BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF040H01

Length=507
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP10414.1|  unnamed protein product                                252   2e-75   Coffea canephora [robusta coffee]
ref|XP_009613360.1|  PREDICTED: phospholipase D alpha 1-like            250   1e-74   Nicotiana tomentosiformis
ref|XP_009760786.1|  PREDICTED: phospholipase D alpha 1-like            247   9e-74   Nicotiana sylvestris
ref|XP_006367508.1|  PREDICTED: phospholipase D alpha 1-like isof...    244   1e-72   Solanum tuberosum [potatoes]
ref|NP_001289824.1|  uncharacterized protein LOC101257989               244   1e-72   
ref|XP_010325100.1|  PREDICTED: phospholipase D alpha 1-like isof...    244   1e-72   Solanum lycopersicum
ref|XP_011078373.1|  PREDICTED: phospholipase D alpha 1-like            244   2e-72   Sesamum indicum [beniseed]
ref|XP_006367510.1|  PREDICTED: phospholipase D alpha 1-like            238   4e-70   Solanum tuberosum [potatoes]
ref|NP_001234863.1|  phospholipase PLDa2                                237   5e-70   
gb|EYU23016.1|  hypothetical protein MIMGU_mgv1a001487mg                228   1e-66   Erythranthe guttata [common monkey flower]
dbj|BAE79735.1|  phospholipase D alpha 2                                226   4e-66   Arachis hypogaea [goober]
ref|XP_002517625.1|  phopholipase d alpha, putative                     223   1e-64   
gb|AAB37305.1|  phospholipase D                                         223   1e-64   Ricinus communis
sp|Q41142.1|PLDA1_RICCO  RecName: Full=Phospholipase D alpha 1; S...    223   1e-64   Ricinus communis
ref|XP_010097235.1|  Phospholipase D alpha 1                            220   9e-64   Morus notabilis
ref|XP_007150746.1|  hypothetical protein PHAVU_005G177300g             218   4e-63   Phaseolus vulgaris [French bean]
ref|XP_011073436.1|  PREDICTED: phospholipase D alpha 1                 218   4e-63   Sesamum indicum [beniseed]
ref|XP_004486668.1|  PREDICTED: phospholipase D alpha 1-like isof...    218   8e-63   
emb|CAB43063.1|  phospholipase D1                                       217   1e-62   Craterostigma plantagineum
gb|ADA72022.1|  phospholipase D                                         216   3e-62   Jatropha curcas
gb|EPS65578.1|  hypothetical protein M569_09194                         216   4e-62   Genlisea aurea
ref|XP_003543677.1|  PREDICTED: phospholipase D alpha 1-like isof...    215   4e-62   Glycine max [soybeans]
ref|XP_008454241.1|  PREDICTED: phospholipase D alpha 1                 214   8e-62   Cucumis melo [Oriental melon]
ref|XP_006385316.1|  phospholipase D family protein                     214   1e-61   
ref|XP_004506968.1|  PREDICTED: phospholipase D alpha 1-like            213   4e-61   
emb|CDY20148.1|  BnaA01g28540D                                          205   4e-61   Brassica napus [oilseed rape]
ref|XP_003604419.1|  Phospholipase D alpha                              211   6e-61   
emb|CAB43062.1|  phospholipase D2                                       212   7e-61   Craterostigma plantagineum
ref|XP_010254401.1|  PREDICTED: phospholipase D alpha 1-like            212   8e-61   Nelumbo nucifera [Indian lotus]
ref|XP_004152203.1|  PREDICTED: phospholipase D alpha 1-like            211   1e-60   Cucumis sativus [cucumbers]
ref|XP_004156800.1|  PREDICTED: phospholipase D alpha 1-like            211   1e-60   
ref|XP_009619857.1|  PREDICTED: phospholipase D alpha 1                 211   1e-60   
tpg|DAA53241.1|  TPA: phospholipase D family protein                    198   2e-60   
ref|XP_003597894.1|  Phospholipase D alpha                              211   2e-60   Medicago truncatula
ref|XP_003528334.1|  PREDICTED: phospholipase D alpha 1-like isof...    211   2e-60   
gb|AES86616.2|  phospholipase D alpha 1                                 211   2e-60   Medicago truncatula
ref|XP_011008452.1|  PREDICTED: phospholipase D alpha 1-like            210   3e-60   Populus euphratica
ref|XP_009799916.1|  PREDICTED: phospholipase D alpha 1                 210   4e-60   Nicotiana sylvestris
emb|CBI36314.3|  unnamed protein product                                201   6e-60   Vitis vinifera
sp|Q70EW5.2|PLDA1_CYNCA  RecName: Full=Phospholipase D alpha 1; S...    209   7e-60   Cynara cardunculus [cardoon]
ref|XP_009625689.1|  PREDICTED: phospholipase D alpha 1                 209   9e-60   Nicotiana tomentosiformis
sp|P93400.2|PLDA1_TOBAC  RecName: Full=Phospholipase D alpha 1; S...    209   9e-60   Nicotiana tabacum [American tobacco]
ref|XP_011081358.1|  PREDICTED: phospholipase D alpha 1                 209   1e-59   Sesamum indicum [beniseed]
ref|XP_003531710.1|  PREDICTED: phospholipase D alpha 1-like isof...    208   2e-59   
gb|KHN47766.1|  Phospholipase D alpha 1                                 208   2e-59   Glycine soja [wild soybean]
gb|KHN01336.1|  Phospholipase D alpha 1                                 208   2e-59   Glycine soja [wild soybean]
tpg|DAA53243.1|  TPA: phospholipase D family protein                    197   2e-59   
tpg|DAA53242.1|  TPA: phospholipase D family protein                    197   2e-59   
gb|KDO48582.1|  hypothetical protein CISIN_1g004579mg                   206   3e-59   Citrus sinensis [apfelsine]
emb|CDY21865.1|  BnaC01g35830D                                          207   4e-59   Brassica napus [oilseed rape]
ref|XP_006427267.1|  hypothetical protein CICLE_v10024917mg             206   7e-59   Citrus clementina [clementine]
ref|XP_006465340.1|  PREDICTED: phospholipase D alpha 1                 206   7e-59   Citrus sinensis [apfelsine]
gb|AGN71006.1|  phospholipase D2                                        206   8e-59   Brassica napus [oilseed rape]
sp|P86387.1|PLDA1_CARPA  RecName: Full=Phospholipase D alpha 1; S...    206   1e-58   Carica papaya [mamon]
ref|XP_009115281.1|  PREDICTED: phospholipase D alpha 2                 206   1e-58   Brassica rapa
ref|NP_001275827.1|  phospholipase D alpha                              206   1e-58   Citrus sinensis [apfelsine]
ref|XP_006364210.1|  PREDICTED: phospholipase D alpha 1-like isof...    206   1e-58   Solanum tuberosum [potatoes]
ref|XP_004235964.1|  PREDICTED: phospholipase D alpha 1                 206   1e-58   Solanum lycopersicum
gb|AGV22364.1|  phospholipase D4                                        206   1e-58   Brassica napus [oilseed rape]
ref|XP_011012164.1|  PREDICTED: phospholipase D alpha 1                 205   2e-58   Populus euphratica
ref|XP_009146200.1|  PREDICTED: phospholipase D alpha 1                 205   2e-58   Brassica rapa
gb|KCW70692.1|  hypothetical protein EUGRSUZ_F03862                     204   2e-58   Eucalyptus grandis [rose gum]
sp|P55939.2|PLDA2_BRAOC  RecName: Full=Phospholipase D alpha 2; S...    205   2e-58   Brassica oleracea var. capitata
ref|XP_006356207.1|  PREDICTED: phospholipase D alpha 1-like isof...    205   3e-58   Solanum tuberosum [potatoes]
ref|XP_010063458.1|  PREDICTED: phospholipase D alpha 1                 204   3e-58   Eucalyptus grandis [rose gum]
emb|CDO98145.1|  unnamed protein product                                204   4e-58   Coffea canephora [robusta coffee]
gb|AIE90138.1|  phospholipase D1                                        204   5e-58   Brassica napus [oilseed rape]
ref|XP_008461111.1|  PREDICTED: phospholipase D alpha 1                 204   5e-58   
sp|O82549.1|PLDA1_BRAOC  RecName: Full=Phospholipase D alpha 1; S...    204   5e-58   Brassica oleracea var. capitata
ref|XP_007135745.1|  hypothetical protein PHAVU_010G155000g             203   1e-57   Phaseolus vulgaris [French bean]
gb|AGN71005.1|  phospholipase D1                                        203   1e-57   Brassica napus [oilseed rape]
gb|AAG50297.1|  phospholipase PLDa3                                     202   1e-57   Solanum lycopersicum
gb|ABB82551.1|  phospholipase D-alpha                                   202   1e-57   Cucumis melo var. inodorus [casaba melon]
ref|NP_001234102.1|  phospholipase PLDa1                                202   2e-57   
gb|ABU54776.1|  phospholipase D alpha 1 precursor                       202   2e-57   Helianthus annuus
ref|XP_002299756.1|  phospholipase D family protein                     202   2e-57   Populus trichocarpa [western balsam poplar]
emb|CDX97705.1|  BnaA05g23740D                                          202   2e-57   
ref|NP_001267897.1|  phospholipase D alpha                              202   3e-57   Vitis vinifera
gb|EYU21635.1|  hypothetical protein MIMGU_mgv1a001489mg                202   3e-57   Erythranthe guttata [common monkey flower]
ref|XP_004171103.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    198   3e-57   
ref|XP_008805616.1|  PREDICTED: phospholipase D alpha 1-like            201   4e-57   Phoenix dactylifera
ref|XP_008792036.1|  PREDICTED: phospholipase D alpha 1                 201   5e-57   Phoenix dactylifera
sp|O04865.1|PLDA1_VIGUN  RecName: Full=Phospholipase D alpha 1; S...    201   5e-57   Vigna unguiculata
ref|XP_010322318.1|  PREDICTED: phospholipase PLDa1 isoform X1          201   7e-57   Solanum lycopersicum
ref|XP_010907269.1|  PREDICTED: phospholipase D alpha 1                 201   9e-57   Elaeis guineensis
gb|KHG06123.1|  Phospholipase D alpha 1                                 199   2e-56   Gossypium arboreum [tree cotton]
gb|AGV22363.1|  phospholipase D3                                        199   3e-56   Brassica napus [oilseed rape]
ref|XP_007150745.1|  hypothetical protein PHAVU_005G177200g             199   4e-56   Phaseolus vulgaris [French bean]
gb|AHN53202.1|  phospholipase D alpha 1-like protein                    199   4e-56   Cocos nucifera
ref|XP_004135845.1|  PREDICTED: phospholipase D alpha 1-like            199   4e-56   
gb|ABN13537.2|  phospholipase D                                         199   4e-56   Cucumis sativus [cucumbers]
gb|ADP23922.1|  phospholipase D alpha                                   198   5e-56   Litchi chinensis [litchi]
ref|XP_006643814.1|  PREDICTED: phospholipase D alpha 1-like            198   6e-56   Oryza brachyantha
ref|XP_010250112.1|  PREDICTED: phospholipase D alpha 1                 198   7e-56   
ref|XP_006842069.1|  hypothetical protein AMTR_s00078p00051300          198   8e-56   Amborella trichopoda
ref|XP_002882959.1|  PLDALPHA1                                          197   9e-56   Arabidopsis lyrata subsp. lyrata
ref|XP_008673445.1|  PREDICTED: phospholipase D alpha 1 isoform X1      197   9e-56   Zea mays [maize]
gb|ACR35730.1|  unknown                                                 197   9e-56   Zea mays [maize]
gb|ACG63794.1|  phospholipase D alpha                                   197   1e-55   Gossypium arboreum [tree cotton]
gb|ACL53693.1|  unknown                                                 197   1e-55   Zea mays [maize]
ref|XP_009381115.1|  PREDICTED: phospholipase D alpha 1                 197   2e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008654846.1|  PREDICTED: phospholipase D family protein is...    197   2e-55   Zea mays [maize]
ref|XP_007023176.1|  Phospholipase D alpha 2 isoform 3                  196   2e-55   
ref|NP_188194.1|  phospholipase D alpha 1                               196   2e-55   Arabidopsis thaliana [mouse-ear cress]
gb|KJB70611.1|  hypothetical protein B456_011G083000                    195   3e-55   Gossypium raimondii
ref|XP_006364211.1|  PREDICTED: phospholipase D alpha 1-like isof...    196   3e-55   
ref|XP_007023174.1|  Phospholipase D alpha 2 isoform 1                  196   4e-55   
ref|NP_001042153.1|  Os01g0172400                                       196   4e-55   
gb|EEC70024.1|  hypothetical protein OsI_00588                          196   5e-55   Oryza sativa Indica Group [Indian rice]
gb|ACG63795.1|  phospholipase D alpha                                   196   5e-55   Gossypium raimondii
ref|XP_009348321.1|  PREDICTED: phospholipase D alpha 1                 195   7e-55   Pyrus x bretschneideri [bai li]
ref|XP_006297003.1|  hypothetical protein CARUB_v10012996mg             195   8e-55   Capsella rubella
ref|XP_009408983.1|  PREDICTED: phospholipase D alpha 1-like            195   8e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003569355.1|  PREDICTED: phospholipase D alpha 1                 195   9e-55   Brachypodium distachyon [annual false brome]
ref|XP_010687988.1|  PREDICTED: phospholipase D alpha 1-like            194   1e-54   
gb|ACV70146.1|  phospholipase D                                         194   1e-54   Gossypium arboreum [tree cotton]
gb|ABX83202.2|  phospholipase D                                         194   2e-54   Lolium temulentum
ref|NP_001105686.1|  phospholipase D alpha 1                            194   2e-54   Zea mays [maize]
ref|XP_006406922.1|  hypothetical protein EUTSA_v10020083mg             193   3e-54   
ref|XP_010691149.1|  PREDICTED: phospholipase D alpha 1-like            193   4e-54   Beta vulgaris subsp. vulgaris [field beet]
gb|ADY75750.1|  phospholipase D alpha                                   193   4e-54   Dimocarpus longan [longan]
ref|XP_008373955.1|  PREDICTED: phospholipase D alpha 1                 193   5e-54   
gb|AGW22212.1|  phospholipase D alpha                                   192   5e-54   Chorispora bungeana
ref|XP_010465563.1|  PREDICTED: phospholipase D alpha 1-like            192   6e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010487412.1|  PREDICTED: phospholipase D alpha 1 isoform X2      192   6e-54   Camelina sativa [gold-of-pleasure]
dbj|BAA11136.1|  phospholipase D                                        192   7e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008360327.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    192   1e-53   Malus domestica [apple tree]
gb|EMT03624.1|  Phospholipase D alpha 1                                 192   1e-53   
gb|EYU24646.1|  hypothetical protein MIMGU_mgv1a001477mg                191   2e-53   Erythranthe guttata [common monkey flower]
gb|ACG80607.1|  phospholipase D alpha                                   191   2e-53   Prunus persica
ref|XP_007217042.1|  hypothetical protein PRUPE_ppa001519mg             191   2e-53   Prunus persica
ref|XP_008243731.1|  PREDICTED: phospholipase D alpha 1                 191   2e-53   Prunus mume [ume]
ref|XP_010503392.1|  PREDICTED: phospholipase D alpha 1-like            191   2e-53   Camelina sativa [gold-of-pleasure]
ref|XP_009365415.1|  PREDICTED: phospholipase D alpha 1-like            190   4e-53   Pyrus x bretschneideri [bai li]
gb|EPS60466.1|  hypothetical protein M569_14336                         188   2e-52   Genlisea aurea
emb|CDY63527.1|  BnaAnng18990D                                          181   2e-52   Brassica napus [oilseed rape]
emb|CDM81985.1|  unnamed protein product                                188   2e-52   Triticum aestivum [Canadian hard winter wheat]
tpg|DAA53239.1|  TPA: phospholipase D family protein                    177   2e-52   
ref|XP_004303313.1|  PREDICTED: phospholipase D alpha 1                 188   3e-52   Fragaria vesca subsp. vesca
gb|AAW83125.1|  phospholipase D alpha                                   187   4e-52   Fragaria x ananassa
tpg|DAA53240.1|  TPA: phospholipase D family protein                    177   5e-52   
ref|NP_001267764.1|  phospholipase D alpha 1-like                       186   1e-51   Setaria italica
ref|XP_010462102.1|  PREDICTED: phospholipase D alpha 2                 186   1e-51   Camelina sativa [gold-of-pleasure]
ref|XP_006392903.1|  hypothetical protein EUTSA_v10011246mg             185   2e-51   Eutrema salsugineum [saltwater cress]
ref|XP_002894388.1|  predicted protein                                  184   5e-51   Arabidopsis lyrata subsp. lyrata
ref|XP_010925209.1|  PREDICTED: phospholipase D alpha 1-like            184   5e-51   Elaeis guineensis
ref|XP_010500868.1|  PREDICTED: phospholipase D alpha 2-like isof...    184   6e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010500864.1|  PREDICTED: phospholipase D alpha 2-like isof...    184   6e-51   Camelina sativa [gold-of-pleasure]
ref|XP_006306783.1|  hypothetical protein CARUB_v10008323mg             184   8e-51   
gb|AAL48261.2|AF451979_1  phospholipase D1                              183   1e-50   Papaver somniferum
emb|CDX87920.1|  BnaC06g09820D                                          176   3e-50   
ref|XP_002443625.1|  hypothetical protein SORBIDRAFT_08g022520          182   4e-50   Sorghum bicolor [broomcorn]
gb|AAL48262.2|AF451980_1  phospholipase D2                              181   5e-50   Papaver somniferum
emb|CDY47540.1|  BnaC03g69220D                                          181   7e-50   Brassica napus [oilseed rape]
ref|XP_009123823.1|  PREDICTED: phospholipase D alpha 2-like            181   8e-50   Brassica rapa
ref|XP_010479770.1|  PREDICTED: phospholipase D alpha 2-like            181   9e-50   Camelina sativa [gold-of-pleasure]
ref|XP_007204652.1|  hypothetical protein PRUPE_ppa001528mg             181   1e-49   Prunus persica
ref|NP_175666.1|  phospholipase D alpha 2                               180   1e-49   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA53245.1|  TPA: phospholipase D family protein                    174   2e-49   
ref|XP_008242775.1|  PREDICTED: phospholipase D alpha 1-like            180   2e-49   Prunus mume [ume]
sp|O04883.1|PLDA1_PIMBR  RecName: Full=Phospholipase D alpha 1; S...    178   7e-49   Spuriopimpinella brachycarpa
ref|XP_009787005.1|  PREDICTED: phospholipase D alpha 1-like isof...    178   8e-49   Nicotiana sylvestris
ref|XP_010545768.1|  PREDICTED: phospholipase D alpha 1                 177   2e-48   Tarenaya hassleriana [spider flower]
tpg|DAA53246.1|  TPA: phospholipase D family protein                    176   4e-48   
ref|XP_006654096.1|  PREDICTED: phospholipase D alpha 1-like            176   4e-48   Oryza brachyantha
ref|XP_002440692.1|  hypothetical protein SORBIDRAFT_09g005220          175   6e-48   
ref|XP_009144830.1|  PREDICTED: phospholipase D alpha 2                 176   7e-48   Brassica rapa
emb|CDY60551.1|  BnaA05g35700D                                          176   7e-48   Brassica napus [oilseed rape]
ref|XP_002524502.1|  phopholipase d alpha, putative                     174   1e-47   
ref|NP_001054773.2|  Os05g0171000                                       174   1e-47   
emb|CBI28204.3|  unnamed protein product                                174   2e-47   Vitis vinifera
ref|XP_011070230.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    174   2e-47   Sesamum indicum [beniseed]
ref|XP_010656428.1|  PREDICTED: phospholipase D alpha 1-like            174   3e-47   Vitis vinifera
ref|XP_002325225.2|  hypothetical protein POPTR_0018s13110g             174   3e-47   Populus trichocarpa [western balsam poplar]
gb|AAU44332.1|  hypothetical protein                                    174   3e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008673447.1|  PREDICTED: phospholipase D alpha 1 isoform X2      174   4e-47   
gb|AFW76092.1|  phospholipase D family protein                          171   5e-47   
emb|CBI28205.3|  unnamed protein product                                172   5e-47   Vitis vinifera
ref|XP_011017763.1|  PREDICTED: phospholipase D alpha 1-like            173   9e-47   Populus euphratica
ref|XP_008650412.1|  PREDICTED: phospholipase D alpha 1-like            172   1e-46   
gb|KDP32412.1|  hypothetical protein JCGZ_13337                         172   1e-46   Jatropha curcas
ref|XP_002282187.3|  PREDICTED: phospholipase D alpha 1-like            172   2e-46   Vitis vinifera
ref|XP_003568837.1|  PREDICTED: phospholipase D alpha 1-like            172   2e-46   
ref|XP_008649399.1|  PREDICTED: phospholipase D alpha 1-like            172   2e-46   Zea mays [maize]
gb|EYU32345.1|  hypothetical protein MIMGU_mgv1a001383mg                172   2e-46   Erythranthe guttata [common monkey flower]
gb|AFW77332.1|  phospholipase D family protein                          172   3e-46   
ref|XP_004965943.1|  PREDICTED: phospholipase D alpha 2-like            171   6e-46   Setaria italica
ref|XP_006656220.1|  PREDICTED: phospholipase D alpha 2-like            170   8e-46   Oryza brachyantha
gb|KJB68102.1|  hypothetical protein B456_010G225600                    169   1e-45   Gossypium raimondii
gb|KCW70693.1|  hypothetical protein EUGRSUZ_F03862                     169   2e-45   Eucalyptus grandis [rose gum]
gb|EEC80931.1|  hypothetical protein OsI_23625                          168   3e-45   Oryza sativa Indica Group [Indian rice]
ref|NP_001058017.1|  Os06g0604400                                       168   4e-45   
ref|XP_008385550.1|  PREDICTED: phospholipase D alpha 1-like            165   6e-44   
ref|XP_006859166.1|  hypothetical protein AMTR_s00070p00140920          152   8e-44   
gb|KJB70612.1|  hypothetical protein B456_011G083000                    164   8e-44   Gossypium raimondii
emb|CAN76339.1|  hypothetical protein VITISV_014670                     164   9e-44   Vitis vinifera
dbj|BAA19466.1|  phospholipase D                                        164   1e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009787006.1|  PREDICTED: phospholipase D alpha 1-like isof...    163   2e-43   Nicotiana sylvestris
ref|XP_009364028.1|  PREDICTED: phospholipase D alpha 1-like            162   4e-43   Pyrus x bretschneideri [bai li]
gb|EMT24153.1|  Phospholipase D alpha 1                                 163   4e-43   
ref|XP_003563661.1|  PREDICTED: phospholipase D alpha 2-like            162   5e-43   Brachypodium distachyon [annual false brome]
dbj|BAJ93878.1|  predicted protein                                      160   2e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ85695.1|  predicted protein                                      160   2e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ94103.1|  predicted protein                                      160   2e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT32202.1|  Phospholipase D alpha 2                                 160   3e-42   
ref|XP_009368855.1|  PREDICTED: phospholipase D alpha 1-like            159   5e-42   Pyrus x bretschneideri [bai li]
ref|NP_001146242.1|  uncharacterized protein LOC100279815               159   6e-42   Zea mays [maize]
emb|CDP13512.1|  unnamed protein product                                159   8e-42   Coffea canephora [robusta coffee]
ref|XP_009407292.1|  PREDICTED: phospholipase D alpha 1-like            159   9e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002515518.1|  phopholipase d alpha, putative                     159   1e-41   Ricinus communis
ref|XP_004287315.1|  PREDICTED: phospholipase D alpha 1-like            157   3e-41   Fragaria vesca subsp. vesca
ref|XP_010090252.1|  Phospholipase D alpha 1                            157   3e-41   
emb|CDP13510.1|  unnamed protein product                                157   5e-41   Coffea canephora [robusta coffee]
ref|XP_002437251.1|  hypothetical protein SORBIDRAFT_10g023630          155   1e-40   Sorghum bicolor [broomcorn]
ref|XP_009614730.1|  PREDICTED: phospholipase D alpha 1 {ECO:0000...    154   4e-40   Nicotiana tomentosiformis
ref|XP_009758055.1|  PREDICTED: phospholipase D alpha 1-like            154   5e-40   Nicotiana sylvestris
ref|XP_004251821.1|  PREDICTED: phospholipase D alpha 1-like            154   6e-40   Solanum lycopersicum
ref|XP_006350007.1|  PREDICTED: phospholipase D alpha 1-like            154   7e-40   Solanum tuberosum [potatoes]
gb|KHN22449.1|  Phospholipase D alpha 1                                 147   7e-40   Glycine soja [wild soybean]
ref|XP_011459180.1|  PREDICTED: phospholipase D alpha 1-like            152   2e-39   Fragaria vesca subsp. vesca
gb|AAC49274.1|  phospholipase D                                         152   2e-39   Arabidopsis thaliana [mouse-ear cress]
gb|KHN07080.1|  Phospholipase D alpha 1                                 152   3e-39   Glycine soja [wild soybean]
ref|XP_011039694.1|  PREDICTED: phospholipase D alpha 1-like            151   7e-39   Populus euphratica
ref|XP_010648662.1|  PREDICTED: phospholipase D alpha 1-like            150   8e-39   Vitis vinifera
ref|XP_007013459.1|  Phospholipase D alpha 1                            150   1e-38   
gb|KDO48581.1|  hypothetical protein CISIN_1g004579mg                   147   3e-38   Citrus sinensis [apfelsine]
ref|XP_008219493.1|  PREDICTED: phospholipase D alpha 1-like            148   5e-38   Prunus mume [ume]
gb|KDO48580.1|  hypothetical protein CISIN_1g004579mg                   148   6e-38   Citrus sinensis [apfelsine]
ref|XP_010923204.1|  PREDICTED: phospholipase D alpha 1-like            148   7e-38   Elaeis guineensis
gb|EPS71739.1|  hypothetical protein M569_03019                         147   9e-38   Genlisea aurea
ref|XP_004984143.1|  PREDICTED: phospholipase D alpha 1-like isof...    148   1e-37   Setaria italica
dbj|BAK02630.1|  predicted protein                                      147   2e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008394091.1|  PREDICTED: phospholipase D alpha 1-like isof...    146   2e-37   
ref|XP_006581357.1|  PREDICTED: phospholipase D alpha 1-like            147   2e-37   Glycine max [soybeans]
ref|XP_004984141.1|  PREDICTED: phospholipase D alpha 1-like isof...    147   2e-37   Setaria italica
ref|XP_004984142.1|  PREDICTED: phospholipase D alpha 1-like isof...    147   3e-37   Setaria italica
ref|XP_004984144.1|  PREDICTED: phospholipase D alpha 1-like isof...    146   3e-37   Setaria italica
ref|XP_006656219.1|  PREDICTED: phospholipase D alpha 2-like            146   3e-37   Oryza brachyantha
ref|XP_008394090.1|  PREDICTED: phospholipase D alpha 1-like isof...    146   4e-37   
gb|EMS46811.1|  Phospholipase D alpha 2                                 144   6e-37   Triticum urartu
gb|EMT15739.1|  Phospholipase D alpha 2                                 144   1e-36   
ref|XP_010228542.1|  PREDICTED: phospholipase D alpha 1-like isof...    145   1e-36   Brachypodium distachyon [annual false brome]
ref|XP_004138856.1|  PREDICTED: phospholipase D alpha 2-like            144   2e-36   
ref|XP_007011867.1|  Phospholipase D alpha 1                            144   2e-36   
tpg|DAA45660.1|  TPA: phospholipase D family protein                    142   5e-36   
ref|XP_004160794.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    143   5e-36   
ref|XP_002974536.1|  hypothetical protein SELMODRAFT_267774             142   5e-36   Selaginella moellendorffii
ref|XP_007137028.1|  hypothetical protein PHAVU_009G093500g             143   6e-36   Phaseolus vulgaris [French bean]
ref|XP_008673230.1|  PREDICTED: phospholipase D family protein is...    143   6e-36   
emb|CAN81667.1|  hypothetical protein VITISV_017804                     141   6e-36   Vitis vinifera
ref|XP_002963233.1|  hypothetical protein SELMODRAFT_165923             142   6e-36   Selaginella moellendorffii
ref|XP_008673211.1|  PREDICTED: phospholipase D family protein is...    142   8e-36   Zea mays [maize]
gb|KDP33596.1|  hypothetical protein JCGZ_07167                         141   2e-35   Jatropha curcas
gb|EEE65981.1|  hypothetical protein OsJ_21905                          140   3e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010228543.1|  PREDICTED: phospholipase D alpha 1-like isof...    140   4e-35   
gb|KGN62948.1|  hypothetical protein Csa_2G381740                       140   6e-35   Cucumis sativus [cucumbers]
ref|NP_001058015.1|  Os06g0604200                                       139   8e-35   
gb|KJB07619.1|  hypothetical protein B456_001G0333002                   139   1e-34   Gossypium raimondii
ref|XP_008445210.1|  PREDICTED: phospholipase D alpha 1-like            138   2e-34   Cucumis melo [Oriental melon]
ref|XP_008777837.1|  PREDICTED: phospholipase D alpha 1-like            138   3e-34   Phoenix dactylifera
ref|XP_009355736.1|  PREDICTED: phospholipase D alpha 1-like            137   3e-34   
ref|XP_002964421.1|  hypothetical protein SELMODRAFT_82084              137   4e-34   Selaginella moellendorffii
emb|CBI21040.3|  unnamed protein product                                137   5e-34   Vitis vinifera
ref|XP_003603407.1|  Phospholipase D alpha                              137   5e-34   Medicago truncatula
gb|AAF78754.1|AF271356_1  phospholipase D                               137   5e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_004501331.1|  PREDICTED: phospholipase D alpha 1-like isof...    137   7e-34   Cicer arietinum [garbanzo]
ref|XP_004501328.1|  PREDICTED: phospholipase D alpha 1-like isof...    137   9e-34   Cicer arietinum [garbanzo]
gb|AAF78755.1|AF271357_1  phospholipase D                               136   9e-34   Oryza sativa Indica Group [Indian rice]
ref|NP_001058016.1|  Os06g0604300                                       136   1e-33   
ref|XP_010050012.1|  PREDICTED: phospholipase D alpha 1-like            136   1e-33   
ref|XP_004501330.1|  PREDICTED: phospholipase D alpha 1-like isof...    135   2e-33   Cicer arietinum [garbanzo]
gb|KCW82853.1|  hypothetical protein EUGRSUZ_C04222                     135   2e-33   Eucalyptus grandis [rose gum]
ref|XP_006657112.1|  PREDICTED: phospholipase D alpha 2-like            134   4e-33   
ref|XP_002308663.2|  hypothetical protein POPTR_0006s27000g             134   4e-33   
ref|XP_003603403.1|  Phospholipase D alpha                              134   7e-33   Medicago truncatula
tpg|DAA45665.1|  TPA: phospholipase D family protein                    134   7e-33   
ref|XP_004979743.1|  PREDICTED: phospholipase D alpha 2-like            134   9e-33   Setaria italica
ref|XP_007225238.1|  hypothetical protein PRUPE_ppa001818mg             133   9e-33   
ref|XP_002967619.1|  hypothetical protein SELMODRAFT_231070             133   1e-32   Selaginella moellendorffii
ref|XP_009151064.1|  PREDICTED: phospholipase D zeta                    132   2e-32   
ref|NP_001146559.1|  phospholipase D family protein                     132   2e-32   
ref|XP_006650158.1|  PREDICTED: phospholipase D alpha 1-like            132   4e-32   
gb|ACL53520.1|  unknown                                                 132   4e-32   
ref|XP_006287080.1|  hypothetical protein CARUB_v10000238mg             132   4e-32   
ref|XP_008660012.1|  PREDICTED: phospholipase D alpha 1-like            132   5e-32   
ref|XP_006394788.1|  hypothetical protein EUTSA_v10003659mg             130   1e-31   
ref|NP_197919.1|  phospholipase D alpha 3                               130   2e-31   
gb|AAR87276.1|  putative phospholipase D                                129   3e-31   
ref|XP_010493792.1|  PREDICTED: phospholipase D zeta                    129   4e-31   
ref|XP_006394787.1|  hypothetical protein EUTSA_v10003665mg             129   5e-31   
ref|XP_010454864.1|  PREDICTED: phospholipase D zeta-like               129   5e-31   
ref|XP_006657113.1|  PREDICTED: phospholipase D alpha 2-like            128   7e-31   
ref|XP_009129965.1|  PREDICTED: phospholipase D zeta-like               128   8e-31   
ref|XP_010424312.1|  PREDICTED: phospholipase D zeta-like               128   8e-31   
ref|XP_007137027.1|  hypothetical protein PHAVU_009G093400g             128   9e-31   
emb|CDY05351.1|  BnaC02g40590D                                          128   1e-30   
emb|CDY05490.1|  BnaA02g32010D                                          128   1e-30   
ref|XP_002874254.1|  predicted protein                                  127   1e-30   
ref|XP_010048204.1|  PREDICTED: phospholipase D alpha 1-like            127   2e-30   
ref|XP_006581358.1|  PREDICTED: phospholipase D alpha 1-like            127   2e-30   
ref|XP_010541603.1|  PREDICTED: phospholipase D zeta                    126   5e-30   
gb|EAY90307.1|  hypothetical protein OsI_11882                          124   3e-29   
gb|EEE59186.1|  hypothetical protein OsJ_11122                          124   4e-29   
ref|XP_002451299.1|  hypothetical protein SORBIDRAFT_05g027210          122   1e-28   
ref|XP_009401714.1|  PREDICTED: phospholipase D alpha 1-like isof...    121   2e-28   
ref|XP_010101275.1|  Phospholipase D alpha 1                            121   3e-28   
ref|XP_009401723.1|  PREDICTED: phospholipase D alpha 1-like isof...    120   6e-28   
gb|KDO61728.1|  hypothetical protein CISIN_1g003523mg                   120   7e-28   
ref|XP_002972515.1|  hypothetical protein SELMODRAFT_441825             120   7e-28   
ref|XP_006450437.1|  hypothetical protein CICLE_v10010712mg             120   7e-28   
ref|XP_002992572.1|  hypothetical protein SELMODRAFT_186850             120   7e-28   
gb|EYU23014.1|  hypothetical protein MIMGU_mgv1a0192722mg               115   4e-27   
gb|KJB55001.1|  hypothetical protein B456_009G057800                    117   6e-27   
ref|XP_006483709.1|  PREDICTED: phospholipase D alpha 1-like            117   8e-27   
emb|CDX80505.1|  BnaC07g29390D                                          116   9e-27   
ref|XP_010942074.1|  PREDICTED: phospholipase D alpha 1-like            116   1e-26   
ref|XP_001753756.1|  predicted protein                                  115   2e-26   
ref|XP_010696306.1|  PREDICTED: phospholipase D alpha 1-like            115   2e-26   
ref|XP_008810306.1|  PREDICTED: phospholipase D alpha 1-like            115   3e-26   
ref|XP_007011868.1|  Phospholipase D alpha 2 isoform 1                  114   5e-26   
ref|XP_007011869.1|  Phospholipase D alpha 2 isoform 2                  110   1e-24   
ref|XP_010325101.1|  PREDICTED: phospholipase D alpha 1-like isof...    110   1e-24   
ref|XP_001762942.1|  predicted protein                                  108   6e-24   
ref|XP_001767482.1|  predicted protein                                  107   2e-23   
ref|XP_001753255.1|  predicted protein                                  106   3e-23   
gb|KHN08131.1|  Phospholipase D alpha 1                               98.2    3e-22   
gb|ACN85289.1|  unknown                                                 102   3e-22   
emb|CDX88175.1|  BnaA06g27660D                                          102   1e-21   
gb|ACI96319.1|  putative phospholipase D alpha 1 precursor            99.4    5e-21   
gb|ACI96318.1|  putative phospholipase D alpha 1 precursor            99.0    8e-21   
gb|ACI96316.1|  putative phospholipase D alpha 1 precursor            99.0    9e-21   
gb|ACI96317.1|  putative phospholipase D alpha 1 precursor            98.6    1e-20   
gb|EEC83543.1|  hypothetical protein OsI_29158                        99.0    1e-20   
dbj|BAC98682.1|  putative phospholipase D alpha 1                     99.0    2e-20   
ref|NP_001061758.2|  Os08g0401800                                     99.0    2e-20   
ref|XP_003576533.1|  PREDICTED: phospholipase D alpha 1-like          98.2    3e-20   
gb|EEE68649.1|  hypothetical protein OsJ_27225                        97.8    4e-20   
gb|EMS68436.1|  Phospholipase D alpha 2                               97.8    4e-20   
gb|EMT22155.1|  Phospholipase D alpha 2                               92.4    2e-18   
gb|AFK37230.1|  unknown                                               86.7    4e-18   
gb|EAZ44767.1|  hypothetical protein OsJ_29399                        91.7    5e-18   
ref|NP_001234108.1|  phospholipase PLDb2                              91.7    5e-18   
ref|XP_004956847.1|  PREDICTED: phospholipase D alpha 1-like          91.3    8e-18   
ref|XP_010323957.1|  PREDICTED: phospholipase PLDb2 isoform X1        90.9    1e-17   
ref|XP_009381793.1|  PREDICTED: phospholipase D alpha 1-like          90.5    1e-17   
ref|XP_007137026.1|  hypothetical protein PHAVU_009G093400g           90.1    2e-17   
ref|XP_006339497.1|  PREDICTED: phospholipase D beta 1-like           89.7    3e-17   
ref|XP_002462392.1|  hypothetical protein SORBIDRAFT_02g024910        89.4    4e-17   
ref|NP_001063203.1|  Os09g0421300                                     88.6    6e-17   
gb|EAZ09131.1|  hypothetical protein OsI_31401                        87.8    1e-16   
dbj|BAE79734.1|  phospholipase D alpha 1                              87.4    2e-16   
gb|AAP50498.1|  phospholipase D                                       87.0    2e-16   
gb|EYU36813.1|  hypothetical protein MIMGU_mgv1a001300mg              86.7    3e-16   
ref|XP_002320087.2|  hypothetical protein POPTR_0014s07070g           86.7    3e-16   
gb|EMS68435.1|  Phospholipase D alpha 2                               86.7    3e-16   
ref|XP_010666738.1|  PREDICTED: phospholipase D delta-like            86.3    3e-16   
ref|XP_011463800.1|  PREDICTED: uncharacterized protein LOC101313411  86.7    4e-16   
gb|EMT19808.1|  Phospholipase D alpha 2                               85.9    5e-16   
gb|KEH18997.1|  phospholipase D alpha 1                               85.5    7e-16   
gb|KEH18998.1|  phospholipase D alpha 1                               85.5    7e-16   
ref|XP_011074721.1|  PREDICTED: phospholipase D delta-like            85.1    8e-16   
gb|ABR17779.1|  unknown                                               85.1    1e-15   
gb|EMT21985.1|  Phospholipase D beta 1                                84.3    1e-15   
gb|KDP43704.1|  hypothetical protein JCGZ_22331                       84.0    2e-15   
ref|XP_006590738.1|  PREDICTED: phospholipase D delta-like            84.0    2e-15   
ref|XP_006341798.1|  PREDICTED: phospholipase D beta 1-like           84.0    2e-15   
gb|EMS46791.1|  Phospholipase D beta 1                                83.6    3e-15   
ref|XP_008445312.1|  PREDICTED: phospholipase D delta-like            83.6    3e-15   
ref|XP_006396843.1|  hypothetical protein EUTSA_v10028422mg           83.6    3e-15   
gb|EMS45543.1|  Phospholipase D beta 1                                83.2    4e-15   
ref|XP_004248573.2|  PREDICTED: phospholipase D gamma 1-like          83.2    5e-15   
ref|XP_004143075.1|  PREDICTED: phospholipase D delta-like            82.8    5e-15   
gb|KGN62275.1|  hypothetical protein Csa_2G347140                     82.8    5e-15   
ref|XP_008670197.1|  PREDICTED: phospholipase D alpha 1-like isof...  82.8    5e-15   
gb|EPS73398.1|  hypothetical protein M569_01343                       82.8    5e-15   
ref|XP_009762579.1|  PREDICTED: phospholipase D beta 1-like           82.4    7e-15   
emb|CDP08909.1|  unnamed protein product                              82.8    7e-15   
ref|XP_009604374.1|  PREDICTED: phospholipase D beta 1-like           82.4    8e-15   
gb|KDO43384.1|  hypothetical protein CISIN_1g0011262mg                80.9    9e-15   
ref|XP_001755745.1|  predicted protein                                81.6    1e-14   
emb|CDY13284.1|  BnaC09g23720D                                        80.5    1e-14   
gb|KFK31940.1|  hypothetical protein AALP_AA6G179600                  81.3    2e-14   
ref|XP_002301317.2|  PHOSPHOLIPASE D BETA 1 family protein            81.6    2e-14   
ref|XP_009410696.1|  PREDICTED: phospholipase D delta-like            81.3    2e-14   
ref|XP_002510602.1|  phospholipase d delta, putative                  81.3    2e-14   
ref|XP_003611170.1|  Phospholipase D                                  80.9    2e-14   
ref|XP_011023457.1|  PREDICTED: phospholipase D beta 2-like isofo...  81.3    2e-14   
dbj|BAK05371.1|  predicted protein                                    80.9    2e-14   
ref|XP_011023456.1|  PREDICTED: phospholipase D beta 2-like isofo...  81.3    2e-14   
ref|XP_006341816.1|  PREDICTED: phospholipase D delta-like isofor...  80.9    3e-14   
ref|XP_006341817.1|  PREDICTED: phospholipase D delta-like isofor...  80.9    3e-14   
ref|XP_010540447.1|  PREDICTED: phospholipase D gamma 1-like          80.5    3e-14   
ref|XP_004298731.1|  PREDICTED: phospholipase D beta 1-like           80.5    3e-14   
ref|XP_006287264.1|  hypothetical protein CARUB_v10000454mg           80.1    4e-14   
ref|XP_006573536.1|  PREDICTED: phospholipase D delta-like isofor...  79.7    5e-14   
gb|ACB98704.1|  phospholipase D gamma 1                               79.7    5e-14   
ref|NP_192921.1|  phospholipase D gamma 3                             79.7    5e-14   
emb|CDP07340.1|  unnamed protein product                              78.2    5e-14   
ref|XP_010113283.1|  Phospholipase D delta                            79.7    6e-14   
ref|XP_009766427.1|  PREDICTED: phospholipase D beta 1-like           79.7    6e-14   
ref|XP_003516537.1|  PREDICTED: phospholipase D delta-like isofor...  79.7    7e-14   
ref|XP_010272594.1|  PREDICTED: phospholipase D beta 1-like           79.7    7e-14   
ref|XP_002509685.1|  phospholipase d beta, putative                   79.7    7e-14   
emb|CDX86742.1|  BnaA09g21320D                                        79.7    7e-14   
ref|XP_009102711.1|  PREDICTED: phospholipase D gamma 1               79.7    7e-14   
ref|NP_192922.1|  phospholipase D gamma 1                             79.3    8e-14   
ref|XP_011083418.1|  PREDICTED: phospholipase D delta-like isofor...  79.3    9e-14   
ref|XP_011083417.1|  PREDICTED: phospholipase D delta-like isofor...  79.3    9e-14   
ref|XP_010422137.1|  PREDICTED: phospholipase D gamma 1-like          79.3    9e-14   
ref|XP_010434095.1|  PREDICTED: phospholipase D gamma 1               79.3    9e-14   
ref|XP_010455598.1|  PREDICTED: phospholipase D gamma 1-like          79.3    1e-13   
gb|EAZ03622.1|  hypothetical protein OsI_25760                        73.2    1e-13   
gb|EYU17554.1|  hypothetical protein MIMGU_mgv1a025612mg              79.0    1e-13   
ref|XP_009593225.1|  PREDICTED: phospholipase D beta 1-like           79.0    1e-13   
ref|XP_010234931.1|  PREDICTED: phospholipase D beta 1-like           78.6    1e-13   
ref|XP_010068155.1|  PREDICTED: phospholipase D delta-like            77.4    1e-13   
gb|EMT00669.1|  Phospholipase D beta 1                                78.6    1e-13   
ref|XP_011035015.1|  PREDICTED: phospholipase D beta 2-like           79.0    1e-13   
ref|XP_009796632.1|  PREDICTED: phospholipase D delta-like            78.6    2e-13   
gb|KJB48276.1|  hypothetical protein B456_008G061600                  78.6    2e-13   
gb|AAN34820.1|  phospholipase D delta isoform                         78.2    2e-13   
gb|AAN05432.1|  phospholipase D delta isoform 1b                      78.2    2e-13   
tpg|DAA39787.1|  TPA: phospholipase D family protein                  75.9    2e-13   
ref|XP_011463799.1|  PREDICTED: phospholipase D gamma 1-like          78.2    2e-13   
gb|KJB14350.1|  hypothetical protein B456_002G120800                  77.8    2e-13   
ref|XP_003611169.1|  Phospholipase D                                  77.8    2e-13   
gb|KJB14349.1|  hypothetical protein B456_002G120800                  77.8    2e-13   
gb|AES94127.2|  phospholipase D alpha 1                               77.8    3e-13   
ref|XP_004248600.1|  PREDICTED: phospholipase D delta-like            77.8    3e-13   
gb|KCW72878.1|  hypothetical protein EUGRSUZ_E01326                   77.8    3e-13   
ref|XP_002299568.2|  hypothetical protein POPTR_0001s08560g           77.4    3e-13   
gb|EMT16220.1|  Phospholipase D beta 1                                77.8    3e-13   
gb|KDP36869.1|  hypothetical protein JCGZ_08160                       77.8    3e-13   
ref|XP_006435265.1|  hypothetical protein CICLE_v10000269mg           77.4    3e-13   
gb|KDO43378.1|  hypothetical protein CISIN_1g0011262mg                77.4    3e-13   
ref|XP_010266912.1|  PREDICTED: phospholipase D delta                 77.4    3e-13   
ref|XP_002874727.1|  PLDGAMMA1                                        77.4    4e-13   
ref|XP_006441123.1|  hypothetical protein CICLE_v10018583mg           77.4    4e-13   
gb|AAB87672.1|  phospholipase D-gamma                                 77.0    4e-13   
ref|XP_009600603.1|  PREDICTED: phospholipase D delta-like            77.0    5e-13   
ref|XP_010058437.1|  PREDICTED: phospholipase D gamma 1               77.4    5e-13   
ref|XP_007134946.1|  hypothetical protein PHAVU_010G088900g           77.0    5e-13   
gb|KJB25734.1|  hypothetical protein B456_004G206700                  77.0    5e-13   
ref|XP_004292929.1|  PREDICTED: phospholipase D delta-like            77.0    6e-13   
ref|XP_011029151.1|  PREDICTED: phospholipase D beta 1-like           77.0    6e-13   
ref|XP_006491998.1|  PREDICTED: phospholipase D beta 1-like isofo...  77.0    6e-13   
gb|AER41636.1|  phospholipase+D                                       76.6    6e-13   
ref|XP_006858490.1|  hypothetical protein AMTR_s00071p00126030        76.6    6e-13   
gb|KJB25733.1|  hypothetical protein B456_004G206700                  76.6    6e-13   
gb|KJB25732.1|  hypothetical protein B456_004G206700                  76.6    6e-13   
ref|XP_010272593.1|  PREDICTED: phospholipase D beta 1-like isofo...  76.6    6e-13   
ref|XP_010526824.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...  76.6    6e-13   
gb|AER41602.1|  phospholipase+D                                       76.6    7e-13   
ref|XP_010272589.1|  PREDICTED: phospholipase D beta 1-like isofo...  76.6    7e-13   
gb|EEC81825.1|  hypothetical protein OsI_25571                        76.6    7e-13   
ref|NP_001059324.1|  Os07g0260400                                     76.6    7e-13   
ref|XP_002874728.1|  PLDGAMMA1                                        76.3    8e-13   
gb|AER41632.1|  phospholipase+D                                       76.3    8e-13   
ref|XP_004510892.1|  PREDICTED: phospholipase D beta 1-like           76.6    8e-13   
ref|XP_010272591.1|  PREDICTED: phospholipase D beta 1-like isofo...  76.3    8e-13   
ref|XP_010255577.1|  PREDICTED: phospholipase D beta 2-like isofo...  76.6    8e-13   
ref|XP_010255578.1|  PREDICTED: phospholipase D beta 2-like isofo...  76.6    8e-13   
ref|XP_007051966.1|  Phospholipase D beta 1 isoform 2                 76.3    8e-13   
ref|XP_006285074.1|  hypothetical protein CARUB_v10006387mg           76.3    9e-13   
ref|XP_007051965.1|  Phospholipase D beta 1 isoform 1                 76.3    1e-12   
gb|KEH36266.1|  phospholipase D alpha 1                               75.9    1e-12   
gb|AEF58504.1|  phospholipase D delta                                 75.9    1e-12   
ref|XP_003603842.1|  Phospholipase D delta                            75.9    1e-12   
ref|XP_009772650.1|  PREDICTED: phospholipase D beta 2-like           76.3    1e-12   
ref|XP_010446878.1|  PREDICTED: phospholipase D delta                 75.9    1e-12   
ref|XP_007046580.1|  Phospholipase D delta isoform 2                  75.9    1e-12   
ref|XP_008670092.1|  PREDICTED: phospholipase D delta-like isofor...  75.9    1e-12   
gb|AER41647.1|  phospholipase+D                                       75.9    1e-12   
ref|XP_008670198.1|  PREDICTED: phospholipase D alpha 1-like isof...  75.9    1e-12   
ref|XP_010108055.1|  Phospholipase D beta 1                           75.9    1e-12   
ref|XP_008670089.1|  PREDICTED: phospholipase D delta-like isofor...  75.9    1e-12   
gb|AEW07932.1|  hypothetical protein 0_14784_01                       71.2    1e-12   
ref|XP_002301946.1|  hypothetical protein POPTR_0002s01750g           75.5    1e-12   
ref|XP_004956880.1|  PREDICTED: phospholipase D delta-like isofor...  75.5    1e-12   
ref|XP_004500904.1|  PREDICTED: phospholipase D delta-like isofor...  75.5    2e-12   
ref|XP_010053353.1|  PREDICTED: phospholipase D beta 1-like           75.5    2e-12   
ref|XP_001773645.1|  predicted protein                                75.5    2e-12   
ref|XP_010646652.1|  PREDICTED: phospholipase D delta-like            73.2    2e-12   
ref|XP_004500903.1|  PREDICTED: phospholipase D delta-like isofor...  75.5    2e-12   
gb|KCW77623.1|  hypothetical protein EUGRSUZ_D01933                   75.5    2e-12   
ref|XP_002306960.2|  hypothetical protein POPTR_0005s26730g           75.1    2e-12   
ref|XP_006581145.1|  PREDICTED: phospholipase D delta-like            75.5    2e-12   
ref|XP_003612259.1|  Phospholipase D delta isoform                    75.5    2e-12   
ref|XP_011003096.1|  PREDICTED: phospholipase D delta-like            75.1    2e-12   
gb|KHG08188.1|  Phospholipase D beta 1 -like protein                  75.1    2e-12   
ref|XP_008221197.1|  PREDICTED: phospholipase D delta-like            75.1    2e-12   
gb|AES95217.2|  phospholipase D alpha 1                               75.1    2e-12   
ref|XP_010529524.1|  PREDICTED: phospholipase D gamma 1               75.1    2e-12   
ref|XP_002270350.2|  PREDICTED: phospholipase D delta-like            75.1    2e-12   
ref|XP_007157859.1|  hypothetical protein PHAVU_002G104200g           75.1    2e-12   
ref|XP_010244833.1|  PREDICTED: phospholipase D delta-like isofor...  75.1    2e-12   
ref|XP_010325304.1|  PREDICTED: phospholipase PLDb1 isoform X2        75.1    2e-12   
ref|XP_010244830.1|  PREDICTED: phospholipase D delta-like isofor...  75.1    2e-12   
ref|XP_010325303.1|  PREDICTED: phospholipase PLDb1 isoform X1        75.1    2e-12   
gb|AER41566.1|  phospholipase+D                                       74.7    2e-12   



