457.1|  serine--glyoxylate aminotransferase                142   7e-37   Methylosinus sp. LW4
ref|WP_026616975.1|  serine--glyoxylate aminotransferase                141   9e-37   Sinorhizobium/Ensifer group
ref|WP_003613273.1|  serine--glyoxylate aminotransferase                141   1e-36   Methylosinus
ref|WP_027146511.1|  serine--glyoxylate aminotransferase                141   1e-36   Mesorhizobium sp. WSM3626
ref|WP_015317366.1|  serine--glyoxylate aminotransferase                141   1e-36   Mesorhizobium australicum
ref|WP_012709136.1|  serine--glyoxylate aminotransferase                141   1e-36   Sinorhizobium fredii
ref|WP_023805485.1|  serine--glyoxylate aminotransferase                141   1e-36   Mesorhizobium sp. L2C089B000
ref|WP_040961132.1|  serine--glyoxylate aminotransferase                141   1e-36   Sinorhizobium fredii
ref|WP_023670792.1|  serine--glyoxylate aminotransferase                141   1e-36   Mesorhizobium sp. LSJC285A00
ref|WP_014329402.1|  serine--glyoxylate aminotransferase                141   1e-36   Sinorhizobium fredii
ref|WP_023714322.1|  serine--glyoxylate aminotransferase                141   1e-36   Mesorhizobium sp. LSHC422A00
ref|WP_040969922.1|  serine--glyoxylate aminotransferase                141   2e-36   Mesorhizobium sp. ORS 3324
ref|WP_037416404.1|  serine--glyoxylate aminotransferase                140   2e-36   Sinorhizobium sp. CCBAU 05631
ref|WP_027051273.1|  serine--glyoxylate aminotransferase                140   2e-36   Mesorhizobium erdmanii
ref|WP_023818017.1|  serine--glyoxylate aminotransferase                140   2e-36   Mesorhizobium sp. L2C066B000
ref|WP_036293367.1|  serine--glyoxylate aminotransferase                140   2e-36   
ref|WP_023822176.1|  serine--glyoxylate aminotransferase                140   2e-36   
ref|WP_013894918.1|  serine--glyoxylate aminotransferase                140   2e-36   
ref|WP_018329867.1|  serine--glyoxylate aminotransferase                140   2e-36   
ref|WP_015314900.1|  serine--glyoxylate aminotransferase                140   3e-36   
ref|WP_023690974.1|  MULTISPECIES: serine--glyoxylate aminotransf...    140   3e-36   
ref|WP_023700366.1|  serine--glyoxylate aminotransferase                140   3e-36   
ref|WP_023731220.1|  MULTISPECIES: serine--glyoxylate aminotransf...    140   3e-36   
ref|WP_031597721.1|  serine--glyoxylate aminotransferase                140   3e-36   
ref|WP_023698325.1|  serine--glyoxylate aminotransferase                140   3e-36   
ref|WP_023706127.1|  MULTISPECIES: serine--glyoxylate aminotransf...    140   4e-36   
ref|WP_023685219.1|  serine--glyoxylate aminotransferase                140   4e-36   
ref|WP_022947294.1|  serine--glyoxylate aminotransferase                140   4e-36   
ref|WP_023829410.1|  serine--glyoxylate aminotransferase                140   4e-36   
ref|WP_027044922.1|  serine--glyoxylate aminotransferase                140   4e-36   
ref|WP_024878012.1|  MULTISPECIES: serine--glyoxylate aminotransf...    140   4e-36   
ref|XP_005851882.1|  hypothetical protein CHLNCDRAFT_33614              140   4e-36   
ref|WP_037384071.1|  serine--glyoxylate aminotransferase                140   4e-36   
ref|WP_042643125.1|  serine--glyoxylate aminotransferase                140   4e-36   
ref|WP_041003840.1|  serine--glyoxylate aminotransferase                139   5e-36   
ref|WP_037131645.1|  serine--glyoxylate aminotransferase                139   5e-36   
ref|WP_041007618.1|  serine--glyoxylate aminotransferase                139   6e-36   
ref|WP_023833857.1|  serine--glyoxylate aminotransferase                139   7e-36   
ref|WP_040981991.1|  serine--glyoxylate aminotransferase                139   7e-36   
ref|WP_023763335.1|  serine--glyoxylate aminotransferase                139   7e-36   
ref|WP_043774228.1|  serine--glyoxylate aminotransferase                139   7e-36   
ref|WP_010910076.1|  serine--glyoxylate aminotransferase                139   8e-36   
ref|WP_023741624.1|  serine--glyoxylate aminotransferase                139   8e-36   
ref|WP_023496630.1|  serine--glyoxylate aminotransferase SgaA           139   9e-36   
ref|WP_023746858.1|  MULTISPECIES: serine--glyoxylate aminotransf...    139   9e-36   
ref|WP_023739129.1|  MULTISPECIES: serine--glyoxylate aminotransf...    139   1e-35   
ref|WP_023769804.1|  MULTISPECIES: serine--glyoxylate aminotransf...    139   1e-35   
gb|AEX09261.1|  alanine glyoxylate aminotransferase                     137   1e-35   
ref|WP_018405893.1|  serine--glyoxylate aminotransferase                139   1e-35   
gb|AEX09247.1|  alanine glyoxylate aminotransferase                     137   1e-35   
ref|WP_023712721.1|  MULTISPECIES: serine--glyoxylate aminotransf...    139   1e-35   
ref|WP_023690293.1|  serine--glyoxylate aminotransferase                139   1e-35   
ref|WP_023782620.1|  serine--glyoxylate aminotransferase                139   1e-35   
ref|WP_023827347.1|  serine--glyoxylate aminotransferase                138   1e-35   
ref|WP_019867322.1|  serine--glyoxylate aminotransferase                138   1e-35   
ref|WP_023779196.1|  serine--glyoxylate aminotransferase                138   1e-35   
ref|WP_029648781.1|  serine--glyoxylate aminotransferase                138   2e-35   
ref|WP_032930697.1|  serine--glyoxylate aminotransferase                138   2e-35   
ref|WP_014890662.1|  serine--glyoxylate aminotransferase                138   2e-35   
ref|WP_041011880.1|  serine--glyoxylate aminotransferase                138   2e-35   
ref|WP_019858769.1|  serine--glyoxylate aminotransferase                138   2e-35   
ref|WP_037283573.1|  serine--glyoxylate aminotransferase                137   4e-35   
ref|WP_040618186.1|  serine--glyoxylate aminotransferase                137   5e-35   
ref|WP_024925735.1|  MULTISPECIES: serine--glyoxylate aminotransf...    137   5e-35   
ref|WP_023753463.1|  MULTISPECIES: serine--glyoxylate aminotransf...    137   5e-35   
gb|AEX09281.1|  alanine glyoxylate aminotransferase                     135   5e-35   
gb|AEX09269.1|  alanine glyoxylate aminotransferase                     135   8e-35   
ref|WP_037133426.1|  serine--glyoxylate aminotransferase                136   9e-35   
ref|WP_016921634.1|  serine--glyoxylate aminotransferase                136   1e-34   
ref|XP_003615391.1|  Alanine glyoxylate aminotransferase                135   1e-34   
gb|AEX09290.1|  alanine glyoxylate aminotransferase                     134   2e-34   
ref|WP_014955398.1|  serine--glyoxylate aminotransferase                134   3e-34   
ref|WP_027163728.1|  serine--glyoxylate aminotransferase                135   3e-34   
ref|WP_013529882.1|  serine--glyoxylate aminotransferase                135   3e-34   
ref|WP_036284904.1|  serine--glyoxylate aminotransferase                134   3e-34   
ref|WP_024505109.1|  serine--glyoxylate aminotransferase                134   4e-34   
gb|AEX09280.1|  alanine glyoxylate aminotransferase                     133   4e-34   
ref|WP_028097617.1|  serine--glyoxylate aminotransferase                134   4e-34   
ref|WP_043847105.1|  serine--glyoxylate aminotransferase                134   7e-34   
gb|AEX09243.1|  alanine glyoxylate aminotransferase                     132   8e-34   
ref|WP_009211467.1|  serine--glyoxylate aminotransferase                134   8e-34   
ref|WP_026227793.1|  serine--glyoxylate aminotransferase                132   2e-33   
ref|WP_036274731.1|  serine--glyoxylate aminotransferase                132   2e-33   
ref|WP_009817966.1|  serine--glyoxylate aminotransferase                132   2e-33   
ref|WP_020482091.1|  serine--glyoxylate aminotransferase                132   2e-33   
ref|WP_026604426.1|  serine--glyoxylate aminotransferase                132   2e-33   
ref|WP_033156535.1|  serine--glyoxylate aminotransferase                132   3e-33   
ref|WP_013949995.1|  MULTISPECIES: serine--glyoxylate aminotransf...    132   4e-33   
gb|AEX09289.1|  alanine glyoxylate aminotransferase                     130   5e-33   
ref|WP_037268413.1|  serine--glyoxylate aminotransferase                131   5e-33   
ref|WP_037245168.1|  serine--glyoxylate aminotransferase                131   7e-33   
ref|WP_008280158.1|  serine--glyoxylate aminotransferase                131   8e-33   
ref|WP_024351906.1|  serine--glyoxylate aminotransferase                130   1e-32   
ref|WP_038511699.1|  serine--glyoxylate aminotransferase                130   1e-32   
sp|O08374.2|SGAA_HYPME  RecName: Full=Serine--glyoxylate aminotra...    130   2e-32   
gb|AHJ64409.1|  Serine-pyruvate aminotransferase                        130   2e-32   
ref|WP_020085137.1|  serine--glyoxylate aminotransferase                130   2e-32   
ref|WP_023434100.1|  Serine--glyoxylate aminotransferase                129   3e-32   
ref|WP_013217108.1|  serine--glyoxylate aminotransferase                129   4e-32   
ref|WP_011630756.1|  serine--glyoxylate aminotransferase                129   4e-32   
ref|WP_015599474.1|  serine--glyoxylate aminotransferase                129   4e-32   
ref|WP_038515723.1|  serine--glyoxylate aminotransferase                129   5e-32   
gb|AFZ62596.1|  serine-glyoxylate aminotransferase                      129   5e-32   
ref|WP_041319044.1|  serine--glyoxylate aminotransferase                129   5e-32   
gb|AHJ67030.1|  hypothetical protein GbCGDNIH2_0048                     129   6e-32   
ref|WP_020592928.1|  hypothetical protein                               128   6e-32   
gb|AHJ61786.1|  Serine-pyruvate aminotransferase                        129   6e-32   
ref|WP_025312373.1|  serine--glyoxylate aminotransferase                128   7e-32   
ref|WP_043870950.1|  serine--glyoxylate aminotransferase                127   2e-31   
gb|KJB54393.1|  hypothetical protein B456_009G074800                    125   3e-31   
ref|WP_037057439.1|  serine--glyoxylate aminotransferase                126   4e-31   
ref|WP_010968118.1|  serine--glyoxylate aminotransferase                125   1e-30   
ref|WP_007815045.1|  serine--glyoxylate aminotransferase                125   1e-30   
ref|WP_006005059.1|  serine--glyoxylate aminotransferase                124   3e-30   
ref|WP_043619319.1|  serine--glyoxylate aminotransferase                122   1e-29   
ref|XP_005539023.1|  serine-glyoxylate aminotransferase                 122   1e-29   
gb|KIZ03753.1|  serine--glyoxylate transaminase                         122   2e-29   
ref|WP_037263007.1|  serine--glyoxylate aminotransferase                121   2e-29   
gb|KJB83533.1|  hypothetical protein B456_013G252200                    120   5e-29   
ref|WP_037126267.1|  serine--glyoxylate aminotransferase                118   3e-28   
emb|CAD13310.1|  serine-glyoxylate aminotransferase                     118   3e-28   
ref|WP_019015661.1|  hypothetical protein                               117   6e-28   
ref|WP_044852944.1|  serine--glyoxylate aminotransferase                117   6e-28   
ref|WP_037336675.1|  serine--glyoxylate aminotransferase                117   9e-28   
ref|WP_036336347.1|  serine--glyoxylate aminotransferase                116   1e-27   
ref|WP_041345074.1|  serine--glyoxylate aminotransferase                116   1e-27   
ref|WP_006344742.1|  serine--glyoxylate aminotransferase                116   1e-27   
ref|WP_014869675.1|  serine--glyoxylate aminotransferase                116   1e-27   
gb|ABA05667.1|  aminotransferase, class V                               116   1e-27   
ref|WP_007351739.1|  serine--glyoxylate aminotransferase                116   1e-27   
ref|WP_005162865.1|  Serine--glyoxylate aminotransferase                116   1e-27   
ref|WP_040829642.1|  serine--glyoxylate aminotransferase                116   2e-27   
ref|WP_013046086.1|  serine--glyoxylate aminotransferase                116   2e-27   
ref|WP_040651093.1|  serine--glyoxylate aminotransferase                116   2e-27   
ref|WP_020636555.1|  serine--glyoxylate aminotransferase                115   2e-27   
ref|WP_012177563.1|  serine--glyoxylate aminotransferase                115   2e-27   
ref|WP_028719065.1|  serine--glyoxylate aminotransferase                115   2e-27   
ref|WP_011750154.1|  serine--glyoxylate aminotransferase                115   2e-27   
ref|WP_036753911.1|  serine--glyoxylate aminotransferase                115   3e-27   
ref|WP_024844788.1|  serine--glyoxylate aminotransferase                115   3e-27   
gb|EAQ23658.1|  probable serine-glyoxylate aminotransferase             115   3e-27   
ref|WP_009796741.1|  serine--glyoxylate aminotransferase                115   3e-27   
gb|ABR16309.1|  unknown                                                 108   3e-27   
ref|WP_029016266.1|  serine--glyoxylate aminotransferase                115   4e-27   
ref|WP_030670113.1|  serine--glyoxylate aminotransferase                115   4e-27   
ref|WP_037249159.1|  serine--glyoxylate aminotransferase                115   5e-27   
ref|WP_005860686.1|  serine--glyoxylate aminotransferase                115   5e-27   
ref|WP_015895604.1|  serine--glyoxylate aminotransferase                115   5e-27   
ref|WP_008757940.1|  serine--glyoxylate aminotransferase                115   5e-27   
ref|WP_028431641.1|  serine--glyoxylate aminotransferase                114   6e-27   
ref|WP_033390460.1|  serine--glyoxylate aminotransferase                114   6e-27   
ref|WP_034483968.1|  serine--glyoxylate aminotransferase                114   6e-27   
ref|WP_036178803.1|  serine--glyoxylate aminotransferase                114   6e-27   
ref|WP_030566583.1|  serine--glyoxylate aminotransferase                114   6e-27   
ref|WP_040808396.1|  serine--glyoxylate aminotransferase                114   7e-27   
ref|WP_014743098.1|  serine--glyoxylate aminotransferase                114   7e-27   
ref|WP_018001111.1|  serine--glyoxylate aminotransferase                114   7e-27   
ref|WP_023666824.1|  serine--glyoxylate aminotransferase                114   7e-27   
ref|WP_026847044.1|  serine--glyoxylate aminotransferase                114   8e-27   
ref|WP_010395294.1|  serine--glyoxylate aminotransferase                114   8e-27   
ref|WP_020084034.1|  serine--glyoxylate aminotransferase                114   8e-27   
gb|AHB47648.1|  serine--glyoxylate aminotransferase                     114   9e-27   
ref|WP_040742470.1|  serine--glyoxylate aminotransferase                114   9e-27   
ref|WP_010239996.1|  serine--glyoxylate aminotransferase                114   9e-27   
ref|WP_008279759.1|  serine--glyoxylate aminotransferase                114   9e-27   
ref|WP_030358204.1|  MULTISPECIES: serine--glyoxylate aminotransf...    114   1e-26   
ref|WP_028712351.1|  serine--glyoxylate aminotransferase                114   1e-26   
ref|WP_041317230.1|  serine--glyoxylate aminotransferase                114   1e-26   
ref|WP_013961473.1|  serine--glyoxylate aminotransferase                114   1e-26   
ref|WP_028716825.1|  serine--glyoxylate aminotransferase                114   1e-26   
ref|WP_038514775.1|  serine--glyoxylate aminotransferase                114   1e-26   
ref|WP_011569032.1|  serine--glyoxylate aminotransferase                113   2e-26   
ref|WP_034505845.1|  serine--glyoxylate aminotransferase                113   2e-26   
ref|WP_026641447.1|  serine--glyoxylate aminotransferase                113   2e-26   
ref|WP_011513322.1|  MULTISPECIES: serine--glyoxylate aminotransf...    113   2e-26   
ref|WP_011454286.1|  serine--glyoxylate aminotransferase                113   2e-26   
ref|WP_024927669.1|  MULTISPECIES: serine--glyoxylate aminotransf...    113   2e-26   
ref|WP_010441851.1|  serine--glyoxylate aminotransferase                113   2e-26   
ref|WP_011455723.1|  serine--glyoxylate aminotransferase                113   2e-26   
ref|WP_036741500.1|  serine--glyoxylate aminotransferase                113   2e-26   
ref|WP_037251090.1|  serine--glyoxylate aminotransferase                112   3e-26   
ref|WP_037276810.1|  serine--glyoxylate aminotransferase                112   3e-26   
ref|WP_039537917.1|  serine--glyoxylate aminotransferase                112   4e-26   
ref|WP_017971680.1|  serine--glyoxylate aminotransferase                112   4e-26   
ref|WP_038147781.1|  serine--glyoxylate aminotransferase                112   4e-26   
gb|EAP76585.1|  probable serine-glyoxylate aminotransferase             112   5e-26   
ref|WP_023002149.1|  MULTISPECIES: serine--glyoxylate aminotransf...    112   6e-26   
ref|WP_020096326.1|  serine--glyoxylate aminotransferase                112   7e-26   
ref|WP_016640027.1|  putative Serine--glyoxylate aminotransferase       111   7e-26   
ref|WP_038008200.1|  MULTISPECIES: serine--glyoxylate aminotransf...    111   7e-26   
ref|WP_029964417.1|  serine--glyoxylate aminotransferase                111   7e-26   
ref|WP_028356096.1|  serine--glyoxylate aminotransferase                111   8e-26   
ref|WP_006935547.1|  serine--glyoxylate aminotransferase                111   9e-26   
ref|WP_026850920.1|  serine--glyoxylate aminotransferase                111   9e-26   
ref|WP_026622392.1|  serine--glyoxylate aminotransferase                111   9e-26   
ref|WP_014982904.1|  serine--glyoxylate aminotransferase                111   1e-25   
gb|ABZ06421.1|  putative aminotransferase class-V                       110   1e-25   
ref|WP_027288003.1|  serine--glyoxylate aminotransferase                110   1e-25   
ref|WP_012179154.1|  serine--glyoxylate aminotransferase                110   1e-25   
ref|WP_019140317.1|  serine--glyoxylate aminotransferase                110   1e-25   
ref|WP_023665384.1|  serine--glyoxylate aminotransferase                110   2e-25   
ref|WP_038072032.1|  serine--glyoxylate aminotransferase                110   2e-25   
ref|WP_016574932.1|  Serine-glyoxylate aminotransferase                 110   2e-25   
ref|WP_036191573.1|  serine--glyoxylate aminotransferase                110   2e-25   
ref|WP_042083882.1|  serine--glyoxylate aminotransferase                110   2e-25   
ref|WP_013695939.1|  serine--glyoxylate aminotransferase                110   2e-25   
ref|WP_009834866.1|  serine--glyoxylate aminotransferase                110   2e-25   
ref|WP_014762541.1|  serine--glyoxylate aminotransferase                110   2e-25   
ref|XP_003391858.1|  PREDICTED: serine--glyoxylate aminotransfera...    110   2e-25   
ref|WP_043145413.1|  serine--glyoxylate aminotransferase                110   2e-25   
ref|WP_009464599.1|  serine--glyoxylate aminotransferase                110   2e-25   
ref|WP_009338917.1|  serine--glyoxylate aminotransferase                110   3e-25   
emb|CEG08571.1|  Soluble hydrogenase 42 kDa subunit                     110   3e-25   
ref|WP_011563908.1|  serine--glyoxylate aminotransferase                110   3e-25   
ref|WP_033381446.1|  serine--glyoxylate aminotransferase                109   3e-25   
ref|WP_043769964.1|  serine--glyoxylate aminotransferase                110   3e-25   
ref|WP_028957602.1|  serine--glyoxylate aminotransferase                110   3e-25   
ref|WP_015888023.1|  serine--glyoxylate aminotransferase                110   3e-25   
ref|WP_029455333.1|  serine--glyoxylate aminotransferase                109   4e-25   
gb|ERL97602.1|  serine-pyruvate aminotransferase/archaeal asparta...    110   4e-25   
ref|WP_002716388.1|  hypothetical protein                               109   4e-25   
ref|WP_037308357.1|  serine--glyoxylate aminotransferase                109   4e-25   
ref|WP_037247820.1|  serine--glyoxylate aminotransferase                109   4e-25   
ref|XP_011399157.1|  Serine-glyoxylate aminotransferase                 109   4e-25   
ref|WP_037929134.1|  serine--glyoxylate aminotransferase                109   4e-25   
ref|WP_043145903.1|  serine--glyoxylate aminotransferase                109   4e-25   
ref|WP_028796360.1|  serine--glyoxylate aminotransferase                109   4e-25   
ref|WP_018238011.1|  serine--glyoxylate aminotransferase                109   5e-25   
ref|WP_020666968.1|  serine--glyoxylate aminotransferase                109   5e-25   
ref|WP_020683672.1|  hypothetical protein                               109   5e-25   
ref|WP_042195193.1|  serine--glyoxylate aminotransferase                109   5e-25   
ref|WP_028435927.1|  serine--glyoxylate aminotransferase                109   5e-25   
ref|WP_042259673.1|  serine--glyoxylate aminotransferase                109   6e-25   
ref|WP_024570173.1|  MULTISPECIES: serine--glyoxylate aminotransf...    108   6e-25   
ref|WP_029895536.1|  serine--glyoxylate aminotransferase                108   6e-25   
ref|WP_014989411.1|  serine--glyoxylate aminotransferase                108   6e-25   



