BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF040G12

Length=554
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004234204.1|  PREDICTED: reticulon-like protein B2               241   1e-76   Solanum lycopersicum
gb|ABC01908.1|  putative 24 kDa seed maturation protein-like protein    240   4e-76   Solanum tuberosum [potatoes]
ref|XP_009626480.1|  PREDICTED: reticulon-like protein B2 isoform X1    240   6e-76   Nicotiana tomentosiformis
ref|XP_009765582.1|  PREDICTED: reticulon-like protein B2               238   4e-75   Nicotiana sylvestris
ref|XP_006366650.1|  PREDICTED: putative 24 kDa seed maturation p...    240   5e-74   
ref|XP_006360189.1|  PREDICTED: reticulon-like protein B2-like          223   2e-69   Solanum tuberosum [potatoes]
ref|XP_009772131.1|  PREDICTED: reticulon-like protein B2               219   7e-68   Nicotiana sylvestris
ref|XP_004240710.1|  PREDICTED: reticulon-like protein B6               218   3e-67   Solanum lycopersicum
gb|EYU25170.1|  hypothetical protein MIMGU_mgv1a012274mg                208   1e-63   Erythranthe guttata [common monkey flower]
ref|XP_010925814.1|  PREDICTED: reticulon-like protein B2               207   4e-63   Elaeis guineensis
gb|KDP22201.1|  hypothetical protein JCGZ_26032                         206   8e-63   Jatropha curcas
ref|XP_011084470.1|  PREDICTED: reticulon-like protein B2               205   2e-62   Sesamum indicum [beniseed]
ref|XP_010915765.1|  PREDICTED: reticulon-like protein B2               205   2e-62   Elaeis guineensis
gb|ABC69764.1|  unknown                                                 203   3e-62   Vitis pseudoreticulata
ref|XP_003633964.1|  PREDICTED: reticulon-like protein B1               203   1e-61   Vitis vinifera
ref|XP_006339640.1|  PREDICTED: reticulon-like protein B1-like          203   2e-61   Solanum tuberosum [potatoes]
ref|XP_006422079.1|  hypothetical protein CICLE_v10005564mg             201   8e-61   Citrus clementina [clementine]
gb|KJB24635.1|  hypothetical protein B456_004G154600                    198   9e-61   Gossypium raimondii
gb|KDO56851.1|  hypothetical protein CISIN_1g023137mg                   201   1e-60   Citrus sinensis [apfelsine]
emb|CDP05124.1|  unnamed protein product                                201   1e-60   Coffea canephora [robusta coffee]
ref|XP_008805646.1|  PREDICTED: reticulon-like protein B3               201   1e-60   Phoenix dactylifera
ref|XP_009766982.1|  PREDICTED: reticulon-like protein B5               201   1e-60   Nicotiana sylvestris
ref|XP_006422078.1|  hypothetical protein CICLE_v10005564mg             201   2e-60   
ref|XP_010658515.1|  PREDICTED: reticulon-like protein B2               200   2e-60   Vitis vinifera
ref|XP_009597328.1|  PREDICTED: reticulon-like protein B5               200   3e-60   Nicotiana tomentosiformis
gb|KDO56850.1|  hypothetical protein CISIN_1g023137mg                   201   3e-60   Citrus sinensis [apfelsine]
gb|KHG04885.1|  Reticulon-like protein B5                               199   4e-60   Gossypium arboreum [tree cotton]
ref|XP_004229935.1|  PREDICTED: reticulon-like protein B1               199   4e-60   
ref|XP_008796064.1|  PREDICTED: reticulon-like protein B2               199   4e-60   Phoenix dactylifera
ref|XP_011003673.1|  PREDICTED: reticulon-like protein B1               199   6e-60   Populus euphratica
gb|EYU19605.1|  hypothetical protein MIMGU_mgv1a012182mg                199   8e-60   Erythranthe guttata [common monkey flower]
gb|KHG24129.1|  Reticulon-like protein B3                               198   9e-60   Gossypium arboreum [tree cotton]
ref|NP_001149653.1|  LOC100283279                                       198   9e-60   Zea mays [maize]
gb|KJB24634.1|  hypothetical protein B456_004G154600                    198   1e-59   Gossypium raimondii
ref|XP_002317731.1|  hypothetical protein POPTR_0012s00980g             197   2e-59   
ref|XP_004503660.1|  PREDICTED: reticulon-like protein B2-like          197   2e-59   Cicer arietinum [garbanzo]
ref|XP_007051689.1|  Reticulon family protein                           197   2e-59   
ref|XP_002511930.1|  conserved hypothetical protein                     197   3e-59   Ricinus communis
ref|XP_006476478.1|  PREDICTED: reticulon-like protein B2-like          197   3e-59   Citrus sinensis [apfelsine]
ref|XP_007038874.1|  VIRB2-interacting protein 2                        196   4e-59   Theobroma cacao [chocolate]
gb|KDP28552.1|  hypothetical protein JCGZ_14323                         196   9e-59   Jatropha curcas
ref|XP_009388111.1|  PREDICTED: reticulon-like protein B1               196   1e-58   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB06452.1|  hypothetical protein B456_001G157900                    193   1e-58   Gossypium raimondii
ref|NP_001056102.1|  Os05g0526400                                       195   1e-58   
ref|XP_006439447.1|  hypothetical protein CICLE_v10021801mg             195   2e-58   Citrus clementina [clementine]
ref|XP_002299504.1|  reticulon family protein                           195   2e-58   Populus trichocarpa [western balsam poplar]
ref|XP_010251601.1|  PREDICTED: reticulon-like protein B2               194   3e-58   Nelumbo nucifera [Indian lotus]
ref|XP_008810936.1|  PREDICTED: reticulon-like protein B5               194   3e-58   Phoenix dactylifera
ref|XP_011093062.1|  PREDICTED: reticulon-like protein B1               194   5e-58   Sesamum indicum [beniseed]
ref|XP_009415169.1|  PREDICTED: reticulon-like protein B2               194   6e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011026963.1|  PREDICTED: reticulon-like protein B2               194   6e-58   Populus euphratica
gb|EAY98759.1|  hypothetical protein OsI_20691                          193   8e-58   Oryza sativa Indica Group [Indian rice]
gb|KJB06451.1|  hypothetical protein B456_001G157900                    193   9e-58   Gossypium raimondii
ref|XP_010545343.1|  PREDICTED: reticulon-like protein B3               193   1e-57   Tarenaya hassleriana [spider flower]
ref|NP_001130478.1|  Seed maturation protein                            193   1e-57   Zea mays [maize]
ref|NP_001239711.1|  uncharacterized protein LOC100811024               192   2e-57   Glycine max [soybeans]
ref|XP_010533622.1|  PREDICTED: reticulon-like protein B4               192   3e-57   Tarenaya hassleriana [spider flower]
gb|KJB06453.1|  hypothetical protein B456_001G157900                    192   3e-57   Gossypium raimondii
ref|XP_003569752.1|  PREDICTED: reticulon-like protein B1               191   7e-57   Brachypodium distachyon [annual false brome]
ref|XP_010518282.1|  PREDICTED: reticulon-like protein B5               191   8e-57   Camelina sativa [gold-of-pleasure]
ref|XP_003525365.1|  PREDICTED: reticulon-like protein B2-like is...    191   8e-57   Glycine max [soybeans]
gb|ABK94480.1|  unknown                                                 191   8e-57   Populus trichocarpa [western balsam poplar]
ref|XP_009626481.1|  PREDICTED: reticulon-like protein B5 isoform X2    189   9e-57   
gb|KDP25363.1|  hypothetical protein JCGZ_20519                         191   9e-57   Jatropha curcas
ref|XP_002320163.1|  reticulon family protein                           190   1e-56   Populus trichocarpa [western balsam poplar]
ref|XP_010506615.1|  PREDICTED: reticulon-like protein B5               190   1e-56   Camelina sativa [gold-of-pleasure]
ref|XP_007160119.1|  hypothetical protein PHAVU_002G294100g             190   2e-56   Phaseolus vulgaris [French bean]
ref|XP_002509881.1|  conserved hypothetical protein                     190   2e-56   Ricinus communis
emb|CDP12094.1|  unnamed protein product                                190   2e-56   Coffea canephora [robusta coffee]
ref|XP_011047748.1|  PREDICTED: reticulon-like protein B1               190   2e-56   Populus euphratica
ref|XP_006374288.1|  hypothetical protein POPTR_0015s05710g             188   2e-56   
ref|XP_006374287.1|  hypothetical protein POPTR_0015s05710g             187   2e-56   
gb|KCW46474.1|  hypothetical protein EUGRSUZ_K00300                     188   2e-56   Eucalyptus grandis [rose gum]
gb|AEZ00899.1|  putative 24 kDa seed maturation protein                 189   3e-56   Elaeis guineensis
gb|EYU23406.1|  hypothetical protein MIMGU_mgv1a012325mg                189   3e-56   Erythranthe guttata [common monkey flower]