>emb|CDP10414.1| unnamed protein product [Coffea canephora]
Length=807

 Score =   252 bits (643),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LH  +YE+DK+K     NL HKIVEG ERVVGFN TASRLYAT+DLEKARV
Sbjct  1    MAQILLHGTLHATIYEIDKLKGGFGQNLLHKIVEGIERVVGFNNTASRLYATVDLEKARV  60

Query  217  GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  396
            GRTRLL+   NPRWYESFHIYCAHMASNV+F+VKVDNPIGAELIGRAY+P + LLG EE+
Sbjct  61   GRTRLLEGDSNPRWYESFHIYCAHMASNVIFTVKVDNPIGAELIGRAYLPVQELLGEEEI  120

Query  397  DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            D WLP+L +D  PIH HSKIHVK+Q+ DV RER W R
Sbjct  121  DRWLPILGDDHKPIHGHSKIHVKVQYFDVTRERNWSR  157



>ref|XP_009613360.1| PREDICTED: phospholipase D alpha 1-like [Nicotiana tomentosiformis]
Length=807

 Score =   250 bits (638),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LH  ++EVDKI T+    LF+K+V G E  +GFNKTASRLYATIDL+KARV
Sbjct  1    MAQILLHGTLHATIFEVDKIHTNFGKELFNKVVHGIEGAIGFNKTASRLYATIDLQKARV  60

Query  217  GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  396
            GRTRLLDEHKNPRWYESFHIYCAHMA++V+F+VKVDNPIGAELIGRAY+P + LL GEEV
Sbjct  61   GRTRLLDEHKNPRWYESFHIYCAHMAADVIFTVKVDNPIGAELIGRAYLPVQELLDGEEV  120

Query  397  DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            D+WL +LD +R P+H HSKIHVKLQF DV RE  W R
Sbjct  121  DKWLEILDTERKPVHGHSKIHVKLQFFDVTREYNWNR  157



>ref|XP_009760786.1| PREDICTED: phospholipase D alpha 1-like [Nicotiana sylvestris]
Length=807

 Score =   247 bits (631),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LH  ++EVDKI T+    LF+K+V G E  +GF+KTASRLYATIDL+KARV
Sbjct  1    MAQILLHGTLHATIFEVDKIHTNFGKELFNKVVHGIEGAIGFSKTASRLYATIDLQKARV  60

Query  217  GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  396
            GRTRLL+EHKNPRWYESFHIYCAHMA++V+F+VK+DNPIGAELIGRAY+P R LL GEEV
Sbjct  61   GRTRLLNEHKNPRWYESFHIYCAHMAADVIFTVKIDNPIGAELIGRAYLPVRELLDGEEV  120

Query  397  DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            D+WL +LD +R P+H HSKIHVKLQF DV RE  W R
Sbjct  121  DKWLEILDTERKPVHGHSKIHVKLQFFDVTREYNWNR  157



>ref|XP_006367508.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Solanum tuberosum]
 ref|XP_006367509.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Solanum tuberosum]
Length=807

 Score =   244 bits (623),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LHV ++EVDK++T+   ++F+K+V+G E  +GFNKTAS LYATIDL KARV
Sbjct  1    MAQILLHGTLHVTIFEVDKLRTNFGRDIFNKVVQGIEGAIGFNKTASTLYATIDLGKARV  60

Query  217  GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  396
            GRTRLLDEHKNPRWYESFHIYCAHMAS+V+F+VK DNPIGAELIGRAY+P  RL+ GE V
Sbjct  61   GRTRLLDEHKNPRWYESFHIYCAHMASDVIFTVKADNPIGAELIGRAYLPVERLIDGEVV  120

Query  397  DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            DEWL +LD +R P+  HSKIHVKLQ+ DV RE  W R
Sbjct  121  DEWLEILDTERKPVQGHSKIHVKLQYFDVTREYNWNR  157



>ref|NP_001289824.1| uncharacterized protein LOC101257989 [Solanum lycopersicum]
 gb|AAG48162.1|AF154425_1 phospholipase D [Solanum lycopersicum]
Length=807

 Score =   244 bits (623),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LHV ++EVDK++T+    +F+K+V+G E  +GFNKTAS LYATIDL KARV
Sbjct  1    MAQILLHGTLHVTIFEVDKLRTNFGREIFNKVVQGIEGAIGFNKTASTLYATIDLGKARV  60

Query  217  GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  396
            GRTRLLDEHKNPRWYESFHIYCAHMAS+VVF+VK DNPIGAELIGRAY+P  +L+ GE V
Sbjct  61   GRTRLLDEHKNPRWYESFHIYCAHMASDVVFTVKADNPIGAELIGRAYLPVEQLIVGEVV  120

Query  397  DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            DEWL +LD +R P+H HSKIHVKLQ+ DV RE  W R
Sbjct  121  DEWLEILDTERKPVHGHSKIHVKLQYFDVTREYNWNR  157



>ref|XP_010325100.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Solanum lycopersicum]
Length=807

 Score =   244 bits (623),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LHV ++EVDK++T+    +F+K+V+G E  +GFNKTAS LYATIDL KARV
Sbjct  1    MAQILLHGTLHVTIFEVDKLRTNFGREIFNKVVQGIEGAIGFNKTASTLYATIDLGKARV  60

Query  217  GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  396
            GRTRLLDEHKNPRWYESFHIYCAHMAS+VVF+VK DNPIGAELIGRAY+P  +L+ GE V
Sbjct  61   GRTRLLDEHKNPRWYESFHIYCAHMASDVVFTVKADNPIGAELIGRAYLPVEQLIVGEVV  120

Query  397  DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            DEWL +LD +R P+H HSKIHVKLQ+ DV RE  W R
Sbjct  121  DEWLEILDTERKPVHGHSKIHVKLQYFDVTREYNWNR  157



>ref|XP_011078373.1| PREDICTED: phospholipase D alpha 1-like [Sesamum indicum]
Length=808

 Score =   244 bits (622),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 128/158 (81%), Gaps = 1/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG LH  +YE+DK+ T  L   FHK+VEG E V+GF  TAS+LYATIDL KARV
Sbjct  1    MAQILLHGDLHATIYEIDKLHTGTLTKFFHKVVEGIEEVLGFGDTASKLYATIDLGKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTRLL  +H NPRWYESFHIYCAHMAS VVF+VKVDNPIGAELIGRAY+P   LL GEE
Sbjct  61   GRTRLLAHQHSNPRWYESFHIYCAHMASQVVFTVKVDNPIGAELIGRAYLPVEELLAGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            VD WL +L++D  PIH HSKIHVKLQF DV RERCW R
Sbjct  121  VDRWLEILNDDHKPIHGHSKIHVKLQFYDVTRERCWAR  158



>ref|XP_006367510.1| PREDICTED: phospholipase D alpha 1-like [Solanum tuberosum]
Length=807

 Score =   238 bits (606),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ LLHG+LHV ++EVD++ T+   + F+K+V+G E  +GFNK ASRLYATIDL KARV
Sbjct  1    MAQFLLHGTLHVTIFEVDRLHTNFGRDFFNKVVQGIEGAIGFNKAASRLYATIDLGKARV  60

Query  217  GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  396
            GRTRLLD+HKNPRWYESFHIYCAHMA+NV+ +VK DNPIGAE+IGRAY P ++LL GEEV
Sbjct  61   GRTRLLDDHKNPRWYESFHIYCAHMAANVIITVKFDNPIGAEVIGRAYFPVQQLLDGEEV  120

Query  397  DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            DEWL +L+ ++ P+H HSKIHVKLQ+ DV RE  W R
Sbjct  121  DEWLEILNTEQKPVHGHSKIHVKLQYFDVTREYNWNR  157



>ref|NP_001234863.1| phospholipase PLDa2 [Solanum lycopersicum]
 gb|AAG45486.1| phospholipase PLDa2 [Solanum lycopersicum]
Length=806

 Score =   237 bits (605),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ LLHG+LHV ++EVD++ T+   + F+K+V+G E  +GFNK ASRLYATIDL KARV
Sbjct  1    MAQFLLHGTLHVTIFEVDRLHTNFGRDFFNKVVQGIEGAIGFNKAASRLYATIDLGKARV  60

Query  217  GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  396
            GRTRLLD+HKNPRWYESFHIYCAHMA+NV+ +VK DNPIGAE+IGRAY P ++LL GEEV
Sbjct  61   GRTRLLDDHKNPRWYESFHIYCAHMAANVIITVKFDNPIGAEVIGRAYFPVQQLLDGEEV  120

Query  397  DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            DEWL +L+ +R P+H HSKIHVKLQ+ DV R+  W R
Sbjct  121  DEWLEILNTERKPLHGHSKIHVKLQYFDVTRDYNWNR  157



>gb|EYU23016.1| hypothetical protein MIMGU_mgv1a001487mg [Erythranthe guttata]
Length=810

 Score =   228 bits (581),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 123/158 (78%), Gaps = 1/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MA +LLHG LH  +YE+DK+       LFHK+VEG E V+GF +TAS+LYATIDL +ARV
Sbjct  1    MAHILLHGDLHATIYEIDKLHIGAASKLFHKVVEGVEEVLGFKETASKLYATIDLGQARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTRLL  EH NPRWYESFHIYCAH AS V+F++KVDNPIGAELIGRA++P   L+ G+E
Sbjct  61   GRTRLLKHEHTNPRWYESFHIYCAHTASQVIFTIKVDNPIGAELIGRAHIPVSDLMSGDE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            +D WLP+L  +  P+H H KIHVKL F DV RERCW R
Sbjct  121  IDTWLPILHTNNKPVHGHPKIHVKLHFFDVARERCWSR  158



>dbj|BAE79735.1| phospholipase D alpha 2 [Arachis hypogaea]
 dbj|BAE79737.1| phospholipase D alpha 2 [Arachis hypogaea]
Length=807

 Score =   226 bits (577),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 130/158 (82%), Gaps = 2/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LHV +YEVDK+KT G  N+F K+V+  E  VGF K  ++LYATIDLEKARV
Sbjct  1    MAQILLHGTLHVTIYEVDKLKTSG-GNVFTKLVQNIEETVGFGKGVTKLYATIDLEKARV  59

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ +H NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P   +L GEE
Sbjct  60   GRTRIIEKDHSNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVEDVLDGEE  119

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            VD W+ +LD D+NPIH +SKIHVKLQ+ DV +++ W R
Sbjct  120  VDRWVEILDEDKNPIHGNSKIHVKLQYFDVTKDKNWAR  157



>ref|XP_002517625.1| phopholipase d alpha, putative [Ricinus communis]
 gb|EEF44789.1| phopholipase d alpha, putative [Ricinus communis]
Length=808

 Score =   223 bits (567),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 126/158 (80%), Gaps = 1/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+ LHG+LHV +YEVDK+ + G  + F K+VE  E  VGF K  S+LYATIDLEKARV
Sbjct  1    MAQISLHGTLHVTIYEVDKLHSGGGPHFFRKLVENIEETVGFGKGVSKLYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+L+ E  NPRWYESFH+YCAH ASNV+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61   GRTRILENEQSNPRWYESFHVYCAHQASNVIFTVKDDNPIGATLIGRAYVPVEELLDGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            +D W+ +LD D+NP+HS SKIHVKLQ+ +V ++R WG+
Sbjct  121  IDRWVEILDEDKNPVHSGSKIHVKLQYFEVTKDRNWGQ  158



>gb|AAB37305.1| phospholipase D [Ricinus communis]
Length=808

 Score =   223 bits (567),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 126/158 (80%), Gaps = 1/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+ LHG+LHV +YEVDK+ + G  + F K+VE  E  VGF K  S+LYATIDLEKARV
Sbjct  1    MAQISLHGTLHVTIYEVDKLHSGGGPHFFRKLVENIEETVGFGKGVSKLYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+L+ E  NPRWYESFH+YCAH ASNV+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61   GRTRILENEQSNPRWYESFHVYCAHQASNVIFTVKDDNPIGATLIGRAYVPVEELLDGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            +D W+ +LD D+NP+HS SKIHVKLQ+ +V ++R WG+
Sbjct  121  IDRWVEILDEDKNPVHSGSKIHVKLQYFEVTKDRNWGQ  158



>sp|Q41142.1|PLDA1_RICCO RecName: Full=Phospholipase D alpha 1; Short=PLD 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1; Flags: Precursor [Ricinus communis]
 gb|AAB04095.1| phospholipase D [Ricinus communis]
Length=808

 Score =   223 bits (567),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 126/158 (80%), Gaps = 1/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+ LHG+LHV +YEVDK+ + G  + F K+VE  E  VGF K  S+LYATIDLEKARV
Sbjct  1    MAQISLHGTLHVTIYEVDKLHSGGGPHFFRKLVENIEETVGFGKGVSKLYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+L+ E  NPRWYESFH+YCAH ASNV+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61   GRTRILENEQSNPRWYESFHVYCAHQASNVIFTVKDDNPIGATLIGRAYVPVEELLDGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            +D W+ +LD D+NP+HS SKIHVKLQ+ +V ++R WG+
Sbjct  121  IDRWVEILDEDKNPVHSGSKIHVKLQYFEVTKDRNWGQ  158



>ref|XP_010097235.1| Phospholipase D alpha 1 [Morus notabilis]
 gb|EXB67302.1| Phospholipase D alpha 1 [Morus notabilis]
Length=808

 Score =   220 bits (560),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 124/157 (79%), Gaps = 1/157 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MA +LLHGSLH  +YEVDK++  G  N F K+V+  +  VG     ++LYATIDLEKARV
Sbjct  1    MAHILLHGSLHATIYEVDKLRGKGGGNFFSKLVDNIQETVGLGDGVTKLYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ EH NPRW+ESFHIYCAH+ASNVVF+VK DNPIGA LIGRAY+P   +L GEE
Sbjct  61   GRTRIIEKEHSNPRWFESFHIYCAHLASNVVFTVKDDNPIGATLIGRAYVPVADILDGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWG  504
            VD W+ +LD D+NPIH +SKIHVKLQF DV ++R WG
Sbjct  121  VDRWVEILDEDKNPIHGNSKIHVKLQFFDVTKDRNWG  157



>ref|XP_007150746.1| hypothetical protein PHAVU_005G177300g [Phaseolus vulgaris]
 gb|ESW22740.1| hypothetical protein PHAVU_005G177300g [Phaseolus vulgaris]
Length=807

 Score =   218 bits (556),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 124/157 (79%), Gaps = 2/157 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LH  +YEVDK+K  G  N   KIV   E  VGF K  ++LYATIDLEKARV
Sbjct  1    MAQILLHGTLHATIYEVDKLKIGG-GNFLSKIVHNIEETVGFGKGVTKLYATIDLEKARV  59

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ EH NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P   +L GEE
Sbjct  60   GRTRIIEKEHSNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVEEILHGEE  119

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWG  504
            +D W+ +LD D+NPIH +SKIHVKLQ+ D+ ++R W 
Sbjct  120  IDRWIEILDVDKNPIHGNSKIHVKLQYFDISKDRNWA  156



>ref|XP_011073436.1| PREDICTED: phospholipase D alpha 1 [Sesamum indicum]
 ref|XP_011073437.1| PREDICTED: phospholipase D alpha 1 [Sesamum indicum]
Length=808

 Score =   218 bits (556),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 101/158 (64%), Positives = 121/158 (77%), Gaps = 1/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LH  +YEVD++   G  N   K +E  E  +GF K   ++YATIDLEKARV
Sbjct  1    MAQILLHGTLHATIYEVDRLHAGGGGNFLSKFMENVEEKIGFGKGTPKIYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ E  NPRWYESFHIYCAHMASNV+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61   GRTRIIEKEPNNPRWYESFHIYCAHMASNVIFTVKDDNPIGATLIGRAYVPVHELLDGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            VD W+ +LD D+NPIH  SKIHV+LQF DV R+R W R
Sbjct  121  VDRWVEILDEDKNPIHEGSKIHVRLQFFDVPRDRNWAR  158



>ref|XP_004486668.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Cicer arietinum]
 ref|XP_004486669.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Cicer arietinum]
 ref|XP_004486670.1| PREDICTED: phospholipase D alpha 1-like isoform X3 [Cicer arietinum]
Length=809

 Score =   218 bits (554),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 123/157 (78%), Gaps = 1/157 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG LH  +YEVDKIK  G  N+F KI +  E  +GF    ++LYATIDLEKARV
Sbjct  1    MAQILLHGFLHATIYEVDKIKNIGGRNIFSKIKQNFEETIGFGDGVTKLYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ EH NP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P   +LGGEE
Sbjct  61   GRTRIIEKEHTNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYVPVEEVLGGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWG  504
            +D+W+ +LD  +NPIH  SKIHVKLQF DV  +R W 
Sbjct  121  IDKWVEILDEHKNPIHGDSKIHVKLQFFDVTHDRNWA  157



>emb|CAB43063.1| phospholipase D1 [Craterostigma plantagineum]
Length=807

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 123/158 (78%), Gaps = 1/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LHV +YEVD++ + G  N F K+    E  VGF K   ++YA+IDLEKARV
Sbjct  1    MAQILLHGTLHVTIYEVDQLHSGGGGNFFTKLKANIEETVGFGKGTPKIYASIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ E  NPRWYESFHIYCAHMASNV+F+VK DNPIGA LIGRAY+P + +L GEE
Sbjct  61   GRTRMIEHEPNNPRWYESFHIYCAHMASNVIFTVKDDNPIGATLIGRAYIPVQEILDGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            +D W+ +LDND+NPI   SKIHVKLQ+ DV R+  W R
Sbjct  121  IDRWVEILDNDKNPISGESKIHVKLQYFDVTRDLNWNR  158



>gb|ADA72022.1| phospholipase D [Jatropha curcas]
 gb|KDP37092.1| hypothetical protein JCGZ_06148 [Jatropha curcas]
Length=808

 Score =   216 bits (549),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 124/158 (78%), Gaps = 1/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LH  +YEVDK+ + G  + F K++E  E  VGF K  ++LYATIDL KARV
Sbjct  1    MAQILLHGTLHATIYEVDKLHSGGGPHFFRKLMENIEETVGFGKGVTKLYATIDLGKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+L+ EH NPRWYESFHIYCAH AS+V+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61   GRTRILENEHSNPRWYESFHIYCAHQASDVIFTVKDDNPIGATLIGRAYVPVEELLDGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            +D W+ +LD ++NP+   SKIHVKLQ+ D+ ++R WGR
Sbjct  121  IDRWVEILDEEKNPVSGGSKIHVKLQYFDISKDRNWGR  158



>gb|EPS65578.1| hypothetical protein M569_09194 [Genlisea aurea]
Length=808

 Score =   216 bits (549),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 123/158 (78%), Gaps = 1/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LH  +YEVD++   G  N F K+ E  E  VG  K  S++YATIDLEKARV
Sbjct  1    MAQILLHGTLHATIYEVDRLHVGGGRNFFSKLKENFEEAVGIGKGTSKIYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ E +NPRWYESFHIYCAH+AS+V+F+VK +NPIGA LIGRAY+P   LL GEE
Sbjct  61   GRTRMIENEPENPRWYESFHIYCAHLASDVIFTVKDNNPIGATLIGRAYVPVSELLEGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            +D W+ +LD D+NPIH  SKIHVKLQ+ DV R+R W R
Sbjct  121  IDRWVEILDEDKNPIHGESKIHVKLQYFDVSRDRNWAR  158



>ref|XP_003543677.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Glycine max]
 ref|XP_006595164.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Glycine max]
 gb|KHN44174.1| Phospholipase D alpha 1 [Glycine soja]
Length=807

 Score =   215 bits (548),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 124/157 (79%), Gaps = 2/157 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LH  +YEVDK+K  G  N   KIV+  E  VG  K  ++LYATIDLEKARV
Sbjct  1    MAQILLHGTLHATIYEVDKLKIGG-GNFLTKIVQNIEETVGIGKGVTKLYATIDLEKARV  59

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ E KNPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P + +L GEE
Sbjct  60   GRTRIIEKEIKNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVQEILHGEE  119

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWG  504
            +D W+ +LD  +NPIH HSKIHVKLQ+ DV ++R W 
Sbjct  120  IDRWVEILDEHKNPIHGHSKIHVKLQYFDVSKDRNWA  156



>ref|XP_008454241.1| PREDICTED: phospholipase D alpha 1 [Cucumis melo]
 gb|ABS86615.1| phospholipase D alpha [Cucumis melo var. inodorus]
Length=807

 Score =   214 bits (546),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 124/158 (78%), Gaps = 2/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MA +LLHG+LHV +YEVDK+ + G  N   ++VE  E  VGF +  +RLYATIDLEKARV
Sbjct  1    MAHILLHGTLHVTIYEVDKLHSGG-RNFLKQLVENVEEAVGFGRGITRLYATIDLEKARV  59

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR L+ EH NP+WYE+FHIYCAHMASN++F+VK DNPIGA LIGRAY+P R ++ G+E
Sbjct  60   GRTRRLEREHSNPKWYETFHIYCAHMASNIIFTVKDDNPIGATLIGRAYLPVREIIRGDE  119

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            VD+W+P+LD  + PI    KIHVKLQF DV +++ WGR
Sbjct  120  VDKWVPILDEQKKPIRGEPKIHVKLQFFDVTKDQNWGR  157



>ref|XP_006385316.1| phospholipase D family protein [Populus trichocarpa]
 gb|ERP63113.1| phospholipase D family protein [Populus trichocarpa]
Length=808

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 122/157 (78%), Gaps = 1/157 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LHV ++EVDK+   G H   HK+VE     VG     S+LYATIDLE+ARV
Sbjct  1    MAQVLLHGTLHVTIFEVDKLGDGGGHGFLHKLVENIGEKVGIGDGISKLYATIDLERARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+L+ E  NPRW ESFHIYCAHMASN+VF+VK DNPIGA LIGRAY+P + ++ GEE
Sbjct  61   GRTRILEKEATNPRWNESFHIYCAHMASNIVFTVKDDNPIGATLIGRAYIPVQEIVDGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWG  504
            +D W+ +LD D+NPI S SKIHVKLQ+ DV ++R WG
Sbjct  121  IDRWVEMLDEDKNPIQSSSKIHVKLQYFDVTKDRNWG  157



>ref|XP_004506968.1| PREDICTED: phospholipase D alpha 1-like [Cicer arietinum]
Length=793

 Score =   213 bits (541),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 122/158 (77%), Gaps = 1/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LH  +YEVDK++  G  N+F  I +  E  VG  K  ++LYATIDLEKARV
Sbjct  1    MAQILLHGTLHATIYEVDKLQAGGGGNIFSMIRQNIEETVGIGKGVTKLYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ EH NP+WYESFHIYC H+ASN++F+VK DNPIGA LIGRAY+P   +L GEE
Sbjct  61   GRTRIIENEHTNPKWYESFHIYCGHLASNIIFTVKDDNPIGATLIGRAYVPVDEILDGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            +D W+ +LD ++NPI   SKIHVKLQ+ DV ++R W R
Sbjct  121  IDRWVEILDEEKNPIPEGSKIHVKLQYFDVTKDRSWAR  158



>emb|CDY20148.1| BnaA01g28540D [Brassica napus]
Length=399

 Score =   205 bits (522),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 121/157 (77%), Gaps = 2/157 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ LLHG+LH  +YEVD + T GL + F  KI    E  +GF K  ++LYATIDL+KAR
Sbjct  1    MAQHLLHGTLHATIYEVDALHTGGLSSGFLGKIRANVEEAIGFGKGETQLYATIDLQKAR  60