>ref|XP_011090165.1| PREDICTED: serine--glyoxylate aminotransferase [Sesamum indicum]
Length=401

 Score =   252 bits (643),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 120/125 (96%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIPDQV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPDQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDVVESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVVESEWGQG  120

Query  507  ANLDV  521
            ANLDV
Sbjct  121  ANLDV  125



>emb|CDP08481.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   251 bits (640),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/125 (93%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYVN PGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TK LLEDVKKIFKT SG
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKILLEDVKKIFKTESG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDV+ESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVIESEWGQG  120

Query  507  ANLDV  521
            ANLD+
Sbjct  121  ANLDI  125



>gb|EPS59280.1| serine-glyoxylate aminotransferase [Genlisea aurea]
Length=401

 Score =   249 bits (637),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/125 (94%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+QVIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGRG  120

Query  507  ANLDV  521
            A+LD+
Sbjct  121  ADLDI  125



>ref|XP_010277598.1| PREDICTED: serine--glyoxylate aminotransferase [Nelumbo nucifera]
 ref|XP_010277599.1| PREDICTED: serine--glyoxylate aminotransferase [Nelumbo nucifera]
Length=401

 Score =   249 bits (636),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 118/125 (94%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV APGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYVYAPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDV+ESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVIESEWGQG  120

Query  507  ANLDV  521
            ANLD+
Sbjct  121  ANLDI  125



>ref|XP_006584642.1| PREDICTED: enzymatic resistance protein isoform X1 [Glycine max]
 gb|ACE63506.1| alanine:glyoxylate aminotransferase [Vigna radiata]
 gb|ACU23313.1| unknown [Glycine max]
 gb|KHM99689.1| Serine--glyoxylate aminotransferase [Glycine soja]
Length=401

 Score =   249 bits (636),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 116/125 (93%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWG G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGHG  120

Query  507  ANLDV  521
            A LDV
Sbjct  121  AKLDV  125



>ref|XP_003600160.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES70411.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=408

 Score =   249 bits (636),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 123/125 (98%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYVN PGRNHLFVPGPVNIPDQVIRAM+RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPDQVIRAMSRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRIVSF+IGQFSLLW+DQQQRL FNVDVVESEWG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFVIGQFSLLWVDQQQRLKFNVDVVESEWGRG  120

Query  507  ANLDV  521
            A+LD+
Sbjct  121  ADLDI  125



>gb|ACJ61247.1| serine glyoxylate aminotransferase 3 [Glycine max]
Length=401

 Score =   249 bits (635),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 116/125 (93%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWG G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGHG  120

Query  507  ANLDV  521
            A LDV
Sbjct  121  AKLDV  125



>ref|XP_011080387.1| PREDICTED: serine--glyoxylate aminotransferase-like [Sesamum 
indicum]
Length=401

 Score =   249 bits (635),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/125 (94%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+QVIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKT SG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTASG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRIV+FLIGQFSLLWIDQQQRLNFNVDVVESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVTFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  120

Query  507  ANLDV  521
            ANL++
Sbjct  121  ANLEI  125



>ref|NP_001237048.1| enzymatic resistance protein [Glycine max]
 gb|AAZ94162.1| enzymatic resistance protein [Glycine max]
Length=401

 Score =   249 bits (635),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/125 (93%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWG G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGHG  120

Query  507  ANLDV  521
            A LDV
Sbjct  121  AKLDV  125



>ref|XP_003600159.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES70410.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=401

 Score =   248 bits (634),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 123/125 (98%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYVN PGRNHLFVPGPVNIPDQVIRAM+RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPDQVIRAMSRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRIVSF+IGQFSLLW+DQQQRL FNVDVVESEWG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFVIGQFSLLWVDQQQRLKFNVDVVESEWGRG  120

Query  507  ANLDV  521
            A+LD+
Sbjct  121  ADLDI  125



>ref|XP_004499480.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cicer arietinum]
Length=401

 Score =   248 bits (633),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/125 (93%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYVN PGRNHLFVPGPVNIPDQVIRAM+RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPDQVIRAMSRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PT GTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQQRL FNVDVVESEWG+G
Sbjct  61   TPFLFPTXGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGKG  120

Query  507  ANLDV  521
            ANLD+
Sbjct  121  ANLDI  125



>dbj|BAJ33858.1| unnamed protein product [Thellungiella halophila]
Length=438

 Score =   249 bits (636),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/126 (92%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = +3

Query  144  KMDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTS  323
            KMDY+N PGR+HLFVPGPVNIP+QVIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTS
Sbjct  37   KMDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTS  96

Query  324  GTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQ  503
            GTPF+ PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQ
Sbjct  97   GTPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQ  156

Query  504  GANLDV  521
            GANL V
Sbjct  157  GANLQV  162



>gb|AGV54322.1| serine glyoxylate aminotransferase 2 [Phaseolus vulgaris]
Length=401

 Score =   247 bits (631),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/125 (93%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
             PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61   IPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESDWGQG  120

Query  507  ANLDV  521
            A LDV
Sbjct  121  AKLDV  125



>ref|XP_007146302.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 ref|XP_007146303.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 gb|ESW18296.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 gb|ESW18297.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
Length=401

 Score =   247 bits (631),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/125 (93%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
             PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61   IPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESDWGQG  120

Query  507  ANLDV  521
            A LDV
Sbjct  121  AKLDV  125



>gb|KDO44954.1| hypothetical protein CISIN_1g0157291mg [Citrus sinensis]
Length=367

 Score =   246 bits (628),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+ APG+NHLFVPGPV+IPDQVIRAM RNNEDYRSPAVPALTKTLLED+KKIFKTTSG
Sbjct  1    MDYMYAPGKNHLFVPGPVHIPDQVIRAMNRNNEDYRSPAVPALTKTLLEDIKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRI+SFLIGQFSLLWIDQQQRLNFNVDVVES+WG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIISFLIGQFSLLWIDQQQRLNFNVDVVESDWGEG  120

Query  507  ANLDV  521
            A LDV
Sbjct  121  AKLDV  125



>gb|AFK40703.1| unknown [Medicago truncatula]
Length=401

 Score =   247 bits (630),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYVN PGRNHLFVPGPVNIPDQVIRAM+RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPDQVIRAMSRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWES LTNTLSPGDRIVSF+IGQFSLLW+DQQQRL FNVDVVESEWG+G
Sbjct  61   TPFLIPTTGTGAWESVLTNTLSPGDRIVSFVIGQFSLLWVDQQQRLKFNVDVVESEWGRG  120

Query  507  ANLDV  521
            A+LD+
Sbjct  121  ADLDI  125



>gb|KHN28521.1| Serine--glyoxylate aminotransferase [Glycine soja]
Length=401

 Score =   246 bits (629),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKT +G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTITG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
             PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61   IPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  507  ANLDV  521
            A LDV
Sbjct  121  AKLDV  125



>gb|ACJ61246.1| serine glyoxylate aminotransferase 2 [Glycine max]
Length=401

 Score =   246 bits (629),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKT +G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTITG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
             PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61   IPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  507  ANLDV  521
            A LDV
Sbjct  121  AKLDV  125



>gb|KDO44953.1| hypothetical protein CISIN_1g0157291mg [Citrus sinensis]
Length=401

 Score =   246 bits (629),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+ APG+NHLFVPGPV+IPDQVIRAM RNNEDYRSPAVPALTKTLLED+KKIFKTTSG
Sbjct  1    MDYMYAPGKNHLFVPGPVHIPDQVIRAMNRNNEDYRSPAVPALTKTLLEDIKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRI+SFLIGQFSLLWIDQQQRLNFNVDVVES+WG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIISFLIGQFSLLWIDQQQRLNFNVDVVESDWGEG  120

Query  507  ANLDV  521
            A LDV
Sbjct  121  AKLDV  125



>ref|NP_001276276.1| serine--glyoxylate aminotransferase-like [Glycine max]
 gb|ACU18294.1| unknown [Glycine max]
Length=401

 Score =   246 bits (629),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKT +G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTITG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
             PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61   IPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  507  ANLDV  521
            A LDV
Sbjct  121  AKLDV  125



>ref|XP_006409690.1| hypothetical protein EUTSA_v10022711mg [Eutrema salsugineum]
 gb|ESQ51143.1| hypothetical protein EUTSA_v10022711mg [Eutrema salsugineum]
Length=401

 Score =   246 bits (629),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+N PGR+HLFVPGPVNIP+QVIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+ PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61   TPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  507  ANLDV  521
            ANL V
Sbjct  121  ANLQV  125



>ref|XP_006470731.1| PREDICTED: serine--glyoxylate aminotransferase-like [Citrus sinensis]
Length=401

 Score =   246 bits (629),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+ APG+NHLFVPGPV+IPDQVIRAM RNNEDYRSPAVPALTKTLLED+KKIFKTTSG
Sbjct  1    MDYMYAPGKNHLFVPGPVHIPDQVIRAMNRNNEDYRSPAVPALTKTLLEDIKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRI+SFLIGQFSLLWIDQQQRLNFNVDVVES+WG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIISFLIGQFSLLWIDQQQRLNFNVDVVESDWGEG  120

Query  507  ANLDV  521
            A LDV
Sbjct  121  AKLDV  125



>emb|CDY37208.1| BnaA09g08290D [Brassica napus]
Length=401

 Score =   246 bits (628),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+N PGR+HLFVPGPVNIP+QVIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+ PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61   TPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  507  ANLDV  521
            ANL V
Sbjct  121  ANLQV  125



>ref|XP_009112244.1| PREDICTED: serine--glyoxylate aminotransferase [Brassica rapa]
Length=401

 Score =   246 bits (628),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+N PGR+HLFVPGPVNIP+QVIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+ PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61   TPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  507  ANLDV  521
            ANL V
Sbjct  121  ANLQV  125



>ref|XP_006446249.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 ref|XP_006446250.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 gb|ESR59489.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 gb|ESR59490.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
Length=401

 Score =   246 bits (627),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+ APG+NHLFVPGPV IPDQVIRAM RNNEDYRSPAVPALTKTLLED+KKIFKTTSG
Sbjct  1    MDYMYAPGKNHLFVPGPVQIPDQVIRAMNRNNEDYRSPAVPALTKTLLEDIKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRI+SFLIGQFSLLWIDQQQRLNFNVDVVES+WG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIISFLIGQFSLLWIDQQQRLNFNVDVVESDWGEG  120

Query  507  ANLDV  521
            A LDV
Sbjct  121  AKLDV  125



>emb|CDX81443.1| BnaC09g08540D [Brassica napus]
Length=401

 Score =   246 bits (627),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+N PGR+HLFVPGPVNIP+QV+RAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMNGPGRHHLFVPGPVNIPEQVVRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+ PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61   TPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  507  ANLDV  521
            ANL V
Sbjct  121  ANLQV  125



>ref|XP_008812510.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812512.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812513.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812514.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
Length=401

 Score =   245 bits (626),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/125 (93%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL F+VDV+ESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFDVDVIESEWGQG  120

Query  507  ANLDV  521
            ANLD+
Sbjct  121  ANLDI  125



>ref|XP_010045046.1| PREDICTED: serine--glyoxylate aminotransferase [Eucalyptus grandis]
 ref|XP_010045047.1| PREDICTED: serine--glyoxylate aminotransferase [Eucalyptus grandis]
 gb|KCW87200.1| hypothetical protein EUGRSUZ_B03720 [Eucalyptus grandis]
Length=401

 Score =   245 bits (625),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIPDQVIRAM RNNEDYRSPA+PALTK LLEDVKKIFKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPDQVIRAMNRNNEDYRSPAIPALTKILLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDR +SF+IGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRTISFMIGQFSLLWIDQQQRLGFNVDVVESEWGQG  120

Query  507  ANLDV  521
            ANLD+
Sbjct  121  ANLDI  125



>gb|ABA00460.1| serine-glyoxylate aminotransferase [Spirodela polyrhiza]
Length=401

 Score =   245 bits (625),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/125 (94%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES+WG G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGLG  120

Query  507  ANLDV  521
            ANLDV
Sbjct  121  ANLDV  125



>emb|CDX89604.1| BnaC03g45180D [Brassica napus]
Length=401

 Score =   245 bits (625),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+N PGR+HLFVPGPVNIP+QVIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+ PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVES+WGQG
Sbjct  61   TPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQG  120

Query  507  ANLDV  521
            ANL V
Sbjct  121  ANLQV  125



>ref|XP_006349776.1| PREDICTED: serine--glyoxylate aminotransferase-like [Solanum 
tuberosum]
Length=401

 Score =   245 bits (625),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYVN PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQ+RLNF+VDVVES+WGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLNFDVDVVESDWGQG  120

Query  507  ANLDV  521
            ANL+V
Sbjct  121  ANLEV  125



>ref|XP_009136209.1| PREDICTED: serine--glyoxylate aminotransferase-like [Brassica 
rapa]
 ref|XP_009136210.1| PREDICTED: serine--glyoxylate aminotransferase-like [Brassica 
rapa]
 emb|CDX93112.1| BnaA03g38340D [Brassica napus]
Length=401

 Score =   245 bits (625),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+N PGR+HLFVPGPVNIP+QVIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+ PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVES+WGQG
Sbjct  61   TPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQG  120

Query  507  ANLDV  521
            ANL V
Sbjct  121  ANLQV  125



>ref|NP_001265946.1| Hop-interacting protein THI032 [Solanum lycopersicum]
 ref|XP_010314658.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314659.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314661.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314662.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314663.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 gb|AEW69795.1| Hop-interacting protein THI032 [Solanum lycopersicum]
Length=401

 Score =   245 bits (625),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYVN PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQ+RLNF+VDVVES+WGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLNFDVDVVESDWGQG  120

Query  507  ANLDV  521
            ANL+V
Sbjct  121  ANLEV  125



>ref|XP_008449670.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
melo]
 gb|AAQ56195.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   244 bits (623),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDV+ESEWG+G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEG  120

Query  507  ANLDV  521
            A LDV
Sbjct  121  AKLDV  125



>gb|ABQ81925.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   244 bits (623),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDV+ESEWG+G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEG  120