ref|XP_006397801.1|  hypothetical protein EUTSA_v10001599mg             189   3e-56   Eutrema salsugineum [saltwater cress]
ref|XP_010112604.1|  Reticulon-like protein                             189   4e-56   Morus notabilis
ref|XP_009603968.1|  PREDICTED: reticulon-like protein B1               189   6e-56   Nicotiana tomentosiformis
ref|XP_006358652.1|  PREDICTED: reticulon-like protein B1-like          188   7e-56   Solanum tuberosum [potatoes]
ref|XP_008376662.1|  PREDICTED: reticulon-like protein B1               188   8e-56   Malus domestica [apple tree]
ref|XP_010676393.1|  PREDICTED: reticulon-like protein B2               188   9e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008234814.1|  PREDICTED: reticulon-like protein B1               188   9e-56   Prunus mume [ume]
ref|XP_010508058.1|  PREDICTED: reticulon-like protein B5               188   1e-55   Camelina sativa [gold-of-pleasure]
ref|XP_006374289.1|  hypothetical protein POPTR_0015s05710g             188   1e-55   
ref|XP_010916969.1|  PREDICTED: reticulon-like protein B3               189   1e-55   Elaeis guineensis
ref|XP_008437352.1|  PREDICTED: reticulon-like protein B2               188   1e-55   Cucumis melo [Oriental melon]
ref|XP_006654676.1|  PREDICTED: reticulon-like protein B1-like          187   1e-55   Oryza brachyantha
ref|XP_006374290.1|  hypothetical protein POPTR_0015s05710g             188   1e-55   
ref|NP_001118533.1|  reticulon-like protein B5                          185   2e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010035177.1|  PREDICTED: reticulon-like protein B1               187   2e-55   Eucalyptus grandis [rose gum]
ref|XP_007218819.1|  hypothetical protein PRUPE_ppa010065mg             187   2e-55   Prunus persica
ref|XP_009368711.1|  PREDICTED: reticulon-like protein B1               187   2e-55   Pyrus x bretschneideri [bai li]
gb|AFK42129.1|  unknown                                                 185   2e-55   Medicago truncatula
ref|XP_010105716.1|  Reticulon-like protein                             187   3e-55   
emb|CAN77759.1|  hypothetical protein VITISV_034907                     186   4e-55   Vitis vinifera
ref|XP_002275520.1|  PREDICTED: reticulon-like protein B5               186   5e-55   Vitis vinifera
gb|KHG29253.1|  Reticulon-like protein B5                               186   5e-55   Gossypium arboreum [tree cotton]
gb|ACJ84486.1|  unknown                                                 186   6e-55   Medicago truncatula
gb|EAY75742.1|  hypothetical protein OsI_03655                          186   7e-55   Oryza sativa Indica Group [Indian rice]
gb|ACU23452.1|  unknown                                                 186   8e-55   Glycine max [soybeans]
ref|NP_176592.1|  reticulon-like protein B3                             186   9e-55   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566065.1|  reticulon-like protein B5                             185   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010541290.1|  PREDICTED: reticulon-like protein B1               186   1e-54   Tarenaya hassleriana [spider flower]
ref|XP_004143883.1|  PREDICTED: reticulon-like protein B2-like          185   2e-54   Cucumis sativus [cucumbers]
emb|CDY57657.1|  BnaC01g15350D                                          185   2e-54   Brassica napus [oilseed rape]
emb|CDY44123.1|  BnaA01g13310D                                          185   3e-54   Brassica napus [oilseed rape]
ref|XP_003568063.1|  PREDICTED: reticulon-like protein B1               184   3e-54   Brachypodium distachyon [annual false brome]
gb|KJB37517.1|  hypothetical protein B456_006G208500                    182   3e-54   Gossypium raimondii
ref|XP_006294850.1|  hypothetical protein CARUB_v10023902mg             184   4e-54   Capsella rubella
ref|XP_008343772.1|  PREDICTED: reticulon-like protein B1               184   4e-54   Malus domestica [apple tree]
ref|XP_009416410.1|  PREDICTED: reticulon-like protein B2               183   6e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009142682.1|  PREDICTED: reticulon-like protein B5               183   6e-54   Brassica rapa
emb|CDY42012.1|  BnaC04g00900D                                          183   6e-54   Brassica napus [oilseed rape]
emb|CDY08353.1|  BnaC09g12430D                                          183   7e-54   Brassica napus [oilseed rape]
ref|XP_008354289.1|  PREDICTED: reticulon-like protein B1               183   8e-54   
gb|EMS62606.1|  Reticulon-like protein B1                               183   8e-54   Triticum urartu
ref|XP_006391670.1|  hypothetical protein EUTSA_v10023649mg             183   9e-54   Eutrema salsugineum [saltwater cress]
ref|XP_006396933.1|  hypothetical protein EUTSA_v10028886mg             183   1e-53   Eutrema salsugineum [saltwater cress]
gb|KFK40472.1|  hypothetical protein AALP_AA2G000200                    182   1e-53   Arabis alpina [alpine rockcress]
ref|XP_009137263.1|  PREDICTED: reticulon-like protein B1               183   1e-53   Brassica rapa
ref|XP_010544774.1|  PREDICTED: reticulon-like protein B6               182   1e-53   Tarenaya hassleriana [spider flower]
ref|XP_002880222.1|  reticulon family protein                           182   2e-53   Arabidopsis lyrata subsp. lyrata
gb|KFK37395.1|  hypothetical protein AALP_AA4G251600                    182   2e-53   Arabis alpina [alpine rockcress]
gb|KHG15548.1|  Reticulon-like protein B3                               182   2e-53   Gossypium arboreum [tree cotton]
emb|CDY25557.1|  BnaC09g11820D                                          182   3e-53   Brassica napus [oilseed rape]
ref|XP_009375555.1|  PREDICTED: reticulon-like protein B1               182   3e-53   Pyrus x bretschneideri [bai li]
gb|AFK48295.1|  unknown                                                 179   4e-53   Lotus japonicus
emb|CDY34396.1|  BnaA09g11380D                                          181   4e-53   Brassica napus [oilseed rape]
ref|XP_010439153.1|  PREDICTED: reticulon-like protein B1 isoform X2    179   5e-53   Camelina sativa [gold-of-pleasure]
ref|XP_006644671.1|  PREDICTED: reticulon-like protein B1-like          181   6e-53   Oryza brachyantha
emb|CDP08746.1|  unnamed protein product                                181   6e-53   Coffea canephora [robusta coffee]
gb|EMT06999.1|  Reticulon-like protein B1                               181   6e-53   
ref|XP_009406786.1|  PREDICTED: reticulon-like protein B1 isoform X2    180   8e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010669728.1|  PREDICTED: reticulon-like protein B4               181   8e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010924771.1|  PREDICTED: reticulon-like protein B2               180   9e-53   Elaeis guineensis
gb|ACF87936.1|  unknown                                                 179   1e-52   Zea mays [maize]
gb|EMS49910.1|  Reticulon-like protein B3                               182   1e-52   Triticum urartu
ref|XP_010529625.1|  PREDICTED: reticulon-like protein B1               181   1e-52   Tarenaya hassleriana [spider flower]
dbj|BAJ89699.1|  predicted protein                                      180   2e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFK41983.1|  unknown                                                 179   2e-52   Medicago truncatula
ref|XP_010418453.1|  PREDICTED: reticulon-like protein B3               179   2e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010473658.1|  PREDICTED: reticulon-like protein B3 isoform X3    180   2e-52   Camelina sativa [gold-of-pleasure]
emb|CDY52012.1|  BnaC06g42920D                                          179   2e-52   Brassica napus [oilseed rape]
ref|XP_006413534.1|  hypothetical protein EUTSA_v10025959mg             178   2e-52   
ref|XP_009112901.1|  PREDICTED: reticulon-like protein B3               179   3e-52   Brassica rapa
ref|XP_010433883.1|  PREDICTED: reticulon-like protein B1               180   3e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010523772.1|  PREDICTED: reticulon-like protein B5               179   3e-52   Tarenaya hassleriana [spider flower]
ref|XP_006284300.1|  hypothetical protein CARUB_v10005469mg             179   4e-52   
ref|XP_009104316.1|  PREDICTED: reticulon-like protein B6               179   4e-52   Brassica rapa
ref|XP_010439152.1|  PREDICTED: reticulon-like protein B1 isoform X1    179   5e-52   Camelina sativa [gold-of-pleasure]