Query  214  VGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + DE KNP+WYESFHIYCAHMAS+++F+VK DNPIGA LIGRAY+P   ++ GE
Sbjct  61   VGRTRKITDEPKNPKWYESFHIYCAHMASDIIFTVKDDNPIGATLIGRAYVPVDEVINGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCW  501
            EV++W+ +LDNDRNPIH  SKIHVKLQ+  V  +R W
Sbjct  121  EVEKWVEILDNDRNPIHGESKIHVKLQYFGVETDRNW  157



>ref|XP_003604419.1| Phospholipase D alpha [Medicago truncatula]
Length=665

 Score =   211 bits (536),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 120/158 (76%), Gaps = 1/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+ LHG+LH  +YEVDK+   G  N    I +  E  VG  K  ++LYATIDLEKARV
Sbjct  1    MAQIHLHGTLHATIYEVDKLNAGGGGNFLSMIKQNIEETVGLGKGVTKLYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ EH NP+WYESFHIYCAHMAS+++F+VK DNP+GA LIGRAY+PA  +L GEE
Sbjct  61   GRTRIIENEHTNPKWYESFHIYCAHMASDIIFTVKDDNPVGATLIGRAYVPAEEVLNGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            +D W+ +LD ++NPI   SKIHVKLQ+ DV ++R W R
Sbjct  121  IDRWVEILDTEKNPIQEGSKIHVKLQYFDVTKDRSWAR  158



>emb|CAB43062.1| phospholipase D2 [Craterostigma plantagineum]
Length=807

 Score =   212 bits (539),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 123/158 (78%), Gaps = 1/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MA++LLHG+LHV VYEVD++   G  N+F K+    E  VGF K   ++YA+IDLEKARV
Sbjct  1    MARILLHGTLHVTVYEVDRLHAGGGGNIFSKLRANIEEKVGFGKGTPKIYASIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ E  NPRWYESFHIYCAH+ASN++F+VK DNPIGA LIGRAY+P R +L GEE
Sbjct  61   GRTRMIEHEPTNPRWYESFHIYCAHLASNIIFTVKDDNPIGATLIGRAYVPVRDVLDGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            +D W+ LLDN++NPI   SKIHVKLQF DV R+  W R
Sbjct  121  LDRWVELLDNNKNPIRGESKIHVKLQFFDVARDLNWNR  158



>ref|XP_010254401.1| PREDICTED: phospholipase D alpha 1-like [Nelumbo nucifera]
 ref|XP_010254402.1| PREDICTED: phospholipase D alpha 1-like [Nelumbo nucifera]
Length=802

 Score =   212 bits (539),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 120/155 (77%), Gaps = 5/155 (3%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHGSLHV +YEVDK+ +      FH+IVE     +G  K   +LYAT+DLEKARV
Sbjct  1    MAQILLHGSLHVTIYEVDKLSSRH-GGFFHQIVEN----IGIGKGTPQLYATVDLEKARV  55

Query  217  GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  396
            GRTR+L E+ NP+W ESFHIYCAHMASNV+F+VK DNPIGA LIGRAY+P   +L GEEV
Sbjct  56   GRTRMLKENANPQWNESFHIYCAHMASNVIFTVKDDNPIGATLIGRAYIPVEEILNGEEV  115

Query  397  DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCW  501
            D W+ +LD DRNPIH HSKIHV+LQF DV  +R W
Sbjct  116  DRWVEILDEDRNPIHGHSKIHVRLQFFDVTHDRNW  150



>ref|XP_004152203.1| PREDICTED: phospholipase D alpha 1-like [Cucumis sativus]
 gb|KGN52888.1| hypothetical protein Csa_4G004970 [Cucumis sativus]
Length=807

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 123/157 (78%), Gaps = 2/157 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MA +L+HG+LHV +YEVDK+ + G  N   ++VE  E  VGF +  +RLYATIDLEKARV
Sbjct  1    MAHILIHGTLHVTIYEVDKLHSGG-RNFLKQLVENVEEAVGFGRGITRLYATIDLEKARV  59

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR L+ EH NP+WYE+FHIYCAHMASN++F+VK DNPIGA LIGRAY+P R ++ G+E
Sbjct  60   GRTRRLEREHSNPKWYETFHIYCAHMASNIIFTVKDDNPIGATLIGRAYLPVREIIRGDE  119

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWG  504
            VD+W+P+LD  + PI    KIHVKLQF DV +++ WG
Sbjct  120  VDKWVPILDESKKPIRGAPKIHVKLQFFDVTKDQNWG  156



>ref|XP_004156800.1| PREDICTED: phospholipase D alpha 1-like [Cucumis sativus]
Length=807

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 123/157 (78%), Gaps = 2/157 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MA +L+HG+LHV +YEVDK+ + G  N   ++VE  E  VGF +  +RLYATIDLEKARV
Sbjct  1    MAHILIHGTLHVTIYEVDKLHSGG-RNFLKQLVENVEEAVGFGRGITRLYATIDLEKARV  59

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR L+ EH NP+WYE+FHIYCAHMASN++F+VK DNPIGA LIGRAY+P R ++ G+E
Sbjct  60   GRTRRLEREHSNPKWYETFHIYCAHMASNIIFTVKDDNPIGATLIGRAYLPVREIIRGDE  119

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWG  504
            VD+W+P+LD  + PI    KIHVKLQF DV +++ WG
Sbjct  120  VDKWVPILDESKKPIRGAPKIHVKLQFFDVTKDQNWG  156



>ref|XP_009619857.1| PREDICTED: phospholipase D alpha 1 [Nicotiana tomentosiformis]
Length=810

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 122/157 (78%), Gaps = 1/157 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MA +LLHG+LHV V+EVD+++  G  N F KI E  E  VG  K AS++YAT+DLEKARV
Sbjct  1    MAPILLHGTLHVTVHEVDRLREKGGGNFFSKIKETVEETVGVGKGASKIYATVDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ E  NPRW ESFHIYCAHMASNVVF+VK +N IGA LIGRAY+P   LL GEE
Sbjct  61   GRTRVIENEPSNPRWNESFHIYCAHMASNVVFTVKDNNSIGATLIGRAYLPVNELLEGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWG  504
            VDEW+ +LD D+NPI   SKIHV+LQF D+ R+R WG
Sbjct  121  VDEWIEILDEDKNPIKEGSKIHVRLQFFDISRDRNWG  157



>tpg|DAA53241.1| TPA: phospholipase D family protein, partial [Zea mays]
Length=202

 Score =   198 bits (503),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 122/163 (75%), Gaps = 7/163 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LH  ++E + +      T G      K+VEG E  VG  K A+++YAT+DL
Sbjct  1    MAQILLHGTLHATIFEAESLSNPHRATGGAPKFIRKLVEGIEDTVGVGKGATKIYATVDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTR++ +E  NPRWYESFHIYCAHMA++V+F+VK+DN IGA LIGRAY+P + L
Sbjct  61   EKARVGRTRMISNEPVNPRWYESFHIYCAHMAADVIFTVKIDNSIGASLIGRAYLPVQDL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            LGGEE+D+WL + D +R P+   SKIHVKLQ+ DV ++R W R
Sbjct  121  LGGEEIDKWLEICDENREPV-GDSKIHVKLQYFDVGKDRNWAR  162



>ref|XP_003597894.1| Phospholipase D alpha [Medicago truncatula]
 gb|ABD28731.1| C2; Peptidase, cysteine peptidase active site [Medicago truncatula]
 gb|AES68145.1| phospholipase D alpha 1 [Medicago truncatula]
Length=809

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 124/157 (79%), Gaps = 1/157 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LH  ++EVDK+K  G  N+  KI +  E  VGF K  ++LYATIDLEKARV
Sbjct  1    MAQILLHGTLHATIFEVDKLKNIGGGNILSKIRQNFEETVGFGKGTTKLYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ EH NP+W ESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P   +LGGEE
Sbjct  61   GRTRIIEKEHVNPQWNESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYIPVEEVLGGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWG  504
            VD W+ +LD ++ PIH +SKIHVKLQF DV ++R W 
Sbjct  121  VDRWVEILDVNKEPIHGNSKIHVKLQFFDVSKDRNWA  157



>ref|XP_003528334.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Glycine max]
 ref|XP_006583126.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Glycine max]
Length=809

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 123/159 (77%), Gaps = 2/159 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLH-NLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ+LLHG+LH  ++EVD++   G   N F K+ +  E  VG  K  ++LYATIDLEKAR
Sbjct  1    MAQILLHGTLHATIFEVDRLNAGGGGGNFFSKLKQNFEETVGIGKGVTKLYATIDLEKAR  60

Query  214  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR+++ EH NPRWYESFHIYCAHMASN+VF+VK DNPIGA LIGRAY+P   +L GE
Sbjct  61   VGRTRIIENEHTNPRWYESFHIYCAHMASNIVFTVKDDNPIGATLIGRAYVPVSEVLDGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            E+D W+ +LD ++NPIH  SKIHVKLQ+ DV ++R W R
Sbjct  121  EIDRWVEILDEEKNPIHEGSKIHVKLQYFDVTKDRNWAR  159



>gb|AES86616.2| phospholipase D alpha 1 [Medicago truncatula]
Length=808

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 120/158 (76%), Gaps = 1/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+ LHG+LH  +YEVDK+   G  N    I +  E  VG  K  ++LYATIDLEKARV
Sbjct  1    MAQIHLHGTLHATIYEVDKLNAGGGGNFLSMIKQNIEETVGLGKGVTKLYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ EH NP+WYESFHIYCAHMAS+++F+VK DNP+GA LIGRAY+PA  +L GEE
Sbjct  61   GRTRIIENEHTNPKWYESFHIYCAHMASDIIFTVKDDNPVGATLIGRAYVPAEEVLNGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            +D W+ +LD ++NPI   SKIHVKLQ+ DV ++R W R
Sbjct  121  IDRWVEILDTEKNPIQEGSKIHVKLQYFDVTKDRSWAR  158



>ref|XP_011008452.1| PREDICTED: phospholipase D alpha 1-like [Populus euphratica]
 ref|XP_011008453.1| PREDICTED: phospholipase D alpha 1-like [Populus euphratica]
Length=808

 Score =   210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 121/157 (77%), Gaps = 1/157 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LHV ++EVDK+   G H    K+VE     VG     S+LYATIDLE+ARV
Sbjct  1    MAQILLHGTLHVTIFEVDKLGDGGGHGFLRKLVENIGEKVGIGDGISKLYATIDLERARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+L+ E  NPRW ESFHIYCAHMASN+VF+VK DNPIGA LIGRAY+P + ++ GEE
Sbjct  61   GRTRILEKEATNPRWNESFHIYCAHMASNIVFTVKDDNPIGATLIGRAYIPVQEIVDGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWG  504
            +D W+ +LD D+NPI S SKIHVKLQ+ DV ++R WG
Sbjct  121  IDRWVEMLDEDKNPIDSGSKIHVKLQYFDVTKDRNWG  157



>ref|XP_009799916.1| PREDICTED: phospholipase D alpha 1 [Nicotiana sylvestris]
 ref|XP_009799917.1| PREDICTED: phospholipase D alpha 1 [Nicotiana sylvestris]
Length=808

 Score =   210 bits (534),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 120/158 (76%), Gaps = 1/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LHV +YEVD ++ +G  + F KI E  E  +G  K    +YAT+DLEKARV
Sbjct  1    MAQILLHGTLHVTIYEVDNLQKEGGGHFFSKIKEHVEETIGLGKGTPEIYATVDLEKARV  60

Query  217  GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR + +E KNPRWYESFHIYCAHMASNV+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61   GRTRKIKNEPKNPRWYESFHIYCAHMASNVIFTVKDDNPIGATLIGRAYVPVEELLEGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            +D+W+ +LD + NPI   SKIHVKLQF DV R+  W R
Sbjct  121  IDKWVEILDREMNPIAEGSKIHVKLQFFDVSRDPNWAR  158



>emb|CBI36314.3| unnamed protein product [Vitis vinifera]
Length=337

 Score =   201 bits (510),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 122/161 (76%), Gaps = 1/161 (1%)
 Frame = +1

Query  28   LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  207
            +SE  ++ LHG+LH  ++E+D++ + G    F K+VE  E  VGF K  S+LYATID+ +
Sbjct  1    MSEFNEIPLHGTLHATIFEIDRLHSGGAPKFFRKLVENIEETVGFGKGTSKLYATIDIGR  60

Query  208  ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  384
            ARVGRTR+++ E  NPRWYESFHIYCAHMA +++F+VK DNPIGA LIGRA +P + +LG
Sbjct  61   ARVGRTRMIENEPSNPRWYESFHIYCAHMAGHIIFTVKDDNPIGATLIGRASVPIQEILG  120

Query  385  GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            GEEVD+W+ +++ +  PIH  SKIHVKLQ+ +V  +R WGR
Sbjct  121  GEEVDKWVEIVNEELKPIHGGSKIHVKLQYFEVTADRSWGR  161



>sp|Q70EW5.2|PLDA1_CYNCA RecName: Full=Phospholipase D alpha 1; Short=PLD 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Cynara cardunculus]
 emb|CAE47482.2| phospholipase D alpha [Cynara cardunculus]
Length=808

 Score =   209 bits (532),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 125/158 (79%), Gaps = 1/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M+++LLHG+LHV VYEVDK++  G  N+F K++   +  VGF +   ++YATIDLEK+RV
Sbjct  1    MSKVLLHGTLHVTVYEVDKLREGGGPNVFGKLMANIQETVGFGEGTPKIYATIDLEKSRV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ E +NPRWYESFHIYCAH ASN++F+VK DNPIGA L+GRAYMP R LL G+E
Sbjct  61   GRTRMIENEPQNPRWYESFHIYCAHHASNIIFTVKDDNPIGATLLGRAYMPVRELLDGDE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            VD+W+ ++D D NP  + SKIHVKLQ+ DV ++R W R
Sbjct  121  VDKWIEIMDEDNNPTPAGSKIHVKLQYFDVTQDRNWDR  158



>ref|XP_009625689.1| PREDICTED: phospholipase D alpha 1 [Nicotiana tomentosiformis]
 ref|XP_009625690.1| PREDICTED: phospholipase D alpha 1 [Nicotiana tomentosiformis]
 ref|XP_009625691.1| PREDICTED: phospholipase D alpha 1 [Nicotiana tomentosiformis]
 ref|XP_009625692.1| PREDICTED: phospholipase D alpha 1 [Nicotiana tomentosiformis]
Length=808

 Score =   209 bits (532),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 120/158 (76%), Gaps = 1/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LHV +YEVD ++ +G  + F KI E  E  +GF K    +YAT+DLEKARV
Sbjct  1    MAQILLHGTLHVTIYEVDNLQKEGGGHFFSKIKEHVEETIGFGKGTPAIYATVDLEKARV  60

Query  217  GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR + +E  NPRWYESFHIYCAHMASNV+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61   GRTRKIKNEPNNPRWYESFHIYCAHMASNVIFTVKDDNPIGATLIGRAYVPVEELLEGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            +D+W+ +LD + NPI   SKIHVKLQF DV R+  W R
Sbjct  121  IDKWVEILDREMNPIAEGSKIHVKLQFFDVSRDPNWER  158



>sp|P93400.2|PLDA1_TOBAC RecName: Full=Phospholipase D alpha 1; Short=PLD alpha 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Nicotiana tabacum]
 emb|CAB06620.1| phospholipase D [Nicotiana tabacum]
Length=808

 Score =   209 bits (531),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 120/158 (76%), Gaps = 1/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LHV +YEVD ++ +G  + F KI E  E  +GF K    +YAT+DLEKARV
Sbjct  1    MAQILLHGTLHVTIYEVDNLQKEGGGHFFSKIKEHVEETIGFGKGTPAIYATVDLEKARV  60

Query  217  GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR + +E  NPRWYESFHIYCAHMASNV+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61   GRTRKIKNEPNNPRWYESFHIYCAHMASNVIFTVKDDNPIGATLIGRAYVPVEELLEGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            +D+W+ +LD + NPI   SKIHVKLQF DV R+  W R
Sbjct  121  IDKWVEILDREMNPIAEGSKIHVKLQFFDVSRDPNWER  158



>ref|XP_011081358.1| PREDICTED: phospholipase D alpha 1 [Sesamum indicum]
Length=807

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 120/157 (76%), Gaps = 2/157 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M+Q+LLHG+LH  ++EVD +K  G   +F K++E  E  VG  K  S+LYATIDLEK+RV
Sbjct  1    MSQILLHGTLHATIFEVDNLKGGG-GGIFSKLMENIEETVGIGKGVSQLYATIDLEKSRV  59

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTRL++ E  NPRWYESFHIYCAHMASNV+F+VK DNPIGA LIGRAY+P   LL G+E
Sbjct  60   GRTRLIENEPSNPRWYESFHIYCAHMASNVIFTVKDDNPIGATLIGRAYVPVHDLLEGDE  119

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWG  504
            VD W  +LD D+NPI   SKIHVKLQF D+ R+R W 
Sbjct  120  VDRWAEILDEDKNPITEGSKIHVKLQFFDITRDRNWA  156



>ref|XP_003531710.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Glycine max]
 ref|XP_006585630.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Glycine max]
Length=809

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 122/159 (77%), Gaps = 2/159 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLH-NLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ+LLHG+LH  V+EVD++   G   N F K+ +  E  VG  K  ++LYATIDLEKAR
Sbjct  1    MAQILLHGTLHATVFEVDRLNAGGGGGNFFSKLKQNFEETVGIGKGVTKLYATIDLEKAR  60

Query  214  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR+++ EH NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P   +L GE
Sbjct  61   VGRTRIIENEHTNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVSEVLDGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            E+D W+ +LD ++NPI   SKIHVKLQ+ DV ++R W R
Sbjct  121  EIDRWVEILDEEKNPIQEGSKIHVKLQYFDVTKDRNWAR  159



>gb|KHN47766.1| Phospholipase D alpha 1 [Glycine soja]
Length=809

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 122/159 (77%), Gaps = 2/159 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLH-NLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ+LLHG+LH  V+EVD++   G   N F K+ +  E  VG  K  ++LYATIDLEKAR
Sbjct  1    MAQILLHGTLHATVFEVDRLNAGGGGGNFFSKLKQNFEETVGIGKGVTKLYATIDLEKAR  60

Query  214  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR+++ EH NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P   +L GE
Sbjct  61   VGRTRIIENEHTNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVSEVLDGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            E+D W+ +LD ++NPI   SKIHVKLQ+ DV ++R W R
Sbjct  121  EIDRWVEILDEEKNPIQEGSKIHVKLQYFDVTKDRNWAR  159



>gb|KHN01336.1| Phospholipase D alpha 1 [Glycine soja]
Length=809

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 122/159 (77%), Gaps = 2/159 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLH-NLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ+LLHG+LH  ++EVD++   G   N F K+ +  E  VG  K  ++LYATIDLEKAR
Sbjct  1    MAQILLHGTLHATIFEVDRLNAGGGGGNFFSKLKQNFEETVGIGKGVTKLYATIDLEKAR  60

Query  214  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR+++ EH NPRWYESFHIYCAHMASN+VF+VK DNPIGA LIGRAY+P   +L GE
Sbjct  61   VGRTRIIENEHTNPRWYESFHIYCAHMASNIVFTVKDDNPIGATLIGRAYVPVSEVLDGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            E+D W+ +LD ++NPI   SKIHVKLQ+ DV ++R W R
Sbjct  121  EIDRWVEILDEEKNPIREGSKIHVKLQYFDVTKDRNWAR  159



>tpg|DAA53243.1| TPA: phospholipase D family protein, partial [Zea mays]
Length=284

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 122/163 (75%), Gaps = 7/163 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LH  ++E + +      T G      K+VEG E  VG  K A+++YAT+DL
Sbjct  1    MAQILLHGTLHATIFEAESLSNPHRATGGAPKFIRKLVEGIEDTVGVGKGATKIYATVDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTR++ +E  NPRWYESFHIYCAHMA++V+F+VK+DN IGA LIGRAY+P + L
Sbjct  61   EKARVGRTRMISNEPVNPRWYESFHIYCAHMAADVIFTVKIDNSIGASLIGRAYLPVQDL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            LGGEE+D+WL + D +R P+   SKIHVKLQ+ DV ++R W R
Sbjct  121  LGGEEIDKWLEICDENREPV-GDSKIHVKLQYFDVGKDRNWAR  162



>tpg|DAA53242.1| TPA: phospholipase D family protein, partial [Zea mays]
Length=281

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 122/163 (75%), Gaps = 7/163 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LH  ++E + +      T G      K+VEG E  VG  K A+++YAT+DL
Sbjct  1    MAQILLHGTLHATIFEAESLSNPHRATGGAPKFIRKLVEGIEDTVGVGKGATKIYATVDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTR++ +E  NPRWYESFHIYCAHMA++V+F+VK+DN IGA LIGRAY+P + L
Sbjct  61   EKARVGRTRMISNEPVNPRWYESFHIYCAHMAADVIFTVKIDNSIGASLIGRAYLPVQDL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            LGGEE+D+WL + D +R P+   SKIHVKLQ+ DV ++R W R
Sbjct  121  LGGEEIDKWLEICDENREPV-GDSKIHVKLQYFDVGKDRNWAR  162



>gb|KDO48582.1| hypothetical protein CISIN_1g004579mg [Citrus sinensis]
 gb|KDO48583.1| hypothetical protein CISIN_1g004579mg [Citrus sinensis]
Length=662

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/158 (64%), Positives = 122/158 (77%), Gaps = 7/158 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LHV +YEVD++++ G  N F       + + G  K  S LYATIDLEKARV
Sbjct  1    MAQILLHGTLHVTIYEVDQLESGGGGNFF------TKLLGGLGKGGSELYATIDLEKARV  54

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+L  E  NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P   +LGGEE
Sbjct  55   GRTRMLKKEQSNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVEEVLGGEE  114

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            VD+W+ +LD DRNPI S SKIHVKLQ+ DV ++R W R
Sbjct  115  VDKWVEILDEDRNPISSGSKIHVKLQYFDVTKDRSWAR  152



>emb|CDY21865.1| BnaC01g35830D [Brassica napus]
Length=812

 Score =   207 bits (527),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 121/158 (77%), Gaps = 3/158 (2%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHN--LFHKIVEGAERVVGFNKTASRLYATIDLEKA  210
            MAQ LLHG+LH  +YEVD + T GL +     KI+   E  VGF K  ++LYATIDL+KA
Sbjct  1    MAQHLLHGTLHATIYEVDALHTGGLRSAGFLGKIISNVEETVGFGKGETQLYATIDLQKA  60

Query  211  RVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  387
            RVGRTR + DE KNP+WYESFHIYCAHMAS+++F+VK DNPIGA LIGRAY+P   ++ G
Sbjct  61   RVGRTRKITDEPKNPKWYESFHIYCAHMASDIIFTVKDDNPIGATLIGRAYVPVDEVING  120

Query  388  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCW  501
            EEV++W+ +LDNDRNPIH  SKIHVKLQ+  V  +R W
Sbjct  121  EEVEKWVEILDNDRNPIHGESKIHVKLQYFGVEADRNW  158



>ref|XP_006427267.1| hypothetical protein CICLE_v10024917mg [Citrus clementina]
 gb|ESR40507.1| hypothetical protein CICLE_v10024917mg [Citrus clementina]
Length=802

 Score =   206 bits (525),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 101/158 (64%), Positives = 122/158 (77%), Gaps = 7/158 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LHV +YEVD++++ G  N F       + + G  K  S LYATIDLEKARV
Sbjct  1    MAQILLHGTLHVTIYEVDQLESGGGGNFF------TKLLGGLGKGGSELYATIDLEKARV  54

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+L  E  NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P   +LGGEE
Sbjct  55   GRTRMLKKEQSNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVEEVLGGEE  114

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            VD+W+ +LD DRNPI S SKIHVKLQ+ DV ++R W R
Sbjct  115  VDKWVEILDEDRNPISSGSKIHVKLQYFDVTKDRSWAR  152



>ref|XP_006465340.1| PREDICTED: phospholipase D alpha 1 [Citrus sinensis]
Length=802

 Score =   206 bits (525),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 101/158 (64%), Positives = 122/158 (77%), Gaps = 7/158 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LHV +YEVD++++ G  N F       + + G  K  S LYATIDLEKARV
Sbjct  1    MAQILLHGTLHVTIYEVDQLESGGGGNFF------TKLLGGLGKGGSELYATIDLEKARV  54

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+L  E  NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P   +LGGEE
Sbjct  55   GRTRMLKKEQSNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVEEVLGGEE  114

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            VD+W+ +LD DRNPI S SKIHVKLQ+ DV ++R W R
Sbjct  115  VDKWVEILDEDRNPISSGSKIHVKLQYFDVTKDRSWAR  152



>gb|AGN71006.1| phospholipase D2 [Brassica napus]
Length=812

 Score =   206 bits (525),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 122/157 (78%), Gaps = 2/157 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ LLHG+LH  +YEVD + T GL + F  KI    E+ +GF K  ++LYATIDL+KAR
Sbjct  1    MAQHLLHGTLHATIYEVDALHTGGLSSGFLGKIRANVEKAIGFGKGETQLYATIDLQKAR  60

Query  214  VGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + DE KNP+WYESFHIYCAHMAS+++F+VK DNPIGA LIGRAY+P   ++ GE
Sbjct  61   VGRTRKITDEPKNPKWYESFHIYCAHMASDIIFTVKDDNPIGATLIGRAYVPVDEVINGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCW  501
            EV++W+ +LDNDRNPIH  SKIHVKLQ+  V  +R W
Sbjct  121  EVEKWVEILDNDRNPIHGESKIHVKLQYFGVETDRNW  157



>sp|P86387.1|PLDA1_CARPA RecName: Full=Phospholipase D alpha 1; Short=CpPLD1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Carica papaya]
Length=808

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 118/156 (76%), Gaps = 1/156 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MA  L+HG+LH  VYEVDK+ + G+   F KI+   E  +G  K  ++LYATIDLE+ARV
Sbjct  1    MAHYLMHGTLHATVYEVDKLHSGGISGFFGKILANVEGTIGIGKGVTQLYATIDLERARV  60

Query  217  GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR++ DE  NP+WYESFHIYCAHMASNVVF+VK DNPIGA LIGRAY+P   L+ G++
Sbjct  61   GRTRIIKDEPNNPKWYESFHIYCAHMASNVVFTVKDDNPIGATLIGRAYVPVEELIRGDQ  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCW  501
            VD W+ +LD D+NPI   SKIHVKLQF DV ++  W
Sbjct  121  VDRWVEILDEDKNPIEGDSKIHVKLQFFDVKKDSNW  156



>ref|XP_009115281.1| PREDICTED: phospholipase D alpha 2 [Brassica rapa]
Length=812

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 121/157 (77%), Gaps = 2/157 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ LLHG+LH  +YEVD + T GL + F  KI    E  +GF K  ++LYATIDL+KAR
Sbjct  1    MAQHLLHGTLHATIYEVDALHTGGLSSGFLGKIRANVEEAIGFGKGETQLYATIDLQKAR  60

Query  214  VGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + DE KNP+WYESFHIYCAHMAS+++F+VK DNPIGA LIGRAY+P   ++ GE
Sbjct  61   VGRTRKITDEPKNPKWYESFHIYCAHMASDIIFTVKDDNPIGATLIGRAYVPVDEVINGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCW  501
            EV++W+ +LDNDRNPIH  SKIHVKLQ+  V  +R W
Sbjct  121  EVEKWVEILDNDRNPIHGESKIHVKLQYFGVETDRNW  157



>ref|NP_001275827.1| phospholipase D alpha [Citrus sinensis]
 gb|ACA49723.1| phospholipase D alpha [Citrus sinensis]
Length=802

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/158 (64%), Positives = 121/158 (77%), Gaps = 7/158 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LHV +YEVD++++ G  N F       + + G  K  S LYATIDLEKARV
Sbjct  1    MAQILLHGTLHVTIYEVDQLESGGGGNFF------TKLLGGLGKGGSELYATIDLEKARV  54

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+L  E  NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P    LGGEE
Sbjct  55   GRTRMLKKEQSNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVEEALGGEE  114

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            VD+W+ +LD DRNPI S SKIHVKLQ+ DV ++R W R
Sbjct  115  VDKWVEILDEDRNPISSGSKIHVKLQYFDVTKDRSWAR  152



>ref|XP_006364210.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Solanum tuberosum]
Length=811

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 120/158 (76%), Gaps = 1/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MA +LLHG+LHV ++EVD++      N F KI +  E  VG  K ASR+YAT+DLEKARV
Sbjct  1    MAPILLHGTLHVTIHEVDRLHGKHGRNFFSKIKDSVEETVGMGKGASRIYATVDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ E  NPRWYESFHIYCAHMA NV+F+VK +N IGA LIGRAY+P   LL GEE
Sbjct  61   GRTRVIENEPNNPRWYESFHIYCAHMAKNVIFTVKDNNSIGATLIGRAYLPVNDLLEGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            VDEW+ +LD D NPI + SKIHV LQ+ ++ R+R WGR
Sbjct  121  VDEWIEILDEDENPIEAGSKIHVTLQYFEISRDRNWGR  158



>ref|XP_004235964.1| PREDICTED: phospholipase D alpha 1 [Solanum lycopersicum]
Length=811

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 120/158 (76%), Gaps = 1/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MA +LLHG+LHV ++EVDK+      N F KI +  E  VG  K ASR+YAT+DLEKARV
Sbjct  1    MAPILLHGTLHVTIHEVDKLHGKQGRNFFSKIKDSVEEKVGMGKGASRIYATVDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ E  NPRWYESFHIYCAHMA NV+F+VK +N IGA LIGRAY+P   LL GEE
Sbjct  61   GRTRVIENEPNNPRWYESFHIYCAHMAKNVIFTVKDNNSIGATLIGRAYLPVNDLLEGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            VDEW+ +LD D NP+ + SKIHV LQ+ ++ R+R WGR
Sbjct  121  VDEWIEILDEDENPVEAGSKIHVTLQYFEISRDRNWGR  158



>gb|AGV22364.1| phospholipase D4 [Brassica napus]
Length=812

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 121/157 (77%), Gaps = 2/157 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ LLHG+LH  +YEVD + T GL + F  KI    E  +GF K  ++LYATIDL+KAR
Sbjct  1    MAQHLLHGTLHATIYEVDALHTGGLSSGFLGKIRANVEEAIGFGKGETQLYATIDLQKAR  60

Query  214  VGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + DE KNP+WYESFHIYCAHMAS+++F+VK DNPIGA LIGRAY+P   ++ GE
Sbjct  61   VGRTRKITDEPKNPKWYESFHIYCAHMASDIIFTVKDDNPIGATLIGRAYVPVDEVINGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCW  501
            EV++W+ +LDNDRNPIH  SKIHVKLQ+  V  +R W
Sbjct  121  EVEKWVEILDNDRNPIHGESKIHVKLQYFGVETDRNW  157



>ref|XP_011012164.1| PREDICTED: phospholipase D alpha 1 [Populus euphratica]
Length=808

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 122/158 (77%), Gaps = 1/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LHV +YEVDKI   G H  FHK+V      VG     SRLYATIDLEKARV
Sbjct  1    MAQILLHGNLHVTIYEVDKIGDGGGHGFFHKLVGSIGEKVGVGNGISRLYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+L+ E  NPRWYESFHIYCAHMASNV+F+VK  NPIGA LIGRAY+P   +L GEE
Sbjct  61   GRTRILENEATNPRWYESFHIYCAHMASNVIFTVKDVNPIGATLIGRAYIPVEEILDGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            +D W+ +LD D+NPIH+ SKIHVKLQ+ D+ ++  WGR
Sbjct  121  IDRWVEILDGDKNPIHAGSKIHVKLQYFDISKDHNWGR  158



>ref|XP_009146200.1| PREDICTED: phospholipase D alpha 1 [Brassica rapa]
Length=810

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 123/159 (77%), Gaps = 2/159 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHN-LFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ LLHG+LH  +YEVD + T GL +  F KI+   E  +G  K  ++LYATIDL++AR
Sbjct  1    MAQHLLHGTLHATIYEVDDLHTGGLRSGFFGKILANVEETIGVGKGETQLYATIDLQRAR  60

Query  214  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + DE KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P  ++L GE
Sbjct  61   VGRTRKIKDEAKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYVPVDQILHGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EVD+W+ +LDNDRNPIH  SKIHVKLQ+  V  +R W +
Sbjct  121  EVDQWVEILDNDRNPIHGGSKIHVKLQYFGVEADRNWNQ  159



>gb|KCW70692.1| hypothetical protein EUGRSUZ_F03862 [Eucalyptus grandis]
Length=673

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 120/158 (76%), Gaps = 3/158 (2%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LH  +YEVD++   G    F KI+   E  VG  K  S+LYATIDL KARV
Sbjct  1    MAQILLHGTLHATIYEVDQLHHGGAPKFFRKIMANIEETVGLGKGVSKLYATIDLGKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTRLL+ E  NPRWYESFHIYCAHMAS+V+F++K DNPIGA LIGRAY+P   LLGGEE
Sbjct  61   GRTRLLEKEPSNPRWYESFHIYCAHMASDVIFTIKDDNPIGATLIGRAYVPVDELLGGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            +D W+ +LD +RNPI   SKIHVKL + DV ++R +GR
Sbjct  121  LDRWVEILDKERNPI--GSKIHVKLHYFDVSKDRIYGR  156



>sp|P55939.2|PLDA2_BRAOC RecName: Full=Phospholipase D alpha 2; Short=PLD 2; AltName: 
Full=Choline phosphatase 2; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 2; Flags: Precursor [Brassica 
oleracea var. capitata]
 gb|AAC78486.1| phospholipase D2 [Brassica oleracea var. capitata]
 gb|AAC79125.1| phospholipase D [Brassica oleracea var. capitata]
 gb|AAD17209.1| phospholipase D2 [Brassica oleracea var. capitata]
Length=812

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 121/158 (77%), Gaps = 3/158 (2%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHN--LFHKIVEGAERVVGFNKTASRLYATIDLEKA  210
            MAQ LLHG+LH  +YEVD + T GL +     KI+   E  +GF K  ++LYATIDL+KA
Sbjct  1    MAQHLLHGTLHATIYEVDALHTGGLRSAGFLGKIISNVEETIGFGKGETQLYATIDLQKA  60

Query  211  RVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  387
            RVGRTR + DE KNP+WYESFHIYCAHMAS+++F+VK DNPIGA LIGRAY+P   ++ G
Sbjct  61   RVGRTRKITDEPKNPKWYESFHIYCAHMASDIIFTVKDDNPIGATLIGRAYVPVDEVING  120

Query  388  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCW  501
            EEV++W+ +LD+DRNPIH  SKIHVKLQ+  V  +R W
Sbjct  121  EEVEKWVEILDDDRNPIHGESKIHVKLQYFAVEADRNW  158



>ref|XP_006356207.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Solanum tuberosum]
 ref|XP_006356208.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Solanum tuberosum]
 ref|XP_006356209.1| PREDICTED: phospholipase D alpha 1-like isoform X3 [Solanum tuberosum]
Length=809

 Score =   205 bits (521),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 121/159 (76%), Gaps = 2/159 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ+ LHG+LHV ++EVD ++  +G  + F KI +  E  VG  K   +LYATIDLEKAR
Sbjct  1    MAQIQLHGTLHVTIFEVDNLQGEEGGGHFFSKIKQHFEETVGVGKGTPKLYATIDLEKAR  60

Query  214  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR+++ E KNPRWYESFHIYCAHMASNV+F++K DNP GA LIGRAY+P   LL GE
Sbjct  61   VGRTRMIENEPKNPRWYESFHIYCAHMASNVIFTIKDDNPFGASLIGRAYVPVEELLEGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            E+D+W+ +LD + NPI   SKIHVKLQF DV R+  WGR
Sbjct  121  EIDKWVEILDKEMNPIAEGSKIHVKLQFFDVSRDPNWGR  159



>ref|XP_010063458.1| PREDICTED: phospholipase D alpha 1 [Eucalyptus grandis]
Length=805

 Score =   204 bits (520),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 120/158 (76%), Gaps = 3/158 (2%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LH  +YEVD++   G    F KI+   E  VG  K  S+LYATIDL KARV
Sbjct  1    MAQILLHGTLHATIYEVDQLHHGGAPKFFRKIMANIEETVGLGKGVSKLYATIDLGKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTRLL+ E  NPRWYESFHIYCAHMAS+V+F++K DNPIGA LIGRAY+P   LLGGEE
Sbjct  61   GRTRLLEKEPSNPRWYESFHIYCAHMASDVIFTIKDDNPIGATLIGRAYVPVDELLGGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            +D W+ +LD +RNPI   SKIHVKL + DV ++R +GR
Sbjct  121  LDRWVEILDKERNPI--GSKIHVKLHYFDVSKDRIYGR  156



>emb|CDO98145.1| unnamed protein product [Coffea canephora]
Length=809

 Score =   204 bits (520),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 121/159 (76%), Gaps = 2/159 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGL-HNLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            M  +LLHG+LHV ++EVDK+  +G   ++F K++   E  VGF K   ++YATIDLEKAR
Sbjct  1    MDPVLLHGTLHVTIFEVDKLHGEGGGPSVFRKLMANIEETVGFGKGTPKIYATIDLEKAR  60

Query  214  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR+++ E  NPRWYESFHIYCAH ASNV+F+VK DNPIGA LIGRAY+P   LL GE
Sbjct  61   VGRTRMIENEPNNPRWYESFHIYCAHEASNVIFTVKDDNPIGATLIGRAYVPVHELLEGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            E+D W+ +LD D+NPI   SKIHVKLQ+ DV R+R W R
Sbjct  121  EIDRWVEILDEDKNPIKEESKIHVKLQYFDVTRDRNWAR  159