Query  507  ANLDV  521
            A LDV
Sbjct  121  AKLDV  125



>gb|AAL62332.1|AF461048_1 aminotransferase 2 [Cucumis melo]
Length=401

 Score =   244 bits (622),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDV+ESEWG+G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEG  120

Query  507  ANLDV  521
            A LDV
Sbjct  121  AKLDV  125



>ref|NP_001284445.1| serine--glyoxylate aminotransferase-like [Cucumis melo]
 gb|ABQ81923.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   244 bits (622),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDV+ESEWG+G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEG  120

Query  507  ANLDV  521
            A LDV
Sbjct  121  AKLDV  125



>ref|XP_009619693.1| PREDICTED: serine--glyoxylate aminotransferase [Nicotiana tomentosiformis]
Length=401

 Score =   244 bits (622),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYVN PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTK LLEDVKKIFKTTSG
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKVLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNF+VDVVES+WGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFDVDVVESDWGQG  120

Query  507  ANLD  518
            A+L+
Sbjct  121  ADLE  124



>ref|XP_009342610.1| PREDICTED: serine--glyoxylate aminotransferase [Pyrus x bretschneideri]
 ref|XP_009342611.1| PREDICTED: serine--glyoxylate aminotransferase [Pyrus x bretschneideri]
Length=401

 Score =   244 bits (622),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVK+IFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPAMTKTLLEDVKQIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61   TPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  507  ANLDV  521
            ANLDV
Sbjct  121  ANLDV  125



>ref|XP_009775939.1| PREDICTED: serine--glyoxylate aminotransferase [Nicotiana sylvestris]
Length=401

 Score =   244 bits (622),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYVN PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTK LLEDVKKIFKTTSG
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKVLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNF+VDVVES+WGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFDVDVVESDWGQG  120

Query  507  ANLD  518
            A+L+
Sbjct  121  ADLE  124



>ref|XP_008363560.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
Length=401

 Score =   244 bits (622),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61   TPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESDWGQG  120

Query  507  ANLDV  521
            ANLDV
Sbjct  121  ANLDV  125



>gb|ABQ81922.1| aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   243 bits (620),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKT+SG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTSSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDV+ESEWG+G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEG  120

Query  507  ANLDV  521
            A LDV
Sbjct  121  AKLDV  125



>ref|XP_004140203.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 ref|XP_004156042.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 gb|KGN48108.1| Aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDV+ES+WG+G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESDWGEG  120

Query  507  ANLDV  521
            A LDV
Sbjct  121  AKLDV  125



>ref|XP_007015204.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 ref|XP_007015205.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 ref|XP_007015206.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32823.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32824.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32825.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
Length=401

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PA+TKTLLEDVK IFKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPAMTKTLLEDVKMIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG
Sbjct  61   TPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  120

Query  507  ANLDV  521
            ANL++
Sbjct  121  ANLEI  125



>ref|XP_004139054.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 ref|XP_004166102.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 gb|KGN66521.1| Aminotransferase 1 [Cucumis sativus]
Length=401

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV APG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPALTKTLLEDVKKIFK+T+G
Sbjct  1    MDYVYAPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKSTAG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T FLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES+WGQG
Sbjct  61   TTFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGQG  120

Query  507  ANLDV  521
            ANLDV
Sbjct  121  ANLDV  125



>gb|AGT38285.1| serine--glyoxylate aminotransferase [Gossypium hirsutum]
 gb|KJB83532.1| hypothetical protein B456_013G252200 [Gossypium raimondii]
Length=401

 Score =   242 bits (618),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY   PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61   TPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  507  ANLDV  521
            ANLDV
Sbjct  121  ANLDV  125



>gb|AAL47679.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   242 bits (618),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV APG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPALTKTLLEDVKKIFK+T+G
Sbjct  1    MDYVYAPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKSTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T FLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES+WGQG
Sbjct  61   TTFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGQG  120

Query  507  ANLDV  521
            ANLDV
Sbjct  121  ANLDV  125



>ref|XP_006843377.1| hypothetical protein AMTR_s00053p00093890 [Amborella trichopoda]
 gb|ERN05052.1| hypothetical protein AMTR_s00053p00093890 [Amborella trichopoda]
Length=401

 Score =   242 bits (618),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSP DRIVSFL+GQFSLLWIDQQQRLNFNVDV+ESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPRDRIVSFLMGQFSLLWIDQQQRLNFNVDVIESEWGQG  120

Query  507  ANLD  518
            ANLD
Sbjct  121  ANLD  124



>ref|XP_008359496.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
 ref|XP_008359497.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
Length=401

 Score =   242 bits (617),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+ V+R+M RNNEDYRSPAVPA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEAVLRSMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  507  ANLDV  521
            ANLD+
Sbjct  121  ANLDI  125



>gb|AAQ56192.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   242 bits (617),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV APG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPALTKTLLEDVKKIFK+T+G
Sbjct  1    MDYVYAPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKSTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T FLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDV+ES+WGQG
Sbjct  61   TTFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVIESDWGQG  120

Query  507  ANLDV  521
            ANLDV
Sbjct  121  ANLDV  125



>gb|KHG29969.1| Serine--glyoxylate aminotransferase -like protein [Gossypium 
arboreum]
Length=401

 Score =   242 bits (617),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDYVYGPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDR V+FLIGQFSLLWIDQQQRLNFNVDVVESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRTVTFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  120

Query  507  ANLDV  521
            ANLD+
Sbjct  121  ANLDI  125



>ref|XP_010938608.1| PREDICTED: serine--glyoxylate aminotransferase-like [Elaeis guineensis]
Length=401

 Score =   242 bits (617),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTL+EDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLIEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL F+VDV+ESEWG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFDVDVIESEWGRG  120

Query  507  ANLDV  521
            ANLD+
Sbjct  121  ANLDM  125



>ref|XP_009410322.1| PREDICTED: serine--glyoxylate aminotransferase-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410323.1| PREDICTED: serine--glyoxylate aminotransferase-like [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   241 bits (616),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MD+  APGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDFFYAPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGD+IVSFLIGQFSLLWIDQQQRLNFNVDV+ESEWG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDKIVSFLIGQFSLLWIDQQQRLNFNVDVIESEWGRG  120

Query  507  ANLD  518
            A+LD
Sbjct  121  ADLD  124



>ref|XP_010094254.1| Serine--glyoxylate aminotransferase [Morus notabilis]
 gb|EXB55505.1| Serine--glyoxylate aminotransferase [Morus notabilis]
Length=358

 Score =   240 bits (612),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYVN PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PA+TK LLEDVK IFKTTSG
Sbjct  1    MDYVNGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPAMTKVLLEDVKMIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESDWGQG  120

Query  507  ANLDV  521
            ANL+V
Sbjct  121  ANLEV  125



>ref|XP_008227244.1| PREDICTED: serine--glyoxylate aminotransferase [Prunus mume]
Length=401

 Score =   241 bits (616),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TK LLEDVKKIFKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPAMTKILLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDVVESEWGQG
Sbjct  61   TPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVVESEWGQG  120

Query  507  ANLDV  521
            ANLD+
Sbjct  121  ANLDI  125



>gb|ABQ81924.1| aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   241 bits (616),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF  PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDV+ESEWG+G
Sbjct  61   TPFSFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEG  120

Query  507  ANLDV  521
            A LDV
Sbjct  121  AKLDV  125



>gb|ABR26028.1| serine-glyoxylate aminotransferase [Oryza sativa Indica Group]
Length=198

 Score =   234 bits (598),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 111/122 (91%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = +3

Query  150  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  329
            DYV  PGRNHLFVPGPVNIPDQVIRAM+R NEDYRSPAVPALTKTLLEDVK+IFKTT+GT
Sbjct  3    DYVYGPGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAVPALTKTLLEDVKQIFKTTTGT  62

Query  330  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  509
            PFL PTTGTGAWESALTNTLSPGD+IVSFLIGQFSLLWIDQQQRLNFNVDVVES+WG GA
Sbjct  63   PFLFPTTGTGAWESALTNTLSPGDKIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGYGA  122

Query  510  NL  515
            +L
Sbjct  123  DL  124



>ref|XP_002885871.1| hypothetical protein ARALYDRAFT_480305 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62130.1| hypothetical protein ARALYDRAFT_480305 [Arabidopsis lyrata subsp. 
lyrata]
Length=401

 Score =   241 bits (615),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  507  ANLDV  521
            ANL V
Sbjct  121  ANLQV  125



>ref|XP_010488837.1| PREDICTED: serine--glyoxylate aminotransferase-like [Camelina 
sativa]
Length=401

 Score =   241 bits (615),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  507  ANLDV  521
            ANL V
Sbjct  121  ANLQV  125



>ref|XP_010518509.1| PREDICTED: serine--glyoxylate aminotransferase isoform X1 [Camelina 
sativa]
 ref|XP_010518516.1| PREDICTED: serine--glyoxylate aminotransferase isoform X1 [Camelina 
sativa]
 ref|XP_010518525.1| PREDICTED: serine--glyoxylate aminotransferase isoform X2 [Camelina 
sativa]
Length=401

 Score =   241 bits (615),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  507  ANLDV  521
            ANL V
Sbjct  121  ANLQV  125



>ref|XP_006369572.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66141.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=321

 Score =   238 bits (608),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY   PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPESVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+IPTTGTGAWESALTNTLSPGDR VSF+IGQFSLLWIDQQ+RL FNVDVVES+WGQG
Sbjct  61   TPFIIPTTGTGAWESALTNTLSPGDRTVSFMIGQFSLLWIDQQKRLGFNVDVVESDWGQG  120

Query  507  ANLDV  521
            ANLD+
Sbjct  121  ANLDI  125



>ref|NP_001284450.1| serine--glyoxylate aminotransferase [Cucumis melo]
 gb|AAQ56194.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   241 bits (614),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV APG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPAL KTLLEDVKKIFK+T+G
Sbjct  1    MDYVYAPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPALAKTLLEDVKKIFKSTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T FLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES+WGQG
Sbjct  61   TTFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGQG  120

Query  507  ANLDV  521
            ANLDV
Sbjct  121  ANLDV  125



>ref|XP_010467178.1| PREDICTED: serine--glyoxylate aminotransferase-like [Camelina 
sativa]
Length=454

 Score =   242 bits (617),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  507  ANLDV  521
            ANL V
Sbjct  121  ANLQV  125



>ref|XP_009338530.1| PREDICTED: serine--glyoxylate aminotransferase-like [Pyrus x 
bretschneideri]
Length=401

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+ V+R+M RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEAVLRSMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+IPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61   TPFMIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  507  ANLDV  521
            ANLD+
Sbjct  121  ANLDI  125



>ref|XP_010557501.1| PREDICTED: serine--glyoxylate aminotransferase [Tarenaya hassleriana]
 ref|XP_010557502.1| PREDICTED: serine--glyoxylate aminotransferase [Tarenaya hassleriana]
Length=401

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWG+G
Sbjct  61   TPFIIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGRG  120

Query  507  ANLDV  521
            A+L V
Sbjct  121  ADLQV  125



>gb|AGL09527.1| alanine-glyoxylate aminotransferase, partial [Piper nigrum]
Length=275

 Score =   236 bits (602),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/119 (94%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP
Sbjct  1    PGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  60

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            TTGTGAWESALTNTLSPGDRI+SFLIGQFSLLWIDQQQRL FNVDVVES+WGQGANLD+
Sbjct  61   TTGTGAWESALTNTLSPGDRIISFLIGQFSLLWIDQQQRLGFNVDVVESDWGQGANLDI  119



>ref|XP_010909203.1| PREDICTED: serine--glyoxylate aminotransferase [Elaeis guineensis]
 ref|XP_010909204.1| PREDICTED: serine--glyoxylate aminotransferase [Elaeis guineensis]
Length=402

 Score =   240 bits (612),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 120/126 (95%), Gaps = 1/126 (1%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES-EWGQ  503
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL F+VDV+ES EWGQ
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFDVDVIESGEWGQ  120

Query  504  GANLDV  521
            GANLD+
Sbjct  121  GANLDI  126



>ref|XP_009415566.1| PREDICTED: serine--glyoxylate aminotransferase [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   239 bits (611),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/124 (91%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MD+V  PG+NHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDFVYGPGKNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDVVESEWG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFRVDVVESEWGRG  120

Query  507  ANLD  518
            A+LD
Sbjct  121  ADLD  124



>gb|KJB54389.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54390.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54392.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54394.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=401

 Score =   239 bits (611),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPA+PA+TK LLEDVKKIFKT++G
Sbjct  1    MDYVYGPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAIPAMTKNLLEDVKKIFKTSTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  120

Query  507  ANLDV  521
            ANLD+
Sbjct  121  ANLDI  125



>ref|XP_006297832.1| hypothetical protein CARUB_v10013869mg [Capsella rubella]
 gb|EOA30730.1| hypothetical protein CARUB_v10013869mg [Capsella rubella]
Length=401

 Score =   239 bits (611),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVES+WGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQG  120

Query  507  ANLDV  521
            ANL V
Sbjct  121  ANLQV  125



>ref|NP_178969.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 ref|NP_849951.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 sp|Q56YA5.2|SGAT_ARATH RecName: Full=Serine--glyoxylate aminotransferase; AltName: Full=Alanine--glyoxylate 
aminotransferase; Short=AGT; AltName: 
Full=Asparagine aminotransferase; AltName: Full=Serine--pyruvate 
aminotransferase [Arabidopsis thaliana]
 gb|AAC26854.1| alanine:glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAD28669.1| alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 dbj|BAB20811.1| serine glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAM20136.1| putative alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAM45058.1| putative alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AEC06227.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AEC06228.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
Length=401

 Score =   239 bits (611),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVES+WGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQG  120

Query  507  ANLDV  521
            ANL V
Sbjct  121  ANLQV  125



>gb|KHG14448.1| Serine--glyoxylate aminotransferase -like protein [Gossypium 
arboreum]
Length=401

 Score =   239 bits (610),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MD   APG+NHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDNFYAPGKNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61   TPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  507  ANLDV  521
            ANLDV
Sbjct  121  ANLDV  125



>ref|XP_011032100.1| PREDICTED: serine--glyoxylate aminotransferase-like [Populus 
euphratica]
Length=401

 Score =   239 bits (610),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY   PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
             PFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61   IPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLGFNVDVVESDWGQG  120

Query  507  ANLDV  521
            ANLD+
Sbjct  121  ANLDI  125



>ref|XP_004291746.1| PREDICTED: serine--glyoxylate aminotransferase [Fragaria vesca 
subsp. vesca]
Length=401

 Score =   239 bits (610),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MD V APGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPA+PA+TK LLEDVKKIFKTT+G
Sbjct  1    MDNVYAPGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAIPAMTKILLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDVVESEWGQG
Sbjct  61   TPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVVESEWGQG  120

Query  507  ANLDV  521
            ANLD+
Sbjct  121  ANLDI  125



>ref|XP_002313371.1| aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEE87326.1| aminotransferase 2 family protein [Populus trichocarpa]
Length=401

 Score =   239 bits (610),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY   PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
             PFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61   IPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLGFNVDVVESDWGQG  120

Query  507  ANLDV  521
            ANLD+
Sbjct  121  ANLDI  125



>gb|AAQ56193.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   239 bits (609),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T FL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWID+QQRLNF VDV+ESEWG+G
Sbjct  61   TLFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDRQQRLNFKVDVIESEWGEG  120

Query  507  ANLDV  521
            A LDV
Sbjct  121  AKLDV  125



>ref|XP_007212264.1| hypothetical protein PRUPE_ppa006653mg [Prunus persica]
 gb|EMJ13463.1| hypothetical protein PRUPE_ppa006653mg [Prunus persica]
Length=401

 Score =   238 bits (608),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TK LLEDVKKIFKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPAMTKILLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T F+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDVVESEWGQG
Sbjct  61   TSFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVVESEWGQG  120

Query  507  ANLDV  521
            ANLD+
Sbjct  121  ANLDI  125



>ref|XP_011043786.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
 ref|XP_011043787.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
 ref|XP_011043788.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
Length=401

 Score =   238 bits (608),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY   PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPESVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+IPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQ+RL FNVDVVES+WGQG
Sbjct  61   TPFIIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLGFNVDVVESDWGQG  120

Query  507  ANLDV  521
            ANLD+
Sbjct  121  ANLDI  125



>gb|KDP35982.1| hypothetical protein JCGZ_08377 [Jatropha curcas]
Length=401

 Score =   238 bits (607),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYMYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVESDWGQG  120

Query  507  ANLDV  521
            ANLD+
Sbjct  121  ANLDI  125



>gb|AGL09526.1| alanine-glyoxylate aminotransferase, partial [Peperomia prostrata]
Length=289

 Score =   234 bits (598),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/119 (92%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSGTPF+IP
Sbjct  1    PGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSGTPFIIP  60

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            TTGTGAWESALTNTLSPGDRI+SFLIGQFSLLWIDQQQRL FNVDVVES+WGQGANLD+
Sbjct  61   TTGTGAWESALTNTLSPGDRIISFLIGQFSLLWIDQQQRLGFNVDVVESDWGQGANLDI  119



>ref|XP_002298306.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 ref|XP_006369570.1| aminotransferase 2 family protein [Populus trichocarpa]
 ref|XP_006369571.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|EEE83111.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66139.1| aminotransferase 2 family protein [Populus trichocarpa]
 gb|ERP66140.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=401

 Score =   238 bits (607),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY   PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPESVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+IPTTGTGAWESALTNTLSPGDR VSF+IGQFSLLWIDQQ+RL FNVDVVES+WGQG
Sbjct  61   TPFIIPTTGTGAWESALTNTLSPGDRTVSFMIGQFSLLWIDQQKRLGFNVDVVESDWGQG  120

Query  507  ANLDV  521
            ANLD+
Sbjct  121  ANLDI  125



>ref|XP_006369573.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66142.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=381

 Score =   237 bits (605),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY   PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPESVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+IPTTGTGAWESALTNTLSPGDR VSF+IGQFSLLWIDQQ+RL FNVDVVES+WGQG
Sbjct  61   TPFIIPTTGTGAWESALTNTLSPGDRTVSFMIGQFSLLWIDQQKRLGFNVDVVESDWGQG  120