ref|XP_004248066.1|  PREDICTED: reticulon-like protein B1               179   5e-52   Solanum lycopersicum
ref|NP_001044177.1|  Os01g0736900                                       178   5e-52   
ref|XP_009763462.1|  PREDICTED: reticulon-like protein B1 isoform X2    178   6e-52   Nicotiana sylvestris
ref|XP_006413535.1|  hypothetical protein EUTSA_v10025959mg             179   7e-52   Eutrema salsugineum [saltwater cress]
ref|XP_009763461.1|  PREDICTED: reticulon-like protein B6 isoform X1    178   7e-52   Nicotiana sylvestris
ref|XP_010509305.1|  PREDICTED: reticulon-like protein B1               178   8e-52   Camelina sativa [gold-of-pleasure]
ref|NP_001241367.1|  uncharacterized protein LOC100796111               177   1e-51   Glycine max [soybeans]
ref|XP_002887921.1|  reticulon family protein                           177   1e-51   Arabidopsis lyrata subsp. lyrata
ref|XP_010261408.1|  PREDICTED: reticulon-like protein B2               177   1e-51   Nelumbo nucifera [Indian lotus]
ref|XP_008232963.1|  PREDICTED: reticulon-like protein B6               177   1e-51   Prunus mume [ume]
gb|KHN15986.1|  Reticulon-like protein B5                               177   1e-51   Glycine soja [wild soybean]
gb|KJB52211.1|  hypothetical protein B456_008G250900                    175   1e-51   Gossypium raimondii
ref|XP_009395750.1|  PREDICTED: reticulon-like protein B2               177   2e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006302727.1|  hypothetical protein CARUB_v10020840mg             177   2e-51   Capsella rubella
ref|NP_192861.1|  reticulon-like protein B2                             177   2e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010455527.1|  PREDICTED: reticulon-like protein B2               177   2e-51   Camelina sativa [gold-of-pleasure]
ref|XP_009137373.1|  PREDICTED: reticulon-like protein B1               177   2e-51   Brassica rapa
gb|KJB24287.1|  hypothetical protein B456_004G137000                    175   2e-51   Gossypium raimondii
ref|XP_009134231.1|  PREDICTED: reticulon-like protein B2               177   3e-51   Brassica rapa
ref|XP_006288443.1|  hypothetical protein CARUB_v10001704mg             177   3e-51   Capsella rubella
dbj|BAJ33905.1|  unnamed protein product                                177   4e-51   Eutrema halophilum
ref|XP_004969875.1|  PREDICTED: reticulon-like protein B1-like          176   4e-51   Setaria italica
ref|XP_010422067.1|  PREDICTED: reticulon-like protein B2               176   4e-51   Camelina sativa [gold-of-pleasure]
ref|XP_007218267.1|  hypothetical protein PRUPE_ppa008259mg             177   4e-51   
ref|XP_011022600.1|  PREDICTED: reticulon-like protein B1               176   5e-51   Populus euphratica
gb|EAZ13460.1|  hypothetical protein OsJ_03377                          176   5e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004149448.1|  PREDICTED: reticulon-like protein B1-like          176   5e-51   Cucumis sativus [cucumbers]
ref|XP_008792381.1|  PREDICTED: reticulon-like protein B2 isoform X2    176   5e-51   
gb|KJB52210.1|  hypothetical protein B456_008G250900                    176   6e-51   Gossypium raimondii
gb|KJB52212.1|  hypothetical protein B456_008G250900                    174   6e-51   Gossypium raimondii
gb|KJB24285.1|  hypothetical protein B456_004G137000                    176   7e-51   Gossypium raimondii
ref|XP_002303615.1|  reticulon family protein                           175   8e-51   Populus trichocarpa [western balsam poplar]
ref|XP_010430525.1|  PREDICTED: reticulon-like protein B3               175   1e-50   Camelina sativa [gold-of-pleasure]
ref|XP_008792378.1|  PREDICTED: reticulon-like protein B3 isoform X1    176   1e-50   
ref|XP_009406784.1|  PREDICTED: reticulon-like protein B1 isoform X1    175   1e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007139766.1|  hypothetical protein PHAVU_008G057300g             173   1e-50   Phaseolus vulgaris [French bean]
gb|KHG20258.1|  Reticulon-like protein B3                               174   1e-50   Gossypium arboreum [tree cotton]
emb|CDM81762.1|  unnamed protein product                                174   2e-50   Triticum aestivum [Canadian hard winter wheat]
emb|CDY10954.1|  BnaA03g46130D                                          175   2e-50   Brassica napus [oilseed rape]
ref|XP_007218268.1|  hypothetical protein PRUPE_ppa008259mg             176   2e-50   
dbj|BAJ98297.1|  predicted protein                                      174   2e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011080892.1|  PREDICTED: reticulon-like protein B2               174   2e-50   Sesamum indicum [beniseed]
gb|AFK34557.1|  unknown                                                 174   3e-50   Medicago truncatula
emb|CDY38194.1|  BnaA09g11950D                                          174   3e-50   Brassica napus [oilseed rape]
ref|XP_007139767.1|  hypothetical protein PHAVU_008G057300g             174   3e-50   Phaseolus vulgaris [French bean]
emb|CDY24806.1|  BnaA08g15040D                                          174   4e-50   Brassica napus [oilseed rape]
ref|XP_002869770.1|  VIRB2-interacting protein 1                        174   4e-50   Arabidopsis lyrata subsp. lyrata
ref|XP_007209494.1|  hypothetical protein PRUPE_ppa010244mg             174   4e-50   Prunus persica
ref|NP_001239653.1|  uncharacterized protein LOC100793862               173   5e-50   Glycine max [soybeans]
gb|KDO86332.1|  hypothetical protein CISIN_1g025719mg                   172   6e-50   Citrus sinensis [apfelsine]
emb|CDY05135.1|  BnaC03g29330D                                          175   6e-50   
ref|NP_194094.1|  VIRB2-interacting protein 1                           174   6e-50   Arabidopsis thaliana [mouse-ear cress]
gb|AFK42059.1|  unknown                                                 173   7e-50   Lotus japonicus
ref|XP_003528823.2|  PREDICTED: reticulon-like protein B1-like          174   8e-50   Glycine max [soybeans]
ref|XP_010435260.1|  PREDICTED: reticulon-like protein B2               173   9e-50   Camelina sativa [gold-of-pleasure]
emb|CDY41666.1|  BnaC03g62180D                                          173   1e-49   Brassica napus [oilseed rape]
gb|KDO86331.1|  hypothetical protein CISIN_1g025719mg                   172   1e-49   Citrus sinensis [apfelsine]
ref|XP_006444935.1|  hypothetical protein CICLE_v10021860mg             172   2e-49   Citrus clementina [clementine]
ref|NP_001185307.1|  reticulon-like protein B3                          172   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870630.1|  VIRB2-interacting protein 3                        172   2e-49   
ref|XP_010092876.1|  Reticulon-like protein                             171   2e-49   Morus notabilis
ref|XP_004245560.1|  PREDICTED: reticulon-like protein B4               172   2e-49   Solanum lycopersicum
ref|XP_009380544.1|  PREDICTED: reticulon-like protein B2               171   3e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002301382.1|  hypothetical protein POPTR_0002s16690g             171   3e-49   Populus trichocarpa [western balsam poplar]
gb|KJB52682.1|  hypothetical protein B456_008G272900                    169   3e-49   Gossypium raimondii
ref|XP_004308034.1|  PREDICTED: reticulon-like protein B2               172   3e-49   Fragaria vesca subsp. vesca
ref|NP_191715.2|  reticulon-like protein B6                             171   4e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004298843.1|  PREDICTED: reticulon-like protein B2               171   4e-49   Fragaria vesca subsp. vesca
ref|XP_009349323.1|  PREDICTED: reticulon-like protein B1               171   6e-49   Pyrus x bretschneideri [bai li]
ref|XP_006402470.1|  hypothetical protein EUTSA_v10006190mg             171   6e-49   Eutrema salsugineum [saltwater cress]
ref|XP_009338786.1|  PREDICTED: reticulon-like protein B1               170   8e-49   Pyrus x bretschneideri [bai li]
gb|KJB52679.1|  hypothetical protein B456_008G272900                    170   8e-49   Gossypium raimondii
ref|XP_006291739.1|  hypothetical protein CARUB_v10017909mg             169   1e-48   Capsella rubella
dbj|BAH57206.1|  AT1G64090                                              169   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198975.1|  reticulon-like protein B4                             169   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009112802.1|  PREDICTED: reticulon-like protein B3               169   1e-48   Brassica rapa