>gb|AIE90138.1| phospholipase D1, partial [Brassica napus]
Length=810

 Score =   204 bits (519),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 123/159 (77%), Gaps = 2/159 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHN-LFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ LLHG+LH  +YEVD + T GL +  F KI+   E  +G  K  ++LYATIDL++AR
Sbjct  1    MAQHLLHGTLHATIYEVDDLHTGGLRSGFFGKILANVEETIGVGKGETQLYATIDLQRAR  60

Query  214  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + DE KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P  +++ GE
Sbjct  61   VGRTRKIKDEAKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYVPVDQVIHGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EVD+W+ +LDNDRNPIH  SKIHVKLQ+  V  +R W +
Sbjct  121  EVDQWVEILDNDRNPIHGGSKIHVKLQYFGVEADRNWNQ  159



>ref|XP_008461111.1| PREDICTED: phospholipase D alpha 1 [Cucumis melo]
Length=833

 Score =   204 bits (519),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 118/158 (75%), Gaps = 1/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M    LHG+LH  +YE+D++ T G  N+F  + +  E  VG  K  ++LYATIDLEKARV
Sbjct  26   MEGTSLHGTLHATIYEIDRLHTGGSSNVFSMLRQNFEEAVGIGKGQTKLYATIDLEKARV  85

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+L+ E  NPRWYESFHIYCAH ASNV+F+VK DNPIGA LIGRAY+P   ++ GEE
Sbjct  86   GRTRILESEPSNPRWYESFHIYCAHKASNVIFTVKDDNPIGATLIGRAYVPVEDIVDGEE  145

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            VD W+P+LD ++NPI   SKIHVKLQ+  V ++R WGR
Sbjct  146  VDRWVPILDENQNPIEGESKIHVKLQYFSVTKDRNWGR  183



>sp|O82549.1|PLDA1_BRAOC RecName: Full=Phospholipase D alpha 1; Short=PLD 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1; Flags: Precursor [Brassica 
oleracea var. capitata]
 gb|AAC78487.1| phospholipase D1 [Brassica oleracea var. capitata]
 gb|AAD17208.1| phospholipase D1 [Brassica oleracea var. capitata]
 emb|CDY30108.1| BnaC05g37540D [Brassica napus]
Length=810

 Score =   204 bits (518),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 123/159 (77%), Gaps = 2/159 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHN-LFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ LLHG+LH  +YEVD + T GL +  F KI+   E  +G  K  ++LYATIDL++AR
Sbjct  1    MAQHLLHGTLHATIYEVDDLHTGGLRSGFFGKILANVEETIGVGKGETQLYATIDLQRAR  60

Query  214  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + DE KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P  +++ GE
Sbjct  61   VGRTRKIKDEAKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYVPVDQVIHGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EVD+W+ +LDNDRNPIH  SKIHVKLQ+  V  +R W +
Sbjct  121  EVDQWVEILDNDRNPIHGGSKIHVKLQYFGVEADRNWNQ  159



>ref|XP_007135745.1| hypothetical protein PHAVU_010G155000g [Phaseolus vulgaris]
 gb|ESW07739.1| hypothetical protein PHAVU_010G155000g [Phaseolus vulgaris]
Length=809

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 119/158 (75%), Gaps = 1/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LH  +YEVDK+   G  N F K+ +  E  VG  K  ++LYATIDLEKARV
Sbjct  1    MAQILLHGTLHATIYEVDKLHAGGGGNFFTKLKQNIEETVGIGKGVTKLYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ EH NP+W ESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P   +L G E
Sbjct  61   GRTRIIENEHTNPKWEESFHIYCAHVASDIIFTVKDDNPIGATLIGRAYVPVSEVLDGHE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            +D W+ +LD ++ PI   SKIHVKLQ+ DV ++R W R
Sbjct  121  IDRWVEILDTEKKPIQEGSKIHVKLQYFDVSKDRNWAR  158



>gb|AGN71005.1| phospholipase D1 [Brassica napus]
Length=810

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 122/159 (77%), Gaps = 2/159 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHN-LFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ LLHG+LH  +YEVD + T GL +  F KI+   E  +G  K  ++LYATIDL++AR
Sbjct  1    MAQHLLHGTLHATIYEVDDLHTGGLRSGFFGKILANVEETIGVGKGETQLYATIDLQRAR  60

Query  214  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + DE KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P  +++ GE
Sbjct  61   VGRTRKIKDEAKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYVPVDQVIHGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EVD+W+  LDNDRNPIH  SKIHVKLQ+  V  +R W +
Sbjct  121  EVDQWVETLDNDRNPIHGGSKIHVKLQYFGVEADRNWNQ  159



>gb|AAG50297.1| phospholipase PLDa3 [Solanum lycopersicum]
Length=678

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 106/125 (85%), Gaps = 3/125 (2%)
 Frame = +1

Query  133  VEGAERVVGFNKTASRLYATIDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFS  312
            +EGA   +GFNKTAS LYATIDL KARVGRTRLLDEHKNPRWYESFHIYCAHMAS+VVF+
Sbjct  3    IEGA---IGFNKTASTLYATIDLGKARVGRTRLLDEHKNPRWYESFHIYCAHMASDVVFT  59

Query  313  VKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  492
            VK DNPIGAELIGRAY+P  +L+ GE VDEWL +LD +R P+H HSKIHVKLQ+ DV RE
Sbjct  60   VKADNPIGAELIGRAYLPVEQLIVGEVVDEWLEILDTERKPVHGHSKIHVKLQYFDVTRE  119

Query  493  RCWGR  507
              W R
Sbjct  120  YNWNR  124



>gb|ABB82551.1| phospholipase D-alpha [Cucumis melo var. inodorus]
Length=808

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 117/158 (74%), Gaps = 1/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M    LHG+LH  +YE+D++ T G  N+F  + +  E  VG  K  ++LYATIDLEKARV
Sbjct  1    MEGTSLHGTLHATIYEIDRLHTGGSSNVFSMLRQNFEEAVGIGKGQTKLYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+L+ E  NPRWYESFHIYCAH ASNV+F+VK DNPIGA LIGR Y+P   ++ GEE
Sbjct  61   GRTRILESEPSNPRWYESFHIYCAHKASNVIFTVKDDNPIGATLIGRTYVPVEDIVDGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            VD W+P+LD ++NPI   SKIHVKLQ+  V ++R WGR
Sbjct  121  VDRWVPILDENQNPIEGESKIHVKLQYFSVTKDRNWGR  158



>ref|NP_001234102.1| phospholipase PLDa1 [Solanum lycopersicum]
 gb|AAG45485.1| phospholipase PLDa1 [Solanum lycopersicum]
Length=809

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 121/160 (76%), Gaps = 4/160 (3%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK--TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  210
            MAQ+ LHG+LHV ++EVD ++   +G H  F KI +  E  VG  K   +LYATIDLEKA
Sbjct  1    MAQIQLHGTLHVTIFEVDNLQGEEEGGH-FFSKIKQHFEETVGIGKGTPKLYATIDLEKA  59

Query  211  RVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  387
            RVGRTR+++ E KNPRWYESFHIYCAHMASNV+F++K DNP GA LIGRAY+P   LL G
Sbjct  60   RVGRTRIIENEPKNPRWYESFHIYCAHMASNVIFTIKDDNPFGASLIGRAYVPVEELLEG  119

Query  388  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EE+D+W+ ++D + NPI   SKIHVKLQF DV R+  WGR
Sbjct  120  EEIDKWVEIMDKEMNPIAEGSKIHVKLQFFDVSRDPNWGR  159



>gb|ABU54776.1| phospholipase D alpha 1 precursor [Helianthus annuus]
Length=810

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 120/159 (75%), Gaps = 2/159 (1%)
 Frame = +1

Query  37   MAQLL-LHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ   LHG+LHV +YEVDKI   G  N+F KIV   E  +GF K   ++YAT+DLEKAR
Sbjct  1    MAQKTHLHGTLHVTIYEVDKIHVAGGGNIFSKIVANIEETIGFGKGTPKMYATVDLEKAR  60

Query  214  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR++ DE + P+W ESFHIYCAH ASNV+F+VK DNP+GA LIGRAY+P   +L GE
Sbjct  61   VGRTRMITDEPETPKWNESFHIYCAHSASNVIFTVKDDNPVGATLIGRAYIPVEEILDGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            E+D W+ +LD D+NPI + SKIHVK+Q+ DV ++R W R
Sbjct  121  ELDRWVEILDEDKNPISAGSKIHVKVQYFDVTQDRNWDR  159



>ref|XP_002299756.1| phospholipase D family protein [Populus trichocarpa]
 gb|EEE84561.1| phospholipase D family protein [Populus trichocarpa]
Length=808

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 120/158 (76%), Gaps = 1/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LHV +YEVDKI   G H  FHK+V      VG     SRLYATIDLEKARV
Sbjct  1    MAQILLHGNLHVTIYEVDKIGEGGGHGFFHKLVGKVGEKVGIGNGISRLYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+L+ E  NPRWYESFHIYCAHMASNV+F+VK  NPIGA LIGRAY+P   +L GEE
Sbjct  61   GRTRILENEATNPRWYESFHIYCAHMASNVIFTVKDVNPIGATLIGRAYIPVEEILDGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            +D W+ +LD D+NPI + SKIHVKLQ+ D+  +  WGR
Sbjct  121  IDRWVEILDGDKNPIRAGSKIHVKLQYFDITNDHNWGR  158



>emb|CDX97705.1| BnaA05g23740D [Brassica napus]
Length=810

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 122/159 (77%), Gaps = 2/159 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHN-LFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ LLHG+LH  +YEVD + T GL +  F KI+   E  +G  K  ++LYATIDL++AR
Sbjct  1    MAQHLLHGTLHATIYEVDDLHTGGLRSGFFGKILANVEETIGVGKGETQLYATIDLQRAR  60

Query  214  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + DE KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P  ++L GE
Sbjct  61   VGRTRKIKDEAKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYVPVDQILHGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EVD+W+ +LDNDRNPI   SKIHVKLQ+  V  +R W +
Sbjct  121  EVDQWVEILDNDRNPIPGGSKIHVKLQYFGVEADRNWNQ  159



>ref|NP_001267897.1| phospholipase D alpha [Vitis vinifera]
 gb|ABC59316.1| phospholipase D alpha [Vitis vinifera]
Length=809

 Score =   202 bits (513),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 121/158 (77%), Gaps = 1/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LH  ++ +D++ + G    F K+VE  E  VGF K  S+LYATID+ +ARV
Sbjct  1    MAQILLHGTLHATIFGIDRLHSGGAPKFFRKLVENIEETVGFGKGTSKLYATIDIGRARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ E  NPRWYESFHIYCAHMA +++F+VK DNPIGA LIGRA +P + +LGGEE
Sbjct  61   GRTRMIENEPSNPRWYESFHIYCAHMAGHIIFTVKDDNPIGATLIGRASVPIQEILGGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            VD+W+ +++ +  PIH  SKIHVKLQ+ +V  +R WGR
Sbjct  121  VDKWVEIVNEELKPIHGGSKIHVKLQYFEVTADRSWGR  158



>gb|EYU21635.1| hypothetical protein MIMGU_mgv1a001489mg [Erythranthe guttata]
 gb|EYU21636.1| hypothetical protein MIMGU_mgv1a001489mg [Erythranthe guttata]
Length=809

 Score =   202 bits (513),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 121/158 (77%), Gaps = 1/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LH  +YEVD +      N F K++E  E  VGF K  +++YA+IDLEKARV
Sbjct  1    MAQILLHGTLHATIYEVDTLHAGKGGNFFGKLMENIEETVGFGKGTAKIYASIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ E  NPRWYESFHIYCAHMASNV+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61   GRTRIIEKEPNNPRWYESFHIYCAHMASNVIFTVKDDNPIGATLIGRAYVPVEELLEGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            VD+W+ +LD D NP+   SKIHVKLQF DV R+R W R
Sbjct  121  VDKWVEILDTDMNPVSEGSKIHVKLQFFDVTRDRNWAR  158



>ref|XP_004171103.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase D alpha 1-like, 
partial [Cucumis sativus]
Length=534

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 118/158 (75%), Gaps = 1/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M    LHG+LH  +YE+D++ T G  N+F  + +  E  VG  K  ++LYATIDLEKARV
Sbjct  1    MEGTSLHGTLHATIYEIDRLHTGGSSNVFSMLRQNFEEAVGIGKGQTKLYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+L+ +  NP+W ESFHIYCAH ASNV+F+VK DNPIGA LIGRAY+P   ++ GEE
Sbjct  61   GRTRILESDPSNPKWNESFHIYCAHKASNVIFTVKDDNPIGATLIGRAYVPVEDIVDGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            VD+W+P+LD ++NPI   SKIHVKLQ+  V ++R WGR
Sbjct  121  VDKWVPILDENQNPIEEESKIHVKLQYFSVTKDRNWGR  158



>ref|XP_008805616.1| PREDICTED: phospholipase D alpha 1-like [Phoenix dactylifera]
 ref|XP_008805617.1| PREDICTED: phospholipase D alpha 1-like [Phoenix dactylifera]
Length=810

 Score =   201 bits (512),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 118/160 (74%), Gaps = 3/160 (2%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK--TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  210
            MA +LLHG+LHV ++E D +   + G      ++V G E  +G  K +S+LYATIDLEKA
Sbjct  1    MAHILLHGTLHVTIFEADSLSRASAGAPKFIRQLVGGIEDAIGLGKGSSKLYATIDLEKA  60

Query  211  RVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  387
            RVGRTRL+ DE  NPRWYESFHIYCAHMA+NV+F+VK DNPIGA LIGRAY+P   +L G
Sbjct  61   RVGRTRLITDEPVNPRWYESFHIYCAHMAANVIFTVKFDNPIGASLIGRAYLPVAEILDG  120

Query  388  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EE D WL + D DRNP+   +KIHVK+Q+ D+ ++R W R
Sbjct  121  EEADRWLEICDEDRNPLDGGAKIHVKVQYFDISKDRNWAR  160



>ref|XP_008792036.1| PREDICTED: phospholipase D alpha 1 [Phoenix dactylifera]
 ref|XP_008792037.1| PREDICTED: phospholipase D alpha 1 [Phoenix dactylifera]
Length=813

 Score =   201 bits (511),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 120/163 (74%), Gaps = 6/163 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LH  ++E D +      + G    F ++VEG E  +G  K +S+LYATIDL
Sbjct  1    MAQILLHGTLHATIFEADSLSNPNRSSGGAPKFFRQLVEGIEDTIGLGKGSSKLYATIDL  60

Query  202  EKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             KARVGRTRL+  E  NPRWYESFHIYCAHMA+NV+F+VK DNPIGA LIGRAY+P   +
Sbjct  61   GKARVGRTRLITKEPVNPRWYESFHIYCAHMAANVIFTVKFDNPIGASLIGRAYLPVTEI  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            L G+EVD+W+ + D DRNP+   +KIHVK+Q+ D+ ++R W R
Sbjct  121  LYGQEVDKWIEICDEDRNPLDGGAKIHVKVQYFDISKDRNWAR  163



>sp|O04865.1|PLDA1_VIGUN RecName: Full=Phospholipase D alpha 1; Short=PLD alpha 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Vigna unguiculata]
 gb|AAB51392.1| phospholipase D [Vigna unguiculata]
Length=809

 Score =   201 bits (511),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 120/158 (76%), Gaps = 1/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LH  +YEVD++   G  N F K+ +  E  VG  K  ++LYATIDLEKARV
Sbjct  1    MAQILLHGTLHATIYEVDELHGGGGGNFFSKLKQNIEETVGIGKGVTKLYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ E  NP+W ESFHIYC H+ASN++F+VK DNPIGA LIGRAY+P   +L G E
Sbjct  61   GRTRIIENETTNPKWNESFHIYCGHLASNIIFTVKDDNPIGATLIGRAYVPVSEVLDGHE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            +D+W+ +LD ++NPI   SKIHV+LQ+ DV+++R W R
Sbjct  121  IDKWVEILDTEKNPIEGGSKIHVRLQYFDVLKDRNWAR  158



>ref|XP_010322318.1| PREDICTED: phospholipase PLDa1 isoform X1 [Solanum lycopersicum]
 ref|XP_010322320.1| PREDICTED: phospholipase PLDa1 isoform X1 [Solanum lycopersicum]
 ref|XP_010322321.1| PREDICTED: phospholipase PLDa1 isoform X1 [Solanum lycopersicum]
 gb|AAF17557.1|AF201661_1 phospholipase D alpha [Solanum lycopersicum]
Length=809

 Score =   201 bits (510),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 120/160 (75%), Gaps = 4/160 (3%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK--TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  210
            MAQ+ LHG+LHV ++EVD ++   +G H  F KI +  E  VG  K   +LYATIDLEKA
Sbjct  1    MAQIQLHGTLHVTIFEVDNLQGEEEGGH-FFSKIKQHFEETVGIGKGTPKLYATIDLEKA  59

Query  211  RVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  387
            RVGRTR+++ E KNPRWYESFHIYCAHMASNV+F++K DNP GA LIGRAY+P   LL G
Sbjct  60   RVGRTRIIENEPKNPRWYESFHIYCAHMASNVIFTIKDDNPFGASLIGRAYVPVEELLEG  119

Query  388  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EE+D+W+ ++D + NP    SKIHVKLQF DV R+  WGR
Sbjct  120  EEIDKWVEIMDKEMNPTAEGSKIHVKLQFFDVSRDPNWGR  159



>ref|XP_010907269.1| PREDICTED: phospholipase D alpha 1 [Elaeis guineensis]
 ref|XP_010907270.1| PREDICTED: phospholipase D alpha 1 [Elaeis guineensis]
Length=813

 Score =   201 bits (510),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 120/163 (74%), Gaps = 6/163 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LHV ++E + +      + G      ++VEG E  +G  K +S+LYATIDL
Sbjct  1    MAQILLHGTLHVTIFEANSLSNPNRASGGAPKFIRQLVEGIEDTIGLGKGSSKLYATIDL  60

Query  202  EKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTRL+  E  NPRWYESFHIYCAHM++NV+F+VK DNPIGA LIGRAY+P   +
Sbjct  61   EKARVGRTRLITKEPVNPRWYESFHIYCAHMSANVIFTVKFDNPIGASLIGRAYLPVTEI  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            L GEEVD W+ + D DRNP+   ++IHVK+Q+ D+ ++R W R
Sbjct  121  LNGEEVDRWIEICDEDRNPLDGGARIHVKVQYFDISKDRNWAR  163



>gb|KHG06123.1| Phospholipase D alpha 1 [Gossypium arboreum]
Length=807

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 117/158 (74%), Gaps = 2/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M + LLHG+LH  +YEVD++  DG  N F K+V   +  +G  K   ++YATIDLE+ARV
Sbjct  1    MEETLLHGTLHATIYEVDRLH-DGGGNFFGKLVANVQETIGIGKGVPKIYATIDLERARV  59

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR ++ E  NPRWYESFHIYCAH ASNVVF+VK DNPIGA LIGRAY+P + L  G+E
Sbjct  60   GRTRTIENETSNPRWYESFHIYCAHNASNVVFTVKDDNPIGATLIGRAYVPVKDLTEGDE  119

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            VD W+ +LD D+NPI S  KIHVKLQ+ DV ++R W R
Sbjct  120  VDRWVVILDEDKNPIKSGGKIHVKLQYFDVTKDRNWAR  157



>gb|AGV22363.1| phospholipase D3 [Brassica napus]
Length=810

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 121/159 (76%), Gaps = 2/159 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHN-LFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ LLHG+LH  +YEVD + T GL +  F KI+   E  +G  K  ++LYAT DL++ R
Sbjct  1    MAQHLLHGTLHATIYEVDDLHTGGLRSGFFGKILANVEETIGVGKGETQLYATTDLQRVR  60

Query  214  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + DE +NP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P  +++ GE
Sbjct  61   VGRTRKIKDEAENPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYVPVDQVIHGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EVD+W+ +LDNDRNPIH  SKIHVKLQ+  V  +R W +
Sbjct  121  EVDQWVEILDNDRNPIHGGSKIHVKLQYFGVEADRNWNQ  159



>ref|XP_007150745.1| hypothetical protein PHAVU_005G177200g [Phaseolus vulgaris]
 gb|ESW22739.1| hypothetical protein PHAVU_005G177200g [Phaseolus vulgaris]
Length=808

 Score =   199 bits (505),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 120/158 (76%), Gaps = 1/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ++LHG+LH  +YEVD +K     N+  K++   E  +G  K  ++LYATIDLEKARV
Sbjct  1    MAQVVLHGTLHATIYEVDNLKAGNGGNILTKLLHNMEETIGIGKGITKLYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ EH NP+WYESFHIYCAH ASN++F+VK DNPIGA LIGRAY+P   +L GEE
Sbjct  61   GRTRVIEKEHTNPKWYESFHIYCAHEASNIIFTVKDDNPIGATLIGRAYVPVEEILHGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            ++ W+ +LD  + PIH+ SKIHVKLQ+ DV ++  WG+
Sbjct  121  IERWVEILDEHKKPIHTRSKIHVKLQYYDVSKDLNWGQ  158



>gb|AHN53202.1| phospholipase D alpha 1-like protein [Cocos nucifera]
Length=813

 Score =   199 bits (505),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 119/163 (73%), Gaps = 6/163 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LHV ++E D +      + G      ++VEG E  +G  K +++LYATIDL
Sbjct  1    MAQILLHGTLHVTIFEADSLSNPNRASGGAPKFIRQLVEGIEDTIGLGKGSTKLYATIDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             KARVGRTRL+ +E  NPRWYESFHIYCAHMA+NV+F+VK DNPIGA LIGRAY+P   +
Sbjct  61   GKARVGRTRLITNEPVNPRWYESFHIYCAHMAANVIFTVKFDNPIGASLIGRAYLPVTEI  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            L GEEVD W+ + D DRNP+   +KIHVK+Q+ D+ ++  W R
Sbjct  121  LDGEEVDRWIEIWDEDRNPLDGGAKIHVKVQYFDISKDHNWAR  163



>ref|XP_004135845.1| PREDICTED: phospholipase D alpha 1-like [Cucumis sativus]
 gb|KGN45278.1| hypothetical protein Csa_7G432600 [Cucumis sativus]
Length=808

 Score =   199 bits (505),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 118/158 (75%), Gaps = 1/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M    LHG+LH  +YE+D++ T G  N+F  + +  E  VG  K  ++LYATIDLEKARV
Sbjct  1    MEGTSLHGTLHATIYEIDRLHTGGSSNVFSMLRQNFEEAVGIGKGQTKLYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+L+ +  NP+W ESFHIYCAH ASNV+F+VK DNPIGA LIGRAY+P   ++ GEE
Sbjct  61   GRTRILESDPSNPKWNESFHIYCAHKASNVIFTVKDDNPIGATLIGRAYVPVEDIVDGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            VD+W+P+LD ++NPI   SKIHVKLQ+  V ++R WGR
Sbjct  121  VDKWVPILDENQNPIEEESKIHVKLQYFSVTKDRNWGR  158



>gb|ABN13537.2| phospholipase D [Cucumis sativus]
Length=808

 Score =   199 bits (505),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 118/158 (75%), Gaps = 1/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M    LHG+LH  +YE+D++ T G  N+F  + +  E  VG  K  ++LYATIDLEKARV
Sbjct  1    MEGTSLHGTLHATIYEIDRLHTGGSSNVFSMLRQNFEEAVGIGKGQTKLYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+L+ +  NP+W ESFHIYCAH ASNV+F+VK DNPIGA LIGRAY+P   ++ GEE
Sbjct  61   GRTRILESDPSNPKWNESFHIYCAHKASNVIFTVKDDNPIGATLIGRAYVPVEDIVDGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            VD+W+P+LD ++NPI   SKIHVKLQ+  V ++R WGR
Sbjct  121  VDKWVPILDENQNPIEEESKIHVKLQYFSVTKDRNWGR  158



>gb|ADP23922.1| phospholipase D alpha [Litchi chinensis]
Length=800

 Score =   198 bits (504),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 122/158 (77%), Gaps = 8/158 (5%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LH  +YEVD++ T G  + F K++       G  K  S++YATIDLEKARV
Sbjct  1    MAQILLHGTLHATIYEVDQLDTGGGGHFFRKLI-------GLGKGQSKIYATIDLEKARV  53

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ +H NPRWYESFHIYCAHMAS+V+F+VK DN +GA LIGRA++P   +LGGEE
Sbjct  54   GRTRIIEKDHANPRWYESFHIYCAHMASDVIFTVKDDNAVGASLIGRAHVPVEEILGGEE  113

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            VD+W+ LLD  +NPI + SKIHVKLQ+ DV ++R + R
Sbjct  114  VDKWVELLDEHKNPIEAGSKIHVKLQYFDVTKDRNFSR  151



>ref|XP_006643814.1| PREDICTED: phospholipase D alpha 1-like [Oryza brachyantha]
Length=812

 Score =   198 bits (504),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 118/163 (72%), Gaps = 7/163 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LH  + E   +      +        K VEG E  VG  K A+++Y+TIDL
Sbjct  1    MAQMLLHGTLHATILEAASLSNPHRASGSAPKFIRKFVEGIEDTVGVGKGATKVYSTIDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTR++ +E  NPRWYESFHIYCAHMASNV+F+VK+DNPIGA  IGRAY+PA+ L
Sbjct  61   EKARVGRTRMITNEPINPRWYESFHIYCAHMASNVIFTVKIDNPIGATNIGRAYLPAQEL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            L GEE+D WL + DNDR P+   SKIHVKLQ+ DV ++R W R
Sbjct  121  LSGEEIDRWLDICDNDRQPV-GESKIHVKLQYFDVAKDRNWAR  162



>ref|XP_010250112.1| PREDICTED: phospholipase D alpha 1 [Nelumbo nucifera]
Length=815

 Score =   198 bits (503),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 118/160 (74%), Gaps = 5/160 (3%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHN----LFHKIVEGAERVVGFNKTASRLYATIDLE  204
            M+ +LLHGSLHV +YEVD++ + G         H+IVE     VG  K   ++YAT+DLE
Sbjct  1    MSDILLHGSLHVTIYEVDRLSSGGGGGGPGGFLHQIVENIGEAVGIGKDTPKIYATVDLE  60

Query  205  KARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLL  381
            KARVGRTR+++ E  NPRWYESFHIYCAHMASNV+F+VK D+ IGA L GRAY+P   +L
Sbjct  61   KARVGRTRIIENERVNPRWYESFHIYCAHMASNVIFTVKDDDAIGATLYGRAYVPVEEIL  120

Query  382  GGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCW  501
             GEEVD WL +LD+DRNP+   SKIHV+LQF DV R+R W
Sbjct  121  NGEEVDRWLEILDDDRNPVREGSKIHVRLQFFDVTRDRNW  160



>ref|XP_006842069.1| hypothetical protein AMTR_s00078p00051300 [Amborella trichopoda]
 gb|ERN03744.1| hypothetical protein AMTR_s00078p00051300 [Amborella trichopoda]
Length=815

 Score =   198 bits (503),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 119/163 (73%), Gaps = 6/163 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LHV +YE + +      T G      ++VEG E  +GF K A +LYATIDL
Sbjct  1    MAQILLHGTLHVTIYEAESLSNPHRATGGAPKFIRQLVEGIEETIGFGKGAGKLYATIDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTR+L +E  NPRWYESFHIYCAHMAS+++F+VK DNPIGA LIGRA++P   +
Sbjct  61   EKARVGRTRILTNESVNPRWYESFHIYCAHMASDIIFTVKDDNPIGASLIGRAHVPVEEV  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            + G+EVD W  + D +R PI   +KIHVKLQ+ DV +++ W R
Sbjct  121  INGDEVDTWAEICDENRKPIGGGAKIHVKLQYFDVTKDQNWSR  163



>ref|XP_002882959.1| PLDALPHA1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59218.1| PLDALPHA1 [Arabidopsis lyrata subsp. lyrata]
Length=810

 Score =   197 bits (502),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 119/159 (75%), Gaps = 2/159 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ LLHG+LH  +YEVD +   G+   F  KI+   E  +G  K  ++LYATIDL+KAR
Sbjct  1    MAQHLLHGTLHATIYEVDALHGGGVRQGFLGKILANVEETIGVGKGETQLYATIDLQKAR  60

Query  214  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + +E KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P   ++ GE
Sbjct  61   VGRTRKIKNEPKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYIPVDEVINGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EVD W+ +LDNDRNPIH  SKIHVKLQ+  V  +R W +
Sbjct  121  EVDRWVEILDNDRNPIHGGSKIHVKLQYFHVEEDRNWNK  159



>ref|XP_008673445.1| PREDICTED: phospholipase D alpha 1 isoform X1 [Zea mays]
 ref|XP_008673446.1| PREDICTED: phospholipase D alpha 1 isoform X1 [Zea mays]
 gb|ACN25900.1| unknown [Zea mays]
 gb|ACN27927.1| unknown [Zea mays]
 gb|ACN28359.1| unknown [Zea mays]
 gb|ACN29073.1| unknown [Zea mays]
 tpg|DAA53244.1| TPA: phospholipase D family protein [Zea mays]
Length=812

 Score =   197 bits (502),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 122/163 (75%), Gaps = 7/163 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LH  ++E + +      T G      K+VEG E  VG  K A+++YAT+DL
Sbjct  1    MAQILLHGTLHATIFEAESLSNPHRATGGAPKFIRKLVEGIEDTVGVGKGATKIYATVDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTR++ +E  NPRWYESFHIYCAHMA++V+F+VK+DN IGA LIGRAY+P + L
Sbjct  61   EKARVGRTRMISNEPVNPRWYESFHIYCAHMAADVIFTVKIDNSIGASLIGRAYLPVQDL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            LGGEE+D+WL + D +R P+   SKIHVKLQ+ DV ++R W R
Sbjct  121  LGGEEIDKWLEICDENREPV-GDSKIHVKLQYFDVGKDRNWAR  162



>gb|ACR35730.1| unknown [Zea mays]
Length=812

 Score =   197 bits (502),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 122/163 (75%), Gaps = 7/163 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LH  ++E + +      T G      K+VEG E  VG  K A+++YAT+DL
Sbjct  1    MAQILLHGTLHATIFEAESLSNPHRATGGAPKFIRKLVEGIEDTVGVGKGATKIYATVDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTR++ +E  NPRWYESFHIYCAHMA++V+F+VK+DN IGA LIGRAY+P + L
Sbjct  61   EKARVGRTRMISNEPVNPRWYESFHIYCAHMAADVIFTVKIDNSIGASLIGRAYLPVQDL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            LGGEE+D+WL + D +R P+   SKIHVKLQ+ DV ++R W R
Sbjct  121  LGGEEIDKWLEICDENREPV-GDSKIHVKLQYFDVGKDRNWAR  162



>gb|ACG63794.1| phospholipase D alpha [Gossypium arboreum]
 gb|ACG70840.1| phospholipase D alpha [Gossypium arboreum]
 gb|ADD83098.1| PLDalpha isoform 2 [Gossypium hirsutum]
 gb|ADD83099.1| PLDalpha [Gossypium hirsutum]
 gb|ADD83100.1| PLDalpha [Gossypium hirsutum]
 gb|ADD83104.1| PLDalpha isoform 1 [Gossypium hirsutum]
Length=807

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 116/158 (73%), Gaps = 2/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M + LLHG+LH  +YEVD++  DG  N F K+V   +  +G  K   ++YATIDLE+ARV
Sbjct  1    MEETLLHGTLHATIYEVDRLH-DGGGNFFGKLVANVQETIGIGKGVPKIYATIDLERARV  59

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR ++ E  NPRWYESFHIYCAH ASNVVF+VK DNPIGA  IGRAY+P + L  G+E
Sbjct  60   GRTRTIENETSNPRWYESFHIYCAHNASNVVFTVKDDNPIGATQIGRAYVPVKDLTEGDE  119

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            VD W+ +LD D+NPI S  KIHVKLQ+ DV ++R W R
Sbjct  120  VDRWVVILDEDKNPIKSGGKIHVKLQYFDVTKDRNWAR  157



>gb|ACL53693.1| unknown [Zea mays]
Length=812

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 122/163 (75%), Gaps = 7/163 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LH  ++E + +      T G      K+VEG E  VG  K A+++YAT+DL
Sbjct  1    MAQILLHGTLHATIFEAESLSNPHRATGGAPKFTRKLVEGIEDTVGVGKGATKIYATVDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTR++ +E  NPRWYESFHIYCAHMA++V+F+VK+DN IGA LIGRAY+P + L
Sbjct  61   EKARVGRTRMISNEPVNPRWYESFHIYCAHMAADVIFTVKIDNSIGASLIGRAYLPVQDL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            LGGEE+D+WL + D +R P+   SKIHVKLQ+ DV ++R W R
Sbjct  121  LGGEEIDKWLEICDENREPV-GDSKIHVKLQYFDVGKDRNWAR  162



>ref|XP_009381115.1| PREDICTED: phospholipase D alpha 1 [Musa acuminata subsp. malaccensis]
Length=812

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 120/163 (74%), Gaps = 7/163 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LH  ++E + +      + G      K+VEG E  VG  K +S+LYATIDL
Sbjct  1    MAQILLHGTLHATIFEAESLTNPHRASGGAPKFLRKLVEGIEDTVGIGKGSSKLYATIDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTR++ +E  +PRWYESFHIYCAHMA+NV+F+VK DNPIGA LIGRAY+P   +
Sbjct  61   EKARVGRTRMITNEPVSPRWYESFHIYCAHMAANVIFTVKFDNPIGASLIGRAYLPVMEI  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            L GEEVD WL + D DRNP+   +KIHVK+Q+ D+ ++R W R
Sbjct  121  LDGEEVDRWLEICDADRNPV-GDAKIHVKVQYFDISKDRNWAR  162



>ref|XP_008654846.1| PREDICTED: phospholipase D family protein isoform X1 [Zea mays]
 ref|XP_008654847.1| PREDICTED: phospholipase D family protein isoform X1 [Zea mays]
 gb|AFW80165.1| phospholipase D family protein [Zea mays]
Length=812

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 120/163 (74%), Gaps = 7/163 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LH  ++E + +      T G      K+VEG E  VG  K  +++YAT+DL
Sbjct  1    MAQILLHGTLHATIFEAESLSNPHRATGGAPKFIRKLVEGIEDTVGIGKGTTKIYATVDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTR++ +E  NPRWYESFHIYCAHMA++VVF+VK+DNPIGA LIGRAY+P   +
Sbjct  61   EKARVGRTRMVSNEPVNPRWYESFHIYCAHMAADVVFTVKIDNPIGASLIGRAYLPVEDI  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            LGG+E+D+WL + D  R PI   SKIHVKLQ+ DV ++R W R
Sbjct  121  LGGDEIDKWLEICDEKREPI-GDSKIHVKLQYFDVGKDRNWAR  162



>ref|XP_007023176.1| Phospholipase D alpha 2 isoform 3 [Theobroma cacao]
 gb|EOY25798.1| Phospholipase D alpha 2 isoform 3 [Theobroma cacao]
Length=670

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 117/159 (74%), Gaps = 2/159 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLH-NLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            M  +LLHG+LHV +YE DK+ + G   + F K++   E  +G  K   ++YATIDLE+AR
Sbjct  1    MEDILLHGTLHVTIYEADKLHSGGGGGHFFRKLMANVEETIGIGKGIPKIYATIDLERAR  60

Query  214  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR+++ E  NPRWYESFHIYCAH ASNVVF+VK DNPIGA LIGRAY+    LL GE
Sbjct  61   VGRTRIIEKEISNPRWYESFHIYCAHRASNVVFTVKDDNPIGATLIGRAYVSVDELLSGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EVD W+ +LD D+NPI S  KIHVKLQ+ DV R+R W R
Sbjct  121  EVDRWVEILDEDKNPIESGGKIHVKLQYFDVTRDRNWNR  159



>ref|NP_188194.1| phospholipase D alpha 1 [Arabidopsis thaliana]
 sp|Q38882.2|PLDA1_ARATH RecName: Full=Phospholipase D alpha 1; Short=AtPLDalpha1; Short=PLD 
alpha 1; AltName: Full=Choline phosphatase 1; AltName: 
Full=PLDalpha; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Arabidopsis thaliana]
 dbj|BAB02304.1| phospholipase D [Arabidopsis thaliana]
 dbj|BAE98964.1| phospholipase D [Arabidopsis thaliana]
 gb|AEE75720.1| phospholipase D alpha 1 [Arabidopsis thaliana]
Length=810

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 119/157 (76%), Gaps = 2/157 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ LLHG+LH  +YEVD +   G+   F  KI+   E  +G  K  ++LYATIDL+KAR
Sbjct  1    MAQHLLHGTLHATIYEVDALHGGGVRQGFLGKILANVEETIGVGKGETQLYATIDLQKAR  60

Query  214  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + +E KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P  +++ GE
Sbjct  61   VGRTRKIKNEPKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYIPVDQVINGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCW  501
            EVD+W+ +LDNDRNPI   SKIHVKLQ+  V  +R W
Sbjct  121  EVDQWVEILDNDRNPIQGGSKIHVKLQYFHVEEDRNW  157



>gb|KJB70611.1| hypothetical protein B456_011G083000 [Gossypium raimondii]
Length=665

 Score =   195 bits (496),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 116/158 (73%), Gaps = 2/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M + LLHG+LH  +YEVD++  DG  N F K+V   +  +G  K   ++YATIDLE+ARV
Sbjct  1    MEETLLHGTLHATIYEVDRLH-DGGGNFFGKLVANVQETIGIGKGVPKIYATIDLERARV  59