Query  507  ANLDV  521
            ANLD+
Sbjct  121  ANLDI  125



>gb|ABK96624.1| unknown [Populus trichocarpa x Populus deltoides]
Length=401

 Score =   237 bits (604),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY   PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
             PFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61   IPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLGFNVDVVESDWGQG  120

Query  507  ANLDV  521
            AN D+
Sbjct  121  ANFDI  125



>ref|XP_002531124.1| serine-pyruvate aminotransferase, putative [Ricinus communis]
 gb|EEF31258.1| serine-pyruvate aminotransferase, putative [Ricinus communis]
Length=401

 Score =   237 bits (604),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL F+VDVV+S+WGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFDVDVVKSQWGQG  120

Query  507  ANLDV  521
            ANLD+
Sbjct  121  ANLDI  125



>gb|AGL09530.1| alanine-glyoxylate aminotransferase, partial [Xymalos monospora]
Length=289

 Score =   233 bits (595),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/119 (93%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTK LLEDVKKIFKT +GTPFLIP
Sbjct  1    PGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKILLEDVKKIFKTATGTPFLIP  60

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            TTGTGAWES LTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDV
Sbjct  61   TTGTGAWESTLTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDV  119



>gb|AAB95218.1| putative serine-glyoxylate aminotransferase [Fritillaria agrestis]
Length=401

 Score =   236 bits (603),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYR+PA+PALTKTLLEDVKK+FKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRAPAIPALTKTLLEDVKKLFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+IPTTGTGAWESALTNTLSPGD IVSFLIGQFSLLWIDQQQRL F VDV+ESEWGQG
Sbjct  61   TPFIIPTTGTGAWESALTNTLSPGDTIVSFLIGQFSLLWIDQQQRLKFKVDVIESEWGQG  120

Query  507  ANLD  518
            ANLD
Sbjct  121  ANLD  124



>gb|AGL09524.1| alanine-glyoxylate aminotransferase, partial [Calycanthus occidentalis]
Length=289

 Score =   232 bits (592),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/119 (92%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTK LLEDVKKIFKTT+ TPF+IP
Sbjct  1    PGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKILLEDVKKIFKTTTATPFVIP  60

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDV+ES+WGQGANLDV
Sbjct  61   TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVIESDWGQGANLDV  119



>dbj|BAJ90006.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90413.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95504.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95684.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+N PGRNHLFVPGPVNIPDQVIRAM+R NEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYMNGPGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSPGDRIVSF +GQFSLLWIDQQQRL F+VDVVES+WG G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLGFSVDVVESDWGYG  120

Query  507  ANLDV  521
            A+L V
Sbjct  121  ADLGV  125



>ref|NP_001062170.1| Os08g0502700 [Oryza sativa Japonica Group]
 dbj|BAD08917.1| putative aminotransferase [Oryza sativa Japonica Group]
 dbj|BAD09269.1| putative aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF24084.1| Os08g0502700 [Oryza sativa Japonica Group]
 gb|EAZ07527.1| hypothetical protein OsI_29783 [Oryza sativa Indica Group]
 gb|EAZ43252.1| hypothetical protein OsJ_27850 [Oryza sativa Japonica Group]
 dbj|BAG89198.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89373.1| unnamed protein product [Oryza sativa Japonica Group]
Length=402

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/122 (91%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = +3

Query  150  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  329
            DYV  PGRNHLFVPGPVNIPDQVIRAM+R NEDYRSPAVPALTKTLLEDVK+IFKTT+GT
Sbjct  3    DYVYGPGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAVPALTKTLLEDVKQIFKTTTGT  62

Query  330  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  509
            PFL PTTGTGAWESALTNTLSPGD+IVSFLIGQFSLLWIDQQQRLNFNVDVVES+WG GA
Sbjct  63   PFLFPTTGTGAWESALTNTLSPGDKIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGYGA  122

Query  510  NL  515
            +L
Sbjct  123  DL  124



>ref|XP_006659561.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X1 
[Oryza brachyantha]
 ref|XP_006659562.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X2 
[Oryza brachyantha]
 ref|XP_006659563.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X3 
[Oryza brachyantha]
Length=402

 Score =   235 bits (600),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/122 (91%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = +3

Query  150  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  329
            DY   PGRNHLFVPGPVNIPDQVIRAM R NEDYRSPAVPALTKTLLEDVK+IFKTT+GT
Sbjct  3    DYAYGPGRNHLFVPGPVNIPDQVIRAMNRQNEDYRSPAVPALTKTLLEDVKQIFKTTTGT  62

Query  330  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  509
            PFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDVVES+WGQGA
Sbjct  63   PFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVVESDWGQGA  122

Query  510  NL  515
            +L
Sbjct  123  DL  124



>ref|XP_003574732.2| PREDICTED: serine--glyoxylate aminotransferase [Brachypodium 
distachyon]
Length=461

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = +3

Query  135  EGEKMDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFK  314
            E  KMDYV  PGRNHLFVPGPVNIPD VIRAM+R NEDYRSPAVPALTKTLLEDVKKIFK
Sbjct  57   ENSKMDYVYGPGRNHLFVPGPVNIPDPVIRAMSRQNEDYRSPAVPALTKTLLEDVKKIFK  116

Query  315  TTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESE  494
            TT+GTPFL PTTGTGAWESALTNTLSPGDRIVSF +GQFSLLWIDQQQRLNF VDVVES+
Sbjct  117  TTTGTPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLNFQVDVVESD  176

Query  495  WGQGANL  515
            WG GA+L
Sbjct  177  WGHGADL  183



>gb|EMS66805.1| Serine--glyoxylate aminotransferase [Triticum urartu]
Length=401

 Score =   234 bits (598),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+N PGRNHLFVPGPVNIPDQVIRAM+R NEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYMNGPGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSPGDRIVSF +GQFSLLWIDQQQRL F+VDVVES+WG G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLGFSVDVVESDWGYG  120

Query  507  ANL  515
            A+L
Sbjct  121  ADL  123



>gb|AGL09523.1| alanine-glyoxylate aminotransferase, partial [Asarum caudatum]
Length=289

 Score =   230 bits (587),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 108/119 (91%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSGTPFLIP
Sbjct  1    PGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSGTPFLIP  60

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            TTGTGAWESALTNTLSPGD+ VSFLIGQFSLLWIDQQQRL FNV+V+ESEWGQGANLD+
Sbjct  61   TTGTGAWESALTNTLSPGDQTVSFLIGQFSLLWIDQQQRLKFNVNVIESEWGQGANLDI  119



>ref|XP_002444789.1| hypothetical protein SORBIDRAFT_07g028080 [Sorghum bicolor]
 gb|EES14284.1| hypothetical protein SORBIDRAFT_07g028080 [Sorghum bicolor]
Length=402

 Score =   233 bits (593),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +3

Query  150  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  329
            DYV  PGRNHLFVPGPVNIPD VIRAM R NEDYRSPA+PALTK LLEDVK+IFKTT+GT
Sbjct  3    DYVYGPGRNHLFVPGPVNIPDPVIRAMNRQNEDYRSPAIPALTKVLLEDVKRIFKTTTGT  62

Query  330  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  509
            PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL F+VDVVES+WG GA
Sbjct  63   PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLGFDVDVVESDWGHGA  122

Query  510  NLD  518
            +LD
Sbjct  123  DLD  125



>ref|XP_010673724.1| PREDICTED: serine--glyoxylate aminotransferase [Beta vulgaris 
subsp. vulgaris]
Length=401

 Score =   231 bits (590),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQ+RL FNVDV+ESEWG+G
Sbjct  61   TPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQKRLGFNVDVIESEWGRG  120

Query  507  ANLD  518
            A+L+
Sbjct  121  ADLE  124



>ref|XP_004973838.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X2 
[Setaria italica]
 ref|XP_004973839.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X3 
[Setaria italica]
Length=402

 Score =   231 bits (590),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +3

Query  150  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  329
            DYV  PGR HLFVPGPVNIPD VIRAM R NEDYRSPAVP LTK LLEDVKKIFKTT+GT
Sbjct  3    DYVYGPGRTHLFVPGPVNIPDPVIRAMNRQNEDYRSPAVPVLTKILLEDVKKIFKTTTGT  62

Query  330  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  509
            PF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVES+WG+GA
Sbjct  63   PFIIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLGFNVDVVESDWGRGA  122

Query  510  NLDV  521
            +LDV
Sbjct  123  DLDV  126



>ref|XP_004973837.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X1 
[Setaria italica]
Length=437

 Score =   231 bits (590),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +3

Query  150  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  329
            DYV  PGR HLFVPGPVNIPD VIRAM R NEDYRSPAVP LTK LLEDVKKIFKTT+GT
Sbjct  38   DYVYGPGRTHLFVPGPVNIPDPVIRAMNRQNEDYRSPAVPVLTKILLEDVKKIFKTTTGT  97

Query  330  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  509
            PF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVES+WG+GA
Sbjct  98   PFIIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLGFNVDVVESDWGRGA  157

Query  510  NLDV  521
            +LDV
Sbjct  158  DLDV  161



>ref|XP_002279236.1| PREDICTED: serine--glyoxylate aminotransferase [Vitis vinifera]
 ref|XP_010651495.1| PREDICTED: serine--glyoxylate aminotransferase [Vitis vinifera]
Length=401

 Score =   229 bits (585),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MD   APG NHLFVPGPVNIPD VIRAM RNNEDYR+P +PALTK LLEDVKKIFKTT+G
Sbjct  1    MDRYFAPGTNHLFVPGPVNIPDHVIRAMNRNNEDYRAPPIPALTKDLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQ+RL FNVDV+ESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLRFNVDVIESEWGQG  120

Query  507  ANLDV  521
            ANL++
Sbjct  121  ANLEI  125



>emb|CAN84001.1| hypothetical protein VITISV_007680 [Vitis vinifera]
Length=401

 Score =   229 bits (584),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MD   APG NHLFVPGPVNIPD VIRAM RNNEDYR+P +PALTK LLEDVKKIFKTT+G
Sbjct  1    MDRYFAPGTNHLFVPGPVNIPDHVIRAMNRNNEDYRAPPIPALTKDLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQ+RL FNVDV+ESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLRFNVDVIESEWGQG  120

Query  507  ANLDV  521
            ANL++
Sbjct  121  ANLEI  125



>tpg|DAA47863.1| TPA: hypothetical protein ZEAMMB73_595389 [Zea mays]
Length=368

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +3

Query  150  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  329
            DYV  PGR HLFVPGPVNIPD VIRAM R NEDYRSPAVPALTK LLEDVKKIFKTT+GT
Sbjct  3    DYVYGPGRTHLFVPGPVNIPDPVIRAMNRQNEDYRSPAVPALTKVLLEDVKKIFKTTTGT  62

Query  330  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  509
            PF+IPTTGTGAWESALTNTLSPGDR+VSFLIGQFSLLWIDQQ+RL F+VD VESEWGQGA
Sbjct  63   PFMIPTTGTGAWESALTNTLSPGDRVVSFLIGQFSLLWIDQQRRLGFDVDAVESEWGQGA  122

Query  510  NL  515
            +L
Sbjct  123  DL  124



>ref|NP_001148339.1| LOC100281949 [Zea mays]
 ref|XP_008675752.1| PREDICTED: LOC100281949 isoform X1 [Zea mays]
 ref|XP_008675758.1| PREDICTED: LOC100281949 isoform X1 [Zea mays]
 gb|ACG30854.1| serine--glyoxylate aminotransferase [Zea mays]
 gb|ACN28633.1| unknown [Zea mays]
 tpg|DAA47859.1| TPA: Serine--glyoxylate aminotransferase isoform 1 [Zea mays]
 tpg|DAA47860.1| TPA: Serine--glyoxylate aminotransferase isoform 2 [Zea mays]
 tpg|DAA47861.1| TPA: Serine--glyoxylate aminotransferase isoform 3 [Zea mays]
 tpg|DAA47862.1| TPA: Serine--glyoxylate aminotransferase isoform 4 [Zea mays]
Length=403

 Score =   228 bits (580),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +3

Query  150  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  329
            DYV  PGR HLFVPGPVNIPD VIRAM R NEDYRSPAVPALTK LLEDVKKIFKTT+GT
Sbjct  3    DYVYGPGRTHLFVPGPVNIPDPVIRAMNRQNEDYRSPAVPALTKVLLEDVKKIFKTTTGT  62

Query  330  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  509
            PF+IPTTGTGAWESALTNTLSPGDR+VSFLIGQFSLLWIDQQ+RL F+VD VESEWGQGA
Sbjct  63   PFMIPTTGTGAWESALTNTLSPGDRVVSFLIGQFSLLWIDQQRRLGFDVDAVESEWGQGA  122

Query  510  NL  515
            +L
Sbjct  123  DL  124



>ref|XP_003617296.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AET00255.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=401

 Score =   223 bits (567),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MD+   PGRNHLFVPGP NIP+ VIRAM RNNE++R+PA+  LTKTLL+DVKKIFKTTSG
Sbjct  1    MDFAYGPGRNHLFVPGPTNIPEHVIRAMNRNNENHRTPAITTLTKTLLDDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
             PFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWI+QQ+RLNF VDVVESEWGQG
Sbjct  61   IPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIEQQKRLNFKVDVVESEWGQG  120

Query  507  ANLD  518
            A+LD
Sbjct  121  ADLD  124



>ref|XP_004491262.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cicer arietinum]
Length=401

 Score =   223 bits (567),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGR+HLFVPGP NIP+QVIRAM RNNE++R+PA+PALTK LL+DVKKIFKTTSG
Sbjct  1    MDYVYGPGRSHLFVPGPSNIPEQVIRAMNRNNENHRTPAIPALTKALLDDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
             PFLIP+TGTGAWESALTNTLSPGD+IVSFL+GQFSLLWI+QQ++LNF VDVVESEWGQ 
Sbjct  61   IPFLIPSTGTGAWESALTNTLSPGDQIVSFLMGQFSLLWIEQQKKLNFKVDVVESEWGQD  120

Query  507  ANLD  518
            A+LD
Sbjct  121  ADLD  124



>gb|ADO24297.1| aminotransferase [Valeriana jatamansi]
Length=116

 Score =   212 bits (540),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/116 (88%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MD   A GRNHLFVPGPVNIP+ V+RAM RNNEDYRSPA+PA+TKTLLEDVK+IFKTTSG
Sbjct  1    MDNFYAAGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAIPAMTKTLLEDVKQIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESE  494
            TPFL PTTGTGAWESALTNTLSPGDR+VSFLIGQFSLLWIDQQQRL FNVDVVESE
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRVVSFLIGQFSLLWIDQQQRLGFNVDVVESE  116



>gb|ABF70331.1| aminotransferase 1 [Cucumis sativus]
Length=386

 Score =   221 bits (562),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            GR +  VPGPVNIP+ V+RAM RNNEDYRSPAVPALTKTLLEDVKKIFK+T+GT FLIPT
Sbjct  1    GRGNSIVPGPVNIPEPVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKSTAGTTFLIPT  60

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES+WGQGANLDV
Sbjct  61   TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGQGANLDV  118



>gb|ADG26437.1| putative aminotransferase [Valeriana jatamansi]
Length=116

 Score =   206 bits (525),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MD   A GRNH+FVPG VNIP+ V+RAM RNNEDYRSPA+PA+TKTLLEDVK+IFKTTSG
Sbjct  1    MDNFYAAGRNHMFVPGLVNIPEPVLRAMNRNNEDYRSPAIPAMTKTLLEDVKQIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESE  494
            TPFL PTTGTGAWESALTNTLSPGDR+VSFLIGQFSLLWIDQQQRL FNVDVVES+
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRVVSFLIGQFSLLWIDQQQRLGFNVDVVESK  116



>gb|AGL09528.1| alanine-glyoxylate aminotransferase, partial [Saururus cernuus]
Length=279

 Score =   211 bits (538),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/108 (94%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +3

Query  198  VNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESAL  377
            VNIP+ VIRAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESAL
Sbjct  1    VNIPEPVIRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSGTPFMIPTTGTGAWESAL  60

Query  378  TNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            TNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQGANLD+
Sbjct  61   TNTLSPGDRIVSFLIGQFSLLWIDQQQRLGFNVDVVESEWGQGANLDI  108



>gb|EMT09291.1| Serine--glyoxylate aminotransferase [Aegilops tauschii]
Length=290

 Score =   210 bits (535),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+N PGRNHLFVPGPVNIPDQVIRAM+R NEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYMNGPGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNV  476
            TPFL PTTGTGAWESALTNTLSPGDRIVSF +GQFSLLWIDQQQRL F+ 
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLGFSA  110



>ref|XP_008666464.1| PREDICTED: serine--glyoxylate aminotransferase-like [Zea mays]
Length=229

 Score =   202 bits (515),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +3

Query  180  LFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTG  359
            +FVPGPVNIP  V RAM R NEDYRSPAVPALTK LLEDVKKIFKTT+GTPF+IPTTGTG
Sbjct  1    MFVPGPVNIPGPVNRAMNRQNEDYRSPAVPALTKVLLEDVKKIFKTTTGTPFMIPTTGTG  60

Query  360  AWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANL  515
             WESALTNTLSPGDR+VSFLIGQFSLLWIDQQ+RL F+VD VESEWGQGA+L
Sbjct  61   VWESALTNTLSPGDRVVSFLIGQFSLLWIDQQRRLGFDVDAVESEWGQGADL  112



>tpg|DAA47874.1| TPA: hypothetical protein ZEAMMB73_131074 [Zea mays]
Length=290

 Score =   202 bits (515),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +3

Query  180  LFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTG  359
            +FVPGPVNIP  V RAM R NEDYRSPAVPALTK LLEDVKKIFKTT+GTPF+IPTTGTG
Sbjct  1    MFVPGPVNIPGPVNRAMNRQNEDYRSPAVPALTKVLLEDVKKIFKTTTGTPFMIPTTGTG  60

Query  360  AWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANL  515
             WESALTNTLSPGDR+VSFLIGQFSLLWIDQQ+RL F+VD VESEWGQGA+L
Sbjct  61   VWESALTNTLSPGDRVVSFLIGQFSLLWIDQQRRLGFDVDAVESEWGQGADL  112