gb|KHF99856.1|  Reticulon-like protein B1                               167   2e-48   Gossypium arboreum [tree cotton]
ref|XP_002874678.1|  VIRB2-interacting protein 2                        170   2e-48   Arabidopsis lyrata subsp. lyrata
ref|XP_011023265.1|  PREDICTED: reticulon-like protein B5               169   3e-48   Populus euphratica
ref|XP_010469092.1|  PREDICTED: reticulon-like protein B6               168   3e-48   Camelina sativa [gold-of-pleasure]
gb|KCW72351.1|  hypothetical protein EUGRSUZ_E00805                     167   3e-48   Eucalyptus grandis [rose gum]
ref|NP_001240231.1|  uncharacterized protein LOC100778096               169   4e-48   Glycine max [soybeans]
gb|KHN40449.1|  Reticulon-like protein B5                               169   4e-48   Glycine soja [wild soybean]
ref|XP_010055800.1|  PREDICTED: reticulon-like protein B1               169   4e-48   Eucalyptus grandis [rose gum]
gb|KCW72350.1|  hypothetical protein EUGRSUZ_E00805                     167   4e-48   Eucalyptus grandis [rose gum]
gb|KCW72347.1|  hypothetical protein EUGRSUZ_E00805                     169   4e-48   Eucalyptus grandis [rose gum]
ref|XP_011073415.1|  PREDICTED: reticulon-like protein B1 isoform X2    165   7e-48   
ref|XP_006343915.1|  PREDICTED: reticulon-like protein B1-like          168   7e-48   Solanum tuberosum [potatoes]
gb|KCW72348.1|  hypothetical protein EUGRSUZ_E00805                     169   8e-48   Eucalyptus grandis [rose gum]
ref|XP_009345612.1|  PREDICTED: reticulon-like protein B1               168   8e-48   Pyrus x bretschneideri [bai li]
gb|KHN29299.1|  Reticulon-like protein B5                               167   9e-48   Glycine soja [wild soybean]
ref|XP_008375931.1|  PREDICTED: reticulon-like protein B1               167   9e-48   Malus domestica [apple tree]
ref|XP_008377768.1|  PREDICTED: reticulon-like protein B2               167   1e-47   Malus domestica [apple tree]
ref|XP_009334492.1|  PREDICTED: reticulon-like protein B2               167   1e-47   Pyrus x bretschneideri [bai li]
ref|XP_008367699.1|  PREDICTED: reticulon-like protein B2               167   1e-47   Malus domestica [apple tree]
ref|XP_010512508.1|  PREDICTED: reticulon-like protein B6               167   1e-47   Camelina sativa [gold-of-pleasure]
ref|XP_009341126.1|  PREDICTED: reticulon-like protein B1               167   1e-47   Pyrus x bretschneideri [bai li]
ref|XP_010413382.1|  PREDICTED: reticulon-like protein B6               166   2e-47   Camelina sativa [gold-of-pleasure]
ref|XP_008344578.1|  PREDICTED: reticulon-like protein B1               167   2e-47   
ref|XP_004306726.1|  PREDICTED: reticulon-like protein B5               167   2e-47   Fragaria vesca subsp. vesca
gb|KFK31901.1|  hypothetical protein AALP_AA6G173800                    167   2e-47   Arabis alpina [alpine rockcress]
gb|EYU32181.1|  hypothetical protein MIMGU_mgv1a012219mg                166   3e-47   Erythranthe guttata [common monkey flower]
gb|KJB24286.1|  hypothetical protein B456_004G137000                    163   3e-47   Gossypium raimondii
ref|XP_009793558.1|  PREDICTED: reticulon-like protein B4               166   3e-47   Nicotiana sylvestris
ref|XP_006645662.1|  PREDICTED: reticulon-like protein B1-like          166   3e-47   Oryza brachyantha
ref|XP_011073407.1|  PREDICTED: reticulon-like protein B2 isoform X1    166   3e-47   Sesamum indicum [beniseed]
gb|KJB19086.1|  hypothetical protein B456_003G084400                    164   4e-47   Gossypium raimondii
dbj|BAB32723.1|  unknown protein                                        166   5e-47   Oryza sativa Japonica Group [Japonica rice]
gb|EAY73097.1|  hypothetical protein OsI_00974                          166   5e-47   Oryza sativa Indica Group [Indian rice]
gb|KJB19089.1|  hypothetical protein B456_003G084400                    164   8e-47   Gossypium raimondii
ref|XP_010053196.1|  PREDICTED: reticulon-like protein B1               165   8e-47   Eucalyptus grandis [rose gum]
gb|KJB24636.1|  hypothetical protein B456_004G154600                    161   8e-47   Gossypium raimondii
ref|XP_009109295.1|  PREDICTED: reticulon-like protein B1               165   9e-47   Brassica rapa
ref|XP_003592173.1|  Reticulon family protein                           165   9e-47   Medicago truncatula
ref|XP_007040378.1|  Reticulan like protein B3, putative isoform 3      166   9e-47   
ref|XP_010538815.1|  PREDICTED: reticulon-like protein B1               165   1e-46   Tarenaya hassleriana [spider flower]
gb|EPS73616.1|  hypothetical protein M569_01145                         164   1e-46   Genlisea aurea
gb|KJB19088.1|  hypothetical protein B456_003G084400                    164   1e-46   Gossypium raimondii
gb|KJB19091.1|  hypothetical protein B456_003G084400                    164   1e-46   Gossypium raimondii
ref|XP_004967455.1|  PREDICTED: reticulon-like protein B1-like          165   1e-46   Setaria italica
ref|XP_007040377.1|  Reticulan like protein B3, putative isoform 2      165   1e-46   
ref|XP_007040376.1|  Reticulan like protein B3, putative isoform 1      165   2e-46   
gb|KJB19087.1|  hypothetical protein B456_003G084400                    164   2e-46   Gossypium raimondii
ref|XP_004496510.1|  PREDICTED: reticulon-like protein B1-like          164   2e-46   Cicer arietinum [garbanzo]
tpg|DAA52789.1|  TPA: seed maturation protein                           164   2e-46   
ref|NP_001150474.1|  seed maturation protein                            164   4e-46   
ref|XP_006589518.1|  PREDICTED: reticulon-like protein B1-like          163   4e-46   Glycine max [soybeans]
ref|XP_007143486.1|  hypothetical protein PHAVU_007G075900g             162   7e-46   Phaseolus vulgaris [French bean]
ref|XP_003565836.1|  PREDICTED: reticulon-like protein B1               163   7e-46   Brachypodium distachyon [annual false brome]
ref|XP_011037168.1|  PREDICTED: reticulon-like protein B5               162   8e-46   
ref|XP_008655792.1|  PREDICTED: reticulon-like protein B1               163   1e-45   
ref|XP_004961431.1|  PREDICTED: reticulon-like protein B1-like          162   1e-45   
ref|XP_004510697.1|  PREDICTED: reticulon-like protein B1-like          161   2e-45   
gb|KHG09260.1|  Reticulon-like protein B3                               161   2e-45   
emb|CDJ26559.1|  unnamed protein product                                162   2e-45   
gb|EMT19773.1|  Reticulon-like protein B1                               161   4e-45   
ref|XP_002876621.1|  reticulon family protein                           160   6e-45   
ref|XP_008782788.1|  PREDICTED: reticulon-like protein B1               158   8e-45   
gb|AFK39432.1|  unknown                                                 155   2e-44   
ref|XP_002441411.1|  hypothetical protein SORBIDRAFT_09g026210          159   2e-44   
ref|XP_008793405.1|  PREDICTED: reticulon-like protein B1               158   3e-44   
ref|XP_010921231.1|  PREDICTED: reticulon-like protein B1 isoform X1    158   3e-44   
ref|NP_001130268.1|  uncharacterized protein LOC100191362               158   3e-44   
ref|XP_010447719.1|  PREDICTED: reticulon-like protein B4               158   4e-44   
ref|XP_006847055.1|  hypothetical protein AMTR_s00017p00194840          159   4e-44   
ref|XP_007135152.1|  hypothetical protein PHAVU_010G105400g             158   5e-44   
gb|EMS62854.1|  Reticulon-like protein B1                               157   5e-44   
ref|XP_008239009.1|  PREDICTED: reticulon-like protein B2               158   5e-44   
gb|EPS71452.1|  hypothetical protein M569_03311                         157   6e-44   
ref|XP_003555396.1|  PREDICTED: reticulon-like protein B1-like          157   7e-44   
gb|KHN12926.1|  Reticulon-like protein B1                               157   8e-44   
ref|XP_010938076.1|  PREDICTED: reticulon-like protein B1               157   9e-44   
gb|ACG32549.1|  seed maturation protein                                 157   1e-43   
ref|XP_010436110.1|  PREDICTED: reticulon-like protein B4               156   2e-43   
ref|XP_010462752.1|  PREDICTED: reticulon-like protein B5 isoform X2    152   3e-43   
gb|KHN21799.1|  Reticulon-like protein B1                               155   5e-43   
ref|XP_010441324.1|  PREDICTED: reticulon-like protein B4               155   5e-43   