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR ++ E  NPRW+ESFHIYCAH ASNVVF+VK DNPIGA LIGRAY+P + L  G+E
Sbjct  60   GRTRTIENETSNPRWFESFHIYCAHNASNVVFTVKDDNPIGATLIGRAYVPVKDLTEGDE  119

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            VD W+ +LD D+NPI S  KIHVKLQ+  V ++R W R
Sbjct  120  VDRWVEILDEDKNPIKSGGKIHVKLQYFGVTKDRNWDR  157



>ref|XP_006364211.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Solanum tuberosum]
Length=805

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 117/158 (74%), Gaps = 7/158 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MA +LLHG+LHV ++EVD++      N F K        VG  K ASR+YAT+DLEKARV
Sbjct  1    MAPILLHGTLHVTIHEVDRLHGKHGRNFFSK------ETVGMGKGASRIYATVDLEKARV  54

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ E  NPRWYESFHIYCAHMA NV+F+VK +N IGA LIGRAY+P   LL GEE
Sbjct  55   GRTRVIENEPNNPRWYESFHIYCAHMAKNVIFTVKDNNSIGATLIGRAYLPVNDLLEGEE  114

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            VDEW+ +LD D NPI + SKIHV LQ+ ++ R+R WGR
Sbjct  115  VDEWIEILDEDENPIEAGSKIHVTLQYFEISRDRNWGR  152



>ref|XP_007023174.1| Phospholipase D alpha 2 isoform 1 [Theobroma cacao]
 ref|XP_007023175.1| Phospholipase D alpha 2 isoform 1 [Theobroma cacao]
 gb|EOY25796.1| Phospholipase D alpha 2 isoform 1 [Theobroma cacao]
 gb|EOY25797.1| Phospholipase D alpha 2 isoform 1 [Theobroma cacao]
Length=809

 Score =   196 bits (497),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 117/159 (74%), Gaps = 2/159 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLH-NLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            M  +LLHG+LHV +YE DK+ + G   + F K++   E  +G  K   ++YATIDLE+AR
Sbjct  1    MEDILLHGTLHVTIYEADKLHSGGGGGHFFRKLMANVEETIGIGKGIPKIYATIDLERAR  60

Query  214  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR+++ E  NPRWYESFHIYCAH ASNVVF+VK DNPIGA LIGRAY+    LL GE
Sbjct  61   VGRTRIIEKEISNPRWYESFHIYCAHRASNVVFTVKDDNPIGATLIGRAYVSVDELLSGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EVD W+ +LD D+NPI S  KIHVKLQ+ DV R+R W R
Sbjct  121  EVDRWVEILDEDKNPIESGGKIHVKLQYFDVTRDRNWNR  159



>ref|NP_001042153.1| Os01g0172400 [Oryza sativa Japonica Group]
 sp|Q43007.2|PLDA1_ORYSJ RecName: Full=Phospholipase D alpha 1; Short=PLD alpha 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1; Flags: Precursor [Oryza 
sativa Japonica Group]
 dbj|BAF04067.1| Os01g0172400 [Oryza sativa Japonica Group]
 gb|EEE53959.1| hypothetical protein OsJ_00559 [Oryza sativa Japonica Group]
Length=812

 Score =   196 bits (497),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 118/163 (72%), Gaps = 7/163 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LH  ++E   +      +        K VEG E  VG  K A+++Y+TIDL
Sbjct  1    MAQMLLHGTLHATIFEAASLSNPHRASGSAPKFIRKFVEGIEDTVGVGKGATKVYSTIDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTR++ +E  NPRWYESFHIYCAHMASNV+F+VK+DNPIGA  IGRAY+P + L
Sbjct  61   EKARVGRTRMITNEPINPRWYESFHIYCAHMASNVIFTVKIDNPIGATNIGRAYLPVQEL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            L GEE+D WL + DN+R P+   SKIHVKLQ+ DV ++R W R
Sbjct  121  LNGEEIDRWLDICDNNREPV-GESKIHVKLQYFDVSKDRNWAR  162



>gb|EEC70024.1| hypothetical protein OsI_00588 [Oryza sativa Indica Group]
Length=812

 Score =   196 bits (497),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 118/163 (72%), Gaps = 7/163 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LH  ++E   +      +        K VEG E  VG  K A+++Y+TIDL
Sbjct  1    MAQMLLHGTLHATIFEAASLSNPHRASGSAPKFIRKFVEGIEDTVGVGKGATKVYSTIDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTR++ +E  NPRWYESFHIYCAHMASNV+F+VK+DNPIGA  IGRAY+P + L
Sbjct  61   EKARVGRTRMITNEPINPRWYESFHIYCAHMASNVIFTVKIDNPIGATNIGRAYLPVQEL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            L GEE+D WL + DN+R P+   SKIHVKLQ+ DV ++R W R
Sbjct  121  LNGEEIDRWLDICDNNREPV-GESKIHVKLQYFDVSKDRNWAR  162



>gb|ACG63795.1| phospholipase D alpha [Gossypium raimondii]
 gb|ACG70839.1| phospholipase D alpha [Gossypium raimondii]
 gb|ACV70145.1| phospholipase D [Gossypium raimondii]
 gb|ADD83101.1| PLDalpha [Gossypium hirsutum]
 gb|ADD83102.1| PLDalpha [Gossypium hirsutum]
 gb|ADD83103.1| PLDalpha isoform 1 [Gossypium hirsutum]
 gb|ADD83105.1| PLDalpha isoform 2 [Gossypium hirsutum]
 gb|KJB70610.1| hypothetical protein B456_011G083000 [Gossypium raimondii]
 gb|KJB70614.1| hypothetical protein B456_011G083000 [Gossypium raimondii]
Length=807

 Score =   196 bits (497),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 116/158 (73%), Gaps = 2/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M + LLHG+LH  +YEVD++  DG  N F K+V   +  +G  K   ++YATIDLE+ARV
Sbjct  1    MEETLLHGTLHATIYEVDRLH-DGGGNFFGKLVANVQETIGIGKGVPKIYATIDLERARV  59

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR ++ E  NPRW+ESFHIYCAH ASNVVF+VK DNPIGA LIGRAY+P + L  G+E
Sbjct  60   GRTRTIENETSNPRWFESFHIYCAHNASNVVFTVKDDNPIGATLIGRAYVPVKDLTEGDE  119

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            VD W+ +LD D+NPI S  KIHVKLQ+  V ++R W R
Sbjct  120  VDRWVEILDEDKNPIKSGGKIHVKLQYFGVTKDRNWDR  157



>ref|XP_009348321.1| PREDICTED: phospholipase D alpha 1 [Pyrus x bretschneideri]
Length=810

 Score =   195 bits (495),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 115/160 (72%), Gaps = 2/160 (1%)
 Frame = +1

Query  28   LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  207
            ++E     LHG+LH  +YEVDK+ +    N F KI    E  VG  K  S+LYAT+DLE+
Sbjct  1    MTEAENQWLHGTLHATIYEVDKLHSSS-GNFFRKITGKIEETVGIGKGISKLYATVDLER  59

Query  208  ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  384
            ARVGRTR+++ E  NPRWYESFHIYCAH  +NV+F+VK  NPIGA LIGRAY+P + L+ 
Sbjct  60   ARVGRTRVIEKEPSNPRWYESFHIYCAHTTANVIFTVKESNPIGASLIGRAYVPVQELIE  119

Query  385  GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWG  504
            GEEVD+W  +LD  +NP+H + KIHVKLQF  V ++R WG
Sbjct  120  GEEVDQWAEILDEKKNPVHGNPKIHVKLQFFHVTKDRSWG  159



>ref|XP_006297003.1| hypothetical protein CARUB_v10012996mg [Capsella rubella]
 gb|EOA29901.1| hypothetical protein CARUB_v10012996mg [Capsella rubella]
Length=810

 Score =   195 bits (495),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 118/159 (74%), Gaps = 2/159 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ LLHG+LH  +YEVD +   G+   F  KI+   E  +G  K  ++LYATIDL+KAR
Sbjct  1    MAQHLLHGTLHATIYEVDALHGGGVRQGFLGKILANVEETIGVGKGETQLYATIDLQKAR  60

Query  214  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + +E KNP+WYESFHIYCAH+AS+++F++K DNPIGA LIGRAY+P   ++ GE
Sbjct  61   VGRTRKIKNEPKNPKWYESFHIYCAHLASDIIFTIKDDNPIGATLIGRAYIPVDEVINGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EVD W+ +LDNDRNPI   SKIHVKLQ+  V  +R W +
Sbjct  121  EVDRWVEILDNDRNPIQGGSKIHVKLQYFHVEEDRNWNK  159



>ref|XP_009408983.1| PREDICTED: phospholipase D alpha 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009408984.1| PREDICTED: phospholipase D alpha 1-like [Musa acuminata subsp. 
malaccensis]
Length=809

 Score =   195 bits (495),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 117/160 (73%), Gaps = 4/160 (3%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTD--GLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  210
            MAQ+LLHG+LH  +++ + +     G       +VEG E  +G  K  ++ YATIDLEKA
Sbjct  1    MAQILLHGTLHATIFDAESLTNPQRGSGGFLRMVVEGIEDTIGLGKGTTKHYATIDLEKA  60

Query  211  RVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  387
            RVGRTR+L DE  NPRWYESFHIYCAHMA+NV+F++K DNPIGA LIGRAY+P   +L G
Sbjct  61   RVGRTRMLSDEPVNPRWYESFHIYCAHMAANVIFTIKFDNPIGATLIGRAYLPVMEILDG  120

Query  388  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            +EVD WL + D DRNP+   +KIHVKLQ+ DV+++R W R
Sbjct  121  DEVDRWLEICDEDRNPV-GDAKIHVKLQYFDVLKDRNWAR  159



>ref|XP_003569355.1| PREDICTED: phospholipase D alpha 1 [Brachypodium distachyon]
Length=811

 Score =   195 bits (495),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 119/162 (73%), Gaps = 6/162 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLE  204
            MAQ+LLHG+LHV ++E   +     + G      K VEG E  VG  K AS+LYATIDLE
Sbjct  1    MAQILLHGNLHVTIFEASSLSNPRASGGAPKFLRKFVEGIEDTVGVGKGASKLYATIDLE  60

Query  205  KARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLL  381
            KARVGRTR+L +E  NPRWYESFHIYCAH+A++V+F+VK DN IGA LIGRAY+P + LL
Sbjct  61   KARVGRTRMLSNEPVNPRWYESFHIYCAHLAADVIFTVKADNAIGATLIGRAYLPVQELL  120

Query  382  GGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
             GEE+D WL + D++R P+   SKIHVKLQ+ D+ ++R W R
Sbjct  121  DGEEIDRWLEVRDDNREPV-GESKIHVKLQYFDISKDRNWSR  161



>ref|XP_010687988.1| PREDICTED: phospholipase D alpha 1-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010687989.1| PREDICTED: phospholipase D alpha 1-like [Beta vulgaris subsp. 
vulgaris]
Length=806

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 116/155 (75%), Gaps = 2/155 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MA++LLHG LHV +YE +++   G    FHK+VEG E V+G  K A +LYA+ID+E ARV
Sbjct  1    MAKILLHGVLHVTIYEANRLFGGGGGKFFHKVVEGLESVIG--KGAGKLYASIDIEGARV  58

Query  217  GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  396
            GRTRL++   NPRWYE FHI CAHMAS++VF++K D  IGA L+GRAY+PA  +LGGEEV
Sbjct  59   GRTRLVENDSNPRWYEQFHICCAHMASDIVFTLKEDEAIGATLLGRAYLPATDILGGEEV  118

Query  397  DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCW  501
            D WL +LD D NPIH  SK+HV +QF DV R+  W
Sbjct  119  DTWLDILDKDHNPIHKGSKVHVLVQFFDVTRDLNW  153



>gb|ACV70146.1| phospholipase D [Gossypium arboreum]
Length=807

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 115/158 (73%), Gaps = 2/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M + LLHG+LH  +YEVD++  DG  N F K+V   +  +G      ++YATIDLE+ARV
Sbjct  1    MEETLLHGTLHATIYEVDRLH-DGGGNFFGKLVANVQETIGIGIGVPKIYATIDLERARV  59

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR ++ E  NPRWYESFHIYCAH ASNVVF+VK DNPIGA  IGRAY+P + L  G+E
Sbjct  60   GRTRTIENETSNPRWYESFHIYCAHNASNVVFTVKDDNPIGATQIGRAYVPVKDLTEGDE  119

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            VD W+ +LD D+NPI S  KIHVKLQ+ DV ++R W R
Sbjct  120  VDRWVVILDEDKNPIKSGGKIHVKLQYFDVTKDRNWAR  157



>gb|ABX83202.2| phospholipase D [Lolium temulentum]
Length=811

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 116/162 (72%), Gaps = 6/162 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTD----GLHNLFHKIVEGAERVVGFNKTASRLYATIDLE  204
            MAQ+LLHG+LHV ++E   + T            KIVEG E  VG  K AS+LYATIDLE
Sbjct  1    MAQILLHGNLHVTIFEAQALSTGRASAAAPKFLRKIVEGLEDTVGVGKGASKLYATIDLE  60

Query  205  KARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLL  381
            KARVGRTR+L +E  +PRWYESFHIYCAH+A++V+F+VK DN IGA LIGRAY+P   LL
Sbjct  61   KARVGRTRMLANEPVSPRWYESFHIYCAHLAADVIFTVKADNAIGAALIGRAYLPVSELL  120

Query  382  GGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
             G+E+D WL + D DR PI   SKIHVKLQF +  ++R W R
Sbjct  121  AGDEIDRWLEVCDTDRQPI-GESKIHVKLQFFEATKDRNWAR  161



>ref|NP_001105686.1| phospholipase D alpha 1 [Zea mays]
 sp|Q43270.1|PLDA1_MAIZE RecName: Full=Phospholipase D alpha 1; Short=PLD alpha 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Zea mays]
 dbj|BAA11135.1| phospholipase D [Zea mays]
Length=812

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 121/163 (74%), Gaps = 7/163 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LH  ++E + +      T G      K+VEG E  VG  K A+++YAT+DL
Sbjct  1    MAQILLHGTLHATIFEAESLSNPHRATGGAPKFIRKLVEGIEDTVGVGKGATKIYATVDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTR++ +E  NPRWYESFHIYCAHMA++V+F+VK+DN IGA LIGRAY+  + L
Sbjct  61   EKARVGRTRMISNEPVNPRWYESFHIYCAHMAADVIFTVKIDNSIGASLIGRAYLAVQDL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            LGGEE+D+WL + D +R P+   SKIHVKLQ+ DV ++R W R
Sbjct  121  LGGEEIDKWLEISDENREPV-GDSKIHVKLQYFDVGKDRNWAR  162



>ref|XP_006406922.1| hypothetical protein EUTSA_v10020083mg [Eutrema salsugineum]
 ref|XP_006406923.1| hypothetical protein EUTSA_v10020083mg [Eutrema salsugineum]
 gb|ESQ48375.1| hypothetical protein EUTSA_v10020083mg [Eutrema salsugineum]
 gb|ESQ48376.1| hypothetical protein EUTSA_v10020083mg [Eutrema salsugineum]
Length=810

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 119/157 (76%), Gaps = 2/157 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ LLHG+LH  ++EVD +   G+   F  K++   E  +G  K  ++LYATIDL+KAR
Sbjct  1    MAQHLLHGTLHATIFEVDALHGGGIRQGFLGKVLANVEEKIGVGKGETQLYATIDLQKAR  60

Query  214  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + +E KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P  +++ GE
Sbjct  61   VGRTRKIKNEPKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYIPVDQVINGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCW  501
            EVD+W+ +LDNDRNPI   SKIHVKLQ+  V  +R W
Sbjct  121  EVDQWVEILDNDRNPIEGGSKIHVKLQYFHVEEDRNW  157



>ref|XP_010691149.1| PREDICTED: phospholipase D alpha 1-like [Beta vulgaris subsp. 
vulgaris]
Length=809

 Score =   193 bits (490),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 116/156 (74%), Gaps = 1/156 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LHV +YE   +       +F K++   E  VG  +   ++YATIDLEKAR 
Sbjct  1    MAQILLHGTLHVTIYEASDLHHGNDPGVFRKLMANIEETVGLGQGTPKMYATIDLEKARA  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ E  NPRWYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P   +LGGEE
Sbjct  61   GRTRIIENEPANPRWYESFHIYCAHLASSIIFTVKDDNPIGATLIGRAYVPVEEILGGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCW  501
            VD W+ + D D+NP+ S +KIHVKLQF ++ +ER +
Sbjct  121  VDRWVEICDRDKNPLDSGAKIHVKLQFFEITQERSF  156



>gb|ADY75750.1| phospholipase D alpha [Dimocarpus longan]
Length=800

 Score =   193 bits (490),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 120/158 (76%), Gaps = 8/158 (5%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LH  +YEVD++   G  + F K++       G  K  S++YATIDLEKARV
Sbjct  1    MAQILLHGTLHATIYEVDQLDRGGGGHFFRKLI-------GLGKGESKIYATIDLEKARV  53

Query  217  GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR++  +H NPRWYESFHIYCAHMAS+V+F+VK DN +GA LIGRA++P   +LGGEE
Sbjct  54   GRTRIIGKDHANPRWYESFHIYCAHMASDVIFTVKDDNAVGASLIGRAHVPVEEILGGEE  113

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            VD+W+ LLD  +NPI + SKIHVKLQ+ D+ ++R + R
Sbjct  114  VDKWVELLDEHKNPIEAGSKIHVKLQYFDIRKDRNFSR  151



>ref|XP_008373955.1| PREDICTED: phospholipase D alpha 1 [Malus domestica]
Length=810

 Score =   193 bits (490),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 115/160 (72%), Gaps = 2/160 (1%)
 Frame = +1

Query  28   LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  207
            ++E     LHG+LH  +YEVDK+ +    N   KI    E  VG  K  S+LYAT+DLE+
Sbjct  1    MTEAENHWLHGTLHATIYEVDKLHSSS-GNFLRKIAGKIEETVGIGKGISKLYATVDLER  59

Query  208  ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  384
            ARVGRTR+++ E  NPRWYESFHIYCAH A+NV+F+VK  NPIGA LIGRAY+P + L+ 
Sbjct  60   ARVGRTRVIEKEPSNPRWYESFHIYCAHTAANVIFTVKESNPIGASLIGRAYVPVQELIE  119

Query  385  GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWG  504
            GEEVD+W  +LD  +NP+H + KIHVKLQF  V ++R WG
Sbjct  120  GEEVDQWAEILDEKKNPVHGNPKIHVKLQFFHVTKDRSWG  159



>gb|AGW22212.1| phospholipase D alpha [Chorispora bungeana]
Length=809

 Score =   192 bits (489),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 115/158 (73%), Gaps = 1/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ LLHG+LH  +YEVD++          K++   E  +G  K  ++LY TIDL+KARV
Sbjct  1    MAQHLLHGTLHATIYEVDELHGGVRSGFLGKMLANVEEKIGVGKGETQLYTTIDLQKARV  60

Query  217  GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR + +E KNP+WYESFHIYC HMAS+++F+VK DNPIGA LIGRAY+P   ++ GEE
Sbjct  61   GRTRKIKNEPKNPKWYESFHIYCGHMASDIIFTVKDDNPIGATLIGRAYVPVDDVINGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            VD W+ +LDNDRNPIH  SKIHVKLQ+  V  +R W +
Sbjct  121  VDRWVEILDNDRNPIHGGSKIHVKLQYFHVEEDRNWNK  158



>ref|XP_010465563.1| PREDICTED: phospholipase D alpha 1-like [Camelina sativa]
Length=810

 Score =   192 bits (489),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 118/159 (74%), Gaps = 2/159 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ LLHG+LH  ++E+D +   G+   F  KI+   E  +G  K  ++LYATIDL+KAR
Sbjct  1    MAQHLLHGTLHATIFEIDALHGGGVRQGFLGKILANVEETIGVGKGETQLYATIDLQKAR  60

Query  214  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + +E KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P   ++ GE
Sbjct  61   VGRTRKIKNEPKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYIPVDEVINGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EVD W+ +LDND+NPI   SKIHVKLQ+  V  +R W +
Sbjct  121  EVDRWVEILDNDKNPIQGGSKIHVKLQYFHVEEDRNWNK  159



>ref|XP_010487412.1| PREDICTED: phospholipase D alpha 1 isoform X2 [Camelina sativa]
Length=810

 Score =   192 bits (489),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 117/159 (74%), Gaps = 2/159 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ LLHG+LH  +YE+D +   G+   F  KI+   E  +G  K  ++LYATIDL+KAR
Sbjct  1    MAQHLLHGTLHATIYEIDALHGGGVRQGFLGKILANVEETIGVGKGETQLYATIDLQKAR  60

Query  214  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + +E KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGR Y+P   ++ GE
Sbjct  61   VGRTRKIKNEPKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRGYIPVDEVINGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EVD W+ +LDND+NPI   SKIHVKLQ+  V  +R W +
Sbjct  121  EVDRWVEILDNDKNPIQGGSKIHVKLQYFHVEEDRNWNK  159



>dbj|BAA11136.1| phospholipase D [Oryza sativa Japonica Group]
 dbj|BAA19467.1| phospholipase D [Oryza sativa Japonica Group]
Length=812

 Score =   192 bits (488),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 117/163 (72%), Gaps = 7/163 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LH  ++E   +      +        K VEG E  VG  K A+++Y+TIDL
Sbjct  1    MAQMLLHGTLHATIFEAASLSNPHRASGSAPKFIRKFVEGIEDTVGVGKGATKVYSTIDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTR++ +E  NPRWYESFHIYCAHMASNV+F+VK+DNPIGA  IGRAY+P + L
Sbjct  61   EKARVGRTRMITNEPINPRWYESFHIYCAHMASNVIFTVKIDNPIGATNIGRAYLPVQEL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            L GEE+D WL + DN+R  +   SKIHVKLQ+ DV ++R W R
Sbjct  121  LNGEEIDRWLDICDNNRESV-GESKIHVKLQYFDVSKDRNWAR  162



>ref|XP_008360327.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase D alpha 1-like 
[Malus domestica]
Length=810

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 114/160 (71%), Gaps = 2/160 (1%)
 Frame = +1

Query  28   LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  207
            ++E     LHG+LH  +YEVDK+ +    N   KI    E  VG  K  SRLYAT+DLE+
Sbjct  1    MTEAENHWLHGTLHATIYEVDKLHSSS-GNFLRKITGKLEETVGIGKGISRLYATVDLER  59

Query  208  ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  384
            ARVGRTR+++ E  NPRWYESFHIYCAH A+NV+F+VK  NPIGA LIGRAY+P + L+ 
Sbjct  60   ARVGRTRVIEKEPSNPRWYESFHIYCAHTAANVIFTVKESNPIGASLIGRAYVPVQELIE  119

Query  385  GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWG  504
            GEEVD+W  +LD  + P+H + KIHVKLQF  V ++R WG
Sbjct  120  GEEVDQWAEILDGKKEPVHGNPKIHVKLQFFHVTKDRSWG  159



>gb|EMT03624.1| Phospholipase D alpha 1 [Aegilops tauschii]
Length=812

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 118/163 (72%), Gaps = 7/163 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LHV ++E   +      + G      K VEG E  VG  K +S+LYATIDL
Sbjct  1    MAQILLHGNLHVTIFEASSLSHPGRASGGAPKFIRKFVEGIEETVGVGKGSSKLYATIDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTR+L +E  NPRWYESFHIYCAH+A++V+F++K DN IGA LIGRAY+P   L
Sbjct  61   EKARVGRTRMLGNEPVNPRWYESFHIYCAHLAADVIFTMKADNAIGATLIGRAYLPVGEL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            LGGEE+D WL + D++R P+   SKIHVKLQ+  V ++R W R
Sbjct  121  LGGEEIDRWLEICDDNREPV-GESKIHVKLQYFGVDKDRNWAR  162



>gb|EYU24646.1| hypothetical protein MIMGU_mgv1a001477mg [Erythranthe guttata]
Length=812

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 113/156 (72%), Gaps = 1/156 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MA +LLHG+LH  + EVDK+      N F K++E     VG  K   ++YAT+DLEK+RV
Sbjct  1    MAHILLHGTLHATICEVDKLHGGADGNFFGKLMENIGETVGIGKGTPKIYATVDLEKSRV  60

Query  217  GRTRLLDEHKN-PRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTRL++   N PRWYESFHIYCAHMAS+V+F+VK  NPIGA LIGRAY+P   LL GEE
Sbjct  61   GRTRLIENEPNSPRWYESFHIYCAHMASSVIFTVKDANPIGATLIGRAYVPVHDLLDGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCW  501
            +D W+ +LD ++NP+   SKI VKLQF DV R+R W
Sbjct  121  IDRWVEILDENKNPVPEGSKIRVKLQFFDVTRDRNW  156



>gb|ACG80607.1| phospholipase D alpha [Prunus persica]
Length=810

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 115/160 (72%), Gaps = 2/160 (1%)
 Frame = +1

Query  28   LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  207
            ++E  +  LHG+LH  +YEVDK+ +    NL  KI    E  VG  K  SRLYAT+DLE+
Sbjct  1    MAEPQEQWLHGTLHATIYEVDKLHSSS-GNLLRKITGKIEETVGIGKGVSRLYATVDLER  59

Query  208  ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  384
            ARVGRTR+++ E  NPRWYESFHIYCAH+A+NV+F+VK  NPIGA LIGRAY+P   L+ 
Sbjct  60   ARVGRTRVIEKEPSNPRWYESFHIYCAHVAANVIFTVKESNPIGASLIGRAYVPVDDLVE  119

Query  385  GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWG  504
            GEEVD W  +LD  + P+H + KIHVKLQF  V ++R WG
Sbjct  120  GEEVDRWAEILDEKKRPVHGNPKIHVKLQFFHVTKDRSWG  159



>ref|XP_007217042.1| hypothetical protein PRUPE_ppa001519mg [Prunus persica]
 gb|EMJ18241.1| hypothetical protein PRUPE_ppa001519mg [Prunus persica]
Length=810

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 115/160 (72%), Gaps = 2/160 (1%)
 Frame = +1

Query  28   LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  207
            ++E  +  LHG+LH  +YEVDK+ +    NL  KI    E  VG  K  SRLYAT+DLE+
Sbjct  1    MAEPQEQWLHGTLHATIYEVDKLHSSS-GNLLRKITGKIEETVGIGKGVSRLYATVDLER  59

Query  208  ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  384
            ARVGRTR+++ E  NPRWYESFHIYCAH+A+NV+F+VK  NPIGA LIGRAY+P   L+ 
Sbjct  60   ARVGRTRVIEKEPSNPRWYESFHIYCAHVAANVIFTVKESNPIGASLIGRAYVPVDDLVE  119

Query  385  GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWG  504
            GEEVD W  +LD  + P+H + KIHVKLQF  V ++R WG
Sbjct  120  GEEVDRWAEILDEKKRPVHGNPKIHVKLQFFHVTKDRSWG  159



>ref|XP_008243731.1| PREDICTED: phospholipase D alpha 1 [Prunus mume]
 ref|XP_008243732.1| PREDICTED: phospholipase D alpha 1 [Prunus mume]
 ref|XP_008243733.1| PREDICTED: phospholipase D alpha 1 [Prunus mume]
Length=810

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 115/160 (72%), Gaps = 2/160 (1%)
 Frame = +1

Query  28   LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  207
            ++E  +  LHG+LH  +YEVDK+ +    NL  KI    E  VG  K  SRLYAT+DLE+
Sbjct  1    MAEPQEQWLHGTLHATIYEVDKLHSSS-GNLLRKITGKIEETVGIGKGVSRLYATVDLER  59

Query  208  ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  384
            ARVGRTR+++ E  NPRWYESFHIYCAH+A+NV+F+VK  NPIGA LIGRAY+P   L+ 
Sbjct  60   ARVGRTRVIEKEPSNPRWYESFHIYCAHVAANVIFTVKESNPIGASLIGRAYVPVDDLVE  119

Query  385  GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWG  504
            GEEVD W  +LD  + P+H + KIHVKLQF  V ++R WG
Sbjct  120  GEEVDRWAEILDEKKRPVHGNPKIHVKLQFFHVTKDRSWG  159



>ref|XP_010503392.1| PREDICTED: phospholipase D alpha 1-like [Camelina sativa]
Length=810

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 117/159 (74%), Gaps = 2/159 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ LLHG+LH  ++E+D +   G+   F  KI+   E  +G  K  ++LYATIDL+KAR
Sbjct  1    MAQHLLHGTLHATIFEIDALHGGGVRQGFLGKILANVEETIGVGKGETQLYATIDLQKAR  60

Query  214  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + +E KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGR Y+P   ++ GE
Sbjct  61   VGRTRKIKNEPKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRGYVPVDEVINGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EVD W+ +LDND+NPI   SKIHVKLQ+  V  +R W +
Sbjct  121  EVDRWVEILDNDKNPIQGGSKIHVKLQYFHVEEDRNWNK  159



>ref|XP_009365415.1| PREDICTED: phospholipase D alpha 1-like [Pyrus x bretschneideri]
Length=816

 Score =   190 bits (483),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 116/166 (70%), Gaps = 8/166 (5%)
 Frame = +1

Query  28   LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  207
            ++E     LHG+LH  +YEVDK+ +    N F KI    E  VG  K  S+LYAT+DLE+
Sbjct  1    MTEAENQWLHGTLHATIYEVDKLHSSS-GNFFRKITGKIEETVGIGKGISKLYATVDLER  59

Query  208  ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIG------RAYMP  366
            ARVGRTR+++ E  NPRWYESFHIYCAH A+NV+F+VK  NPIGA LIG      RAY+P
Sbjct  60   ARVGRTRVIEKEPSNPRWYESFHIYCAHTATNVIFTVKESNPIGASLIGGASLIGRAYVP  119

Query  367  ARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWG  504
             + L+ GEEVD+W  +LD  +NP+H + KIHVKLQF  V ++R WG
Sbjct  120  VQELIEGEEVDQWAEILDEKKNPVHGNPKIHVKLQFFHVTKDRSWG  165



>gb|EPS60466.1| hypothetical protein M569_14336, partial [Genlisea aurea]
Length=770

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = +1

Query  133  VEGAERVVGFNKTASRLYATIDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFS  312
             EG E  +GF KTASRLYATIDL  ARVGRTRLL+E  NPRWYESFHIYCAH  S+VVFS
Sbjct  1    AEGVEEALGFRKTASRLYATIDLGIARVGRTRLLEETSNPRWYESFHIYCAHTTSDVVFS  60

Query  313  VKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  492
            VK+DNPIGAE+IGRA + A  ++ GEE+D WLP+L++D   IH + KIHVKLQF DV RE
Sbjct  61   VKIDNPIGAEVIGRAALAAADIVVGEEIDAWLPILNSDHKAIHGNPKIHVKLQFFDVARE  120

Query  493  RCWGR  507
            RCW R
Sbjct  121  RCWSR  125



>emb|CDY63527.1| BnaAnng18990D, partial [Brassica napus]
Length=334

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 110/160 (69%), Gaps = 3/160 (2%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKI--KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  210
            M + LLHG LH  +YEVD +     G    F KI+   E  +G  K   +LYATIDLEKA
Sbjct  1    MEEFLLHGRLHATIYEVDSLHGSEGGRSGFFGKILANVEETIGVGKGEPQLYATIDLEKA  60

Query  211  RVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  387
            RVGRTR + +E  NP+W+ESFHIYC HMA +V+F+VK DNPIGA LIGRAY+P   +L G
Sbjct  61   RVGRTRKITNEPNNPKWHESFHIYCGHMAKHVIFTVKDDNPIGATLIGRAYIPVEDILHG  120

Query  388  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EEVD W+ +LD ++ P+   SKIHVKLQ+  V +++ W R
Sbjct  121  EEVDRWVEILDTEKKPVEGGSKIHVKLQYFGVEKDKNWNR  160



>emb|CDM81985.1| unnamed protein product [Triticum aestivum]
Length=812

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 116/163 (71%), Gaps = 7/163 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LHV ++E   +      + G      K VEG E  VG  K +S+LYATIDL
Sbjct  1    MAQILLHGNLHVTIFEASSLSHPGRASGGAPKFIRKFVEGIEETVGVGKGSSKLYATIDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTR+L +E  NPRWYESFHIYCAH+A++V+F++K DN IGA LIGRAY+P   L
Sbjct  61   EKARVGRTRMLGNEPVNPRWYESFHIYCAHLAADVIFTMKADNAIGATLIGRAYLPVAEL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            L GEE+D WL + D+ R P+   SKIHVKLQ+  V ++R W R
Sbjct  121  LEGEEIDRWLEICDDKREPV-GESKIHVKLQYFGVDKDRNWAR  162



>tpg|DAA53239.1| TPA: phospholipase D family protein, partial [Zea mays]
Length=205

 Score =   177 bits (449),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 110/147 (75%), Gaps = 7/147 (5%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LH  ++E + +      T G      K+VEG E  VG  K A+++YAT+DL
Sbjct  1    MAQILLHGTLHATIFEAESLSNPHRATGGAPKFIRKLVEGIEDTVGVGKGATKIYATVDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTR++ +E  NPRWYESFHIYCAHMA++V+F+VK+DN IGA LIGRAY+P + L
Sbjct  61   EKARVGRTRMISNEPVNPRWYESFHIYCAHMAADVIFTVKIDNSIGASLIGRAYLPVQDL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIH  459
            LGGEE+D+WL + D +R P+   SKIH
Sbjct  121  LGGEEIDKWLEICDENREPV-GDSKIH  146



>ref|XP_004303313.1| PREDICTED: phospholipase D alpha 1 [Fragaria vesca subsp. vesca]
Length=810

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 115/161 (71%), Gaps = 2/161 (1%)
 Frame = +1

Query  28   LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  207
            + + A+  LHG+LH  +YEVDK+      N   KI    E  VG  K  S+LYAT+DLE+
Sbjct  1    MGDAAEHWLHGTLHATIYEVDKLHGSS-GNFLRKITGKLEETVGLGKGVSKLYATVDLER  59

Query  208  ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  384
            ARVGRTR+++ E  NP+W+ESFHIYCAH+A+NV+F+VK  NPIGA LIGRAY+P  +L+ 
Sbjct  60   ARVGRTRVIEKEPSNPKWFESFHIYCAHVAANVIFTVKESNPIGASLIGRAYVPVEQLIE  119

Query  385  GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            GEEVD W  +LD+ + P+H   KIHVKLQF  V ++R WG+
Sbjct  120  GEEVDTWAEILDDKKKPVHGEPKIHVKLQFFHVSKDRSWGQ  160



>gb|AAW83125.1| phospholipase D alpha [Fragaria x ananassa]
Length=810

 Score =   187 bits (475),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 114/161 (71%), Gaps = 2/161 (1%)
 Frame = +1

Query  28   LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  207
            + + A+  LHG+LH  +YEVDK+      N   KI    E  VG  K  S+LYAT+DLE+
Sbjct  1    MGDSAEHWLHGTLHATIYEVDKLHGSS-GNFLRKITGKLEETVGLGKGVSKLYATVDLER  59

Query  208  ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  384
            ARVGRTR+++ E  NP W ESFHIYCAH+A+NV+F+VK  NPIGA LIGRAY+P  +L+ 
Sbjct  60   ARVGRTRVIEKEPSNPNWSESFHIYCAHVAANVIFTVKESNPIGASLIGRAYVPVEQLIE  119

Query  385  GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            GEEVD W  +LD+ +NP+H   KIHVKLQF  V ++R WG+
Sbjct  120  GEEVDTWAKILDDKKNPVHGEPKIHVKLQFFHVSKDRSWGQ  160



>tpg|DAA53240.1| TPA: phospholipase D family protein [Zea mays]
Length=243

 Score =   177 bits (450),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 110/147 (75%), Gaps = 7/147 (5%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LH  ++E + +      T G      K+VEG E  VG  K A+++YAT+DL
Sbjct  1    MAQILLHGTLHATIFEAESLSNPHRATGGAPKFIRKLVEGIEDTVGVGKGATKIYATVDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTR++ +E  NPRWYESFHIYCAHMA++V+F+VK+DN IGA LIGRAY+P + L
Sbjct  61   EKARVGRTRMISNEPVNPRWYESFHIYCAHMAADVIFTVKIDNSIGASLIGRAYLPVQDL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIH  459
            LGGEE+D+WL + D +R P+   SKIH
Sbjct  121  LGGEEIDKWLEICDENREPV-GDSKIH  146



>ref|NP_001267764.1| phospholipase D alpha 1-like [Setaria italica]
 gb|ADK60917.1| phospholipase D alpha 1 [Setaria italica]
Length=811

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 118/163 (72%), Gaps = 7/163 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LH  ++E  ++      + G      K+VEG E  VG  K  +++YATIDL
Sbjct  1    MAQILLHGTLHATIFEAQELSNPHRASGGAPKFIRKLVEGIEDTVGVGKGTTKIYATIDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EK RVGRTR++ +E  NPRWYESFHIYCAH+A++V+F+VK+DNPIGA LIGRA++P + L
Sbjct  61   EKTRVGRTRMISNEPANPRWYESFHIYCAHLAADVIFTVKIDNPIGATLIGRAHLPVQDL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            L G+E+D+WL + D    PI   SKIHVKLQ+ DV ++R W R
Sbjct  121  LDGKEIDKWLEICDEGGEPI-GGSKIHVKLQYFDVSKDRNWAR  162



>ref|XP_010462102.1| PREDICTED: phospholipase D alpha 2 [Camelina sativa]
 ref|XP_010462103.1| PREDICTED: phospholipase D alpha 2 [Camelina sativa]
 ref|XP_010462104.1| PREDICTED: phospholipase D alpha 2 [Camelina sativa]
Length=810