>gb|ABR16109.1| unknown [Picea sitchensis]
Length=359

 Score =   198 bits (504),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MD    PGRN LFVPGPVNIP+ V++AM RNNEDYR+P VPALTK LL DV KIFK+T+G
Sbjct  1    MDPFYGPGRNQLFVPGPVNIPEPVLQAMNRNNEDYRAPPVPALTKKLLADVPKIFKSTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSP DRI+SF +GQFSLLWIDQ +RLNF+VDVV  EWG G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPRDRIISFEMGQFSLLWIDQMKRLNFDVDVVHCEWGTG  120

Query  507  ANLDV  521
             +L++
Sbjct  121  VDLEI  125



>gb|ACN39798.1| unknown [Picea sitchensis]
Length=401

 Score =   199 bits (506),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MD    PGRN LFVPGPVNIP+ V++AM RNNEDYR+P VPALTK LL DV KIFK+T+G
Sbjct  1    MDPFYGPGRNQLFVPGPVNIPEPVLQAMNRNNEDYRAPPVPALTKKLLADVPKIFKSTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSP DRI+SF +GQFSLLWIDQ +RLNF+VDVV  EWG G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPRDRIISFEMGQFSLLWIDQMKRLNFDVDVVHCEWGTG  120

Query  507  ANLDV  521
             +L++
Sbjct  121  VDLEI  125



>gb|ABK24112.1| unknown [Picea sitchensis]
Length=401

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MD    PGRN LFVPGPVNIP+ V+ AM RNNEDYR+P VPALTK LL DV KIFK+T+G
Sbjct  1    MDPFYGPGRNQLFVPGPVNIPEPVLHAMNRNNEDYRAPPVPALTKKLLADVPKIFKSTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSP DRI+SF +GQFSLLWIDQ +RLNF+VDVV  EWG G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPRDRIISFEMGQFSLLWIDQMKRLNFDVDVVHCEWGTG  120

Query  507  ANLDV  521
             +L++
Sbjct  121  VDLEI  125



>ref|XP_001755667.1| predicted protein [Physcomitrella patens]
 gb|EDQ79340.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   198 bits (503),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            M+Y  APGRNHLFVPGP N+P+ ++RAM R+NED+RSPA P L+K++++DVK+IF+TT+ 
Sbjct  1    MEYYPAPGRNHLFVPGPTNVPEPILRAMNRSNEDHRSPAFPKLSKSVIDDVKQIFRTTTA  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T F+ PTTGTGAWESALTNTLSPGD+I+SF +GQFSLLWIDQ QR NF+VDVV+ EWG G
Sbjct  61   TSFIFPTTGTGAWESALTNTLSPGDKIISFRLGQFSLLWIDQMQRYNFDVDVVDCEWGTG  120

Query  507  ANLD  518
             +LD
Sbjct  121  VDLD  124



>ref|XP_001783551.1| predicted protein [Physcomitrella patens]
 gb|EDQ51640.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            M+Y  APGRNHLFVPGP N+P+ ++RAM R+NED+RSPA P L+K++++DVK+IF+T + 
Sbjct  1    MEYYPAPGRNHLFVPGPTNVPEPILRAMNRSNEDHRSPAFPKLSKSVIDDVKEIFRTKTA  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T F+ PTTGTGAWESALTNTLSPGD+I+SF +GQFSLLWIDQ QR NF+VDVV+ EWG G
Sbjct  61   TSFIFPTTGTGAWESALTNTLSPGDKIISFRLGQFSLLWIDQMQRYNFDVDVVDCEWGAG  120

Query  507  ANLDV  521
             +LDV
Sbjct  121  IDLDV  125



>gb|AGL09525.1| alanine-glyoxylate aminotransferase, partial [Manekia incurva]
Length=267

 Score =   191 bits (486),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/96 (96%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +3

Query  234  RNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVS  413
            RNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSP DRIVS
Sbjct  2    RNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPCDRIVS  61

Query  414  FLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            FLIGQFSLLWIDQQQRL FNVDVVES+WGQGANLD+
Sbjct  62   FLIGQFSLLWIDQQQRLGFNVDVVESDWGQGANLDI  97



>gb|AGL09529.1| alanine-glyoxylate aminotransferase, partial [Thottea sp. JN-2013]
Length=252

 Score =   189 bits (479),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/96 (94%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +3

Query  234  RNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVS  413
            RNNEDYRSPAVP LTKTLLEDVKKIFKTT+GTPFLIPTTGTGAWESALTNTLSPGDRIVS
Sbjct  1    RNNEDYRSPAVPLLTKTLLEDVKKIFKTTAGTPFLIPTTGTGAWESALTNTLSPGDRIVS  60

Query  414  FLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            FLIGQFSLLWIDQQQRLNFNVDVVES+WG+GA+L+V
Sbjct  61   FLIGQFSLLWIDQQQRLNFNVDVVESDWGRGADLEV  96



>ref|XP_002983655.1| hypothetical protein SELMODRAFT_228964 [Selaginella moellendorffii]
 gb|EFJ15151.1| hypothetical protein SELMODRAFT_228964 [Selaginella moellendorffii]
Length=401

 Score =   193 bits (490),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            M+Y  APGRNHLFVPGP N+P++VI+A +R NED+RSPA   L+K++L+ VK +FKT + 
Sbjct  1    MEYFPAPGRNHLFVPGPTNVPEKVIQAFSRGNEDHRSPAFATLSKSVLDGVKDLFKTKTA  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T F+ PTTGTGAWESALTNTLSPGD+IVSF +GQFSLLWIDQ QRL FNVDVV+ EWG G
Sbjct  61   TSFIFPTTGTGAWESALTNTLSPGDKIVSFRLGQFSLLWIDQMQRLKFNVDVVDCEWGAG  120

Query  507  ANLDV  521
            A+L++
Sbjct  121  ADLNI  125



>ref|XP_002990557.1| hypothetical protein SELMODRAFT_448066 [Selaginella moellendorffii]
 gb|EFJ08434.1| hypothetical protein SELMODRAFT_448066 [Selaginella moellendorffii]
Length=401

 Score =   193 bits (490),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            M+Y  APGRNHLFVPGP N+P++VI+A +R NED+RSPA   L+K++L+ VK +FKT + 
Sbjct  1    MEYFPAPGRNHLFVPGPTNVPEKVIQAFSRGNEDHRSPAFATLSKSVLDGVKDLFKTKTA  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T F+ PTTGTGAWESALTNTLSPGD+IVSF +GQFSLLWIDQ QRL FNVDVV+ EWG G
Sbjct  61   TSFIFPTTGTGAWESALTNTLSPGDKIVSFRLGQFSLLWIDQMQRLKFNVDVVDCEWGAG  120

Query  507  ANLDV  521
            A+L++
Sbjct  121  ADLNI  125



>gb|AGL09531.1| alanine-glyoxylate aminotransferase, partial [Zippelia begoniifolia]
Length=259

 Score =   186 bits (473),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/93 (96%), Positives = 92/93 (99%), Gaps = 0/93 (0%)
 Frame = +3

Query  243  EDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLI  422
            EDYRSPAVPALTKTLL+DVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLI
Sbjct  1    EDYRSPAVPALTKTLLQDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLI  60

Query  423  GQFSLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            GQFSLLWIDQQQRL FNVDVVES+WGQGANLD+
Sbjct  61   GQFSLLWIDQQQRLGFNVDVVESDWGQGANLDI  93



>gb|ACN36238.1| unknown [Zea mays]
Length=328

 Score =   188 bits (477),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 100/120 (83%), Gaps = 7/120 (6%)
 Frame = +3

Query  150  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  329
            DYV  PGR HLFVPGPVNIPD VIRAM R NEDYRSPAVPALTK LLEDVKKIFKTT+GT
Sbjct  3    DYVYGPGRTHLFVPGPVNIPDPVIRAMNRQNEDYRSPAVPALTKVLLEDVKKIFKTTTGT  62

Query  330  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQR---LNFNVDVVESEWG  500
            PF+IPTTGTGAWESALTNTLSPGDR+VSFLIGQFSLL +D       L+F +D    EWG
Sbjct  63   PFMIPTTGTGAWESALTNTLSPGDRVVSFLIGQFSLLLVDGVSSICALDFRMD----EWG  118



>ref|XP_001763095.1| predicted protein [Physcomitrella patens]
 gb|EDQ71972.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            M+   APGRNHLFVPGP NIPD+V++AM RNNED+RSP  PAL K++LEDVK +F+T +G
Sbjct  1    MELFPAPGRNHLFVPGPTNIPDRVLQAMNRNNEDHRSPTFPALAKSVLEDVKLLFRTQTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+ P++GTGAWESALTNT+SPGDRI+   +GQF +LWI+   RL+FNVDV+E EWG+G
Sbjct  61   TPFIFPSSGTGAWESALTNTMSPGDRIIVPRMGQFCVLWINLMTRLHFNVDVIECEWGEG  120

Query  507  ANLDV  521
             +L++
Sbjct  121  IDLEI  125



>emb|CBI24214.3| unnamed protein product [Vitis vinifera]
Length=374

 Score =   184 bits (468),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +3

Query  228  MTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRI  407
            M RNNEDYR+P +PALTK LLEDVKKIFKTT+GTPFLIPTTGTGAWESALTNTLSPGDR 
Sbjct  1    MNRNNEDYRAPPIPALTKDLLEDVKKIFKTTTGTPFLIPTTGTGAWESALTNTLSPGDRT  60

Query  408  VSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            VSFLIGQFSLLWIDQQ+RL FNVDV+ESEWGQGANL++
Sbjct  61   VSFLIGQFSLLWIDQQKRLRFNVDVIESEWGQGANLEI  98



>gb|AEX09293.1| alanine glyoxylate aminotransferase [Peperomia rupiseda]
Length=358

 Score =   177 bits (449),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDRI+SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRIISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WGQGANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEI  90



>gb|AEX09308.1| alanine glyoxylate aminotransferase [Peperomia polycephala]
Length=356

 Score =   176 bits (447),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WGQGANLD+
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLDI  90



>gb|AEX09252.1| alanine glyoxylate aminotransferase [Peperomia exclamationis]
Length=342

 Score =   176 bits (445),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPAVPALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAVPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WGQGANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEI  90



>gb|AEX09255.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   176 bits (445),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPAVPALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAVPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WGQGANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEI  90



>gb|AEX09262.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=342

 Score =   175 bits (444),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WGQGANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEI  90



>gb|AEX09251.1| alanine glyoxylate aminotransferase [Peperomia schizandra]
Length=331

 Score =   175 bits (443),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WGQGANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEI  90



>gb|AEX09248.1| alanine glyoxylate aminotransferase [Peperomia questionis]
Length=360

 Score =   175 bits (444),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WGQGANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEI  90



>gb|AEX09268.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=359

 Score =   175 bits (444),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WGQGANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEI  90



>gb|AEX09305.1| alanine glyoxylate aminotransferase [Peperomia pseudoverruculosa]
Length=362

 Score =   175 bits (444),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WGQGANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEI  90



>gb|AEX09266.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=350

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WGQGANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEI  90



>gb|AEX09274.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=358

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WGQGANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEI  90



>gb|AEX09301.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=358

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WGQGANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEI  90



>gb|AEX09306.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=362

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WGQGANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEI  90



>gb|AEX09250.1| alanine glyoxylate aminotransferase [Peperomia schizandra]
Length=362

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WGQGANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEI  90



>gb|AEX09283.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=349

 Score =   174 bits (442),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WGQGANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEI  90



>gb|AEX09302.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=343

 Score =   174 bits (442),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WGQGANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEI  90



>gb|AEX09246.1| alanine glyoxylate aminotransferase [Peperomia elatior]
Length=335

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WG GANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEI  90



>gb|AEX09310.1| alanine glyoxylate aminotransferase [Peperomia wernerrauhii]
Length=331

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WG GANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEI  90



>gb|AEX09309.1| alanine glyoxylate aminotransferase [Peperomia wernerrauhii]
Length=335

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WG GANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEI  90



>gb|AEX09288.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=335

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WG GANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEI  90



>gb|AEX09263.1| alanine glyoxylate aminotransferase [Peperomia putlaensis]
Length=358

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPAVPALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAVPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WG GANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEI  90



>gb|AEX09256.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPAVPALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAVPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WG GANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEI  90



>gb|AEX09282.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=332

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WG GANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEI  90



>gb|AEX09287.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=331

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WG GANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEI  90



>gb|AEX09244.1| alanine glyoxylate aminotransferase [Peperomia basiradicans]
Length=332

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WG GANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEI  90



>gb|AEX09300.1| alanine glyoxylate aminotransferase [Peperomia parvifolia]
Length=362

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPAVPALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAVPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WG GANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEI  90



>gb|AEX09286.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=358

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WG GANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEI  90



>gb|AEX09249.1| alanine glyoxylate aminotransferase [Peperomia aff. gracillima 
JN-2011]
Length=358

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WG GANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEI  90



>ref|XP_002970880.1| hypothetical protein SELMODRAFT_147375 [Selaginella moellendorffii]
 gb|EFJ28206.1| hypothetical protein SELMODRAFT_147375 [Selaginella moellendorffii]
Length=401

 Score =   175 bits (443),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY  APGRNHLFVPGP NIP +V++A+ R NED+RSPA P  ++ LL DV +IF T SG
Sbjct  1    MDYFMAPGRNHLFVPGPSNIPQKVMQALNRGNEDHRSPAFPVFSRQLLADVTRIFSTQSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+IPTTGTG WE A  NTLS GDR+++F+ GQFS LW  Q Q+L+F+VD V+ +WG G
Sbjct  61   TPFIIPTTGTGGWECAAVNTLSTGDRVLTFVFGQFSHLWSQQLQKLHFDVDAVQCQWGGG  120

Query  507  ANLDV  521
             +L V
Sbjct  121  VDLGV  125



>gb|AEX09277.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=351

 Score =   174 bits (440),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WG GANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEI  90



>gb|AEX09295.1| alanine glyoxylate aminotransferase [Peperomia pugnicaudex]
Length=356

 Score =   174 bits (440),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WG GANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEI  90



>gb|AEX09245.1| alanine glyoxylate aminotransferase [Peperomia putlaensis]
Length=349

 Score =   174 bits (440),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WG GANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEI  90



>ref|XP_002969615.1| hypothetical protein SELMODRAFT_267279 [Selaginella moellendorffii]
 gb|EFJ29703.1| hypothetical protein SELMODRAFT_267279 [Selaginella moellendorffii]
Length=401

 Score =   175 bits (443),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY  APGRNHLFVPGP NIP +V++A+ R NED+RSPA P  ++ LL DV +IF T SG
Sbjct  1    MDYFMAPGRNHLFVPGPSNIPQKVMQALNRGNEDHRSPAFPVFSRQLLADVTRIFSTQSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+IPTTGTG WE A  NTLS GDR+++F+ GQFS LW  Q Q+L+F+VD V+ +WG G
Sbjct  61   TPFIIPTTGTGGWECAAVNTLSTGDRVLTFVFGQFSHLWSQQLQKLHFDVDAVQCQWGGG  120

Query  507  ANLDV  521
             +L V
Sbjct  121  VDLGV  125



>gb|AEX09260.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=326

 Score =   173 bits (438),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WG GANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEI  90



>gb|AEX09311.1| alanine glyoxylate aminotransferase [Peperomia andina]
Length=362

 Score =   174 bits (440),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WG GANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEI  90



>gb|AEX09275.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=362

 Score =   174 bits (440),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WG GANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEI  90



>gb|AEX09257.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
 gb|AEX09278.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
 gb|AEX09279.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=362

 Score =   174 bits (440),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WG GANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEI  90



>gb|AEX09298.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   174 bits (440),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WG GANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEI  90



>gb|AEX09270.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
 gb|AEX09296.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
 gb|AEX09297.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
Length=362

 Score =   174 bits (440),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WG GANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEI  90



>gb|AEX09253.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   174 bits (440),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WG GANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEI  90



>gb|AEX09294.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=345

 Score =   173 bits (439),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WG GANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEI  90



>gb|AEX09273.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   174 bits (440),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WG GANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEI  90



>gb|AEX09254.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   173 bits (439),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPAVPALTKTLLEDVKKIFKTTSGT F+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAVPALTKTLLEDVKKIFKTTSGTSFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WGQGANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEI  90



>gb|AEX09304.1| alanine glyoxylate aminotransferase [Peperomia chutanka]
Length=358

 Score =   172 bits (437),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQ+RL FNVDVVES+WG GANL++
Sbjct  61   SLLWIDQQERLGFNVDVVESDWGHGANLEI  90



>gb|AEX09258.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   172 bits (437),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPAVPAL KTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAVPALAKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WG GANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEI  90



>gb|AEX09299.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSG PF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGAPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WG GANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEI  90



>gb|AEX09292.1| alanine glyoxylate aminotransferase [Peperomia klopfensteinii]
Length=330

 Score =   171 bits (434),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTT GTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTXGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WG GANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEI  90



>gb|ADO24296.1| aminotransferase [Valeriana jatamansi]
Length=91

 Score =   164 bits (414),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/91 (86%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MD   A GRNHLFVPGPVNIP+ V+RAM RNNEDYRSPA+PA+TKTLLEDVK+IFKTTSG
Sbjct  1    MDNFYAAGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAIPAMTKTLLEDVKQIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFL  419
            TPFL PTTGTGAWESALTNTLSPGDR+VSFL
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRVVSFL  91



>gb|AEX09242.1| alanine glyoxylate aminotransferase [Peperomia aff. pinoi JN-2011]
Length=335

 Score =   171 bits (434),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQ RL FNVDVVES+WG GANL++
Sbjct  61   SLLWIDQQTRLGFNVDVVESDWGLGANLEI  90



>gb|AEX09267.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=362

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL  +VDVVES+WG GANL++
Sbjct  61   SLLWIDQQQRLGLDVDVVESDWGHGANLEI  90