gb|KFK33000.1|  hypothetical protein AALP_AA6G316900                    155   5e-43   
emb|CDX90792.1|  BnaA03g24720D                                          155   5e-43   
ref|XP_006284372.1|  hypothetical protein CARUB_v10005543mg             154   1e-42   
ref|XP_010671578.1|  PREDICTED: reticulon-like protein B4               155   1e-42   
ref|XP_010278922.1|  PREDICTED: reticulon-like protein B5               153   3e-42   
ref|XP_010462746.1|  PREDICTED: reticulon-like protein B5 isoform X1    150   3e-42   
ref|XP_004980276.1|  PREDICTED: uncharacterized protein LOC101782657    153   3e-41   
gb|EPS69502.1|  hypothetical protein M569_05265                         150   3e-41   
ref|XP_009404680.1|  PREDICTED: reticulon-like protein B2               149   1e-40   
gb|ACN40158.1|  unknown                                                 149   1e-40   
gb|ABR17571.1|  unknown                                                 149   1e-40   
ref|XP_009419823.1|  PREDICTED: reticulon-like protein B2               148   2e-40   
ref|XP_004133840.1|  PREDICTED: reticulon-like protein B5-like          148   3e-40   
ref|NP_001057713.1|  Os06g0503400                                       147   6e-40   
ref|XP_008437980.1|  PREDICTED: reticulon-like protein B5               147   8e-40   
ref|NP_001130603.1|  uncharacterized protein LOC100191702               146   1e-39   
gb|EPS64109.1|  hypothetical protein M569_10676                         146   2e-39   
ref|XP_006656127.1|  PREDICTED: reticulon-like protein B2-like          146   2e-39   
ref|XP_002438444.1|  hypothetical protein SORBIDRAFT_10g019720          145   3e-39   
gb|ACG36034.1|  reticulon                                               145   3e-39   
ref|XP_009400146.1|  PREDICTED: reticulon-like protein B1               145   3e-39   
ref|XP_008788043.1|  PREDICTED: reticulon-like protein B5               144   6e-39   
gb|EAY85291.1|  hypothetical protein OsI_06662                          144   7e-39   
ref|NP_001046501.1|  Os02g0265900                                       143   1e-38   
dbj|BAJ94514.1|  predicted protein                                      143   2e-38   
ref|XP_003563831.1|  PREDICTED: reticulon-like protein B1               143   2e-38   
ref|NP_001030913.1|  reticulon-like protein B6                          143   3e-38   
ref|NP_001130091.1|  uncharacterized protein LOC100191184               142   4e-38   
ref|XP_004965478.1|  PREDICTED: reticulon-like protein B2-like          142   5e-38   
dbj|BAK05980.1|  predicted protein                                      141   6e-38   
ref|XP_011085435.1|  PREDICTED: reticulon-like protein B8               141   8e-38   
ref|XP_006842617.1|  hypothetical protein AMTR_s00077p00178230          141   9e-38   
ref|XP_009421445.1|  PREDICTED: reticulon-like protein B1               139   1e-37   
gb|KHG24796.1|  Reticulon-like protein B5                               139   1e-37   
ref|XP_003572248.1|  PREDICTED: reticulon-like protein B2               140   2e-37   
ref|XP_010931411.1|  PREDICTED: reticulon-like protein B6               140   2e-37   
gb|KJB39437.1|  hypothetical protein B456_007G013600                    140   2e-37   
ref|XP_006647139.1|  PREDICTED: reticulon-like protein B2-like          139   3e-37   
gb|KJB52681.1|  hypothetical protein B456_008G272900                    136   4e-37   
gb|EEC80692.1|  hypothetical protein OsI_23118                          147   6e-37   
gb|ABK22748.1|  unknown                                                 139   6e-37   
ref|XP_004951242.1|  PREDICTED: reticulon-like protein B2-like          138   9e-37   
ref|XP_006366629.1|  PREDICTED: reticulon-like protein B8-like is...    138   2e-36   
ref|XP_006366628.1|  PREDICTED: reticulon-like protein B8-like is...    138   3e-36   
gb|ABK26525.1|  unknown                                                 137   3e-36   
ref|XP_008809740.1|  PREDICTED: reticulon-like protein B8 isoform X2    135   3e-36   
ref|XP_009403393.1|  PREDICTED: reticulon-like protein B8               137   3e-36   
ref|XP_008809739.1|  PREDICTED: reticulon-like protein B8 isoform X1    135   4e-36   
dbj|BAK06264.1|  predicted protein                                      137   4e-36   
gb|KJB52680.1|  hypothetical protein B456_008G272900                    134   4e-36   
ref|XP_009416753.1|  PREDICTED: reticulon-like protein B8 isoform X2    135   5e-36   
gb|EMS52545.1|  Reticulon-like protein B1                               137   6e-36   
gb|EMT25698.1|  Reticulon-like protein B2                               137   7e-36   
ref|XP_004243617.1|  PREDICTED: reticulon-like protein B8               136   8e-36   
ref|XP_006836413.1|  hypothetical protein AMTR_s00092p00151450          135   1e-35   
ref|XP_009416749.1|  PREDICTED: reticulon-like protein B8 isoform X1    135   2e-35   
ref|XP_002521590.1|  conserved hypothetical protein                     135   2e-35   
ref|XP_007146289.1|  hypothetical protein PHAVU_006G028000g             135   3e-35   
ref|XP_009598008.1|  PREDICTED: reticulon-like protein B2               134   3e-35   
emb|CDP18758.1|  unnamed protein product                                134   4e-35   
ref|XP_004147776.1|  PREDICTED: reticulon-like protein B8-like          134   4e-35   
ref|XP_004499535.1|  PREDICTED: reticulon-like protein B8-like is...    134   5e-35   
ref|XP_008458672.1|  PREDICTED: reticulon-like protein B2               134   6e-35   
ref|XP_004161550.1|  PREDICTED: reticulon-like protein B8-like          134   8e-35   
ref|XP_008451843.1|  PREDICTED: reticulon-like protein B8 isoform X2    134   8e-35   
ref|XP_009777726.1|  PREDICTED: reticulon-like protein B8               133   1e-34   
ref|XP_002302126.2|  reticulon family protein                           133   1e-34   
ref|XP_009596514.1|  PREDICTED: reticulon-like protein B8               133   2e-34   
gb|ABB51093.1|  reticulon                                               131   2e-34   
ref|XP_011080610.1|  PREDICTED: reticulon-like protein B5               132   3e-34   
ref|XP_010904667.1|  PREDICTED: reticulon-like protein B8               132   3e-34   
ref|XP_007048924.1|  Reticulon family protein                           132   4e-34   
ref|XP_008451841.1|  PREDICTED: reticulon-like protein B8 isoform X1    132   4e-34   
ref|XP_009399837.1|  PREDICTED: reticulon-like protein B5               131   5e-34   
ref|XP_002306759.1|  reticulon family protein                           131   6e-34   
gb|EMT18983.1|  Reticulon-like protein B1                               130   6e-34   
ref|XP_008342327.1|  PREDICTED: reticulon-like protein B8               131   9e-34   
ref|XP_009376960.1|  PREDICTED: reticulon-like protein B8               131   9e-34   
gb|KEH33647.1|  reticulon-like protein B2                               130   1e-33   
ref|XP_003532073.1|  PREDICTED: reticulon-like protein B8-like is...    130   2e-33   
ref|XP_009356582.1|  PREDICTED: reticulon-like protein B8 isoform X2    130   2e-33   
gb|KCW89794.1|  hypothetical protein EUGRSUZ_A02040                     129   2e-33   
ref|XP_006654252.1|  PREDICTED: reticulon-like protein B1-like          130   2e-33   
ref|XP_010464699.1|  PREDICTED: reticulon-like protein B8               130   2e-33   
ref|XP_011467620.1|  PREDICTED: reticulon-like protein B8 isoform X2    130   2e-33   
gb|KJB24288.1|  hypothetical protein B456_004G137000                    129   2e-33   
ref|XP_006485002.1|  PREDICTED: reticulon-like protein B8-like is...    129   3e-33   
ref|XP_006602275.1|  PREDICTED: reticulon-like protein B8-like is...    129   3e-33   
gb|KDO44767.1|  hypothetical protein CISIN_1g025770mg                   129   3e-33   
ref|XP_006437080.1|  hypothetical protein CICLE_v10032550mg             129   4e-33   
gb|KHN28537.1|  Reticulon-like protein B8                               129   4e-33   
ref|XP_010486627.1|  PREDICTED: reticulon-like protein B8               129   4e-33   
ref|NP_566371.1|  reticulon-like protein B8                             129   4e-33   
ref|XP_010482050.1|  PREDICTED: reticulon-like protein B8               129   4e-33   
ref|XP_004159803.1|  PREDICTED: reticulon-like protein B2-like          129   4e-33   
ref|XP_009601019.1|  PREDICTED: reticulon-like protein B8               129   5e-33   
ref|XP_008380166.1|  PREDICTED: reticulon-like protein B8 isoform X4    129   5e-33   