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 114/159 (72%), Gaps = 2/159 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            M + LLHG LH  +YEVD++ T+G  + F   I+   E  +G  K  ++LYATIDLEKAR
Sbjct  1    MEEFLLHGRLHATIYEVDRLNTEGGRSGFLGSILANVEETIGVGKGETQLYATIDLEKAR  60

Query  214  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR +  E KNP+WYESFHIYC HMA +V+F+VK  NPIGA LIGR Y+P   +L GE
Sbjct  61   VGRTRKISKEPKNPKWYESFHIYCGHMAKHVIFTVKDANPIGATLIGRGYVPVEDILHGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EVD W+ +LDN++NPI   SKIHVKLQ+  V +++ W R
Sbjct  121  EVDRWVEILDNEKNPIAGGSKIHVKLQYFGVEKDKNWNR  159



>ref|XP_006392903.1| hypothetical protein EUTSA_v10011246mg [Eutrema salsugineum]
 gb|ESQ30189.1| hypothetical protein EUTSA_v10011246mg [Eutrema salsugineum]
Length=813

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 114/159 (72%), Gaps = 2/159 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            M + +LHG LH  +YEVD++  +G  + F  +I+   E  +G  K  ++LYATIDLEKAR
Sbjct  1    MEEFMLHGRLHATIYEVDRLHVEGGRSGFLGQILANVEETIGVGKGETQLYATIDLEKAR  60

Query  214  VGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR +  E KNP+WYESFHIYC HMA +V+F+VK DNPIGA LIGRAY+P   +  GE
Sbjct  61   VGRTRKITKEPKNPKWYESFHIYCGHMAKHVIFTVKDDNPIGATLIGRAYVPVEDIFHGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EVD W+ +LD +R PI+  SKIHVKLQ+  V ++R W R
Sbjct  121  EVDRWVEILDTERKPINGGSKIHVKLQYFGVEKDRNWNR  159



>ref|XP_002894388.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70647.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=810

 Score =   184 bits (468),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 113/159 (71%), Gaps = 2/159 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            M + LLHG LH  +YEVD++  +G  + F   I+   E  +G  K  ++LYATIDLEKAR
Sbjct  1    MEEFLLHGRLHATIYEVDRLHAEGGRSGFLGSILANVEETIGVGKGETQLYATIDLEKAR  60

Query  214  VGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR +  E KNP+W+ESFHIYC HMA +V+F+VK  NPIGA LIGR Y+P   +L GE
Sbjct  61   VGRTRKITKEPKNPKWFESFHIYCGHMAKHVIFTVKDANPIGATLIGRGYIPVEDILHGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EVD W+ +LDND+NPI   SKIHVKLQ+  V +++ W R
Sbjct  121  EVDRWVDILDNDKNPIAGGSKIHVKLQYFGVEKDKNWNR  159



>ref|XP_010925209.1| PREDICTED: phospholipase D alpha 1-like [Elaeis guineensis]
 ref|XP_010925210.1| PREDICTED: phospholipase D alpha 1-like [Elaeis guineensis]
 ref|XP_010925211.1| PREDICTED: phospholipase D alpha 1-like [Elaeis guineensis]
Length=810

 Score =   184 bits (468),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 115/160 (72%), Gaps = 3/160 (2%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKT--DGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  210
            MA +LLHG+LH+ ++E D + +   G      ++VEG    +G  K +S+LYATID+EKA
Sbjct  1    MAYILLHGTLHITIFEADSLSSASGGGPKFIRQLVEGIGDTIGLGKGSSQLYATIDVEKA  60

Query  211  RVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  387
            RVGRTRL+ +E   PRWYESFHIYCAH+A++V+F+VK D PIGA L+GRAY+P   +L G
Sbjct  61   RVGRTRLITNEPVKPRWYESFHIYCAHLAASVIFTVKDDKPIGASLVGRAYLPVTEILDG  120

Query  388  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EE+D WL + D D  P+   +KIHVK+Q+ D+ ++R W R
Sbjct  121  EEIDRWLEICDEDSKPLDGGAKIHVKVQYFDISKDRNWAR  160



>ref|XP_010500868.1| PREDICTED: phospholipase D alpha 2-like isoform X2 [Camelina 
sativa]
Length=811

 Score =   184 bits (467),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 113/159 (71%), Gaps = 2/159 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            M + LLHG LH  +YEVD++  +G  + F   I+   E  +G  K  ++LYATIDLEKAR
Sbjct  1    MEEFLLHGRLHATIYEVDRLNAEGGRSGFLGSILANVEETIGVGKGETQLYATIDLEKAR  60

Query  214  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR +  E KNP+WYESFHIYC HMA +V+F+VK  NPIGA LIGR Y+P   +L GE
Sbjct  61   VGRTRKISKEPKNPKWYESFHIYCGHMAKHVIFTVKDANPIGATLIGRGYVPVEDILHGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EVD W+ +LDN++NPI   SKIHVKLQ+  V +++ W R
Sbjct  121  EVDRWVEILDNEKNPIAGGSKIHVKLQYFGVEKDKNWNR  159



>ref|XP_010500864.1| PREDICTED: phospholipase D alpha 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010500866.1| PREDICTED: phospholipase D alpha 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010500867.1| PREDICTED: phospholipase D alpha 2-like isoform X1 [Camelina 
sativa]
Length=811

 Score =   184 bits (467),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 113/159 (71%), Gaps = 2/159 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            M + LLHG LH  +YEVD++  +G  + F   I+   E  +G  K  ++LYATIDLEKAR
Sbjct  1    MEEFLLHGRLHATIYEVDRLNAEGGRSGFLGSILANVEETIGVGKGETQLYATIDLEKAR  60

Query  214  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR +  E KNP+WYESFHIYC HMA +V+F+VK  NPIGA LIGR Y+P   +L GE
Sbjct  61   VGRTRKISKEPKNPKWYESFHIYCGHMAKHVIFTVKDANPIGATLIGRGYVPVEDILHGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EVD W+ +LDN++NPI   SKIHVKLQ+  V +++ W R
Sbjct  121  EVDRWVEILDNEKNPIAGGSKIHVKLQYFGVEKDKNWNR  159



>ref|XP_006306783.1| hypothetical protein CARUB_v10008323mg, partial [Capsella rubella]
 gb|EOA39681.1| hypothetical protein CARUB_v10008323mg, partial [Capsella rubella]
Length=813

 Score =   184 bits (466),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 114/160 (71%), Gaps = 2/160 (1%)
 Frame = +1

Query  34   EMAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKA  210
            +M + LLHG LH  +YEVD++  +G  + F   I+   E  +G  K  ++LYATIDLEKA
Sbjct  3    KMDEFLLHGRLHATIYEVDRLNAEGGRSGFLGSILANVEETIGVGKGETQLYATIDLEKA  62

Query  211  RVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  387
            RVGRTR +  E KNP+WYESFHIYC HMA +V+F+VK  NPIGA LIGR Y+P   +L G
Sbjct  63   RVGRTRKISKEPKNPKWYESFHIYCGHMAKHVIFTVKDANPIGATLIGRGYVPVEDILHG  122

Query  388  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EEVD W+ +LDN++NPI   SKIHVKLQ+  V +++ W R
Sbjct  123  EEVDRWVEILDNEKNPIAGGSKIHVKLQYFGVEKDKNWNR  162



>gb|AAL48261.2|AF451979_1 phospholipase D1 [Papaver somniferum]
 gb|AAL48263.2|AF451981_1 phospholipase D1 [Papaver somniferum]
Length=813

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 123/163 (75%), Gaps = 6/163 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKI-----KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+ LHG+LHV ++E + I     KT G    F K+VE  E  VGF K AS LYA++DL
Sbjct  1    MAQISLHGTLHVTIFEANSISHPDRKTGGAPKFFRKLVENIEETVGFGKGASMLYASVDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            +KARVGRTR++ DE  NP+WYESFHIYCAHMA+NV+F+VK DNPIGA LIGRAY+P  ++
Sbjct  61   DKARVGRTRIIKDEPVNPKWYESFHIYCAHMAANVIFTVKDDNPIGATLIGRAYVPIDKV  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            L GEEVDEW+ ++D +RNP+    KIHVKLQ+ DV +++ W R
Sbjct  121  LSGEEVDEWVEVVDQERNPVQGGCKIHVKLQYFDVGQDKNWAR  163



>emb|CDX87920.1| BnaC06g09820D [Brassica napus]
Length=343

 Score =   176 bits (445),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 110/160 (69%), Gaps = 3/160 (2%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKI--KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  210
            M + LLHG LH  +YE+D +     G      K++   E  +G  K  ++LYATIDLEKA
Sbjct  1    MEEFLLHGRLHATIYEIDALHATQGGRSGFLGKMLANVEEKIGVGKGETQLYATIDLEKA  60

Query  211  RVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  387
            RVGRTR + +E K+P+W+ESFHIYC HMA +V+F+VK DNPIGA LIGR Y+P   +L G
Sbjct  61   RVGRTRKITNEPKSPKWHESFHIYCGHMAKHVIFTVKDDNPIGATLIGRGYVPVEDILHG  120

Query  388  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EEVD W+ +LD ++ PI   SKIHVKLQ+  V +++ W R
Sbjct  121  EEVDRWVEILDTEKKPIEGGSKIHVKLQYFGVEKDKNWNR  160



>ref|XP_002443625.1| hypothetical protein SORBIDRAFT_08g022520 [Sorghum bicolor]
 gb|EES17463.1| hypothetical protein SORBIDRAFT_08g022520 [Sorghum bicolor]
Length=813

 Score =   182 bits (461),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 120/166 (72%), Gaps = 9/166 (5%)
 Frame = +1

Query  28   LSEMAQLLLHGSLHVCVYEVDKI----KTDGLHNLF-HKIVEGAERVVGFNKTASRLYAT  192
            ++EM+  LLHG+LH  ++E   +    +  G    F  K+VEG E  VG  K ++++YAT
Sbjct  1    MAEMS--LLHGTLHATIFEAASLSNPQRASGRAPKFIRKLVEGIEESVGVGKGSTKIYAT  58

Query  193  IDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPA  369
            IDLEK RVGRTR++ +E  NPRWYESFHIYCAH A+NV+F+VK+DNPIGA LIGRAYMP 
Sbjct  59   IDLEKTRVGRTRIISNEPVNPRWYESFHIYCAHRAANVIFTVKIDNPIGASLIGRAYMPV  118

Query  370  RRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
              +L GEE+D+WL + D+ R PI  HSKIHVK+Q+ DV ++  W R
Sbjct  119  ADILVGEEIDKWLEICDDKREPI-GHSKIHVKIQYFDVSKDCNWAR  163



>gb|AAL48262.2|AF451980_1 phospholipase D2 [Papaver somniferum]
 gb|AAL48264.2|AF451982_1 phospholipase D2 [Papaver somniferum]
Length=813

 Score =   181 bits (460),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 123/163 (75%), Gaps = 6/163 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKI-----KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+ LHG+LHV ++E + I     KT G    F K+VE  E  VGF K AS LYA++DL
Sbjct  1    MAQISLHGTLHVTIFEANSISHPDRKTGGAPKFFRKLVENIEETVGFGKGASMLYASVDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            +KARVGRTR++ DE  NP+WYESFHIYCAHMA+NV+F+VK DNPIGA LIGRAY+P  ++
Sbjct  61   DKARVGRTRIIKDEPVNPKWYESFHIYCAHMAANVIFTVKDDNPIGATLIGRAYVPIDQV  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            L GEEVDEW+ ++D +RNP+    KIHVKLQ+ DV +++ W R
Sbjct  121  LSGEEVDEWVEVVDEERNPVQGGCKIHVKLQYFDVGQDKNWAR  163



>emb|CDY47540.1| BnaC03g69220D [Brassica napus]
Length=812

 Score =   181 bits (459),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 110/160 (69%), Gaps = 3/160 (2%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKI--KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  210
            M + LLHG LH  +YEVD +     G    F KI+   E  +G  K   +LYATIDLEKA
Sbjct  1    MEEFLLHGRLHATIYEVDSLHGSEGGRSGFFGKILANVEETIGVGKGEPQLYATIDLEKA  60

Query  211  RVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  387
            RVGRTR + +E  NP+W+ESFHIYC HMA +V+F+VK DNPIGA LIGRAY+P   +L G
Sbjct  61   RVGRTRKITNEPNNPKWHESFHIYCGHMAKHVIFTVKDDNPIGATLIGRAYIPVEDILHG  120

Query  388  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EEVD W+ +LD ++ P+   SKIHVKLQ+  V +++ W R
Sbjct  121  EEVDRWVEILDTEKKPVEGGSKIHVKLQYFGVEKDKNWNR  160



>ref|XP_009123823.1| PREDICTED: phospholipase D alpha 2-like [Brassica rapa]
Length=812

 Score =   181 bits (459),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 110/160 (69%), Gaps = 3/160 (2%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKI--KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  210
            M + LLHG LH  +YEVD +     G    F KI+   E  +G  K   +LYATIDLEKA
Sbjct  1    MEEFLLHGRLHATIYEVDSLHGSEGGRSGFFGKILANVEETIGVGKGEPQLYATIDLEKA  60

Query  211  RVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  387
            RVGRTR + +E  NP+W+ESFHIYC HMA +V+F+VK DNPIGA LIGRAY+P   +L G
Sbjct  61   RVGRTRKITNEPNNPKWHESFHIYCGHMAKHVIFTVKDDNPIGATLIGRAYIPVEDILHG  120

Query  388  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EEVD W+ +LD ++ P+   SKIHVKLQ+  V +++ W R
Sbjct  121  EEVDRWVEILDTEKKPVEGGSKIHVKLQYFGVEKDKNWNR  160



>ref|XP_010479770.1| PREDICTED: phospholipase D alpha 2-like [Camelina sativa]
 ref|XP_010479771.1| PREDICTED: phospholipase D alpha 2-like [Camelina sativa]
 ref|XP_010479772.1| PREDICTED: phospholipase D alpha 2-like [Camelina sativa]
Length=810

 Score =   181 bits (459),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 112/159 (70%), Gaps = 2/159 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            M + LLHG LH  +YEVD++  +G  + F   I+   E  +G  K  ++LYATIDLEKAR
Sbjct  1    MEEFLLHGRLHATIYEVDRLNAEGGRSGFLGSILANVEETIGVGKGETQLYATIDLEKAR  60

Query  214  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR +  E KNP+WYESFHIYC HMA +V+F+VK  NPIGA LIGR Y+P   +L GE
Sbjct  61   VGRTRKISKEPKNPKWYESFHIYCGHMAKHVIFTVKDANPIGATLIGRGYVPVEDILHGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EVD W+ +LDN++ PI   SKIHVK+Q+  V +++ W R
Sbjct  121  EVDRWVEILDNEKKPIAGGSKIHVKIQYFGVEKDKNWNR  159



>ref|XP_007204652.1| hypothetical protein PRUPE_ppa001528mg [Prunus persica]
 gb|EMJ05851.1| hypothetical protein PRUPE_ppa001528mg [Prunus persica]
Length=807

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 114/159 (72%), Gaps = 6/159 (4%)
 Frame = +1

Query  37   MAQ-LLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ +LLHG LH  +YEVD++  DG    F K+++   + V F K  S+ YATIDLE AR
Sbjct  1    MAQTVLLHGVLHTTIYEVDRLMADGCCIFFCKLLK---KSVEFGK-GSKFYATIDLENAR  56

Query  214  VGRTRLLDE-HKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTRLL+   +NPRW ESFHIYCAH ASNVVFS+K DN IGA++IGRAYMPA  LL GE
Sbjct  57   VGRTRLLENATQNPRWRESFHIYCAHKASNVVFSIKEDNAIGAKVIGRAYMPAAELLNGE  116

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EVD WL +LDN+  P+H  SKIHVKL F  V  +  W R
Sbjct  117  EVDRWLKILDNNNKPLHGGSKIHVKLCFSSVNEDPNWSR  155



>ref|NP_175666.1| phospholipase D alpha 2 [Arabidopsis thaliana]
 sp|Q9SSQ9.1|PLDA2_ARATH RecName: Full=Phospholipase D alpha 2; Short=AtPLDalpha2; Short=PLD 
alpha 2; AltName: Full=Choline phosphatase 2; AltName: 
Full=Phosphatidylcholine-hydrolyzing phospholipase D 2 [Arabidopsis 
thaliana]
 gb|AAD55607.1|AC008016_17 Similar to gb|AF090445 phospholipase D1 from Brassica oleacea 
[Arabidopsis thaliana]
 gb|AEE32825.1| phospholipase D alpha 2 [Arabidopsis thaliana]
Length=810

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 112/159 (70%), Gaps = 2/159 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            M + LLHG LH  +YEVD +  +G  + F   I+   E  +G  K  ++LYATIDLEKAR
Sbjct  1    MEECLLHGRLHATIYEVDHLHAEGGRSGFLGSILANVEETIGVGKGETQLYATIDLEKAR  60

Query  214  VGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR +  E KNP+W+ESFHIYC HMA +V+F+VK  NPIGA LIGR Y+P   +L GE
Sbjct  61   VGRTRKITKEPKNPKWFESFHIYCGHMAKHVIFTVKDANPIGATLIGRGYIPVEDILHGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EVD W+ +LDN++NPI   SKIHVKLQ+  V +++ W R
Sbjct  121  EVDRWVDILDNEKNPIAGGSKIHVKLQYFGVEKDKNWNR  159



>tpg|DAA53245.1| TPA: phospholipase D family protein, partial [Zea mays]
Length=332

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 104/128 (81%), Gaps = 2/128 (2%)
 Frame = +1

Query  127  KIVEGAERVVGFNKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNV  303
            ++VEG E  VG  K A+++YAT+DLEKARVGRTR++ +E  NPRWYESFHIYCAHMA++V
Sbjct  34   QLVEGIEDTVGVGKGATKIYATVDLEKARVGRTRMISNEPVNPRWYESFHIYCAHMAADV  93

Query  304  VFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  483
            +F+VK+DN IGA LIGRAY+P + LLGGEE+D+WL + D +R P+   SKIHVKLQ+ DV
Sbjct  94   IFTVKIDNSIGASLIGRAYLPVQDLLGGEEIDKWLEICDENREPV-GDSKIHVKLQYFDV  152

Query  484  VRERCWGR  507
             ++R W R
Sbjct  153  GKDRNWAR  160



>ref|XP_008242775.1| PREDICTED: phospholipase D alpha 1-like [Prunus mume]
Length=807

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 113/159 (71%), Gaps = 6/159 (4%)
 Frame = +1

Query  37   MAQ-LLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ +LLHG LH  +YEVD++   G    F K+++   + V F K  S+LYATIDLE AR
Sbjct  1    MAQTVLLHGVLHTTIYEVDRLMASGCSIFFCKLLK---KSVEFGK-GSKLYATIDLENAR  56

Query  214  VGRTRLLDE-HKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTRLL+   KNPRW ESFHIYCAH ASNVVFS+K DN IGA +IGRAYMPA  LL GE
Sbjct  57   VGRTRLLENATKNPRWRESFHIYCAHKASNVVFSIKEDNAIGATVIGRAYMPAAELLNGE  116

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EVD WL +LDN+  P+H  SKIHVKL+   V  +  W R
Sbjct  117  EVDRWLKILDNNNKPLHGGSKIHVKLRLSSVNEDPNWSR  155



>sp|O04883.1|PLDA1_PIMBR RecName: Full=Phospholipase D alpha 1; Short=PLD alpha 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Spuriopimpinella brachycarpa]
 gb|AAB70463.1| phospholipase D [Spuriopimpinella brachycarpa]
Length=808

 Score =   178 bits (452),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 112/157 (71%), Gaps = 1/157 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MA+ LLHG+LHV ++EVD +K   +      +     + +   K   ++YA+IDL+KARV
Sbjct  1    MAKTLLHGTLHVTIFEVDHLKAGSVVVFSESLRRTLRKPLVLAKGTPKIYASIDLDKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ E  NP+W ESFHIYC H ++NV+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61   GRTRMIENEPNNPKWNESFHIYCGHPSTNVIFTVKDDNPIGATLIGRAYLPVHELLEGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWG  504
            VD+W+ +LD D+NPI   SKIHVKLQ+ D+ ++R W 
Sbjct  121  VDKWVEILDEDKNPISEGSKIHVKLQYFDITQDRNWA  157



>ref|XP_009787005.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Nicotiana 
sylvestris]
Length=790

 Score =   178 bits (451),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 100/128 (78%), Gaps = 1/128 (1%)
 Frame = +1

Query  127  KIVEGAERVVGFNKTASRLYATIDLEKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNV  303
            KI E  E  VG  K AS++YAT+DLEKARVGRTR+++ E  NPRW ESFHIYCAHMASNV
Sbjct  11   KIKETVEETVGVGKGASKMYATVDLEKARVGRTRVIENEPSNPRWNESFHIYCAHMASNV  70

Query  304  VFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  483
            +F+VK +N IGA LIGRAY+P   LL GEEVDEW+ +LD D+NPI   SKIHV LQF D+
Sbjct  71   IFTVKDNNSIGATLIGRAYLPVNELLEGEEVDEWIEILDEDKNPIKEGSKIHVTLQFFDI  130

Query  484  VRERCWGR  507
             R+R WGR
Sbjct  131  SRDRNWGR  138



>ref|XP_010545768.1| PREDICTED: phospholipase D alpha 1 [Tarenaya hassleriana]
Length=810

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 114/159 (72%), Gaps = 2/159 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKI-KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ LLHG+LH  VYE+D +    G    F +++   E  +G  K  ++LYAT+DLEKAR
Sbjct  1    MAQRLLHGTLHATVYEIDHLHGGGGRSGFFGQLLANVEETIGVGKGETQLYATVDLEKAR  60

Query  214  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + D+  +P+W ESFHIYCAHMASN++F+VK  NPIGA LIGRAY+P   +  GE
Sbjct  61   VGRTRKIKDDPNSPKWNESFHIYCAHMASNIIFTVKDANPIGATLIGRAYVPVEEIWDGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EV++W+ +LD +RNPI   SKI V+LQ+ DV ++R W R
Sbjct  121  EVEKWVEILDTNRNPIKGDSKIRVRLQYFDVTKDRNWNR  159



>tpg|DAA53246.1| TPA: phospholipase D family protein [Zea mays]
Length=655

 Score =   176 bits (445),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +1

Query  121  FHKIVEGAERVVGFNKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMAS  297
            F ++VEG E  VG  K A+++YAT+DLEKARVGRTR++ +E  NPRWYESFHIYCAHMA+
Sbjct  5    FRQLVEGIEDTVGVGKGATKIYATVDLEKARVGRTRMISNEPVNPRWYESFHIYCAHMAA  64

Query  298  NVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFL  477
            +V+F+VK+DN IGA LIGRAY+P + LLGGEE+D+WL + D +R P+   SKIHVKLQ+ 
Sbjct  65   DVIFTVKIDNSIGASLIGRAYLPVQDLLGGEEIDKWLEICDENREPV-GDSKIHVKLQYF  123

Query  478  DVVRERCWGR  507
            DV ++R W R
Sbjct  124  DVGKDRNWAR  133



>ref|XP_006654096.1| PREDICTED: phospholipase D alpha 1-like [Oryza brachyantha]
Length=818

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 115/167 (69%), Gaps = 10/167 (6%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA++LLHG+LHV V+E D +      +        K+VEG E  VG  K  S++YATI L
Sbjct  1    MAKILLHGTLHVTVFEADGLSNPSRPSSQAPQFLRKLVEGIEDTVGVGKGTSKVYATIGL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            +KARVGRTR L D+   PRWYESFH+YCAH+AS+V+F++K  NPIG+ L+G AY+P R +
Sbjct  61   DKARVGRTRTLADDTAAPRWYESFHVYCAHLASDVLFTLKAKNPIGSSLLGVAYLPVRDI  120

Query  379  LGGEEVDEWLPLLDN---DRNPI-HSHSKIHVKLQFLDVVRERCWGR  507
              G EV+ WLPL D+   +R P+    SK+HVKLQ+ D+ ++R WGR
Sbjct  121  FAGAEVERWLPLCDDVDAERKPVGDGDSKVHVKLQYFDISKDRSWGR  167



>ref|XP_002440692.1| hypothetical protein SORBIDRAFT_09g005220 [Sorghum bicolor]
 gb|EES19122.1| hypothetical protein SORBIDRAFT_09g005220 [Sorghum bicolor]
Length=700

 Score =   175 bits (443),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 112/168 (67%), Gaps = 11/168 (7%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDG-----LHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA++LLHGSLHV ++E +++   G           K+VE  E  VG  K  S++YATI L
Sbjct  1    MARILLHGSLHVTIFEAEELSNSGRPSSQAPGFLRKLVETVEDTVGVGKGTSKIYATIGL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             KARVGRTR L DE  +PRWYESFH+YCAH+AS+VVF+++  NPIGA  +G AY+P R +
Sbjct  61   GKARVGRTRTLTDETASPRWYESFHVYCAHLASDVVFTIRAKNPIGASTVGVAYLPVRDI  120

Query  379  LGGEEVDEWLPLLDN-----DRNPIHSHSKIHVKLQFLDVVRERCWGR  507
              G EVD WL L D      +R P+ +  K+HVKLQ+ D+ ++R WGR
Sbjct  121  FDGHEVDRWLHLCDGGGDDKNRTPLETGGKVHVKLQYFDISKDRSWGR  168



>ref|XP_009144830.1| PREDICTED: phospholipase D alpha 2 [Brassica rapa]
Length=812

 Score =   176 bits (445),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 110/160 (69%), Gaps = 3/160 (2%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKI--KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  210
            M + LLHG LH  +YE+D +     G      K++   E  +G  K  ++LYATIDLEKA
Sbjct  1    MEEFLLHGRLHATIYEIDALHATQGGRSGFLGKMLANVEEKIGVGKGETQLYATIDLEKA  60

Query  211  RVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  387
            RVGRTR + +E K+P+W+ESFHIYC HMA +V+F+VK DNPIGA LIGR Y+P   +L G
Sbjct  61   RVGRTRKITNEPKSPKWHESFHIYCGHMAKHVIFTVKDDNPIGATLIGRGYVPVEDILHG  120

Query  388  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EEVD W+ +LD ++ PI   SKIHVKLQ+  V +++ W R
Sbjct  121  EEVDRWVEILDTEKKPIEGGSKIHVKLQYFGVEKDKNWNR  160



>emb|CDY60551.1| BnaA05g35700D [Brassica napus]
Length=812

 Score =   176 bits (445),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 110/160 (69%), Gaps = 3/160 (2%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKI--KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  210
            M + LLHG LH  +YE+D +     G      K++   E  +G  K  ++LYATIDLEKA
Sbjct  1    MEEFLLHGRLHATIYEIDALHATQGGRSGFLGKMLANVEEKIGVGKGETQLYATIDLEKA  60

Query  211  RVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  387
            RVGRTR + +E K+P+W+ESFHIYC HMA +V+F+VK DNPIGA LIGR Y+P   +L G
Sbjct  61   RVGRTRKITNEPKSPKWHESFHIYCGHMAKHVIFTVKDDNPIGATLIGRGYVPVEDILHG  120

Query  388  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EEVD W+ +LD ++ PI   SKIHVKLQ+  V +++ W R
Sbjct  121  EEVDRWVEILDTEKKPIEGGSKIHVKLQYFGVEKDKNWNR  160



>ref|XP_002524502.1| phopholipase d alpha, putative [Ricinus communis]
 gb|EEF37942.1| phopholipase d alpha, putative [Ricinus communis]
Length=725

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 111/158 (70%), Gaps = 1/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MA +LLHG L + ++EVD++   G    F KI+E  E  VG  K  S+LYATIDLE  +V
Sbjct  1    MAPVLLHGILDLTIFEVDRLSGSGCSKFFCKILENVEETVGCGKGFSKLYATIDLEGTKV  60

Query  217  GRTRLLDEHK-NPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR L   + +P+W ESFHIYCAH+ASNV FS+KV +PIG+++IGRAY+P   LL GE+
Sbjct  61   GRTRELKHARSDPQWDESFHIYCAHLASNVTFSIKVKDPIGSQVIGRAYLPVVELLNGEK  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            VD+WL +L+ +  P+H   KIHV++QFLD  +   W +
Sbjct  121  VDKWLRILNKNHKPLHRGLKIHVRVQFLDATKRSSWSK  158



>ref|NP_001054773.2| Os05g0171000 [Oryza sativa Japonica Group]
 dbj|BAF16687.2| Os05g0171000 [Oryza sativa Japonica Group]
Length=686

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 113/166 (68%), Gaps = 9/166 (5%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA++LLHG++HV ++E + +      +        K+VEG E  VG  K  S++YATI L
Sbjct  1    MAKILLHGTMHVTIFEAESLSNPSRPSSQAPQFLRKLVEGIEDTVGVGKGTSKVYATIGL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            +KARVGRTR L D+   PRWYESFH+YCAH+A++V F++K  NPIGA L+G  Y+P R +
Sbjct  61   DKARVGRTRTLADDTAAPRWYESFHVYCAHLATHVAFTLKAKNPIGASLLGVGYLPVRDV  120

Query  379  LGGEEVDEWLPLLDND--RNPI-HSHSKIHVKLQFLDVVRERCWGR  507
            L G+EVD WLPL D+   R PI     K+HVKLQ+ D+ ++R WGR
Sbjct  121  LAGDEVDRWLPLCDDTDARTPIGDGGGKVHVKLQYFDISKDRSWGR  166



>emb|CBI28204.3| unnamed protein product [Vitis vinifera]
Length=703

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 111/159 (70%), Gaps = 5/159 (3%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEG-AERVVGFNKTASRLYATIDLEKAR  213
            M Q L+HG+LH  +YEVD + T G  N   K+    ++R+VG     S++Y TIDLEKA 
Sbjct  2    MEQSLVHGTLHATIYEVDGLSTGGPWNFIQKVYTTLSKRIVG--APISKIYVTIDLEKAG  59

Query  214  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRT  LD E  NPRWY+SFHIYCAH AS+VVFSVK DNPIGA +IGRA++P   LL G 
Sbjct  60   VGRTSKLDNEDSNPRWYQSFHIYCAHKASHVVFSVKQDNPIGATVIGRAHLPVGELLEG-  118

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EVD WL L  +D  PI+  SK+HVKLQF+DV RE  W R
Sbjct  119  EVDRWLELFHHDHTPINGGSKLHVKLQFVDVTREFNWSR  157



>ref|XP_011070230.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase D alpha 1-like 
[Sesamum indicum]
Length=819

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 112/176 (64%), Gaps = 24/176 (14%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKI------------------KTDGLHNLFHKIVEGAERVVGF  162
            MA  LLHG+LH  ++E D++                  KT    + F + +  +  +VG 
Sbjct  1    MAPRLLHGTLHATIFEADRLQGGFSLSHLFGTTGNPQKKTKSFLSQFKRFLLCSPEIVG-  59

Query  163  NKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGA  339
                SR+YATIDLE+ARVGRTR++ +E  NPRW E FHIYCAH  SN+VF+VK DNPIGA
Sbjct  60   ----SRIYATIDLERARVGRTRVIQNEPSNPRWSEYFHIYCAHNVSNIVFTVKDDNPIGA  115

Query  340  ELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
             LIGRAY+P   L+ G  VD W+ +LD DRNPIH  SKIHVKLQF  V++E  W +
Sbjct  116  TLIGRAYLPVEELMSGHMVDRWIDILDEDRNPIHGGSKIHVKLQFFQVIQESSWSQ  171



>ref|XP_010656428.1| PREDICTED: phospholipase D alpha 1-like [Vitis vinifera]
Length=814

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 111/158 (70%), Gaps = 7/158 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M Q L+HG+LH  +YEVD + T G  N   K+   ++R+VG     S++Y TIDLEKA V
Sbjct  2    MEQSLVHGTLHATIYEVDGLSTGGPWNFIQKL---SKRIVG--APISKIYVTIDLEKAGV  56

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRT  LD E  NPRWY+SFHIYCAH AS+VVFSVK DNPIGA +IGRA++P   LL G E
Sbjct  57   GRTSKLDNEDSNPRWYQSFHIYCAHKASHVVFSVKQDNPIGATVIGRAHLPVGELLEG-E  115

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            VD WL L  +D  PI+  SK+HVKLQF+DV RE  W R
Sbjct  116  VDRWLELFHHDHTPINGGSKLHVKLQFVDVTREFNWSR  153



>ref|XP_002325225.2| hypothetical protein POPTR_0018s13110g [Populus trichocarpa]
 gb|EEF03790.2| hypothetical protein POPTR_0018s13110g [Populus trichocarpa]
Length=808

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 110/158 (70%), Gaps = 1/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M  +LLHG+LHV +YE  ++   G      KI+E  ++ VGF K   +LYA I LE+ RV
Sbjct  1    MEPVLLHGTLHVTIYEACRVFGSGCSKFCCKILENIDKTVGFGKGFCKLYAGIYLEETRV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTRLL+  H +P+W+ESFHIYCAH+ASNV+FSVK DNPI A +IG+AY+P   LL G+E
Sbjct  61   GRTRLLEHPHSDPQWFESFHIYCAHIASNVIFSVKEDNPIEAVVIGKAYLPVAELLDGKE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            V++WL +L  +  P+H  SKIHVK+QF D  +   W R
Sbjct  121  VEKWLNILHKNHRPLHKGSKIHVKVQFFDATKRHYWSR  158



>gb|AAU44332.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAY96710.1| hypothetical protein OsI_18631 [Oryza sativa Indica Group]
 dbj|BAH00843.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62492.1| hypothetical protein OsJ_17289 [Oryza sativa Japonica Group]
Length=824

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 113/166 (68%), Gaps = 9/166 (5%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA++LLHG++HV ++E + +      +        K+VEG E  VG  K  S++YATI L
Sbjct  1    MAKILLHGTMHVTIFEAESLSNPSRPSSQAPQFLRKLVEGIEDTVGVGKGTSKVYATIGL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            +KARVGRTR L D+   PRWYESFH+YCAH+A++V F++K  NPIGA L+G  Y+P R +
Sbjct  61   DKARVGRTRTLADDTAAPRWYESFHVYCAHLATHVAFTLKAKNPIGASLLGVGYLPVRDV  120

Query  379  LGGEEVDEWLPLLDND--RNPI-HSHSKIHVKLQFLDVVRERCWGR  507
            L G+EVD WLPL D+   R PI     K+HVKLQ+ D+ ++R WGR
Sbjct  121  LAGDEVDRWLPLCDDTDARTPIGDGGGKVHVKLQYFDISKDRSWGR  166



>ref|XP_008673447.1| PREDICTED: phospholipase D alpha 1 isoform X2 [Zea mays]
Length=810

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 104/128 (81%), Gaps = 2/128 (2%)
 Frame = +1

Query  127  KIVEGAERVVGFNKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNV  303
            ++VEG E  VG  K A+++YAT+DLEKARVGRTR++ +E  NPRWYESFHIYCAHMA++V
Sbjct  34   QLVEGIEDTVGVGKGATKIYATVDLEKARVGRTRMISNEPVNPRWYESFHIYCAHMAADV  93

Query  304  VFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  483
            +F+VK+DN IGA LIGRAY+P + LLGGEE+D+WL + D +R P+   SKIHVKLQ+ DV
Sbjct  94   IFTVKIDNSIGASLIGRAYLPVQDLLGGEEIDKWLEICDENREPV-GDSKIHVKLQYFDV  152

Query  484  VRERCWGR  507
             ++R W R
Sbjct  153  GKDRNWAR  160



>gb|AFW76092.1| phospholipase D family protein [Zea mays]
Length=529

 Score =   171 bits (434),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 111/168 (66%), Gaps = 11/168 (7%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA++LLHGSLHV ++E +++      +        K+VEG E  VG  K  S++YATI L
Sbjct  1    MARILLHGSLHVTIFEAEELSNSSRPSSQAPGFLRKLVEGIEDTVGVGKGTSKIYATIGL  60

Query  202  EKARVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             K RVGRTR L DE  +PRWYESFH+YCAH+AS+VVF+++  NPIGA  +G AY+P R +
Sbjct  61   GKTRVGRTRKLTDETASPRWYESFHVYCAHLASDVVFTIRAKNPIGASTVGVAYLPVRDI  120

Query  379  LGGEEVDEWLPLLDN-----DRNPIHSHSKIHVKLQFLDVVRERCWGR  507
              G EVD WL L D      DR P+ S  K+HV+LQ+ D+ ++  WG+
Sbjct  121  FEGHEVDRWLHLCDGGGDDKDRTPLESGGKVHVRLQYFDISKDHSWGK  168



>emb|CBI28205.3| unnamed protein product [Vitis vinifera]
Length=604

 Score =   172 bits (435),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 108/158 (68%), Gaps = 7/158 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M Q+LLHG+LH  +YEVD++ + G  N   K+    ER       +S++Y TIDL+KARV
Sbjct  1    MEQILLHGTLHGTIYEVDRLSSGGPWNFIDKLKRRIERA-----GSSKVYVTIDLDKARV  55

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR L+ E  NP W E FHIYCAH AS+VVFSVK +NPIGA +IGRA +P   LL G E
Sbjct  56   GRTRKLENEETNPHWSECFHIYCAHKASHVVFSVKQENPIGATVIGRAQLPVEELLEG-E  114

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            VD WL L  +DR PIH  SK+HVKLQF DV RE  W R
Sbjct  115  VDRWLELFHHDRTPIHGGSKLHVKLQFFDVTRECNWSR  152



>ref|XP_011017763.1| PREDICTED: phospholipase D alpha 1-like [Populus euphratica]
 ref|XP_011017764.1| PREDICTED: phospholipase D alpha 1-like [Populus euphratica]
Length=831