>gb|AEX09276.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=362

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTT G PF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTPGIPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            SLLWIDQQQRL FNVDVVES+WG GANL++
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEI  90



>gb|ACJ84853.1| unknown [Medicago truncatula]
Length=91

 Score =   158 bits (399),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/91 (86%), Positives = 83/91 (91%), Gaps = 1/91 (1%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYVN PGRNHLFVPGPVNIPDQVIRAM+RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPDQVIRAMSRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFL  419
            TPFLIPTTGTGAWESALT  +    RIV +L
Sbjct  61   TPFLIPTTGTGAWESALTKHIVTW-RIVLYL  90



>ref|XP_005648727.1| serine glyoxylate aminotransferase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24183.1| serine glyoxylate aminotransferase [Coccomyxa subellipsoidea 
C-169]
Length=434

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGRNHL VPGPVNI +QV+RAM R ++++R P  P   + +LED K IFKTT GTPF+ P
Sbjct  41   PGRNHLAVPGPVNIHEQVMRAMDRPSQNHRDPWFPPFFQQILEDTKYIFKTTEGTPFIFP  100

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGAN  512
             TGTG WE ALTNTLSPGD++V+F  GQFS LWID  QRL  +V VVE EWG GA+
Sbjct  101  GTGTGGWEVALTNTLSPGDKVVTFRYGQFSHLWIDMMQRLGLDVQVVEVEWGGGAD  156



>gb|EYU35937.1| hypothetical protein MIMGU_mgv1a026291mg, partial [Erythranthe 
guttata]
Length=359

 Score =   157 bits (398),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/82 (93%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  273  LTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQ  452
            LTK LLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQ
Sbjct  1    LTKNLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQ  60

Query  453  QQRLNFNVDVVESEWGQGANLD  518
            QQRL FNVDVVES+WG GA+LD
Sbjct  61   QQRLKFNVDVVESDWGAGADLD  82



>ref|XP_003617694.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AET00653.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=350

 Score =   157 bits (397),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 90/124 (73%), Gaps = 16/124 (13%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MD+   P RNHLFVPG  NIP+ VI   T             LTKTLL+DVKKIFKT  G
Sbjct  1    MDFAYGPERNHLFVPGSTNIPEHVIPITT-------------LTKTLLDDVKKIFKTVYG  47

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
              FLIPTTG    ESALTNT+SPG R +SFLIGQFSLLWI+QQ+RLNF VDVVESEWGQG
Sbjct  48   ISFLIPTTGI---ESALTNTMSPGYRTISFLIGQFSLLWIEQQKRLNFKVDVVESEWGQG  104

Query  507  ANLD  518
            ANL+
Sbjct  105  ANLE  108



>ref|WP_017485211.1| serine--glyoxylate aminotransferase [Methylobacterium sp. MB200]
Length=402

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            M     PGRNHLFVPGP NIPD+V+RAM   +ED+RS   P+LTK L ED KK+F +T G
Sbjct  1    MAATRRPGRNHLFVPGPTNIPDRVMRAMMVQSEDHRSVDFPSLTKPLFEDTKKVFGSTEG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T FL P +GTG WESALTNTL+ GD++++   GQFS LWID  QRL  +V V E EWG G
Sbjct  61   TIFLFPASGTGIWESALTNTLARGDKVLTARYGQFSHLWIDMAQRLGLDVIVQEEEWGTG  120

Query  507  ANLD  518
            A  D
Sbjct  121  AKAD  124



>ref|WP_018410273.1| serine--glyoxylate aminotransferase [Methyloversatilis sp. NVD]
Length=396

 Score =   156 bits (394),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            GRNHLFVPGP N+PD+V+RAM    ED+RSP  P LTK++L D+KK+FKTT GT    P 
Sbjct  6    GRNHLFVPGPTNVPDRVLRAMVVAQEDHRSPKFPELTKSVLADLKKVFKTTEGTILTFPA  65

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLD  518
            +GTG WE+ALTNTLSPGD+++    GQFS LW D  QRL F V +++ EWG G   D
Sbjct  66   SGTGMWEAALTNTLSPGDKVLCSRFGQFSHLWADMAQRLGFEVQILDVEWGTGVPYD  122



>gb|AEX09303.1| alanine glyoxylate aminotransferase [Peperomia ayacuchoana]
Length=351

 Score =   155 bits (391),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/79 (91%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +3

Query  285  LLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL  464
            LLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL
Sbjct  1    LLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRL  60

Query  465  NFNVDVVESEWGQGANLDV  521
             FNVDVVES+WGQGANL++
Sbjct  61   GFNVDVVESDWGQGANLEI  79



>ref|WP_015950680.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 gb|ACK82978.1| aminotransferase class V [Methylobacterium extorquens CM4]
Length=402

 Score =   156 bits (394),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 87/122 (71%), Gaps = 0/122 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            M     PGRNHLFVPGP NIPD+V+RAM   +ED+RS   P+LTK L ED KK+F +T G
Sbjct  1    MAATRRPGRNHLFVPGPTNIPDRVMRAMMVQSEDHRSVDFPSLTKPLFEDTKKVFGSTEG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T FL P +GTG WESAL+NTL+ GD++V+   GQFS LWID  QRL  +V V E EWG G
Sbjct  61   TIFLFPASGTGIWESALSNTLARGDKVVAARFGQFSHLWIDMAQRLGLDVVVQEEEWGTG  120

Query  507  AN  512
            A 
Sbjct  121  AK  122



>ref|WP_012453656.1| serine--glyoxylate aminotransferase [Methylobacterium populi]
 gb|ACB79910.1| aminotransferase class V [Methylobacterium populi BJ001]
Length=402

 Score =   155 bits (391),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 87/122 (71%), Gaps = 0/122 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            M     PGRNHLFVPGP NIPD+V+RAM   +ED+RS   P+LTK L ED KK+F +T G
Sbjct  1    MAATRRPGRNHLFVPGPTNIPDRVMRAMMVQSEDHRSVDFPSLTKPLFEDTKKVFGSTEG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T FL P +GTG WESALTNTL+ GD++++   GQFS LWID  QRL  +V V E EWG G
Sbjct  61   TIFLFPASGTGIWESALTNTLARGDKVLTSRYGQFSHLWIDMAQRLGLDVIVQEEEWGTG  120

Query  507  AN  512
            A 
Sbjct  121  AK  122



>gb|AEX09259.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=351

 Score =   154 bits (388),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/79 (90%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = +3

Query  285  LLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL  464
            LLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL
Sbjct  1    LLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRL  60

Query  465  NFNVDVVESEWGQGANLDV  521
             FNVDVVES+WG GANL++
Sbjct  61   GFNVDVVESDWGHGANLEI  79



>ref|WP_003597639.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 sp|P55819.2|SGAA_METEA RecName: Full=Serine--glyoxylate aminotransferase; Short=SGAT 
[Methylobacterium extorquens AM1]
 gb|ACS39570.1| serine-glyoxylate aminotransferase (SGAT) [Methylobacterium extorquens 
AM1]
 emb|CAX24121.1| serine-glyoxylate aminotransferase (SGAT) [Methylobacterium extorquens 
DM4]
 gb|EHP94104.1| Serine--glyoxylate transaminase [Methylobacterium extorquens 
DSM 13060]
Length=402

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 87/122 (71%), Gaps = 0/122 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            M     PGRNHLFVPGP NIPD+V+RAM   +ED+RS   P+LTK L ED KK+F +T G
Sbjct  1    MAATRRPGRNHLFVPGPTNIPDRVMRAMMVQSEDHRSVDFPSLTKPLFEDTKKVFGSTEG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T FL P +GTG WESAL+NTL+ GD++++   GQFS LWID  QRL  +V V E EWG G
Sbjct  61   TIFLFPASGTGIWESALSNTLARGDKVLAARFGQFSHLWIDMAQRLGLDVVVQEEEWGTG  120

Query  507  AN  512
            A 
Sbjct  121  AK  122



>ref|WP_012253362.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 gb|ABY30194.1| Serine--glyoxylate transaminase [Methylobacterium extorquens 
PA1]
Length=402

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 87/122 (71%), Gaps = 0/122 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            M     PGRNHLFVPGP NIPD+V+RAM   +ED+RS   P+LTK L ED KK+F +T G
Sbjct  1    MAATRRPGRNHLFVPGPTNIPDRVMRAMMVQSEDHRSVDFPSLTKPLFEDTKKVFGSTEG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T FL P +GTG WESAL+NTL+ GD++++   GQFS LWID  QRL  +V V E EWG G
Sbjct  61   TIFLFPASGTGIWESALSNTLARGDKVLAARFGQFSHLWIDMAQRLGLDVVVQEEEWGTG  120

Query  507  AN  512
            A 
Sbjct  121  AK  122



>gb|AEX09264.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=334

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/79 (90%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = +3

Query  285  LLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL  464
            LLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL
Sbjct  1    LLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRL  60

Query  465  NFNVDVVESEWGQGANLDV  521
             FNVDVVES+WG GANL++
Sbjct  61   GFNVDVVESDWGHGANLEI  79



>gb|AEX09307.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
Length=351

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/79 (90%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = +3

Query  285  LLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL  464
            LLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL
Sbjct  1    LLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRL  60

Query  465  NFNVDVVESEWGQGANLDV  521
             FNVDVVES+WG GANL++
Sbjct  61   GFNVDVVESDWGHGANLEI  79



>gb|AEX09284.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=338

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/78 (91%), Positives = 76/78 (97%), Gaps = 0/78 (0%)
 Frame = +3

Query  288  LEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLN  467
            LEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL 
Sbjct  1    LEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLG  60

Query  468  FNVDVVESEWGQGANLDV  521
            FNVDVVES+WGQGANL++
Sbjct  61   FNVDVVESDWGQGANLEI  78



>ref|XP_005709273.1| serine--glyoxylate transaminase [Galdieria sulphuraria]
 gb|EME32753.1| serine--glyoxylate transaminase [Galdieria sulphuraria]
Length=400

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 90/118 (76%), Gaps = 0/118 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            G+N L VPGP N+PD+V+RAM RN+ED+RSP  PAL KT+LE++K +F TT G  F+ P 
Sbjct  5    GKNFLMVPGPTNVPDRVLRAMHRNSEDHRSPDFPALAKTVLENIKWVFGTTKGRSFIFPA  64

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            +GTGAWE+ALTNTL+ GD+++S   GQFS LWID  QRL   V +++ +WG+G  +D+
Sbjct  65   SGTGAWEAALTNTLNKGDKVISVRFGQFSHLWIDMMQRLGLEVTILDVDWGEGIPIDI  122



>gb|AEX09291.1| alanine glyoxylate aminotransferase [Peperomia jalcaensis]
Length=323

 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/78 (90%), Positives = 75/78 (96%), Gaps = 0/78 (0%)
 Frame = +3

Query  288  LEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLN  467
            LEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL 
Sbjct  1    LEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLG  60

Query  468  FNVDVVESEWGQGANLDV  521
            FNVDVVES+WG GANL++
Sbjct  61   FNVDVVESDWGHGANLEI  78



>dbj|BAQ46928.1| serine--glyoxylate aminotransferase [Methylobacterium aquaticum]
Length=396

 Score =   153 bits (387),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 88/118 (75%), Gaps = 0/118 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGRN LFVPGP NIPD+V RAM   +ED+RS A P LT  L E+ KKIFK+  G  FL P
Sbjct  7    PGRNFLFVPGPTNIPDRVQRAMIVPSEDHRSSAFPELTLPLFEETKKIFKSREGQIFLFP  66

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLD  518
             TGTGAWE+ALTNTLSPGDR+++   GQFS LWID  +R+  +V+V E EWG+GA+ D
Sbjct  67   ATGTGAWEAALTNTLSPGDRVLAPRYGQFSTLWIDLARRVGLDVEVQEEEWGKGADPD  124



>gb|AEX09272.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=338

 Score =   152 bits (383),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 70/78 (90%), Positives = 75/78 (96%), Gaps = 0/78 (0%)
 Frame = +3

Query  288  LEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLN  467
            LEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL 
Sbjct  1    LEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLG  60

Query  468  FNVDVVESEWGQGANLDV  521
            FNVDVVES+WG GANL++
Sbjct  61   FNVDVVESDWGHGANLEI  78



>ref|WP_041930245.1| serine--glyoxylate aminotransferase, partial [Methylibium petroleiphilum]
Length=395

 Score =   152 bits (385),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            GRN LFVPGP N+P++V RAM  + ED+RS   P LTK++LED+K +FKTT+GTP + P 
Sbjct  3    GRNFLFVPGPTNVPERVQRAMVVSMEDHRSSKFPDLTKSVLEDLKAVFKTTTGTPIIFPA  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TGTG WE+ALTNTLSPGD +++   GQFS LWID   RL F V+ VE EWG+G
Sbjct  63   TGTGGWEAALTNTLSPGDLVLASRFGQFSHLWIDMITRLGFQVETVECEWGEG  115



>gb|ABM96214.1| serine-glyoxylate aminotransferase [Methylibium petroleiphilum 
PM1]
Length=415

 Score =   153 bits (386),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            GRN LFVPGP N+P++V RAM  + ED+RS   P LTK++LED+K +FKTT+GTP + P 
Sbjct  3    GRNFLFVPGPTNVPERVQRAMVVSMEDHRSSKFPDLTKSVLEDLKAVFKTTTGTPIIFPA  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TGTG WE+ALTNTLSPGD +++   GQFS LWID   RL F V+ VE EWG+G
Sbjct  63   TGTGGWEAALTNTLSPGDLVLASRFGQFSHLWIDMITRLGFQVETVECEWGEG  115



>gb|AEX09265.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=353

 Score =   152 bits (383),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  279  KTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQ  458
            KTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGD  +SFLIGQFSLLWIDQQQ
Sbjct  1    KTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDXTISFLIGQFSLLWIDQQQ  60

Query  459  RLNFNVDVVESEWGQGANLDV  521
            RL F VDVVES+WG GANL++
Sbjct  61   RLGFXVDVVESDWGHGANLEI  81



>ref|WP_036230592.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylibium]
 gb|EWS54025.1| Soluble hydrogenase 42 kDa subunit [Methylibium sp. T29]
 gb|EWS61014.1| Soluble hydrogenase 42 kDa subunit [Methylibium sp. T29-B]
Length=415

 Score =   152 bits (385),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            GRN LFVPGP N+P++V RAM  + ED+RS   P LTK++LED+K +FKTT+GTP + P 
Sbjct  3    GRNFLFVPGPTNVPERVQRAMVVSMEDHRSSKFPDLTKSVLEDLKAVFKTTNGTPIIFPA  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TGTG WE+ALTNTLSPGD +++   GQFS LWID   RL F V+ VE EWG+G
Sbjct  63   TGTGGWEAALTNTLSPGDLVLASRFGQFSHLWIDMITRLGFQVETVECEWGEG  115



>ref|WP_040580464.1| serine--glyoxylate aminotransferase [Methyloferula stellata]
Length=404

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGR+ LFVPGP N+PD+++RAM    ED+R+P  P LTK +LED+KKIFKTT+G  F+ P
Sbjct  10   PGRHFLFVPGPTNVPDRILRAMHVPMEDHRNPTFPDLTKPILEDLKKIFKTTTGQCFVYP  69

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGAN  512
            +TGTG WE+ALTNTLSPGD+++    GQFS LW D  QR+  +V V++ EWG G +
Sbjct  70   STGTGGWEAALTNTLSPGDKVIVSRYGQFSALWTDLAQRIGLDVQVIDEEWGTGTH  125



>ref|WP_028223486.1| serine--glyoxylate aminotransferase [Burkholderia oxyphila]
Length=421

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGRN L VPGP NIPD V+RAM  + ED+RS   P L   +L D+K+++KTTSG PF+ P
Sbjct  10   PGRNILAVPGPTNIPDAVLRAMVVSMEDHRSTRFPELANGVLSDLKRLYKTTSGQPFIFP  69

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            ++GTGAWE+ALTNTLSPGDR++    GQFS LW D  QRL F V++VE +WG+G
Sbjct  70   SSGTGAWEAALTNTLSPGDRVLVARFGQFSHLWADMAQRLGFEVEIVEVDWGEG  123



>ref|WP_036271184.1| serine--glyoxylate aminotransferase [Methyloversatilis universalis]
Length=396

 Score =   151 bits (381),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 84/117 (72%), Gaps = 0/117 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            GRNHL+VPGP N P++++RAM    ED+RSP  P LTK++L D+KK+FKTT GT    P 
Sbjct  6    GRNHLYVPGPTNTPERILRAMVVPQEDHRSPKFPELTKSVLADLKKVFKTTEGTVLTFPA  65

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLD  518
            +GTG WE+ALTNTLSPGD+I+    GQFS LW D  QRL F V +++ EWG G   D
Sbjct  66   SGTGMWETALTNTLSPGDKILCSRFGQFSHLWADMAQRLGFEVQILDVEWGTGVPYD  122



>ref|WP_026362994.1| serine--glyoxylate aminotransferase [Methylopila sp. M107]
Length=402

 Score =   150 bits (379),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 87/116 (75%), Gaps = 0/116 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PG+N LFVPGP N+P++V+RAM  + ED+RSP  P LTK L E +KK++KTT G  F+ P
Sbjct  5    PGKNFLFVPGPTNVPERVLRAMVVSQEDHRSPIFPELTKPLYEGLKKVYKTTEGQVFIFP  64

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGAN  512
            ++GTG WE+AL NTL+PGD++++   GQFS LW D  QRL  +V ++E EWG GA+
Sbjct  65   SSGTGGWEAALANTLAPGDKVLNSRFGQFSHLWTDMAQRLGLDVQILEEEWGTGAH  120



>ref|WP_026597137.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 77]
Length=402

 Score =   150 bits (379),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 85/122 (70%), Gaps = 0/122 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            M     PGRNHLFVPGP NIPD+V RAM   +ED+RS   PALTK L E+ K +F +T G
Sbjct  1    MAATRRPGRNHLFVPGPTNIPDRVQRAMIVPSEDHRSVDFPALTKPLFEETKAVFGSTEG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T FL P +GTG WE+ALTNTL  GD++++   GQFS LWID  QRL  NV V E EWG G
Sbjct  61   TIFLFPASGTGIWEAALTNTLHRGDKVLTSRFGQFSHLWIDMAQRLGLNVIVQEEEWGTG  120