ref|XP_009123032.1|  PREDICTED: reticulon-like protein B8               129   6e-33   
ref|XP_006602273.1|  PREDICTED: reticulon-like protein B8-like is...    129   6e-33   
ref|XP_010054120.1|  PREDICTED: reticulon-like protein B8 isoform X2    129   6e-33   
ref|XP_008380160.1|  PREDICTED: reticulon-like protein B8 isoform X2    129   7e-33   
ref|XP_004247011.1|  PREDICTED: reticulon-like protein B5               128   7e-33   
ref|NP_850552.1|  reticulon-like protein B8                             129   7e-33   
gb|KHG28741.1|  Reticulon-like protein B8                               128   8e-33   
ref|XP_006407589.1|  hypothetical protein EUTSA_v10021400mg             128   9e-33   
gb|KDP36280.1|  hypothetical protein JCGZ_10290                         128   9e-33   
ref|XP_003568686.1|  PREDICTED: reticulon-like protein B1               128   1e-32   
ref|XP_011032749.1|  PREDICTED: reticulon-like protein B8 isoform X2    128   1e-32   
ref|XP_004962474.1|  PREDICTED: reticulon-like protein B1-like          128   1e-32   
ref|XP_009787619.1|  PREDICTED: reticulon-like protein B5               128   1e-32   
ref|NP_001051461.1|  Os03g0781700                                       128   1e-32   
gb|KCW89791.1|  hypothetical protein EUGRSUZ_A02040                     128   1e-32   
ref|XP_011032748.1|  PREDICTED: reticulon-like protein B8 isoform X1    128   1e-32   
ref|XP_002463790.1|  hypothetical protein SORBIDRAFT_01g006220          127   2e-32   
ref|XP_008811812.1|  PREDICTED: reticulon-like protein B8               127   2e-32   
gb|EAY97489.1|  hypothetical protein OsI_19418                          127   2e-32   
ref|XP_011100485.1|  PREDICTED: reticulon-like protein B8               127   2e-32   
gb|KFK30707.1|  hypothetical protein AALP_AA6G017300                    127   3e-32   
gb|EAY92056.1|  hypothetical protein OsI_13754                          127   3e-32   
gb|EYU36885.1|  hypothetical protein MIMGU_mgv1a013116mg                126   3e-32   
emb|CDY56712.1|  BnaC01g38700D                                          129   3e-32   
ref|XP_009621222.1|  PREDICTED: reticulon-like protein B5               127   3e-32   
gb|EPS67049.1|  hypothetical protein M569_07727                         126   4e-32   
ref|XP_009146855.1|  PREDICTED: reticulon-like protein B8 isoform X2    126   4e-32   
emb|CDY00916.1|  BnaC05g42840D                                          126   4e-32   
ref|XP_008647873.1|  PREDICTED: LOC100282693 isoform X1                 126   5e-32   
gb|AFW80460.1|  hypothetical protein ZEAMMB73_353444                    124   5e-32   
ref|XP_010688858.1|  PREDICTED: reticulon-like protein B8               126   5e-32   
ref|XP_010247587.1|  PREDICTED: reticulon-like protein B8               126   5e-32   
ref|NP_001055164.1|  Os05g0312500                                       126   5e-32   
ref|XP_007141449.1|  hypothetical protein PHAVU_008G196600g             126   5e-32   
ref|XP_009146854.1|  PREDICTED: reticulon-like protein B8 isoform X1    126   6e-32   
ref|XP_009783850.1|  PREDICTED: reticulon-like protein B8               126   6e-32   
ref|XP_009111430.1|  PREDICTED: reticulon-like protein B7 isoform X1    126   7e-32   
ref|XP_002283026.1|  PREDICTED: reticulon-like protein B8               126   7e-32   
ref|XP_006339395.1|  PREDICTED: reticulon-like protein B5-like          126   1e-31   
ref|XP_011467618.1|  PREDICTED: reticulon-like protein B8 isoform X1    125   1e-31   
gb|AFW82132.1|  hypothetical protein ZEAMMB73_565764                    124   1e-31   
ref|XP_011026205.1|  PREDICTED: reticulon-like protein B8               125   1e-31   
ref|XP_006650682.1|  PREDICTED: reticulon-like protein B8-like          125   1e-31   
gb|KJB71177.1|  hypothetical protein B456_011G126300                    123   2e-31   
emb|CDY07184.1|  BnaCnng01990D                                          125   2e-31   
gb|KJB71176.1|  hypothetical protein B456_011G126300                    123   2e-31   
ref|NP_001149072.1|  LOC100282693                                       125   2e-31   
ref|NP_001150935.1|  seed maturation protein                            125   2e-31   
ref|XP_004299572.1|  PREDICTED: reticulon-like protein B9               124   2e-31   
ref|XP_010543528.1|  PREDICTED: reticulon-like protein B8               124   3e-31   
gb|KJB71178.1|  hypothetical protein B456_011G126300                    123   3e-31   
ref|XP_007215866.1|  hypothetical protein PRUPE_ppa010481mg             124   3e-31   
ref|XP_010054092.1|  PREDICTED: reticulon-like protein B8 isoform X1    124   4e-31   
gb|EMT10142.1|  Reticulon-like protein B1                               124   5e-31   
emb|CDY41331.1|  BnaA01g31880D                                          123   8e-31   
ref|XP_010552962.1|  PREDICTED: reticulon-like protein B8               123   8e-31   
gb|KJB71174.1|  hypothetical protein B456_011G126300                    123   8e-31   
ref|XP_004981542.1|  PREDICTED: reticulon-like protein B8-like          124   1e-30   
gb|AFW78798.1|  hypothetical protein ZEAMMB73_677867                    119   1e-30   
ref|NP_001058867.1|  Os07g0142000                                       122   1e-30   
ref|XP_008229593.1|  PREDICTED: reticulon-like protein B8               122   1e-30   
gb|EEE63204.1|  hypothetical protein OsJ_18014                          125   2e-30   
ref|XP_006432015.1|  hypothetical protein CICLE_v10002112mg             122   3e-30   
gb|KJB71173.1|  hypothetical protein B456_011G126300                    122   3e-30   
gb|KHN11998.1|  Reticulon-like protein B8                               121   3e-30   
ref|XP_010023631.1|  PREDICTED: reticulon-like protein B8 isoform X2    122   3e-30   
ref|XP_006491909.1|  PREDICTED: reticulon-like protein B5-like is...    122   4e-30   
gb|ACG31942.1|  seed maturation protein                                 121   5e-30   
ref|XP_006491906.1|  PREDICTED: reticulon-like protein B5-like is...    122   8e-30   
ref|XP_006491907.1|  PREDICTED: reticulon-like protein B5-like is...    122   8e-30   
ref|XP_006351999.1|  PREDICTED: reticulon-like protein B8-like          120   9e-30   
ref|NP_001241930.1|  uncharacterized protein LOC100787981               120   1e-29   
ref|XP_010093192.1|  Reticulon-like protein                             120   1e-29   
ref|NP_001137021.1|  seed maturation protein isoform 1                  119   2e-29   
gb|ACG26944.1|  seed maturation protein                                 119   3e-29   
tpg|DAA51729.1|  TPA: seed maturation protein                           119   3e-29   
ref|XP_011008495.1|  PREDICTED: reticulon-like protein B2               119   3e-29   
ref|XP_010906868.1|  PREDICTED: reticulon-like protein B8 isoform X2    119   3e-29   
ref|XP_010906857.1|  PREDICTED: reticulon-like protein B8 isoform X1    119   3e-29   
ref|XP_009356580.1|  PREDICTED: reticulon-like protein B8 isoform X1    119   3e-29   
ref|XP_003519525.1|  PREDICTED: uncharacterized LOC100500122 isof...    119   4e-29   
gb|AFW77088.1|  hypothetical protein ZEAMMB73_846644                    118   5e-29   
gb|KHN38355.1|  Reticulon-like protein B8                               119   6e-29   
ref|XP_008353672.1|  PREDICTED: LOW QUALITY PROTEIN: reticulon-li...    116   6e-29   
ref|XP_009793495.1|  PREDICTED: reticulon-like protein B2               117   9e-29   
gb|EMT17810.1|  Reticulon-like protein B8                               118   1e-28   
ref|XP_009631245.1|  PREDICTED: reticulon-like protein B2 isoform X2    117   1e-28   
ref|XP_009631244.1|  PREDICTED: reticulon-like protein B2 isoform X1    117   1e-28   
ref|XP_008380161.1|  PREDICTED: reticulon-like protein B8 isoform X3    117   1e-28   
ref|XP_008380159.1|  PREDICTED: reticulon-like protein B8 isoform X1    117   1e-28   
gb|EMS50148.1|  Reticulon-like protein B2                               117   2e-28   
gb|EEE65781.1|  hypothetical protein OsJ_21474                          122   2e-28   
ref|XP_010023623.1|  PREDICTED: reticulon-like protein B8 isoform X1    118   2e-28   
ref|NP_001042463.1|  Os01g0226300                                       115   2e-28   
gb|ABK26009.1|  unknown                                                 115   4e-28   
ref|XP_004491277.1|  PREDICTED: reticulon-like protein B8-like is...    116   4e-28   