 Score =   173 bits (438),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 110/158 (70%), Gaps = 1/158 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M  +L+HG+LHV +YE  ++   G      KI+E  ++ VGF K   +LYA I LE+ARV
Sbjct  24   MEPVLIHGTLHVTIYEACRVFGSGCSKFCCKILENIDKNVGFGKGFCKLYAGIYLEEARV  83

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTRLL+  H +P+W+ESFHIYCAH+ASNV+FSVK DNPI A +IG+AY+P   LL G+E
Sbjct  84   GRTRLLEHPHSDPQWFESFHIYCAHIASNVIFSVKEDNPIEAVVIGKAYLPVAELLDGKE  143

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            VD+WL +L  +  P H  SKIHVK+QF D  +   W +
Sbjct  144  VDKWLDILHKNHRPPHKGSKIHVKVQFFDATKRHYWSK  181



>ref|XP_008650412.1| PREDICTED: phospholipase D alpha 1-like [Zea mays]
Length=733

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 111/168 (66%), Gaps = 11/168 (7%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA++LLHGSLHV ++E +++      +        K+VEG E  VG  K  S++YATI L
Sbjct  1    MARILLHGSLHVTIFEAEELSNSSRPSSQAPGFLRKLVEGIEDTVGVGKGTSKIYATIGL  60

Query  202  EKARVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             K RVGRTR L DE  +PRWYESFH+YCAH+AS+VVF+++  NPIGA  +G AY+P R +
Sbjct  61   GKTRVGRTRKLTDETASPRWYESFHVYCAHLASDVVFTIRAKNPIGASTVGVAYLPVRDI  120

Query  379  LGGEEVDEWLPLLDN-----DRNPIHSHSKIHVKLQFLDVVRERCWGR  507
              G EVD WL L D      DR P+ S  K+HV+LQ+ D+ ++  WG+
Sbjct  121  FEGHEVDRWLHLCDGGGDDKDRTPLESGGKVHVRLQYFDISKDHSWGK  168



>gb|KDP32412.1| hypothetical protein JCGZ_13337 [Jatropha curcas]
Length=810

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 112/158 (71%), Gaps = 3/158 (2%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MA +LLHG LHV ++E+D++      N F KIVE  E  V   K+ S++YATI+LE+AR+
Sbjct  1    MASVLLHGILHVTIFEIDRLSGSSCCNFFCKIVEKCEGTVACGKSISKIYATIELEEARI  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR L     NP+W+ESFHIYCAHMASNV FS+K+ +PIG+++IGRA +PA ++L GE 
Sbjct  61   GRTRELKHASSNPQWHESFHIYCAHMASNVTFSIKIKDPIGSQVIGRASLPAMQVLNGEA  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            ++ WL +L+    P+   SKIHVKLQF DV +   W +
Sbjct  121  LNTWLRILNKKNKPL--RSKIHVKLQFFDVSKGSNWSK  156



>ref|XP_002282187.3| PREDICTED: phospholipase D alpha 1-like [Vitis vinifera]
 ref|XP_010656427.1| PREDICTED: phospholipase D alpha 1-like [Vitis vinifera]
Length=814

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 108/158 (68%), Gaps = 7/158 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M Q+LLHG+LH  +YEVD++ + G  N   K+    ER       +S++Y TIDL+KARV
Sbjct  2    MEQILLHGTLHGTIYEVDRLSSGGPWNFIDKLKRRIERA-----GSSKVYVTIDLDKARV  56

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR L+ E  NP W E FHIYCAH AS+VVFSVK +NPIGA +IGRA +P   LL G E
Sbjct  57   GRTRKLENEETNPHWSECFHIYCAHKASHVVFSVKQENPIGATVIGRAQLPVEELLEG-E  115

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            VD WL L  +DR PIH  SK+HVKLQF DV RE  W R
Sbjct  116  VDRWLELFHHDRTPIHGGSKLHVKLQFFDVTRECNWSR  153



>ref|XP_003568837.1| PREDICTED: phospholipase D alpha 1-like [Brachypodium distachyon]
Length=822

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 109/163 (67%), Gaps = 6/163 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA++LLHG+LHV V+E + +      +        K+VEG E  VG  K  S  YAT+ L
Sbjct  1    MAKILLHGTLHVTVFEAEGLSNPSRPSSQAPQFLRKLVEGIEDTVGVGKGNSNFYATVSL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             + R+GRTR L DE  +PRW+ESFHIYCAH+AS+V+F++K  + IGA ++G  ++P R +
Sbjct  61   GQCRIGRTRTLSDESTSPRWFESFHIYCAHLASDVLFTIKAKSAIGASVVGTGFLPVRDI  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
              G+EV+ WLPL D+ RNP     K+HVKLQ+ D+ ++R WGR
Sbjct  121  FPGDEVERWLPLCDDARNPADGGGKVHVKLQYFDISKDRAWGR  163



>ref|XP_008649399.1| PREDICTED: phospholipase D alpha 1-like [Zea mays]
 ref|XP_008649400.1| PREDICTED: phospholipase D alpha 1-like [Zea mays]
Length=821

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 111/168 (66%), Gaps = 11/168 (7%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA++LLHGSLHV ++E +++      +        K+VEG E  VG  K  S++YATI L
Sbjct  1    MARILLHGSLHVTIFEAEELSNSSRPSSQAPGFLRKLVEGIEDTVGVGKGTSKIYATIGL  60

Query  202  EKARVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             K RVGRTR L DE  +PRWYESFH+YCAH+AS+VVF+++  NPIGA  +G AY+P R +
Sbjct  61   GKTRVGRTRKLTDETASPRWYESFHVYCAHLASDVVFTIRAKNPIGASTVGVAYLPVRDI  120

Query  379  LGGEEVDEWLPLLDN-----DRNPIHSHSKIHVKLQFLDVVRERCWGR  507
              G EVD WL L D      DR P+ S  K+HV+LQ+ D+ ++  WG+
Sbjct  121  FEGHEVDRWLHLCDGGGDDKDRTPLESGGKVHVRLQYFDISKDHSWGK  168



>gb|EYU32345.1| hypothetical protein MIMGU_mgv1a001383mg [Erythranthe guttata]
Length=828

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 112/176 (64%), Gaps = 24/176 (14%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKI------------------KTDGLHNLFHKIVEGAERVVGF  162
            MA  LLHG+LH  +YE D++                  +T    + F + V     VVG 
Sbjct  1    MAPRLLHGTLHATIYEADRLQGRFNFDLCGGTAGNPQKRTKRFLSQFKRYVLCRPEVVG-  59

Query  163  NKTASRLYATIDLEKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGA  339
                SR+YATIDLE+ARVGRTR+++ E  NPRWYE+FHIYCAH  SN+VF+VK DNPIGA
Sbjct  60   ----SRVYATIDLERARVGRTRMIENEPSNPRWYENFHIYCAHTVSNIVFTVKDDNPIGA  115

Query  340  ELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
             LIGRAY+P   L+ G  VD W+ ++D DRNPIH  SKIHVKLQ+  V +E  W +
Sbjct  116  ILIGRAYLPVEDLISGRAVDRWIEIVDEDRNPIHGGSKIHVKLQYFHVFQESNWSQ  171



>gb|AFW77332.1| phospholipase D family protein [Zea mays]
Length=925

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 111/168 (66%), Gaps = 11/168 (7%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA++LLHGSLHV ++E +++      +        K+VEG E  VG  K  S++YATI L
Sbjct  105  MARILLHGSLHVTIFEAEELSNSSRPSSQAPGFLRKLVEGIEDTVGVGKGTSKIYATIGL  164

Query  202  EKARVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             K RVGRTR L DE  +PRWYESFH+YCAH+AS+VVF+++  NPIGA  +G AY+P R +
Sbjct  165  GKTRVGRTRKLTDETASPRWYESFHVYCAHLASDVVFTIRAKNPIGASTVGVAYLPVRDI  224

Query  379  LGGEEVDEWLPLLDN-----DRNPIHSHSKIHVKLQFLDVVRERCWGR  507
              G EVD WL L D      DR P+ S  K+HV+LQ+ D+ ++  WG+
Sbjct  225  FEGHEVDRWLHLCDGGGDDKDRTPLESGGKVHVRLQYFDISKDHSWGK  272



>ref|XP_004965943.1| PREDICTED: phospholipase D alpha 2-like [Setaria italica]
Length=818

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 110/164 (67%), Gaps = 7/164 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA LLLHG+L   + E D +      T G   +F K VEG E  +G  + A+RLYAT+D+
Sbjct  1    MAHLLLHGTLDATILEADHLTNPTRATGGAPGIFRKFVEGFEDSLGLGQGATRLYATVDI  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             +ARVGRTR++  +  NPRWYE+FHIYCAH AS+VVFSVK   PIGA LIGRAY+P R L
Sbjct  61   GRARVGRTRVIAGDPVNPRWYEAFHIYCAHFASDVVFSVKAAQPIGATLIGRAYLPVRDL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE-RCWGR  507
            LGG E+D WL +LD  R  +    KI V+L+F DV  + R WGR
Sbjct  121  LGGHEIDRWLDVLDAARKRLPHGPKIRVRLRFQDVAADPRGWGR  164



>ref|XP_006656220.1| PREDICTED: phospholipase D alpha 2-like [Oryza brachyantha]
Length=820

 Score =   170 bits (431),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 108/164 (66%), Gaps = 7/164 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA LLLHG+L   + E D +      T G   +F K VEG E  +G  K A+RLYATIDL
Sbjct  1    MAHLLLHGTLEATILEADNLSDPTRATGGAPGIFRKFVEGFEDSLGLGKGATRLYATIDL  60

Query  202  EKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             +ARVGRTR++D E  NPRWYE FHIYCAH A++VVFSVK   PIGA LIGRAY+P R L
Sbjct  61   GRARVGRTRVVDGESVNPRWYEVFHIYCAHFAADVVFSVKAAQPIGATLIGRAYLPVRDL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRER-CWGR  507
            L G+ ++  L +LD  R  I     IHV+LQF DV  +R  WGR
Sbjct  121  LSGQAIERRLDVLDASRKRISHGPTIHVRLQFRDVAGDRHGWGR  164



>gb|KJB68102.1| hypothetical protein B456_010G225600 [Gossypium raimondii]
Length=805

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 111/157 (71%), Gaps = 4/157 (3%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MA+  LHG+LHV +YEV+K++  G    F K++   E  +G  K + +LYATIDLEKARV
Sbjct  1    MARTSLHGNLHVTIYEVNKLEGGGF---FRKLMANVEESIGIGKGSGKLYATIDLEKARV  57

Query  217  GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  396
            GRTR + E  +P W ESFHIYCAHMA++V+F+VK    IGA +IGRAY+P   +L GEEV
Sbjct  58   GRTRKV-ESDDPSWNESFHIYCAHMANDVIFTVKQAGSIGANVIGRAYLPVEDILSGEEV  116

Query  397  DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            D W+ L D ++  + + +KIHVK+++ DV ++R W R
Sbjct  117  DRWIELKDEEKQNLENEAKIHVKIRYFDVTKDRNWNR  153



>gb|KCW70693.1| hypothetical protein EUGRSUZ_F03862 [Eucalyptus grandis]
Length=773

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 97/122 (80%), Gaps = 3/122 (2%)
 Frame = +1

Query  145  ERVVGFNKTASRLYATIDLEKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKV  321
            E  VG  K  S+LYATIDL KARVGRTRLL+ E  NPRWYESFHIYCAHMAS+V+F++K 
Sbjct  5    EETVGLGKGVSKLYATIDLGKARVGRTRLLEKEPSNPRWYESFHIYCAHMASDVIFTIKD  64

Query  322  DNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCW  501
            DNPIGA LIGRAY+P   LLGGEE+D W+ +LD +RNPI   SKIHVKL + DV ++R +
Sbjct  65   DNPIGATLIGRAYVPVDELLGGEELDRWVEILDKERNPI--GSKIHVKLHYFDVSKDRIY  122

Query  502  GR  507
            GR
Sbjct  123  GR  124



>gb|EEC80931.1| hypothetical protein OsI_23625 [Oryza sativa Indica Group]
Length=802

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 107/164 (65%), Gaps = 7/164 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA LLLHG+L   + E D +      T     +F K VEG E  +G  K A+RLYATIDL
Sbjct  1    MAHLLLHGTLEATILEADHLSNPTRATGAAPGIFRKFVEGFEDSLGLGKGATRLYATIDL  60

Query  202  EKARVGRTRLLDEHK-NPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             +ARVGRTR++D+   NPRWYE FHIYCAH A++VVFSVK   PIGA LIGRAY+P R L
Sbjct  61   GRARVGRTRVVDDEPVNPRWYEVFHIYCAHFAADVVFSVKAAQPIGATLIGRAYLPVREL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRER-CWGR  507
            L GE ++  L +LD  R  I     IHV+LQF DV  +R  WGR
Sbjct  121  LSGEAIERRLDILDAGRRRISHGPTIHVRLQFRDVAGDRHGWGR  164



>ref|NP_001058017.1| Os06g0604400 [Oryza sativa Japonica Group]
 sp|P93844.2|PLDA2_ORYSJ RecName: Full=Phospholipase D alpha 2; Short=PLD alpha 2; AltName: 
Full=Choline phosphatase 2; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 2 [Oryza sativa Japonica 
Group]
 dbj|BAD35531.1| Phospholipase D alpha 2 [Oryza sativa Japonica Group]
 dbj|BAF19931.1| Os06g0604400 [Oryza sativa Japonica Group]
 gb|EEE65982.1| hypothetical protein OsJ_21907 [Oryza sativa Japonica Group]
Length=817

 Score =   168 bits (425),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 107/164 (65%), Gaps = 7/164 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA LLLHG+L   + E D +      T     +F K VEG E  +G  K A+RLYATIDL
Sbjct  1    MAHLLLHGTLEATILEADHLSNPTRATGAAPGIFRKFVEGFEDSLGLGKGATRLYATIDL  60

Query  202  EKARVGRTRLLDEHK-NPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             +ARVGRTR++D+   NPRWYE FHIYCAH A++VVFSVK   PIGA LIGRAY+P R L
Sbjct  61   GRARVGRTRVVDDEPVNPRWYEVFHIYCAHFAADVVFSVKAAQPIGATLIGRAYLPVREL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRER-CWGR  507
            L GE ++  L +LD  R  I     IHV+LQF DV  +R  WGR
Sbjct  121  LSGEAIERRLDILDAGRRRISHGPTIHVRLQFRDVAGDRHGWGR  164



>ref|XP_008385550.1| PREDICTED: phospholipase D alpha 1-like [Malus domestica]
Length=809

 Score =   165 bits (417),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 106/153 (69%), Gaps = 5/153 (3%)
 Frame = +1

Query  46   LLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARVGRT  225
            +LLHG LH  +YEVD++   G    F K +     +VG  K  S LYATIDLE  RVGRT
Sbjct  6    VLLHGVLHATIYEVDRLMPGGCCIFFCKFLG---ELVGLGK-GSXLYATIDLENVRVGRT  61

Query  226  RLLDEH-KNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDE  402
            RLL+   KNP+W ESFHIYCAHM SNVVFS+K D   GA++IGRAYMPA  LL G+EVD 
Sbjct  62   RLLENSTKNPQWGESFHIYCAHMTSNVVFSIKEDKAFGAKVIGRAYMPAAELLDGKEVDR  121

Query  403  WLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCW  501
            WL ++ ++  P+H  SKIHVKLQF +V ++  W
Sbjct  122  WLKIMYDNNKPLHIRSKIHVKLQFFNVNQDLNW  154



>ref|XP_006859166.1| hypothetical protein AMTR_s00070p00140920 [Amborella trichopoda]
 gb|ERN20633.1| hypothetical protein AMTR_s00070p00140920 [Amborella trichopoda]
Length=126

 Score =   152 bits (385),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 93/124 (75%), Gaps = 1/124 (1%)
 Frame = +1

Query  127  KIVEGAERVVGFNKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNV  303
            K+V+G    VGF K AS+ YA I LEKA VGRTR+L ++  NPRWYESFHIYCAHMAS +
Sbjct  2    KLVKGIGETVGFGKGASKHYARIILEKAIVGRTRVLTNQLVNPRWYESFHIYCAHMASYI  61

Query  304  VFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  483
            +F++K D PIGA LIGRA++P + +L G+EVD W  + D DR PI   +KIHVKLQ+ D+
Sbjct  62   IFTIKDDVPIGASLIGRAHVPVKEVLNGDEVDTWAEICDEDRKPIGGGTKIHVKLQYFDI  121

Query  484  VRER  495
             ++R
Sbjct  122  TKDR  125



>gb|KJB70612.1| hypothetical protein B456_011G083000 [Gossypium raimondii]
 gb|KJB70613.1| hypothetical protein B456_011G083000 [Gossypium raimondii]
 gb|KJB70615.1| hypothetical protein B456_011G083000 [Gossypium raimondii]
Length=795

 Score =   164 bits (416),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 96/128 (75%), Gaps = 1/128 (1%)
 Frame = +1

Query  127  KIVEGAERVVGFNKTASRLYATIDLEKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNV  303
            ++V   +  +G  K   ++YATIDLE+ARVGRTR ++ E  NPRW+ESFHIYCAH ASNV
Sbjct  18   QLVANVQETIGIGKGVPKIYATIDLERARVGRTRTIENETSNPRWFESFHIYCAHNASNV  77

Query  304  VFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  483
            VF+VK DNPIGA LIGRAY+P + L  G+EVD W+ +LD D+NPI S  KIHVKLQ+  V
Sbjct  78   VFTVKDDNPIGATLIGRAYVPVKDLTEGDEVDRWVEILDEDKNPIKSGGKIHVKLQYFGV  137

Query  484  VRERCWGR  507
             ++R W R
Sbjct  138  TKDRNWDR  145



>emb|CAN76339.1| hypothetical protein VITISV_014670 [Vitis vinifera]
Length=801

 Score =   164 bits (416),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 102/158 (65%), Gaps = 19/158 (12%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M Q L+HG+LH  +YEVD + T G  N   KI                 Y TIDLEKA V
Sbjct  1    MEQSLVHGTLHATIYEVDGLSTGGPWNFIQKI-----------------YVTIDLEKAGV  43

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRT  LD E  NPRWY+SFHIYCAH AS+VVFSVK DNPIGA +IGRA++P   LL G E
Sbjct  44   GRTSKLDNEDSNPRWYQSFHIYCAHKASHVVFSVKQDNPIGATVIGRAHLPVGELLEG-E  102

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            VD WL L  +D  PI+  SK+HVKLQF+DV RE  W R
Sbjct  103  VDRWLELFHHDHTPINGGSKLHVKLQFVDVTREFNWSR  140



>dbj|BAA19466.1| phospholipase D [Oryza sativa Japonica Group]
Length=818

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 106/164 (65%), Gaps = 7/164 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA LLLHG+L   + E D +      T     +F K VEG E  +G  K A+RLYATIDL
Sbjct  1    MAHLLLHGTLEATILEADHLSNPTRATGAAPGIFRKFVEGFEDSLGLGKGATRLYATIDL  60

Query  202  EKARVGRTRLLDEHK-NPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             +ARVGRTR++D+   NPRWYE FHIYCAH A++VVFSVK   PIGA LI RAY+P R L
Sbjct  61   GRARVGRTRVVDDEPVNPRWYEVFHIYCAHFAADVVFSVKAAQPIGATLIDRAYLPVREL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRER-CWGR  507
            L GE ++  L +LD  R  I     IHV+LQF DV  +R  WGR
Sbjct  121  LCGEAIERRLDILDAGRRRISHGPTIHVRLQFRDVAGDRHGWGR  164



>ref|XP_009787006.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Nicotiana 
sylvestris]
Length=762

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 90/110 (82%), Gaps = 1/110 (1%)
 Frame = +1

Query  181  LYATIDLEKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRA  357
            +YAT+DLEKARVGRTR+++ E  NPRW ESFHIYCAHMASNV+F+VK +N IGA LIGRA
Sbjct  1    MYATVDLEKARVGRTRVIENEPSNPRWNESFHIYCAHMASNVIFTVKDNNSIGATLIGRA  60

Query  358  YMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            Y+P   LL GEEVDEW+ +LD D+NPI   SKIHV LQF D+ R+R WGR
Sbjct  61   YLPVNELLEGEEVDEWIEILDEDKNPIKEGSKIHVTLQFFDISRDRNWGR  110



>ref|XP_009364028.1| PREDICTED: phospholipase D alpha 1-like [Pyrus x bretschneideri]
Length=807

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 107/153 (70%), Gaps = 7/153 (5%)
 Frame = +1

Query  46   LLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARVGRT  225
            +LLHG LH  +YEVD++   G    F K +  +   VG  K  SRLYATIDLE  RVGRT
Sbjct  6    VLLHGVLHATIYEVDRLMPGGCCIFFCKFLGES---VGLRK-GSRLYATIDLENVRVGRT  61

Query  226  RLLDEH-KNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDE  402
            RLL+   KNP+W ESFHIYCAHM SNVVFS+K D   GA++IGRAYMPA  LL G+EVD 
Sbjct  62   RLLENSTKNPQWRESFHIYCAHMTSNVVFSIKEDKAFGAKVIGRAYMPAAELLNGKEVDR  121

Query  403  WLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCW  501
            WL ++ ++  P+  HSKIHVKLQF +V ++  W
Sbjct  122  WLTIMYHNNKPL--HSKIHVKLQFFNVNQDLNW  152



>gb|EMT24153.1| Phospholipase D alpha 1 [Aegilops tauschii]
Length=906

 Score =   163 bits (413),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 95/127 (75%), Gaps = 1/127 (1%)
 Frame = +1

Query  130  IVEGAERVVGFNKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVV  306
            +VEG E  VG  K AS+LYAT+ L KAR+GRTR L DE   PRW+ESFHIYCAH+A++V+
Sbjct  4    LVEGIEDTVGVGKGASKLYATVGLGKARIGRTRTLNDESSTPRWFESFHIYCAHLATDVL  63

Query  307  FSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVV  486
            F++K  + IGA ++G  Y+P R + GG+EV+ WLPL D+ RNP+    KIHVKLQ+ D+ 
Sbjct  64   FTIKGSSTIGASVVGTGYLPVRDIYGGDEVERWLPLCDDSRNPVEGGGKIHVKLQYFDIS  123

Query  487  RERCWGR  507
            ++R WGR
Sbjct  124  KDRAWGR  130



>ref|XP_003563661.1| PREDICTED: phospholipase D alpha 2-like [Brachypodium distachyon]
Length=823

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 110/168 (65%), Gaps = 11/168 (7%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA  LLHG+LH  + E DK+      T G   +F K VEG E  +G  K ++RLYATIDL
Sbjct  1    MAHRLLHGTLHATILEADKLTDPTRATGGAPGIFRKFVEGFEETIGRGKGSTRLYATIDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             +ARVGRTR++ D+  NPRWYE FHIYCAH A++VVF+VK D PIGA L+GRAY+P R L
Sbjct  61   GRARVGRTRVIADDPVNPRWYEEFHIYCAHFAADVVFTVKADQPIGATLLGRAYLPVRDL  120

Query  379  L--GGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVR---ERCWGR  507
            L   G+E++  L +LD  +  +     IHV+L+F DV      R WGR
Sbjct  121  LDAAGKEIERRLDVLDPGKKKLPHGPTIHVRLRFCDVAAAEGRREWGR  168



>dbj|BAJ93878.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=783

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 95/128 (74%), Gaps = 1/128 (1%)
 Frame = +1

Query  124  HKIVEGAERVVGFNKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASN  300
             ++VEG E  VG  K AS+LYAT+ L KAR+GRTR L DE   PRW+ESFHIYCAH+AS+
Sbjct  3    QQLVEGIEDTVGVGKGASKLYATVGLGKARIGRTRTLNDESSTPRWFESFHIYCAHLASD  62

Query  301  VVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLD  480
            V+F++K  + IGA ++G  Y+P R + GG+EV+ WLPL D+ RNP+    KIHVKLQ+ D
Sbjct  63   VLFTIKGKSTIGAVVVGTGYLPVRDIYGGDEVERWLPLCDDSRNPVEGGGKIHVKLQYFD  122

Query  481  VVRERCWG  504
            + ++R WG
Sbjct  123  ISKDRGWG  130



>dbj|BAJ85695.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96017.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87850.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=820

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 108/165 (65%), Gaps = 9/165 (5%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA  LLHG+LH  + E D +      T G   +F + VEG E  +G  K +++LYAT+DL
Sbjct  1    MAHRLLHGTLHATILEADNLTNPDRATGGAPQIFRRFVEGFEETIGRGKGSTQLYATVDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             KARVGRTR++  +  NPRWYE FHIYCAH A++VVF+VK   PIGA LIGRAY+P R L
Sbjct  61   GKARVGRTRVIAGDPVNPRWYEEFHIYCAHFAADVVFTVKAAQPIGATLIGRAYLPVRDL  120

Query  379  L--GGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV-VRERCWG  504
            L  GG+E++  L +LD  +  IH    IHV+L+F DV    R WG
Sbjct  121  LDAGGQEIERRLDVLDPSKKKIHHGPTIHVRLRFCDVAANRREWG  165



>dbj|BAJ94103.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=820

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 108/165 (65%), Gaps = 9/165 (5%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA  LLHG+LH  + E D +      T G   +F + VEG E  +G  K +++LYAT+DL
Sbjct  1    MAHRLLHGTLHATILEADNLTNPDRATGGAPQIFRRFVEGFEETIGRGKGSTQLYATVDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             KARVGRTR++  +  NPRWYE FHIYCAH A++VVF+VK   PIGA LIGRAY+P R L
Sbjct  61   GKARVGRTRVIAGDPVNPRWYEEFHIYCAHFAADVVFTVKAAQPIGATLIGRAYLPVRDL  120

Query  379  L--GGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV-VRERCWG  504
            L  GG+E++  L +LD  +  IH    IHV+L+F DV    R WG
Sbjct  121  LDAGGQEIERRLDVLDPSKKKIHHGPTIHVRLRFCDVAANRREWG  165



>gb|EMT32202.1| Phospholipase D alpha 2 [Aegilops tauschii]
Length=820

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 107/165 (65%), Gaps = 9/165 (5%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA  LLHG+LH  + E D +      T G   +F + VEG E  +G  K +++LYAT+DL
Sbjct  1    MAHRLLHGTLHATILEADNLTNPDRATGGAPQIFRRFVEGFEETIGRGKGSTQLYATVDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             KARVGRTR++  +  NPRWYE FHIYCAH A++VVF+VK   PIGA LIGRAY+P R L
Sbjct  61   GKARVGRTRVIAGDPVNPRWYEDFHIYCAHFAADVVFTVKAAQPIGATLIGRAYLPVREL  120

Query  379  L--GGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVV-RERCWG  504
            L  GG E++  L +LD  +  IH    IHV+L+F DV    R WG
Sbjct  121  LDAGGREIERRLDVLDPSKKKIHHGPTIHVRLRFCDVTANRREWG  165



>ref|XP_009368855.1| PREDICTED: phospholipase D alpha 1-like [Pyrus x bretschneideri]
Length=808

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 107/155 (69%), Gaps = 6/155 (4%)
 Frame = +1

Query  46   LLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARVGRT  225
            +LLHG LH  +YEVD++   G    F K +  +   VGF K  SRLYATIDLE  RVGRT
Sbjct  6    VLLHGVLHATIYEVDRLMAGGCCIFFCKFLGES---VGFGK-GSRLYATIDLENVRVGRT  61

Query  226  RLLDEH-KNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDE  402
            RLL+   KNP W ESFHIYCAHM SNVVFS+K DN  G ++IGRA+MPA  LL  E +D 
Sbjct  62   RLLENSTKNPLWCESFHIYCAHMTSNVVFSIKEDNAFGTKVIGRAHMPAAELLNSEVIDR  121

Query  403  WLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            W+ ++ +++ P+H  SKIHVKL+F +V +E  W R
Sbjct  122  WVRIIYHNK-PLHGRSKIHVKLRFFNVNQESNWSR  155



>ref|NP_001146242.1| uncharacterized protein LOC100279815 [Zea mays]
 gb|ACL53544.1| unknown [Zea mays]
 gb|AFW87188.1| phospholipase D family protein [Zea mays]
Length=816

 Score =   159 bits (403),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 108/164 (66%), Gaps = 7/164 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA LLLHG+L   + E D +      T G   +F K VEG E  +G  + ++RLYAT+DL
Sbjct  1    MAHLLLHGTLDATILEADHLTNPTRATGGAPGIFRKFVEGFEDSLGLGQGSTRLYATVDL  60

Query  202  EKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             +ARVGRTR++  +  NPRWYE FHIYCAH AS+VVFSVK   PIGA LIGRAY+P R L
Sbjct  61   GRARVGRTRVITGDPVNPRWYEVFHIYCAHFASDVVFSVKAAQPIGATLIGRAYLPVRDL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE-RCWGR  507
            + G+E++  L +LD  +  +    KI V+L+F DV  + R WGR
Sbjct  121  IAGQEIERSLDILDASKKRLPHGPKIRVRLRFQDVSADPRGWGR  164



>emb|CDP13512.1| unnamed protein product [Coffea canephora]
Length=825

 Score =   159 bits (402),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 104/170 (61%), Gaps = 13/170 (8%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGF------------NKTASR  180
            MA  LLHG+L   ++E+D+++T    N   K     +   GF                SR
Sbjct  1    MASKLLHGTLQATIFEIDRLRTGWGFNFCGKTGGPEKMARGFCARVKRAVFCRPEIVGSR  60

Query  181  LYATIDLEKARVGRTRLLDEH-KNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRA  357
            LYATIDLE+ARVGRTR++++   NPRWYE F IYCAHM SNV+F+VK DN +GA LIGRA
Sbjct  61   LYATIDLERARVGRTRMIEKQLSNPRWYEGFRIYCAHMVSNVIFTVKDDNAVGATLIGRA  120

Query  358  YMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            Y+P   ++ G  VD WL +LD D  PI    KIHVKLQF  V ++  W +
Sbjct  121  YLPVEEIINGFIVDRWLQILDEDGIPIQGGPKIHVKLQFFSVNQDPNWSQ  170



>ref|XP_009407292.1| PREDICTED: phospholipase D alpha 1-like [Musa acuminata subsp. 
malaccensis]
Length=815

 Score =   159 bits (401),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 102/163 (63%), Gaps = 6/163 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            M+Q LLHG LH  ++E   +      T        ++VE  E+ V F K  SR YATID+
Sbjct  1    MSQFLLHGVLHATIFEATSVSDRCRITRHAPKFVRELVEAVEKTVSFGKGWSRFYATIDI  60

Query  202  EKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            E AR+GRTR++   H NPRW ESFHIYCAH A+NVVF+VK++ PIGA ++GRA +    L
Sbjct  61   EMARLGRTRVITGHHGNPRWNESFHIYCAHTAANVVFTVKLEEPIGARVVGRASLSTEEL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            LG  EVD WL +LD DR P+     IHV L+F+    +  WGR
Sbjct  121  LGCAEVDRWLEILDEDRRPLRGGPAIHVSLRFVAADMDPNWGR  163



>ref|XP_002515518.1| phopholipase d alpha, putative [Ricinus communis]
 gb|EEF46967.1| phopholipase d alpha, putative [Ricinus communis]
Length=817

 Score =   159 bits (401),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 81/166 (49%), Positives = 110/166 (66%), Gaps = 15/166 (9%)
 Frame = +1

Query  49   LLHGSLHVCVYEVDKIKTD----------GLHNLFHKIVEGAERVVGFNK--TASRLYAT  192
            LLHG+L V ++EVDK++T           G  N   + +   +RVV        + LYAT
Sbjct  4    LLHGTLSVTIFEVDKLQTGCGFNFFSRGPGQQNCGKRFLSQVKRVVLCRPEIVGTGLYAT  63

Query  193  IDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPA  369
            +DL+KARVGRTR L D+H NP+WYESFHIYCAH+ S+V+F++K D  +GA LIGRAY+P 
Sbjct  64   VDLDKARVGRTRKLEDQHYNPQWYESFHIYCAHLISHVIFTIKDDQFVGASLIGRAYIPV  123

Query  370  RRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
              ++ G  +D W+ +LD  RNPI   SKIHVKLQFL+V ++  W +
Sbjct  124  EDVITGYIIDRWVEILDEQRNPI--GSKIHVKLQFLNVTQDSSWSQ  167



>ref|XP_004287315.1| PREDICTED: phospholipase D alpha 1-like [Fragaria vesca subsp. 
vesca]
Length=809

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 105/158 (66%), Gaps = 7/158 (4%)
 Frame = +1

Query  37   MAQ-LLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ +LLHG LH  ++EVD +K  G    F K+ E +   VG  K   R YATIDLE AR
Sbjct  1    MAQTVLLHGVLHATIFEVDSLKAGGCCTFFCKLFEES---VGLGK-GCRPYATIDLENAR  56

Query  214  VGRTRLLDEHK-NPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTRLL+E   NP+W E+FHIYCAHMASNVVFS+K  NPIGA +IG AY+PA  L  GE
Sbjct  57   VGRTRLLEETTTNPQWNEAFHIYCAHMASNVVFSIKEYNPIGANVIGEAYLPAAELFNGE  116

Query  391  EVDEWLPL-LDNDRNPIHSHSKIHVKLQFLDVVRERCW  501
            EVD WL + + +   P+H  SKI VKL+F  V     W
Sbjct  117  EVDRWLKITMHHHGRPLHGGSKIRVKLRFYPVTGNCNW  154



>ref|XP_010090252.1| Phospholipase D alpha 1 [Morus notabilis]
 gb|EXB39153.1| Phospholipase D alpha 1 [Morus notabilis]
Length=788

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 106/159 (67%), Gaps = 22/159 (14%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKAR-  213
            MAQ+LLHG LH                    ++E  E +VGF K  S+LYATIDLE +R 
Sbjct  1    MAQVLLHGVLH--------------------LIEKFEEIVGFRKGTSKLYATIDLENSRS  40

Query  214  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VG TR+L+ +  NPRWYESF IYCAH ASNVVF++K D PIGAE+I RAY+P   LL G+
Sbjct  41   VGSTRVLECKTWNPRWYESFDIYCAHKASNVVFTIKQDKPIGAEVIARAYLPVDELLSGK  100

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EVD+WL L+D+   P+H  SKIHV+++F DV ++  W +
Sbjct  101  EVDQWLHLMDHKHKPLHHGSKIHVRVRFCDVSKDINWSK  139



>emb|CDP13510.1| unnamed protein product [Coffea canephora]
Length=825

 Score =   157 bits (396),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 83/170 (49%), Positives = 105/170 (62%), Gaps = 13/170 (8%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKI---VEGAERVVGFNKTA---------SR  180
            MA  LLHG+L   ++E+D+++T    N   K     + A R     K A         SR
Sbjct  1    MASKLLHGTLQATIFEIDRLQTGWGFNFCGKTGGPAKMARRFFARLKRAVLCRPEIVGSR  60

Query  181  LYATIDLEKARVGRTRLLDEH-KNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRA  357
            LYATIDLE+ARVGRTR++++   NPRWYE F IYCAHM SNV+F+VK DN +GA LIGRA
Sbjct  61   LYATIDLERARVGRTRMIEKQLSNPRWYEGFRIYCAHMVSNVIFTVKDDNAVGATLIGRA  120

Query  358  YMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            Y+P   ++ G  VD WL +LD D  PI    KIHVKLQF  V  +  W +
Sbjct  121  YLPVEEIISGFVVDRWLQILDEDGIPIQGGPKIHVKLQFFSVNHDPNWSQ  170



>ref|XP_002437251.1| hypothetical protein SORBIDRAFT_10g023630 [Sorghum bicolor]
 gb|EER88618.1| hypothetical protein SORBIDRAFT_10g023630 [Sorghum bicolor]
Length=816

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 105/158 (66%), Gaps = 6/158 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA LLLHG+L   + E D +      T G   +F K VEG E  +G  + ++RLYAT+DL
Sbjct  1    MAHLLLHGTLDATILEADHLTNPTRATGGAPGIFRKFVEGFEESLGLGQGSTRLYATVDL  60

Query  202  EKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             +ARVGRTR++  +  NPRWYE+FHIYCAH ASNVVFSVK   PIGA LIGRAY+P R L
Sbjct  61   GRARVGRTRVITGDPVNPRWYEAFHIYCAHFASNVVFSVKAAQPIGATLIGRAYLPVRDL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  492
            + G+E++  L +L+  +  +    K+ V+L+F DV  +
Sbjct  121  IAGQEIERSLDILNASKKRLPHGPKLRVRLRFQDVAAD  158



>ref|XP_009614730.1| PREDICTED: phospholipase D alpha 1 {ECO:0000250|UniProtKB:Q41142}-like 
[Nicotiana tomentosiformis]
Length=820

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 106/169 (63%), Gaps = 12/169 (7%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK---------TDGLHNLFHKIVEGAERV--VGFNKTASRL  183
            M   LLHG+LH  +YEVDKI+         T     +  + +   +++       + ++ 
Sbjct  1    MGPRLLHGTLHATIYEVDKIRGGCGDCCGPTASPQKVSRRFLNNVKKLFFCAPEISGTKF  60

Query  184  YATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAY  360
            YATIDL+KARVGRTR+  ++  NPRWYE+F IYCAH  SN++F++K +NPI A LIGRAY
Sbjct  61   YATIDLDKARVGRTRIFGNDPSNPRWYETFRIYCAHEISNIIFTIKDENPISATLIGRAY  120

Query  361  MPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            +P   +L    VD W+P+LD D  PI   SKIHV+LQF +V ++  W R
Sbjct  121  LPVEEVLNRYVVDRWVPILDEDGYPISGRSKIHVRLQFFNVKQDSNWSR  169