Query  507  AN  512
            A+
Sbjct  121  AS  122



>ref|WP_028212654.1| serine--glyoxylate aminotransferase [Burkholderia mimosarum]
Length=419

 Score =   150 bits (379),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGRN L VPGP NIPD V+RAM  + ED+RS   P L   +L D+K+++KTTSG PF+ P
Sbjct  10   PGRNILAVPGPTNIPDAVLRAMVVSMEDHRSSRFPELANGVLSDLKRLYKTTSGQPFIFP  69

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            ++GTGAWE+ALTNTLSPGDR++    GQFS LW D  QRL F V++++ +WG+G
Sbjct  70   SSGTGAWEAALTNTLSPGDRVLVARFGQFSHLWADMAQRLGFEVEIIDVDWGEG  123



>ref|WP_007559580.1| serine--glyoxylate aminotransferase [Methylobacterium sp. GXF4]
 gb|EIZ86366.1| class V aminotransferase [Methylobacterium sp. GXF4]
Length=402

 Score =   150 bits (378),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 87/122 (71%), Gaps = 0/122 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            M     PGRNHLF+PGP NIPD+V+RAM   +ED+RSP  P L K LL+D K +F +T+G
Sbjct  1    MAATRRPGRNHLFIPGPTNIPDRVLRAMHVPSEDHRSPGFPELVKPLLQDAKIVFGSTAG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T  L P++GTG WESAL+NTL  GD++++   GQFS LW+D  QRL  +V V E EWG G
Sbjct  61   TVILFPSSGTGIWESALSNTLCRGDKVLTSRYGQFSHLWVDMAQRLGLDVIVQEEEWGTG  120

Query  507  AN  512
            A+
Sbjct  121  AD  122



>ref|WP_026175686.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 88A]
Length=402

 Score =   150 bits (378),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 83/122 (68%), Gaps = 0/122 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            M     PGRNHLFVPGP NIPD+V RAM   +ED+RS   P LTK L E+ K +F +T G
Sbjct  1    MAATRRPGRNHLFVPGPTNIPDRVQRAMIVPSEDHRSVDFPTLTKPLFEETKAVFGSTEG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T FL P +GTG WESALTNTL  GD +++   GQFS LWID  QRL  NV V E EWG G
Sbjct  61   TIFLFPASGTGIWESALTNTLHRGDTVLTSRFGQFSHLWIDMAQRLGLNVIVQEEEWGTG  120

Query  507  AN  512
            AN
Sbjct  121  AN  122



>ref|WP_014149643.1| serine--glyoxylate aminotransferase [Methylomicrobium alcaliphilum]
 ref|YP_004918468.1| serine-glyoxylate aminotransferase [Methylomicrobium alcaliphilum 
20Z]
 emb|CCE24883.1| Serine-glyoxylate aminotransferase [Methylomicrobium alcaliphilum 
20Z]
Length=387

 Score =   149 bits (377),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            GRNHL+VPGP NIPD+V+ AM   +ED+RSP  P L K LLED+KK+FKT +G  F+ P 
Sbjct  3    GRNHLYVPGPTNIPDEVLSAMHVPSEDHRSPIFPELFKPLLEDLKKVFKTETGHSFIFPA  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLD  518
            TGT  WE ALTNTLSPGD+++ +  GQFS LW    +RL+F V V+E  WG+G  LD
Sbjct  63   TGTAGWEIALTNTLSPGDKVLIYRFGQFSHLWAAMAKRLDFEVIVIERPWGEGIPLD  119



>ref|WP_020188076.1| hypothetical protein [Methylopila sp. 73B]
Length=402

 Score =   150 bits (378),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 86/116 (74%), Gaps = 0/116 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PG+N LFVPGP N+P++V+RAM  + ED+RSP  P LTK L E +KK+FKT  G  F+ P
Sbjct  5    PGKNFLFVPGPTNVPERVLRAMVVSQEDHRSPIFPELTKPLYEGLKKVFKTKDGQVFIFP  64

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGAN  512
            ++GTG WE+ALTNTL+PGD++++   GQFS LW D  QRL  +V + E EWG GA+
Sbjct  65   SSGTGGWEAALTNTLAPGDKVLTARFGQFSHLWTDMAQRLGLDVQIQEEEWGTGAH  120



>ref|WP_027172630.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 10]
Length=402

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 83/122 (68%), Gaps = 0/122 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            M     PGRNHLFVPGP NIPD+V RAM   +ED+RS   P LTK L E+ K +F +T G
Sbjct  1    MAATRRPGRNHLFVPGPTNIPDRVQRAMIVPSEDHRSVDFPTLTKPLFEETKAVFGSTEG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T FL P +GTG WESALTNTL  GD +++   GQFS LWID  QRL  NV V E EWG G
Sbjct  61   TIFLFPASGTGIWESALTNTLHRGDTVLTSRFGQFSHLWIDMAQRLGLNVIVQEEEWGTG  120

Query  507  AN  512
            AN
Sbjct  121  AN  122



>ref|WP_008058631.1| serine--glyoxylate aminotransferase [Methyloversatilis universalis]
 gb|EGK73403.1| Serine-glyoxylate aminotransferase [Methyloversatilis universalis 
FAM5]
Length=396

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 83/117 (71%), Gaps = 0/117 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            GRNHL+VPGP N P++++RAM    ED+RSP  P L  ++L D+KK+FKTT GT F  P 
Sbjct  6    GRNHLYVPGPTNTPERILRAMVVPQEDHRSPKFPELALSVLTDLKKVFKTTEGTIFTFPA  65

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLD  518
            +GTG WE+ALTNTLSPGD+I+    GQFS LW D  QR+ F V V++ EWG G   D
Sbjct  66   SGTGMWEAALTNTLSPGDKILCSRFGQFSHLWADMAQRMGFEVQVLDCEWGTGVPYD  122



>gb|AEX09285.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=350

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/78 (88%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = +3

Query  288  LEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLN  467
            LEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL 
Sbjct  1    LEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLG  60

Query  468  FNVDVVESEWGQGANLDV  521
            F VDVVES+WG GANL++
Sbjct  61   FIVDVVESDWGHGANLEI  78



>ref|WP_035937801.1| serine--glyoxylate aminotransferase [Burkholderia glathei]
 gb|KDR42451.1| serine--glyoxylate aminotransferase [Burkholderia glathei]
 emb|CDY78627.1| Serine--glyoxylate aminotransferase [Burkholderia glathei]
Length=419

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 84/114 (74%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGRN L VPGP NIPDQV+R+M  + ED+RS   P L   +L D+K ++KTT+G PF+ P
Sbjct  10   PGRNFLAVPGPTNIPDQVLRSMVVSMEDHRSSKFPELANGVLSDLKALYKTTTGQPFIFP  69

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            ++GTGAWE+ALTNTLSPGD++V    GQFS LW D   RL F V +V+ EWG+G
Sbjct  70   SSGTGAWEAALTNTLSPGDKVVVARFGQFSHLWADMAHRLGFEVQIVDVEWGEG  123



>ref|WP_017840623.1| serine--glyoxylate aminotransferase [Methylomicrobium buryatense]
Length=387

 Score =   149 bits (376),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 84/117 (72%), Gaps = 0/117 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            GRNHL+VPGP NIPD+V+ AM   +ED+RSP  P L K LLED+KK+FKT +G  F+ P 
Sbjct  3    GRNHLYVPGPTNIPDEVLSAMHVPSEDHRSPIFPELFKPLLEDLKKVFKTETGHSFIFPA  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLD  518
            TGT  WE ALTNTLSPGD+++ +  GQFS LW    +RL F V V+E  WG+G  LD
Sbjct  63   TGTAGWEIALTNTLSPGDKVLIYRFGQFSHLWAAMAKRLGFEVIVIERPWGEGIPLD  119



>ref|WP_026610206.1| serine--glyoxylate aminotransferase [Methylocaldum szegediense]
Length=394

 Score =   149 bits (376),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 84/118 (71%), Gaps = 0/118 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGR HL+VPGP NIPD ++ AM    ED+R P  P L + LLED+KKIF+T SG  F+ P
Sbjct  2    PGRTHLYVPGPTNIPDSILSAMHVPMEDHRRPDFPELIQPLLEDLKKIFQTKSGQCFIFP  61

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLD  518
             TGT  WE ALTNTLSPGD+++++  GQFS LWID  +RL F+V+  E  WG+G  LD
Sbjct  62   ATGTAGWEIALTNTLSPGDKVLAYRFGQFSHLWIDMARRLGFDVEYEEVPWGEGVPLD  119



>ref|WP_035525480.1| serine--glyoxylate aminotransferase [Burkholderia sacchari]
 gb|KHD21372.1| serine--glyoxylate aminotransferase [Burkholderia sacchari]
Length=418

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGRN L VPGP NIPD V+RAM  + ED+RS   P L   +L D+K+++KTTSG PF+ P
Sbjct  10   PGRNILAVPGPTNIPDAVLRAMVVSMEDHRSTRFPELANGVLSDLKRLYKTTSGQPFIFP  69

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            ++GTGAWE+ALTNTLSPGDR++    GQFS LW D  QRL F V++++ +WG+G
Sbjct  70   SSGTGAWEAALTNTLSPGDRVLVARFGQFSHLWADMAQRLGFEVEILDVDWGEG  123



>ref|WP_029644281.1| serine--glyoxylate aminotransferase [Methyloversatilis sp. FAM1]
Length=396

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 83/117 (71%), Gaps = 0/117 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            GRNHL+VPGP N P++++RAM    ED+RSP  P L  ++L D+KK+FKTT GT F  P 
Sbjct  6    GRNHLYVPGPTNTPERILRAMVVPQEDHRSPKFPELALSVLADLKKVFKTTEGTIFTFPA  65

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLD  518
            +GTG WE+ALTNTLSPGD+++    GQFS LW D  QRL F V V++ EWG G   D
Sbjct  66   SGTGMWEAALTNTLSPGDKVLCSRFGQFSHLWADMAQRLGFEVQVLDVEWGTGVPYD  122



>ref|WP_043363897.1| serine--glyoxylate aminotransferase [Methyloversatilis universalis]
Length=396

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 83/117 (71%), Gaps = 0/117 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            GRNHL+VPGP N P++++RAM    ED+RSP  P L  ++L D+KK+FKTT GT F  P 
Sbjct  6    GRNHLYVPGPTNTPERILRAMVVPQEDHRSPKFPELALSVLADLKKVFKTTEGTIFTFPA  65

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLD  518
            +GTG WE+ALTNTLSPGD+++    GQFS LW D  QRL F V V++ EWG G   D
Sbjct  66   SGTGMWEAALTNTLSPGDKVLCSRFGQFSHLWADMAQRLGFEVQVLDVEWGTGVPYD  122



>ref|WP_012590731.1| serine--glyoxylate aminotransferase [Methylocella silvestris]
 gb|ACK50661.1| aminotransferase class V [Methylocella silvestris BL2]
Length=396

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 83/114 (73%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGR+ LFVPGP N+P++V RAM    ED+RSP  P LT  L +D+KKI+KT  G  FL P
Sbjct  2    PGRHFLFVPGPTNVPERVARAMVVPMEDHRSPKFPELTLPLFQDLKKIYKTKDGQVFLFP  61

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            ++GTGAWESA  NTLSPGD+++    GQFS LWID  QR+ F+V ++E EWG G
Sbjct  62   SSGTGAWESAFNNTLSPGDKVLMSRFGQFSHLWIDMAQRMGFDVQILEEEWGTG  115



>ref|WP_012320605.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylobacterium]
 gb|ACB25646.1| aminotransferase class V [Methylobacterium radiotolerans JCM 
2831]
 gb|KIU30995.1| serine--glyoxylate aminotransferase [Methylobacterium radiotolerans]
 dbj|GAN47418.1| class V aminotransferase [Methylobacterium sp. ME121]
Length=402

 Score =   148 bits (374),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 88/122 (72%), Gaps = 0/122 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            M     PGRNHLF+PGP NIP++V+RAM   +ED+RSP+ P L K LL+D K +F +T+G
Sbjct  1    MAATRRPGRNHLFIPGPTNIPERVLRAMHVPSEDHRSPSFPELVKPLLQDSKMVFGSTNG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T  L P++GTG WESAL+NTL  GD++++   GQFS LW+D  QRL  +V V E EWG G
Sbjct  61   TVILFPSSGTGIWESALSNTLCRGDKVLTARYGQFSHLWVDMAQRLGLDVIVQEEEWGAG  120

Query  507  AN  512
            A+
Sbjct  121  AD  122



>ref|WP_027156802.1| serine--glyoxylate aminotransferase [Methylobacter luteus]
Length=388

 Score =   147 bits (371),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            GRNHL++PGP N+P +V+ AM  N ED+RSP  P L K LL+D+KK+FKT +G  F+ P 
Sbjct  3    GRNHLYIPGPTNVPSEVLNAMHVNMEDHRSPIFPKLLKPLLQDLKKVFKTETGQAFIFPA  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLD  518
            TGT  WE ALTNTL+PGD+++ +  GQFS LW +  +RL FNV++ +  WG+G  LD
Sbjct  63   TGTAGWEIALTNTLNPGDKVLIYRFGQFSHLWAEMAKRLGFNVEIHQETWGKGIPLD  119



>ref|WP_007585769.1| serine--glyoxylate aminotransferase [Burkholderia terrae]
 gb|EIM98368.1| serine--glyoxylate transaminase [Burkholderia terrae BS001]
Length=422

 Score =   148 bits (373),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 85/114 (75%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGRN L VPGP N+PD V RAM  + ED+RS   P LT  LL D+KKI++T  G PF+ P
Sbjct  10   PGRNILAVPGPTNVPDAVQRAMVVSMEDHRSTKFPELTHGLLSDLKKIYRTAEGQPFIFP  69

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            ++GTGAWE+ALTNTLSPGDR++    GQFS LW D  QRL F+V++++ +WG+G
Sbjct  70   SSGTGAWEAALTNTLSPGDRVLVPRFGQFSHLWADMAQRLGFDVEILDVDWGEG  123



>ref|WP_007742731.1| serine--glyoxylate aminotransferase [Burkholderia sp. BT03]
 gb|EUC15360.1| Serine--glyoxylate transaminase [Burkholderia sp. BT03]
Length=422

 Score =   147 bits (372),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 85/114 (75%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGRN L VPGP N+PD V RAM  + ED+RS   P LT  LL D+KKI++T  G PF+ P
Sbjct  10   PGRNILAVPGPTNVPDAVQRAMVVSMEDHRSTKFPELTHGLLSDLKKIYRTAEGQPFIFP  69

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            ++GTGAWE+ALTNTLSPGDR++    GQFS LW D  QRL F+V++++ +WG+G
Sbjct  70   SSGTGAWEAALTNTLSPGDRVLVPRFGQFSHLWADMAQRLGFDVEILDVDWGEG  123



>ref|WP_042306504.1| serine--glyoxylate aminotransferase [Burkholderia terrae]
Length=422

 Score =   147 bits (372),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 85/114 (75%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGRN L VPGP N+PD V RAM  + ED+RS   P LT  LL D+KKI++T  G PF+ P
Sbjct  10   PGRNILAVPGPTNVPDAVQRAMVVSMEDHRSTKFPELTHGLLSDLKKIYRTAEGQPFIFP  69

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            ++GTGAWE+ALTNTLSPGDR++    GQFS LW D  QRL F+V++++ +WG+G
Sbjct  70   SSGTGAWEAALTNTLSPGDRVLVPRFGQFSHLWADMAQRLGFDVEILDVDWGEG  123



>ref|WP_035994918.1| serine--glyoxylate aminotransferase [Burkholderia caribensis]
 gb|ETY83415.1| Serine--glyoxylate aminotransferase [Burkholderia caribensis 
MBA4]
Length=422

 Score =   147 bits (372),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 85/114 (75%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGRN L VPGP N+PD V RAM  + ED+RS   P LT  LL D+KKI++T  G PF+ P
Sbjct  10   PGRNILAVPGPTNVPDAVQRAMVVSMEDHRSTKFPELTHGLLSDLKKIYRTAEGQPFIFP  69

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            ++GTGAWE+ALTNTLSPGDR++    GQFS LW D  QRL F+V++++ +WG+G
Sbjct  70   SSGTGAWEAALTNTLSPGDRVLVPRFGQFSHLWADMAQRLGFDVEILDVDWGEG  123



>ref|WP_010960683.1| serine--glyoxylate aminotransferase [Methylococcus capsulatus]
 gb|AAU92322.1| serine--glyoxylate aminotransferase [Methylococcus capsulatus 
str. Bath]
Length=395

 Score =   147 bits (371),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 83/118 (70%), Gaps = 0/118 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGRNHL+VPGP NIPD V+ AM    ED+R P  PAL   LLE++KK+F+T +G  F+ P
Sbjct  2    PGRNHLYVPGPTNIPDAVLSAMHVPMEDHRRPDFPALVTPLLENLKKVFRTEAGQCFIFP  61

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLD  518
             TGT  WE AL+NTLSPGD+++S+  GQFS LWID  +RL   V+  E  WGQG  LD
Sbjct  62   ATGTAGWEIALSNTLSPGDKVLSYRFGQFSHLWIDLARRLGLEVEYEEVPWGQGVPLD  119



>ref|WP_042673896.1| serine--glyoxylate aminotransferase [Methylobacterium sp. B34]
Length=402

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 87/122 (71%), Gaps = 0/122 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            M     PGRNHLF+PGP NIP++V+RAM   +ED+RSP+ P L K LL+D K +F +T+G
Sbjct  1    MAATRRPGRNHLFIPGPTNIPERVLRAMHVPSEDHRSPSFPELVKPLLQDSKMVFGSTAG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T  L P++GTG WESAL+NTL  GD +++   GQFS LW+D  QRL  +V V E EWG G
Sbjct  61   TVILFPSSGTGIWESALSNTLCRGDTVLTSRYGQFSHLWVDMAQRLGLDVVVQEEEWGTG  120