>ref|XP_004234204.1| PREDICTED: reticulon-like protein B2 [Solanum lycopersicum]
Length=255

 Score =   241 bits (616),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MADHAG+H+ + E+VMEKI++KL  H+SSSSDSED+     S DAVKAKIYRLFGRER V
Sbjct  1    MADHAGEHEPVVESVMEKINEKLHDHNSSSSDSEDEKEKISSVDAVKAKIYRLFGRERPV  60

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            HKVLGGGKPADIFLWRDKK++  V+GFAT++WVLFEL++YHLLTLVCHILILALA+ FLW
Sbjct  61   HKVLGGGKPADIFLWRDKKITAGVLGFATSLWVLFELLQYHLLTLVCHILILALAVLFLW  120

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNASTFINKSPPQIP VILP+D VL VA+ALRIEINR L V 
Sbjct  121  SNASTFINKSPPQIPDVILPEDIVLGVAAALRIEINRALEVF  162



>gb|ABC01908.1| putative 24 kDa seed maturation protein-like protein [Solanum 
tuberosum]
Length=255

 Score =   240 bits (613),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MADHAG+H+S+ E+VMEKI+DKL  HDSSSSDSEDD     S DAVKAKIYRLFGRER V
Sbjct  1    MADHAGEHESVVESVMEKINDKLHDHDSSSSDSEDDKEKISSVDAVKAKIYRLFGRERPV  60

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            HKVLGGGKPADIFLWRDKK++  V+GFAT++WVLFEL++YHLLTLVCHILILALA+ FLW
Sbjct  61   HKVLGGGKPADIFLWRDKKITAGVLGFATSLWVLFELLQYHLLTLVCHILILALAVLFLW  120

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNASTFINKSPPQIP VILP+D VL VA+ALRIEIN+ L + 
Sbjct  121  SNASTFINKSPPQIPDVILPEDIVLGVAAALRIEINKALEIF  162



>ref|XP_009626480.1| PREDICTED: reticulon-like protein B2 isoform X1 [Nicotiana tomentosiformis]
Length=254

 Score =   240 bits (612),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 137/162 (85%), Gaps = 1/162 (1%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MADHAG+H+S+ E+VM+KI+DKL    SSS   ++     P  +AVKAKIYRLFGRER V
Sbjct  1    MADHAGEHESVVESVMDKINDKLHHDSSSSDSEDEKEKISP-VEAVKAKIYRLFGRERPV  59

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            HKVLGGGKPADIFLWRDKK++  V+GFAT IWVLFEL+EYHLLTLVCHILILALA+ FLW
Sbjct  60   HKVLGGGKPADIFLWRDKKITAGVLGFATAIWVLFELLEYHLLTLVCHILILALAVLFLW  119

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNASTFINKSPPQIP VILP+D VL VASALRIEINR L +L
Sbjct  120  SNASTFINKSPPQIPEVILPEDIVLGVASALRIEINRALEIL  161