>ref|XP_009758055.1| PREDICTED: phospholipase D alpha 1-like [Nicotiana sylvestris]
 ref|XP_009758056.1| PREDICTED: phospholipase D alpha 1-like [Nicotiana sylvestris]
Length=820

 Score =   154 bits (389),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 106/169 (63%), Gaps = 12/169 (7%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK---------TDGLHNLFHKIVEGAERV--VGFNKTASRL  183
            M   LLHG+LH  +YEVDKI+         T     +  + +   +++       + ++ 
Sbjct  1    MGPRLLHGTLHATIYEVDKIRGGCGDCCGPTASPQKVSRRFLNNVKKLFFCAPEISGTKF  60

Query  184  YATIDLEKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAY  360
            YATIDL+KARVGRTR+ + +  NPRWYE+F IYCAH  SN++F++K +NP+ A LIGRAY
Sbjct  61   YATIDLDKARVGRTRIFENDPSNPRWYETFRIYCAHEISNIIFTIKDENPVSATLIGRAY  120

Query  361  MPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            +P   +L    VD W+P+LD D  PI   SKIHV+LQF +V ++  W R
Sbjct  121  LPVEEVLNRYVVDRWVPILDEDGYPISGRSKIHVRLQFFNVKQDSNWSR  169



>ref|XP_004251821.1| PREDICTED: phospholipase D alpha 1-like [Solanum lycopersicum]
Length=820

 Score =   154 bits (389),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 109/168 (65%), Gaps = 11/168 (7%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKT--------DGLHNLFHKIVEGAERV--VGFNKTASRLY  186
            M   LLHG+LH  +YE+DKI+T             L  +++   +++       +A++LY
Sbjct  1    MVPRLLHGTLHATIYEIDKIRTGCADCCGPTSPQKLTKRVLNNVKKLFFCAPKISATKLY  60

Query  187  ATIDLEKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYM  363
            ATIDL+KARVGRTR+ + E  NP W ++F +YCAH  SN++F+VK +NP+ A LIGRAY+
Sbjct  61   ATIDLDKARVGRTRIAENEPSNPHWNDTFRLYCAHEVSNIIFTVKDENPVSATLIGRAYL  120

Query  364  PARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            P   +L    VD W+P++D +R+PI  HSKIHV+LQF  V ++  W R
Sbjct  121  PVEEVLNRYIVDRWVPIVDEERHPISGHSKIHVRLQFYSVKQDSNWSR  168



>ref|XP_006350007.1| PREDICTED: phospholipase D alpha 1-like [Solanum tuberosum]
Length=819

 Score =   154 bits (388),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 108/168 (64%), Gaps = 11/168 (7%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKT--------DGLHNLFHKIVEGAERV--VGFNKTASRLY  186
            M   LLHG+LH  +YE+DKI+T             L  +++   +++       +A++LY
Sbjct  1    MGPRLLHGTLHATIYEIDKIRTGCADCCGPTSPQKLTKRVLNNVKKLFFCAPKISATKLY  60

Query  187  ATIDLEKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYM  363
            ATIDL+KARVGRTR+ + E  NP W ++F  YCAH  SN++F+VK +NP+ A LIGRAY+
Sbjct  61   ATIDLDKARVGRTRIAENEPSNPHWNDTFRFYCAHEVSNIIFTVKDENPVSATLIGRAYL  120

Query  364  PARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            P   +L    VD W+P++D +R+PI  HSKIHV+LQF  V ++  W R
Sbjct  121  PVEEVLNRYIVDRWVPIVDEERHPISGHSKIHVRLQFYSVKQDSNWSR  168



>gb|KHN22449.1| Phospholipase D alpha 1 [Glycine soja]
Length=271

 Score =   147 bits (370),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 89/121 (74%), Gaps = 1/121 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+L   +YEVD +K   + N+  K V   E   G  K  ++LYAT+DLEKARV
Sbjct  1    MAQILLHGTLQAKIYEVDNLKVGSVGNVLTKSVHNIEETNGIGKGITKLYATVDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ EH NP+  ESFHIYCAHMASN++F+VK DNPIGA LIG AY+P   +L G+E
Sbjct  61   GRTRIIEKEHTNPKGNESFHIYCAHMASNIIFTVKDDNPIGATLIGSAYVPVEEILDGKE  120

Query  394  V  396
            +
Sbjct  121  I  121



>ref|XP_011459180.1| PREDICTED: phospholipase D alpha 1-like [Fragaria vesca subsp. 
vesca]
Length=814

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 111/159 (70%), Gaps = 6/159 (4%)
 Frame = +1

Query  49   LLHGSLHVCVYEVDKIKTD-GLHNLF---HKIVEGAERVV--GFNKTASRLYATIDLEKA  210
            LLHG+L+  +YE+DKI +  G+  L+    K V+  +R+V  G   + S++YAT+DL+KA
Sbjct  4    LLHGTLYATIYEIDKINSGCGIGLLWTSPKKFVDQVKRLVLCGPEISGSKIYATVDLDKA  63

Query  211  RVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            RV RTR+++  +NP W E FHIY AH  S+++F+VK ++PIGA LIGRAY+P   ++ G 
Sbjct  64   RVARTRMVNNPRNPIWKEDFHIYSAHNISHIIFTVKANDPIGATLIGRAYVPVEDIIKGY  123

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
             VD W+ +LD + NPIH +S+IHVKLQF  V+ +  W +
Sbjct  124  VVDRWVEILDEEHNPIHGNSRIHVKLQFSSVIEDAHWSQ  162



>gb|AAC49274.1| phospholipase D [Arabidopsis thaliana]
Length=809

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 101/157 (64%), Gaps = 3/157 (2%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDG-LHNLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MA  LLHG+LH  +YEVD +   G +     KI+   E  +G  K  +RLYATIDL+KAR
Sbjct  1    MAHDLLHGTLHATIYEVDALHGGGVMQGFLGKILANVEETIGVGKGETRLYATIDLQKAR  60

Query  214  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + +E KNP+WYESF +             K D PIGA LIGRAY+P  +++ GE
Sbjct  61   VGRTRKIKNEPKNPKWYESFQVSVVTWLLISSSLSKDDIPIGATLIGRAYIPVDQVINGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCW  501
             VD+W+ +LDNDRNPI   SKIHVKLQ+  V  +R W
Sbjct  121  -VDQWVEILDNDRNPIQGGSKIHVKLQYFHVEEDRNW  156



>gb|KHN07080.1| Phospholipase D alpha 1 [Glycine soja]
Length=799

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 103/156 (66%), Gaps = 15/156 (10%)
 Frame = +1

Query  49   LLHGSLHVCVYEVDKIKT--DGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARVGR  222
            LLHG L V +YEVD + T  D   NL  K VE            + LYATIDL+KARVGR
Sbjct  4    LLHGRLDVIIYEVDTLPTLNDCNLNLCSKFVE------------TGLYATIDLDKARVGR  51

Query  223  TRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVD  399
            T+LL D+  NP W E+FH+YCAH+ S+V+F+VK  +PI A LIGRAY+P  +++ G  VD
Sbjct  52   TKLLNDQSSNPTWDETFHVYCAHLISHVIFTVKQKDPIDATLIGRAYVPVEQVVNGNIVD  111

Query  400  EWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            EW+ +LD D NPI S SKIHVK+QF  V  +  W +
Sbjct  112  EWVQILDEDHNPIPSESKIHVKMQFSSVRNDINWSQ  147



>ref|XP_011039694.1| PREDICTED: phospholipase D alpha 1-like [Populus euphratica]
 ref|XP_011039695.1| PREDICTED: phospholipase D alpha 1-like [Populus euphratica]
Length=820

 Score =   151 bits (381),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 108/170 (64%), Gaps = 13/170 (8%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKI---------KTDGLHNLFHKIVEGAERVVGF---NKTASR  180
            MA  LLHG+L V VY VD +         KT+G      + +   +R +     N   SR
Sbjct  1    MAPRLLHGTLDVTVYGVDNLQYGCGFSLLKTEGFLKFGKRCLVNVKRSMSCLPENVAGSR  60

Query  181  LYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRA  357
            LYAT+DL+KARV RTR++  E  NPRW ESFHIYCAH  S+VVF++K D+ IGA LIGRA
Sbjct  61   LYATVDLDKARVARTRMVGKEPYNPRWNESFHIYCAHSISHVVFTIKDDDAIGATLIGRA  120

Query  358  YMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            Y+P   +  G+ ++ W+ ++D DR P+   S++H+KLQF DV ++R W +
Sbjct  121  YLPVEDIPNGKILERWVEIVDEDRKPVPGGSRVHIKLQFFDVNQDRYWSQ  170



>ref|XP_010648662.1| PREDICTED: phospholipase D alpha 1-like [Vitis vinifera]
Length=825

 Score =   150 bits (380),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 108/170 (64%), Gaps = 14/170 (8%)
 Frame = +1

Query  40   AQLLLHGSLHVCVYEVDK----------IKTDGLHNLFHKIVEGAERVVGFNK--TASRL  183
            A  +LHG+L+  ++++D+          IKT    NL  +++   +R+V        S+L
Sbjct  3    APFVLHGTLYATIFDIDRLYGGCECGHIIKTSRTQNLPKRLLGEVKRMVLCRPEVIGSKL  62

Query  184  YATIDLEKARVGRTRLLDE--HKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRA  357
            YAT+DLEKARV RTRL++   +  PRW+ESF IYCAH  SN++F++K DNP+GA LIGRA
Sbjct  63   YATVDLEKARVARTRLIENRAYSKPRWFESFRIYCAHRISNIIFTIKEDNPVGARLIGRA  122

Query  358  YMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            Y+P   +  G EVD  + +LD DRNP+  HS+IHVKL F    ++  W +
Sbjct  123  YVPVEAIKSGHEVDLQVEILDEDRNPLPGHSRIHVKLHFFHAKKQSDWSK  172



>ref|XP_007013459.1| Phospholipase D alpha 1 [Theobroma cacao]
 gb|EOY31078.1| Phospholipase D alpha 1 [Theobroma cacao]
Length=806

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 91/127 (72%), Gaps = 1/127 (1%)
 Frame = +1

Query  130  IVEGAERVVGFNKTASRLYATIDLEKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVV  306
            +V+  E  VG  K  S+LY TIDLE+ RVGR+RLL+ E  N +W+ESFHIYCAH ASNVV
Sbjct  30   LVQNIEESVGVGKAFSKLYVTIDLEETRVGRSRLLENEGSNLQWHESFHIYCAHKASNVV  89

Query  307  FSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVV  486
            FS+K ++PIGA LIGRAY+P   LL GEEVD WL ++D +  P+   S+IHVKLQF D  
Sbjct  90   FSIKENDPIGASLIGRAYLPVEELLNGEEVDRWLKVVDKEYKPLCRGSRIHVKLQFFDTT  149

Query  487  RERCWGR  507
            R   W +
Sbjct  150  RHPNWSQ  156



>gb|KDO48581.1| hypothetical protein CISIN_1g004579mg [Citrus sinensis]
Length=610

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +1

Query  229  LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWL  408
            L  E  NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P   +LGGEEVD+W+
Sbjct  2    LKKEQSNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVEEVLGGEEVDKWV  61

Query  409  PLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
             +LD DRNPI S SKIHVKLQ+ DV ++R W R
Sbjct  62   EILDEDRNPISSGSKIHVKLQYFDVTKDRSWAR  94



>ref|XP_008219493.1| PREDICTED: phospholipase D alpha 1-like [Prunus mume]
Length=806

 Score =   148 bits (374),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 108/164 (66%), Gaps = 17/164 (10%)
 Frame = +1

Query  49   LLHGSLHVCVYEVDKIKTD-GLHNLFHK-----------IVEGAERVVGFNKTASRLYAT  192
            LLHG+L   +YEVD++    GLH L+             ++ G +++VG     S+LYAT
Sbjct  4    LLHGTLLATIYEVDRLYNGCGLHLLWKSPKIFVAQIKKLVLCGPKQIVG-----SKLYAT  58

Query  193  IDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPAR  372
            +DL+KARVGRTR++++  NP+W E FHIYCAH  S+++F+VK ++ IGA LIGRAY+P  
Sbjct  59   VDLDKARVGRTRMVNDPNNPKWREDFHIYCAHNISSLIFTVKSNDLIGATLIGRAYIPVE  118

Query  373  RLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWG  504
             ++ G  VD WL + D D NPI+ +S+IHVKLQF  V  +  W 
Sbjct  119  EIIKGYAVDRWLEIFDEDGNPIYGNSRIHVKLQFSSVKDDFHWS  162



>gb|KDO48580.1| hypothetical protein CISIN_1g004579mg [Citrus sinensis]
Length=744

 Score =   148 bits (373),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +1

Query  229  LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWL  408
            L  E  NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P   +LGGEEVD+W+
Sbjct  2    LKKEQSNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVEEVLGGEEVDKWV  61

Query  409  PLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
             +LD DRNPI S SKIHVKLQ+ DV ++R W R
Sbjct  62   EILDEDRNPISSGSKIHVKLQYFDVTKDRSWAR  94



>ref|XP_010923204.1| PREDICTED: phospholipase D alpha 1-like [Elaeis guineensis]
Length=859

 Score =   148 bits (374),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 81/193 (42%), Positives = 112/193 (58%), Gaps = 36/193 (19%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYE-----------------VDKIKTDGLHNLFH-------------  126
            MAQ LLHG+L V ++E                 + K  T     L               
Sbjct  1    MAQYLLHGTLQVTIFEATSLSNSNAISVSAPKPIQKAPTTSKRRLMRRLSWIKRVSFCRP  60

Query  127  KIVEGAERVVGFNKTASRLYATIDLEKARVGRTR-LLDEHKNPRWYESFHIYCAHMASNV  303
            K+VE  E  VGF K +++LYATIDLE+ARVGRTR +++E  NPRWYESFHIYCAH  +N+
Sbjct  61   KLVEEIEDTVGFGKGSAKLYATIDLERARVGRTRVIMNEPNNPRWYESFHIYCAHWTANI  120

Query  304  VFSVKVDNPIGAELIGRAYMPARRLLGGEE---VDEWLPLLDNDRNPIHSHSKIHVKLQF  474
            +F++K DNP+GA LIGRAY+P + +L       VD WL +   D + +   ++IHV+L +
Sbjct  121  IFTIKADNPVGASLIGRAYLPVKDILNNNNSGAVDRWLNIYREDCSQVGGGAQIHVRLWY  180

Query  475  LDVVRER--CWGR  507
            LDV ++    WG+
Sbjct  181  LDVSKDPYLGWGQ  193



>gb|EPS71739.1| hypothetical protein M569_03019, partial [Genlisea aurea]
Length=782

 Score =   147 bits (372),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 86/112 (77%), Gaps = 1/112 (1%)
 Frame = +1

Query  175  SRLYATIDLEKARVGRTRLLDEH-KNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIG  351
            SR+YAT+DLE AR+GRTR++ +   NPRWYE+F IYCAH  SNVVF+VK DNPIGA LIG
Sbjct  21   SRIYATVDLEGARMGRTRMISKKASNPRWYENFRIYCAHTLSNVVFTVKDDNPIGATLIG  80

Query  352  RAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            RAY+P   +L G+ +D W+ +LD D+NPI+  SKIHVKLQ+  V +E  W +
Sbjct  81   RAYLPVEDILDGQIIDRWIQILDEDKNPINGGSKIHVKLQYFHVSQENNWSQ  132



>ref|XP_004984143.1| PREDICTED: phospholipase D alpha 1-like isoform X3 [Setaria italica]
Length=832

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 104/169 (62%), Gaps = 20/169 (12%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVD-KIKTDG-----------------LHNL-FHKIVEGAERVVG  159
            MAQLLLHG +   +   D  + +DG                 +  L F K  +  E  +G
Sbjct  1    MAQLLLHGLIDARIVAADLSVTSDGQLQPTKKTRMKRKVFSWISKLPFCKCQQRLENAIG  60

Query  160  FNKTASRLYATIDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGA  339
               TA +LYAT+D++KARVGRTR+LD   +PRW E+F IYCAH ASN++F+VK DN IGA
Sbjct  61   LG-TAGKLYATVDIDKARVGRTRMLDPVHSPRWNEAFRIYCAHDASNIIFTVKADNAIGA  119

Query  340  ELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVV  486
             LIGRAY+P R ++ G++V+ WL + D  R P+    KIHV+LQF DV 
Sbjct  120  TLIGRAYLPTRDVVAGQKVERWLDICDEKRQPLEGGDKIHVQLQFTDVA  168



>dbj|BAK02630.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=828

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 106/178 (60%), Gaps = 22/178 (12%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVD-KIKTDGLHNLFHKIV------------------EGAERVVG  159
            MAQ+LLHG +   + E D  + +DG      K V                  +  E  +G
Sbjct  1    MAQMLLHGVVDAMILEADLSVGSDGQLRPTRKTVMKKRVFSWIKKLSFCNNCQQLENAIG  60

Query  160  FNKTASRLYATIDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGA  339
               TA +LYAT+D++KARVGRTR+++    P W ESFHIYCAH AS+++F+VK DN +GA
Sbjct  61   LGGTAGKLYATVDIDKARVGRTRMVNPSNAPSWNESFHIYCAHDASHIIFTVKADNTVGA  120

Query  340  ELIGRAYMPAR-RLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVR--ERCWG  504
             LIGRAY+P    +L G+ VD+WLP+ D+ R P+    ++HV+L+F DV    E  WG
Sbjct  121  TLIGRAYLPTDGAVLAGQWVDQWLPICDDKRRPLDGGDRVHVQLRFTDVAADPEARWG  178



>ref|XP_008394091.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Malus domestica]
Length=672

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 105/164 (64%), Gaps = 17/164 (10%)
 Frame = +1

Query  49   LLHGSLHVCVYEVDKIKTDGLHNLFHK------------IVEGAERVVGFNKTASRLYAT  192
            LLHG L+  +YEVD++ T    NL  K            ++   +++VG     S+LYAT
Sbjct  4    LLHGMLYATIYEVDRLDTGCGFNLLCKSPKRFATQIKKLVLCRPQQIVG-----SKLYAT  58

Query  193  IDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPAR  372
            IDL+KARVGRTR++++  NP+W E F+IYCAH  S ++F+VK D+ IGA LIGRAY+P  
Sbjct  59   IDLDKARVGRTRMVNDPNNPKWREEFYIYCAHNISQIIFTVKDDDLIGATLIGRAYIPVG  118

Query  373  RLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWG  504
             ++ G   + W+ +LD D NPIH +S+IHVKLQF  V  +  W 
Sbjct  119  DIIKGYVEERWVEILDEDHNPIHGNSRIHVKLQFSSVAEDFHWS  162



>ref|XP_006581357.1| PREDICTED: phospholipase D alpha 1-like [Glycine max]
Length=826

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 107/174 (61%), Gaps = 24/174 (14%)
 Frame = +1

Query  49   LLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVG--------------------FNK  168
            LLHG L V +YEVD + T    NL +   +G  R VG                    F +
Sbjct  4    LLHGRLDVIIYEVDTLPTLNDCNL-NLCSKGTSRSVGKRFLSQLKSCFLCQCQCQPEFVE  62

Query  169  TASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAEL  345
            T   LYATIDL+KARVGRT+LL D+  NP W E+FH+YCAH+ S+V+F+VK  +PI A L
Sbjct  63   TG--LYATIDLDKARVGRTKLLNDQSSNPTWDETFHVYCAHLISHVIFTVKQKDPIDATL  120

Query  346  IGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            IGRAY+P  +++ G  VDEW+ +LD D NPI S SKIHVK+QF  V  +  W +
Sbjct  121  IGRAYVPVEQVVNGNIVDEWVQILDEDHNPIPSESKIHVKMQFSSVRNDINWSQ  174



>ref|XP_004984141.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Setaria italica]
Length=834

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 104/171 (61%), Gaps = 22/171 (13%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVD-KIKTDG-------------------LHNL-FHKIVEGAERV  153
            MAQLLLHG +   +   D  + +DG                   +  L F K  +  E  
Sbjct  1    MAQLLLHGLIDARIVAADLSVTSDGQLQPTKKVETRMKRKVFSWISKLPFCKCQQRLENA  60

Query  154  VGFNKTASRLYATIDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPI  333
            +G   TA +LYAT+D++KARVGRTR+LD   +PRW E+F IYCAH ASN++F+VK DN I
Sbjct  61   IGLG-TAGKLYATVDIDKARVGRTRMLDPVHSPRWNEAFRIYCAHDASNIIFTVKADNAI  119

Query  334  GAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVV  486
            GA LIGRAY+P R ++ G++V+ WL + D  R P+    KIHV+LQF DV 
Sbjct  120  GATLIGRAYLPTRDVVAGQKVERWLDICDEKRQPLEGGDKIHVQLQFTDVA  170



>ref|XP_004984142.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Setaria italica]
Length=833

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 102/170 (60%), Gaps = 21/170 (12%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVD-KIKTDGLHNLFHKI-------------------VEGAERVV  156
            MAQLLLHG +   +   D  + +DG      K+                    +  E  +
Sbjct  1    MAQLLLHGLIDARIVAADLSVTSDGQLQPTKKVETRMKRKVFSWISKLPFCKCQRLENAI  60

Query  157  GFNKTASRLYATIDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIG  336
            G   TA +LYAT+D++KARVGRTR+LD   +PRW E+F IYCAH ASN++F+VK DN IG
Sbjct  61   GLG-TAGKLYATVDIDKARVGRTRMLDPVHSPRWNEAFRIYCAHDASNIIFTVKADNAIG  119

Query  337  AELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVV  486
            A LIGRAY+P R ++ G++V+ WL + D  R P+    KIHV+LQF DV 
Sbjct  120  ATLIGRAYLPTRDVVAGQKVERWLDICDEKRQPLEGGDKIHVQLQFTDVA  169



>ref|XP_004984144.1| PREDICTED: phospholipase D alpha 1-like isoform X4 [Setaria italica]
Length=831

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 101/168 (60%), Gaps = 19/168 (11%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVD-KIKTDGLHNLFHKI-----------------VEGAERVVGF  162
            MAQLLLHG +   +   D  + +DG      K                   +  E  +G 
Sbjct  1    MAQLLLHGLIDARIVAADLSVTSDGQLQPTKKTRMKRKVFSWISKLPFCKCQRLENAIGL  60

Query  163  NKTASRLYATIDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAE  342
              TA +LYAT+D++KARVGRTR+LD   +PRW E+F IYCAH ASN++F+VK DN IGA 
Sbjct  61   G-TAGKLYATVDIDKARVGRTRMLDPVHSPRWNEAFRIYCAHDASNIIFTVKADNAIGAT  119

Query  343  LIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVV  486
            LIGRAY+P R ++ G++V+ WL + D  R P+    KIHV+LQF DV 
Sbjct  120  LIGRAYLPTRDVVAGQKVERWLDICDEKRQPLEGGDKIHVQLQFTDVA  167



>ref|XP_006656219.1| PREDICTED: phospholipase D alpha 2-like [Oryza brachyantha]
Length=828

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 98/158 (62%), Gaps = 6/158 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA LL+HG+L   ++E   +      T      F K  EG E+  G     +RLYATIDL
Sbjct  1    MAHLLMHGTLDATIFEAANLTNPTRLTGDAPEGFRKWWEGLEKTTGLGPGGTRLYATIDL  60

Query  202  EKARVGRTRLLDEHK-NPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             KAR+GRTR++D+   NPRW E FH+YCAH A NVVFSVKV  P+GA LIGRAY+P R L
Sbjct  61   GKARLGRTRIVDDEPVNPRWDERFHLYCAHFAENVVFSVKVSLPVGAALIGRAYLPVREL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  492
            L GE V+  L +L  D+  +     IHV+LQF +V  +
Sbjct  121  LSGEVVERKLDILGEDKKKLPHGPTIHVRLQFKNVAAD  158



>ref|XP_008394090.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Malus domestica]
Length=810

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 105/164 (64%), Gaps = 17/164 (10%)
 Frame = +1

Query  49   LLHGSLHVCVYEVDKIKTDGLHNLFHK------------IVEGAERVVGFNKTASRLYAT  192
            LLHG L+  +YEVD++ T    NL  K            ++   +++VG     S+LYAT
Sbjct  4    LLHGMLYATIYEVDRLDTGCGFNLLCKSPKRFATQIKKLVLCRPQQIVG-----SKLYAT  58

Query  193  IDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPAR  372
            IDL+KARVGRTR++++  NP+W E F+IYCAH  S ++F+VK D+ IGA LIGRAY+P  
Sbjct  59   IDLDKARVGRTRMVNDPNNPKWREEFYIYCAHNISQIIFTVKDDDLIGATLIGRAYIPVG  118

Query  373  RLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWG  504
             ++ G   + W+ +LD D NPIH +S+IHVKLQF  V  +  W 
Sbjct  119  DIIKGYVEERWVEILDEDHNPIHGNSRIHVKLQFSSVAEDFHWS  162



>gb|EMS46811.1| Phospholipase D alpha 2 [Triticum urartu]
Length=684

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 84/196 (43%), Positives = 108/196 (55%), Gaps = 40/196 (20%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKI-----------------------  132
            MA  LLHG+LH  + E D +      T G   +F ++                       
Sbjct  1    MAHRLLHGTLHATILEADDLTNPDRATGGAPQIFRRVSHSPSFPASTCCNHGRVKLVGLV  60

Query  133  --------VEGAERVVGFNKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCA  285
                    VEG E  +G  K +++LYAT+DL KARVGRTR++  +  NPRWYE FHIYCA
Sbjct  61   RNLVWLQFVEGFEETIGRGKGSTQLYATVDLGKARVGRTRVIAGDPVNPRWYEDFHIYCA  120

Query  286  HMASNVVFSVKVDNPIGAELIGRAYMPARRLL--GGEEVDEWLPLLDNDRNPIHSHSKIH  459
            H A++VVF+VK   PIGA LIGRAY+P R LL  GG E++  L +LD  +  IH    IH
Sbjct  121  HFAADVVFTVKAAQPIGATLIGRAYLPVRELLDAGGREIERRLDVLDPSKKKIHHGPTIH  180

Query  460  VKLQFLDV-VRERCWG  504
            V+L+F DV    R WG
Sbjct  181  VRLRFCDVAANPREWG  196



>gb|EMT15739.1| Phospholipase D alpha 2 [Aegilops tauschii]
Length=755

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 101/163 (62%), Gaps = 18/163 (11%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA  LLHG+LH  + E DK+      T G   +  K+VEG E  +G  K ++RLYATIDL
Sbjct  1    MAHRLLHGTLHATILEADKLTHPDRATGGAPEILRKLVEGFEETIGRGKGSTRLYATIDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             +ARVGRTR+L  +  NPRWYE FHIYCAH A++VVF+VK   PIGA LIGRAY+P R L
Sbjct  61   GRARVGRTRVLAGDPVNPRWYEDFHIYCAHFAAHVVFTVKAAQPIGATLIGRAYLPVREL  120

Query  379  L--GGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCW  501
            L   G E++  L +LD  +           KL    +++ RCW
Sbjct  121  LDADGNEIERRLDILDATKQ----------KLPHGPMIQGRCW  153



>ref|XP_010228542.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Brachypodium 
distachyon]
Length=824

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 104/172 (60%), Gaps = 20/172 (12%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVD--KIKTDGL-----HNLFHKIV------------EGAERVVG  159
            MA +LLHG +   + + D   + +DG        L  K V            +  E  +G
Sbjct  1    MALMLLHGVIDAQILDADLSSVSSDGQIRPNRKTLMKKKVFSWIKKLPFCNCQQVENAIG  60

Query  160  FNKTASRLYATIDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGA  339
               TA +LYAT+D++KARVGRTR+L+    P+W + FHIYCAH A++V+F+VK DNP+GA
Sbjct  61   LGSTAGKLYATVDIDKARVGRTRMLEPTNTPKWGQEFHIYCAHDAAHVIFTVKADNPVGA  120

Query  340  ELIGRAYMP-ARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  492
             LIGRAY+P    +  G+ VD+WLP+ D+ R P+    +IHV+L+F DV  +
Sbjct  121  TLIGRAYLPTGGAVAAGQRVDQWLPICDDKRRPLEGGDRIHVQLRFTDVAAD  172



>ref|XP_004138856.1| PREDICTED: phospholipase D alpha 2-like [Cucumis sativus]
Length=810

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 101/161 (63%), Gaps = 13/161 (8%)
 Frame = +1

Query  25   PLSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLE  204
            P       LLHG+LH  +YE+D+++T G      KIV             SR+YAT+DL+
Sbjct  13   PKQRQMPRLLHGTLHADIYEIDRLQT-GFPVFCGKIV------------GSRMYATVDLD  59

Query  205  KARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  384
            KARVGRTR++D+  NP W + F IYCAH  S+++F+VK  + IGA LIGRAY+P   ++ 
Sbjct  60   KARVGRTRIVDQPYNPHWNDHFRIYCAHTVSHIIFTVKDGDFIGATLIGRAYVPVEEIIK  119

Query  385  GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            G   ++W+ +LD D  P++  S+IHVKLQF  V  +R W R
Sbjct  120  GFVYEKWVDILDEDGKPLYGRSRIHVKLQFSSVNEDRNWSR  160



>ref|XP_007011867.1| Phospholipase D alpha 1 [Theobroma cacao]
 gb|EOY29486.1| Phospholipase D alpha 1 [Theobroma cacao]
Length=824

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 102/170 (60%), Gaps = 13/170 (8%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGF------------NKTASR  180
            MA  LLHG L V +Y +D +K     +L  K     +    F                S+
Sbjct  1    MATHLLHGKLTVRIYGIDTLKYPSGLSLLSKATGPTQLAKLFIAQLKRIMLCQSEMIGSK  60

Query  181  LYATIDLEKARVGRTRLLDEH-KNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRA  357
            LYAT+DL+KARV RTR++ +    P W ESF IYC H+ S+++F+VK  NPIGA LIGRA
Sbjct  61   LYATVDLDKARVARTRMISKKGSEPIWNESFRIYCGHLISDIIFTVKYANPIGATLIGRA  120

Query  358  YMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            ++PA  ++ G  VD W+ +LD +RNPI   SKIHV+LQF +V ++R W +
Sbjct  121  HIPAEDVIQGAAVDRWVDILDENRNPIPGGSKIHVQLQFFNVTQDRNWSQ  170



>tpg|DAA45660.1| TPA: phospholipase D family protein [Zea mays]
Length=715

 Score =   142 bits (358),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 103/178 (58%), Gaps = 22/178 (12%)
 Frame = +1

Query  34   EMAQLLLHGSLHVCVYEVD-KIKTDGL-----HNLFHKIV-------------EGAERVV  156
            +  QLLLHG +   + E D  + TDG        L  K V             +  E  +
Sbjct  21   QTTQLLLHGVIEATILEADLSVTTDGKLQPTKKTLMKKKVFSWIRKLTFCRNQQQLENAI  80

Query  157  GFNKTASRLYATIDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIG  336
            G   T  +LYAT+D++KARVGRTR++    +P W ESFH+YCAH ASN++F+VK DN IG
Sbjct  81   GLG-TDGKLYATVDIDKARVGRTRMVPPVHSPMWDESFHLYCAHDASNIIFTVKADNAIG  139

Query  337  AELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERC--WG  504
            A LIGRAY+P   ++ G +VD WLP+ D  R P+    +IHV++QF DV  +    WG
Sbjct  140  ATLIGRAYLPTEGVVAGRKVDLWLPIRDEKRQPLEGGDQIHVQVQFTDVAADPTAGWG  197



>ref|XP_004160794.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase D alpha 2-like 
[Cucumis sativus]
Length=820

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 100/153 (65%), Gaps = 13/153 (8%)
 Frame = +1

Query  49   LLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARVGRTR  228
            LLHG+LH  +YE+D+++T G      KIV             SR+YAT+DL+KARVGRTR
Sbjct  31   LLHGTLHADIYEIDRLQT-GFPVFCGKIV------------GSRMYATVDLDKARVGRTR  77

Query  229  LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWL  408
            ++D+  NP W + F IYCAH  S+++F+VK  + IGA LIGRAY+P   ++ G   ++W+
Sbjct  78   IVDQPYNPHWNDHFRIYCAHTVSHIIFTVKDGDFIGATLIGRAYVPVEEIIKGFVYEKWV  137

Query  409  PLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
             +LD D  P++  S+IHVKLQF  V  +R W R
Sbjct  138  DILDEDGKPLYGRSRIHVKLQFSSVNEDRNWSR  170



>ref|XP_002974536.1| hypothetical protein SELMODRAFT_267774 [Selaginella moellendorffii]
 gb|EFJ24056.1| hypothetical protein SELMODRAFT_267774 [Selaginella moellendorffii]
Length=804

 Score =   142 bits (359),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 104/163 (64%), Gaps = 7/163 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYE----VDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LH+ VYE    V++ +  G    F  K+VEG E  +G  K  S LYATIDL
Sbjct  1    MAQILLHGTLHITVYEAASLVNENRVSGASPKFMRKMVEGVEDSIGIGKGVSSLYATIDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            E+ RVGRTRL+  E   P W ESFHI CAH  +NVV SVK D  + A L+GRA +P +R+
Sbjct  61   ERQRVGRTRLIRKEPTKPVWNESFHIQCAHNIANVVVSVKDDLAVSAFLLGRAKVPVKRI  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
            + GE V+ W  L  ND      +S++ ++LQF D+ R+  WGR
Sbjct  121  MYGELVEGWFELY-NDSGKKLGNSRVRLRLQFFDITRDPRWGR  162



>ref|XP_007137028.1| hypothetical protein PHAVU_009G093500g [Phaseolus vulgaris]
 gb|ESW09022.1| hypothetical protein PHAVU_009G093500g [Phaseolus vulgaris]
Length=827

 Score =   143 bits (360),  Expect = 6e-36, Method: Composition-based stats.
 Identities = 79/171 (46%), Positives = 105/171 (61%), Gaps = 22/171 (13%)
 Frame = +1

Query  49   LLHGSLHVCVYEVDKIKTDGLHNL-FHKIVEGAERVVGFN------------------KT  171
            LLHGSL V +YEVD + T  L++  F+   +G  R V                      T
Sbjct  4    LLHGSLDVTIYEVDTLPT--LNDCDFNLCCKGTSRSVRKRVLSQLKSCLFCQCQCQPGST  61

Query  172  ASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELI  348
             + LYAT+DL+KARVGRT++L DE  N  W ++F IYCAH+ S+V+F+VK  +PI A LI
Sbjct  62   QTGLYATVDLDKARVGRTKVLNDERSNTMWNDTFRIYCAHLISHVIFTVKQKDPINATLI  121

Query  349  GRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCW  501
            GRAY+P  +++ G  VD W+ +LD D NPI S SKIHVK+QF DV  +  W
Sbjct  122  GRAYVPVEQVMTGNIVDTWVQILDEDLNPIPSDSKIHVKMQFSDVRNDINW  172



>ref|XP_008673230.1| PREDICTED: phospholipase D family protein isoform X2 [Zea mays]
 ref|XP_008673233.1| PREDICTED: phospholipase D family protein isoform X2 [Zea mays]
 ref|XP_008673237.1| PREDICTED: phospholipase D family protein isoform X2 [Zea mays]
 ref|XP_008673242.1| PREDICTED: phospholipase D family protein isoform X2 [Zea mays]
 tpg|DAA45661.1| TPA: phospholipase D family protein isoform 1 [Zea mays]
 tpg|DAA45662.1| TPA: phospholipase D family protein isoform 2 [Zea mays]
 tpg|DAA45663.1| TPA: phospholipase D family protein isoform 3 [Zea mays]
 tpg|DAA45664.1| TPA: phospholipase D family protein isoform 4 [Zea mays]
Length=855

 Score =   143 bits (360),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 103/175 (59%), Gaps = 18/175 (10%)
 Frame = +1

Query  34   EMAQLLLHGSLHVCVYEVD-KIKTDGL-----HNLFHKIVEGAERVVGFNK---------  168
            +  QLLLHG +   + E D  + TDG        L  K V    R + F +         
Sbjct  21   QTTQLLLHGVIEATILEADLSVTTDGKLQPTKKTLMKKKVFSWIRKLTFCRNQLENAIGL  80

Query  169  -TASRLYATIDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAEL  345
             T  +LYAT+D++KARVGRTR++    +P W ESFH+YCAH ASN++F+VK DN IGA L
Sbjct  81   GTDGKLYATVDIDKARVGRTRMVPPVHSPMWDESFHLYCAHDASNIIFTVKADNAIGATL  140

Query  346  IGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERC--WG  504
            IGRAY+P   ++ G +VD WLP+ D  R P+    +IHV++QF DV  +    WG
Sbjct  141  IGRAYLPTEGVVAGRKVDLWLPIRDEKRQPLEGGDQIHVQVQFTDVAADPTAGWG  195



>emb|CAN81667.1| hypothetical protein VITISV_017804 [Vitis vinifera]
Length=642

 Score =   141 bits (356),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 81/110 (74%), Gaps = 2/110 (2%)
 Frame = +1

Query  181  LYATIDLEKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRA  357
            +Y TIDL+KARVGRTR L+ E  NP W E FHIYCAH AS+VVFSVK +NPIGA +IGRA
Sbjct  40   VYVTIDLDKARVGRTRKLENEETNPHWSECFHIYCAHKASHVVFSVKQENPIGATVIGRA  99

Query  358  YMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGR  507
             +P   LL G EVD WL L  +DR PIH  SK+HVKLQF DV RE  W R
Sbjct  100  QLPVEELLEG-EVDRWLELFHHDRTPIHGGSKLHVKLQFFDVTRECNWSR  148



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559877061510