Query  507  AN  512
            A+
Sbjct  121  AD  122



>ref|WP_020092657.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 285MFTsu5.1]
Length=402

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 87/122 (71%), Gaps = 0/122 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            M     PGRNHLF+PGP NIP++V+RAM   +ED+RSP+ P L K LL+D K +F +T+G
Sbjct  1    MAATRRPGRNHLFIPGPTNIPERVLRAMHVPSEDHRSPSFPELVKPLLQDSKMVFGSTAG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T  L P++GTG WESAL+NTL  GD +++   GQFS LW+D  QRL  +V V E EWG G
Sbjct  61   TVILFPSSGTGIWESALSNTLCRGDTVLTSRYGQFSHLWVDMAQRLGLDVVVQEEEWGTG  120

Query  507  AN  512
            A+
Sbjct  121  AD  122



>ref|WP_037429329.1| hypothetical protein, partial [Sinorhizobium fredii]
Length=152

 Score =   140 bits (354),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 83/118 (70%), Gaps = 0/118 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK  +G  F+ P+
Sbjct  28   GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRFPELTLPLFADVKKVFKNRNGRVFIYPS  87

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            +GTGAWE+A+TN LSPGD+++    GQFS LW+D  +RL F VD ++ EWG G  +++
Sbjct  88   SGTGAWEAAMTNVLSPGDKVLMSRFGQFSHLWVDMAERLGFEVDCLDREWGTGVPVEL  145



>ref|WP_043385155.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylobacterium]
Length=402

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 87/122 (71%), Gaps = 0/122 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            M     PGRNHLF+PGP NIP++V+RAM   +ED+RSP+ P L K LL+D K +F +T+G
Sbjct  1    MAATRRPGRNHLFIPGPTNIPERVLRAMHVPSEDHRSPSFPELVKPLLQDSKMVFGSTAG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T  L P++GTG WESAL+NTL  GD +++   GQFS LW+D  QRL  +V V E EWG G
Sbjct  61   TVILFPSSGTGIWESALSNTLCRGDTVLTSRYGQFSHLWVDMAQRLGLDVVVQEEEWGTG  120

Query  507  AN  512
            A+
Sbjct  121  AD  122



>gb|AIQ91949.1| Aminotransferase class V [Methylobacterium oryzae CBMB20]
Length=443

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 88/125 (70%), Gaps = 0/125 (0%)
 Frame = +3

Query  138  GEKMDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKT  317
            G  M     PGRNHLF+PGP NIP++V+RAM   +ED+RSP+ P L K LL+D K +F +
Sbjct  39   GNIMAATRRPGRNHLFIPGPTNIPERVLRAMHVPSEDHRSPSFPELVKPLLQDSKMVFGS  98

Query  318  TSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEW  497
            T+GT  L P++GTG WESAL+NTL  GD +++   GQFS LW+D  QRL  +V V E EW
Sbjct  99   TAGTVILFPSSGTGIWESALSNTLCRGDTVLTSRYGQFSHLWVDMAQRLGLDVVVQEEEW  158

Query  498  GQGAN  512
            G GA+
Sbjct  159  GTGAD  163



>ref|WP_010687105.1| Aminotransferase class V [Methylobacterium mesophilicum]
 gb|EMS39671.1| Aminotransferase class V [Methylobacterium mesophilicum SR1.6/6]
Length=402

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 88/122 (72%), Gaps = 0/122 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            M     PGRNHLF+PGP NIP++V+RAM   +ED+RSP+ P L K LL+D K +F +T+G
Sbjct  1    MAATRRPGRNHLFIPGPTNIPERVLRAMHVPSEDHRSPSFPELVKPLLQDSKMVFGSTNG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T  L P++GTG WESAL+NTL  GD++++   GQFS LW+D  QRL  +V V + EWG G
Sbjct  61   TVILFPSSGTGIWESALSNTLCRGDKVLTARYGQFSHLWVDMAQRLGLDVIVQDEEWGAG  120

Query  507  AN  512
            A+
Sbjct  121  AD  122



>ref|WP_037399714.1| serine--glyoxylate aminotransferase, partial [Sinorhizobium fredii]
Length=118

 Score =   139 bits (350),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 80/113 (71%), Gaps = 0/113 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK  +G  F+ P+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRFPELTLPLFADVKKVFKNRNGRVFIYPS  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            +GTGAWE+A+TN LSPGD+++    GQFS LW+D  +RL F VD ++ EWG G
Sbjct  63   SGTGAWEAAMTNVLSPGDKVLMSRFGQFSHLWVDMAERLGFEVDCLDREWGTG  115



>ref|WP_037437029.1| hypothetical protein, partial [Sinorhizobium fredii]
Length=152

 Score =   140 bits (353),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 83/118 (70%), Gaps = 0/118 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK  +G  F+ P+
Sbjct  28   GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRFPELTLPLFADVKKVFKNRNGRVFIYPS  87

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            +GTGAWE+A+TN LSPGD+++    GQFS LW+D  +RL F VD ++ EWG G  +++
Sbjct  88   SGTGAWEAAMTNVLSPGDKVLMSRFGQFSHLWVDMAERLGFEVDCLDREWGTGVPVEL  145



>ref|WP_028367172.1| serine--glyoxylate aminotransferase [Burkholderia sp. UYPR1.413]
Length=421

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            GRN L VPGP NIPD V+RAM  + ED+RS   P L   LL D+KKI++T  G PF+ P+
Sbjct  11   GRNILAVPGPTNIPDAVLRAMVVSMEDHRSTKFPELAHGLLSDLKKIYRTAEGQPFIFPS  70

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            +GTGAWE+ALTNTLSPGDR++    GQFS LW D  QRL F+V++++ +WG+G
Sbjct  71   SGTGAWEAALTNTLSPGDRVLVPRFGQFSHLWADMAQRLGFDVEILDVDWGEG  123



>ref|WP_043355705.1| serine--glyoxylate aminotransferase [Methylobacterium sp. B1]
Length=402

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 87/122 (71%), Gaps = 0/122 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            M     PGRNHLF+PGP NIP++V+RAM   +ED+RSP+ P L + LL+D K +F +T+G
Sbjct  1    MAATRRPGRNHLFIPGPTNIPERVLRAMHVPSEDHRSPSFPELVRPLLQDSKMVFGSTAG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T  L P++GTG WESAL+NTL  GD +++   GQFS LW+D  QRL  +V V E EWG G
Sbjct  61   TVILFPSSGTGIWESALSNTLCRGDTVLTSRYGQFSHLWVDMAQRLGLDVVVQEEEWGTG  120

Query  507  AN  512
            A+
Sbjct  121  AD  122



>ref|WP_027147316.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylobacter]
Length=388

 Score =   145 bits (367),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            GRNHL++PGP N+P +V+ AM  N ED+RSP  P L K LL+D+KK+FKT +G  F+ P 
Sbjct  3    GRNHLYIPGPTNVPSEVLNAMHVNMEDHRSPIFPKLLKPLLQDLKKVFKTETGQAFVFPA  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLD  518
            TGT  WE ALTNTL+PGD+++ +  GQFS LW +  +RL F+V++ +  WG+G  LD
Sbjct  63   TGTAGWEIALTNTLNPGDKVLIYRFGQFSHLWAEMAKRLGFDVEIHQEAWGKGIPLD  119



>ref|WP_036253086.1| serine--glyoxylate aminotransferase [Methylobacter sp. BBA5.1]
Length=388

 Score =   145 bits (366),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            GRNHL++PGP N+P +V+ AM  N ED+RSP  P L K LL+D+KK+FKT +G  F+ P 
Sbjct  3    GRNHLYIPGPTNVPSEVLNAMHVNMEDHRSPIFPKLLKPLLQDLKKVFKTETGQAFVFPA  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLD  518
            TGT  WE ALTNTL+PGD+++ +  GQFS LW +  +RL F+V++ +  WG+G  LD
Sbjct  63   TGTAGWEIALTNTLNPGDKVLIYRFGQFSHLWAEMAKRLGFDVEIHQETWGKGIPLD  119



>ref|WP_026608295.1| serine--glyoxylate aminotransferase [Methylocapsa acidiphila]
Length=412

 Score =   145 bits (367),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 84/114 (74%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGR+ LFVPGP N+PD+V RAM    ED+RS   P LT  L ED+KK+FK+  G  F+ P
Sbjct  2    PGRHFLFVPGPTNVPDRVQRAMLVAMEDHRSSKFPELTLPLFEDLKKVFKSVDGQVFIFP  61

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            ++GTGAWE++L+NTLSPGD++++   GQFS LWID  QRL  +V V+E EWG G
Sbjct  62   SSGTGAWEASLSNTLSPGDKVLASRFGQFSHLWIDLAQRLGLDVQVLEEEWGTG  115



>ref|WP_015933415.1| serine--glyoxylate aminotransferase [Methylobacterium nodulans]
 gb|ACL61852.1| aminotransferase class V [Methylobacterium nodulans ORS 2060]
Length=417

 Score =   145 bits (367),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGRN LFVPGP N+P++V RAM    ED+RS + P LT  L E++KK+FK+  G  F+ P
Sbjct  7    PGRNFLFVPGPTNVPERVQRAMIVPMEDHRSSSFPDLTLPLFENMKKVFKSKDGQVFIFP  66

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLD  518
            ++GTGAWE+ALTNTLSPGDR+++   GQFS LWID  QR+  +V + + EWG GAN D
Sbjct  67   SSGTGAWEAALTNTLSPGDRVLASRFGQFSTLWIDLAQRVGLDVVIQDEEWGTGANPD  124



>ref|WP_012405153.1| serine--glyoxylate aminotransferase [Burkholderia phymatum]
 gb|ACC74993.1| Serine--glyoxylate transaminase [Burkholderia phymatum STM815]
Length=421

 Score =   145 bits (367),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            GRN L VPGP N+PD V+RAM  + ED+RS   P L   LL D+KKI++T  G PF+ P+
Sbjct  11   GRNILAVPGPTNVPDAVLRAMVVSMEDHRSTKFPELAHGLLSDLKKIYRTAEGQPFIFPS  70

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            +GTGAWE+ALTNTLSPGDR++    GQFS LW D  QRL F+V++++ +WG+G
Sbjct  71   SGTGAWEAALTNTLSPGDRVLVPRFGQFSHLWADMAQRLGFDVEILDVDWGEG  123



>ref|WP_014762956.1| serine--glyoxylate aminotransferase [Sinorhizobium fredii]
 gb|AFL50786.1| serine--glyoxylate aminotransferase SgaA [Sinorhizobium fredii 
USDA 257]
Length=396

 Score =   145 bits (365),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 83/118 (70%), Gaps = 0/118 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK  SG  F+ P+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRYPELTLPLFADVKKVFKNHSGRVFIYPS  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            +GTGAWE+A+TN LSPGDR++    GQFS LW+D  +RL F VD ++ EWG G  +++
Sbjct  63   SGTGAWEAAMTNVLSPGDRVLMSRFGQFSHLWVDMAERLRFEVDCIDREWGTGVPVEL  120



>ref|WP_018238561.1| serine--glyoxylate aminotransferase [Ensifer sp. BR816]
Length=396

 Score =   145 bits (365),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 83/119 (70%), Gaps = 0/119 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PG NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK   G  F+ P
Sbjct  2    PGYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRYPELTLPLFADVKKVFKNQDGRVFIYP  61

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            ++GTGAWE+A+TN LSPGDR++    GQFS LW+D  +RL F VD ++ EWG G  +++
Sbjct  62   SSGTGAWEAAMTNVLSPGDRLLMSRFGQFSHLWVDMAERLGFEVDCLDREWGTGVPVEL  120



>gb|AEX09271.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=332

 Score =   143 bits (361),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/73 (90%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = +3

Query  303  KIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDV  482
            KIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDV
Sbjct  1    KIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDV  60

Query  483  VESEWGQGANLDV  521
            VES+WGQGANL++
Sbjct  61   VESDWGQGANLEI  73



>ref|WP_031434945.1| serine--glyoxylate aminotransferase [Methylomarinum vadi]
Length=388

 Score =   144 bits (364),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 83/118 (70%), Gaps = 0/118 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            GRNHLF+PGP N P +V+ AM    ED+RSP  P L K +LED+KK+F+T +G  F+ P 
Sbjct  3    GRNHLFIPGPTNTPHEVLSAMHVPMEDHRSPDFPKLLKPVLEDLKKVFRTETGQAFIFPA  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            TGT  WE ALTNTLSPGD+++ +  GQFS LW+D  +RL  +V+  E EWG+G  LD 
Sbjct  63   TGTAGWEIALTNTLSPGDKVLIYRFGQFSHLWMDMAKRLGLDVEFHEVEWGKGIPLDA  120



>ref|WP_005371842.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylomicrobium]
 gb|EIC29744.1| serine-pyruvate aminotransferase/archaeal aspartate aminotransferase 
[Methylomicrobium album BG8]
Length=388

 Score =   144 bits (364),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 84/117 (72%), Gaps = 0/117 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            GRNHL++PGP N+P +V+ AM    ED+RSP  PA+ K LLED+KK+F+T  G  F+ P 
Sbjct  3    GRNHLYIPGPTNVPHEVLSAMHAPMEDHRSPKFPAIFKPLLEDMKKVFRTEKGQCFIFPA  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLD  518
            TGT  WE ALTNTL+PGD+++ +  GQFS LW +  +RL F+V++ +  WG+G  LD
Sbjct  63   TGTAGWEIALTNTLNPGDKVIIYRFGQFSHLWAEMAKRLGFDVEIHQETWGKGIPLD  119



>ref|WP_026190999.1| serine--glyoxylate aminotransferase [Methylobacterium sp. WSM2598]
Length=417

 Score =   145 bits (365),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 86/116 (74%), Gaps = 0/116 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGRN LFVPGP N+P++V RAM    ED+RS + P LT  L E++KK+FK+  G  F+ P
Sbjct  7    PGRNFLFVPGPTNVPERVQRAMIVPMEDHRSSSFPDLTLPLFENLKKVFKSKDGQVFIFP  66

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGAN  512
            ++GTGAWE+ALTNTLSPGDR+++   GQFS LWID  QR+  +V + + EWG GAN
Sbjct  67   SSGTGAWEAALTNTLSPGDRVLASRFGQFSTLWIDLAQRVGLDVVIQDEEWGTGAN  122



>ref|WP_012336184.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 4-46]
 gb|ACA20808.1| Serine--glyoxylate transaminase [Methylobacterium sp. 4-46]
Length=417

 Score =   145 bits (365),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 86/116 (74%), Gaps = 0/116 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGRN LFVPGP N+P++V RAM    ED+RS + P LT  L E++KK+FK+  G  F+ P
Sbjct  7    PGRNFLFVPGPTNVPERVQRAMIVPMEDHRSSSFPDLTLPLFENLKKVFKSKDGQVFIFP  66

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGAN  512
            ++GTGAWE+ALTNTLSPGDR+++   GQFS LWID  QR+  +V + + EWG GAN
Sbjct  67   SSGTGAWEAALTNTLSPGDRVLASRFGQFSTLWIDLAQRVGLDVVIQDEEWGTGAN  122



>ref|WP_006890572.1| serine--glyoxylate aminotransferase [Methylobacter tundripaludum]
 gb|EGW22602.1| Serine--glyoxylate transaminase [Methylobacter tundripaludum 
SV96]
Length=388

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            GRNHL++PGP N+P++++ AM  N ED+RSP  P L   LL+D+KKIFKT +G  F+ P 
Sbjct  3    GRNHLYIPGPTNVPNEILNAMHVNMEDHRSPVFPKLLTPLLQDLKKIFKTETGQAFIFPA  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLD  518
            TGT  WE ALTNTL+PGD+++ +  GQFS LW +  +RL F+V++ +  WG+G  LD
Sbjct  63   TGTAGWEVALTNTLNPGDKVLIYRFGQFSHLWAEMAKRLGFDVEIHQEVWGKGIPLD  119



>ref|WP_031437003.1| serine--glyoxylate aminotransferase [Methylobacter tundripaludum]
Length=388

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            GRNHL++PGP N+P++++ AM  N ED+RSP  P L   LL+D+KKIFKT +G  F+ P 
Sbjct  3    GRNHLYIPGPTNVPNEILNAMHVNMEDHRSPVFPKLLTPLLQDLKKIFKTETGQAFIFPA  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLD  518
            TGT  WE ALTNTL+PGD+++ +  GQFS LW +  +RL F+V++ +  WG+G  LD
Sbjct  63   TGTAGWEVALTNTLNPGDKVLIYRFGQFSHLWAEMAKRLGFDVEIHQEVWGKGIPLD  119



>ref|WP_027168976.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. WSM3224]
Length=396

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 84/118 (71%), Gaps = 0/118 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            G  HLF+PGP NIP+QV +AM    ED R+ + P LT  L ED+KK+FK  +G  F+ P+
Sbjct  3    GFTHLFIPGPTNIPEQVRQAMNLPMEDMRAASFPDLTLPLFEDIKKVFKNETGRVFIYPS  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
            +GTGAWE+A+TN LSPGDR++    GQFS LW+D  +RL F VDVV+ EWG G  L++
Sbjct  63   SGTGAWEAAMTNVLSPGDRVLMSRFGQFSHLWVDMAERLGFEVDVVDCEWGTGVPLEI  120



>ref|XP_002953765.1| hypothetical protein VOLCADRAFT_75980 [Volvox carteri f. nagariensis]
 gb|EFJ45089.1| hypothetical protein VOLCADRAFT_75980 [Volvox carteri f. nagariensis]
Length=449

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 82/119 (69%), Gaps = 0/119 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGRNHLFVPGPVNI ++V+RAM    +++R P      K  LED K I+ T   TPF+  
Sbjct  52   PGRNHLFVPGPVNIHERVLRAMHVPGQNHRDPWFAQFFKDCLEDTKLIYGTKEATPFIFS  111

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDV  521
             TGTG WE+ALTNTLSPGD++V F  G FS LWID  QRL  +V VV+  WG+GAN D+
Sbjct  112  GTGTGGWEAALTNTLSPGDKVVCFRYGLFSHLWIDMMQRLGLDVQVVDRPWGEGANEDI  170



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564104274800