>ref|XP_009765582.1| PREDICTED: reticulon-like protein B2 [Nicotiana sylvestris]
Length=254

 Score =   238 bits (606),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 137/162 (85%), Gaps = 1/162 (1%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MADHAG+H+S+ E+VM+KI+DKL    SSS   ++     P  +AVKAKIYRLFGRE+ V
Sbjct  1    MADHAGEHESVVESVMDKINDKLHHDSSSSDSEDEKEKISP-VEAVKAKIYRLFGREKPV  59

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            HKVLGGGKPAD+FLWRDKK++  V+GFAT IWVLFEL+EYHLLTLVCHILILALA+ FLW
Sbjct  60   HKVLGGGKPADVFLWRDKKITAGVLGFATAIWVLFELLEYHLLTLVCHILILALAVLFLW  119

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNASTFINKSPPQIP VILP+D VL VASALRIEINR L +L
Sbjct  120  SNASTFINKSPPQIPEVILPEDIVLGVASALRIEINRALEIL  161



>ref|XP_006366650.1| PREDICTED: putative 24 kDa seed maturation protein-like protein 
[Solanum tuberosum]
Length=403

 Score =   240 bits (612),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +3

Query  57   SSLPMADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGR  236
            S   MADHAG+H+S+ E+VMEKI+DKL  HDSSSSDSEDD     S DAVKAKIYRLFGR
Sbjct  145  SEYTMADHAGEHESVVESVMEKINDKLHDHDSSSSDSEDDKEKISSVDAVKAKIYRLFGR  204

Query  237  ERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAI  416
            ER VHKVLGGGKPADIFLWRDKK++  V+GFAT++WVLFEL++YHLLTLVCHILILALA+
Sbjct  205  ERPVHKVLGGGKPADIFLWRDKKITAGVLGFATSLWVLFELLQYHLLTLVCHILILALAV  264

Query  417  SFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
             FLWSNASTFINKSPPQIP VILP+D VL VA+ALRIEIN+ L + 
Sbjct  265  LFLWSNASTFINKSPPQIPDVILPEDIVLGVAAALRIEINKALEIF  310



>ref|XP_006360189.1| PREDICTED: reticulon-like protein B2-like [Solanum tuberosum]
Length=253

 Score =   223 bits (569),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 134/162 (83%), Gaps = 1/162 (1%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MADHAG++DS  ++VM+K++DKL  HDSSS   +D     P  +AVK KIYRLFGRE+ +
Sbjct  1    MADHAGENDSFVDSVMDKVNDKLHSHDSSSDSDDDKGKRSP-VNAVKTKIYRLFGREKPL  59

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            HKVLGGGKPADIFLWRDKKV+  V+GFAT IW LFEL+EYHLLTLVCHILI+A+A+ FLW
Sbjct  60   HKVLGGGKPADIFLWRDKKVTAGVLGFATVIWALFELLEYHLLTLVCHILIVAVAVLFLW  119

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNAS FIN +PPQIP V+LP+D VL VASALRIEINR L +L
Sbjct  120  SNASAFINTAPPQIPEVVLPKDIVLGVASALRIEINRALEIL  161



>ref|XP_009772131.1| PREDICTED: reticulon-like protein B2 [Nicotiana sylvestris]
Length=260

 Score =   219 bits (558),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 135/167 (81%), Gaps = 5/167 (3%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKIS-DKLQ-GHdssssdseddhadKPS---ADAVKAKIYRLFG  233
            MADHAG+HDS  ETVM+K++ DKL   H  SSS S+ +  +K +    DA KAKIYRLFG
Sbjct  1    MADHAGEHDSFVETVMDKVNVDKLHVAHHDSSSSSDSEDENKDTKSPVDADKAKIYRLFG  60

Query  234  RERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALA  413
            RER VHKVLGGGKPA+IFLWRDKKVS  V+GFAT IW LFEL++YHLLTLVCHILI+A+ 
Sbjct  61   RERPVHKVLGGGKPAEIFLWRDKKVSAGVLGFATVIWALFELLQYHLLTLVCHILIVAIT  120

Query  414  ISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            + FLWSNAS FIN +PPQIP V+LP+D VL VASALRIE+NR L +L
Sbjct  121  VLFLWSNASAFINTAPPQIPEVVLPRDIVLGVASALRIEMNRILEIL  167



>ref|XP_004240710.1| PREDICTED: reticulon-like protein B6 [Solanum lycopersicum]
Length=253

 Score =   218 bits (554),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 131/162 (81%), Gaps = 1/162 (1%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MADHAG++DS  ++V +K++DK   HD SS   +D     P  +AVK KIYRLFGRE+ V
Sbjct  1    MADHAGENDSFVDSVTDKVNDKFHSHDYSSDSDDDKGKKSP-VNAVKTKIYRLFGREKPV  59

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            HKVLGGGKPAD+FLWRDKKV+  V+GFAT IW LFEL+EYHLLTLVCHILI+A+A+ FLW
Sbjct  60   HKVLGGGKPADVFLWRDKKVTAGVLGFATVIWALFELLEYHLLTLVCHILIVAVAVLFLW  119

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNAS FIN +PP IP V+LP+D VL+VASALRIEINR L +L
Sbjct  120  SNASAFINTAPPHIPEVVLPKDIVLSVASALRIEINRALEIL  161



>gb|EYU25170.1| hypothetical protein MIMGU_mgv1a012274mg [Erythranthe guttata]
Length=255

 Score =   208 bits (530),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 133/165 (81%), Gaps = 5/165 (3%)
 Frame = +3

Query  69   MADHAGDHD---SLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRE  239
            MADHAG+H+   S+AE+VM+KI++K  G  S SS S+ D+  K SA AVKAKIYRLFGRE
Sbjct  1    MADHAGEHEKHESVAESVMDKITEKFHG--SDSSSSDSDNDIKSSASAVKAKIYRLFGRE  58

Query  240  RHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAIS  419
              VHKVLGGGKPADIFLWRDKK +G V+G AT IWVLFEL+EYHLL+LVCH LIL LAI 
Sbjct  59   TPVHKVLGGGKPADIFLWRDKKTTGYVLGVATAIWVLFELLEYHLLSLVCHFLILGLAIL  118

Query  420  FLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            FLWSNASTFI+KS P+ P VI+ ++ V++VASAL IE NR  A+L
Sbjct  119  FLWSNASTFISKSRPKFPEVIISENVVVSVASALTIEFNRAFAIL  163



>ref|XP_010925814.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=253

 Score =   207 bits (526),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 133/162 (82%), Gaps = 1/162 (1%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MA+H+ +  S   ++MEKI DKL GHD SSSDS+++ + +PSA ++KA IYRLFGRER V
Sbjct  1    MAEHSEESSSKPVSLMEKIVDKLHGHDDSSSDSDNEKS-EPSASSIKANIYRLFGRERPV  59

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            HKVLGGGKPAD+FLWR+KK+S  V+G AT +WVLFEL+EYHLLTLVCH LIL+LAI FLW
Sbjct  60   HKVLGGGKPADVFLWRNKKISAGVLGGATAVWVLFELLEYHLLTLVCHCLILSLAILFLW  119

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNAS FINK+PP+I  V +P+D  +NVA +LR EINR +AVL
Sbjct  120  SNASIFINKAPPRILEVSIPKDLAVNVALSLRYEINRAIAVL  161



>gb|KDP22201.1| hypothetical protein JCGZ_26032 [Jatropha curcas]
Length=248

 Score =   206 bits (524),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 134/163 (82%), Gaps = 9/163 (6%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPS-ADAVKAKIYRLFGRERH  245
            MA HA       E++M+KI++K++GHDSSSS   DD   KPS  DAVK+KI+RLFGRE+ 
Sbjct  1    MAGHA------VESLMDKITEKIRGHDSSSSSDSDDD--KPSKVDAVKSKIFRLFGREKP  52

Query  246  VHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFL  425
            VHKVLGGGKPAD+ LWR+K+VS +V+G AT +WVLFEL+EYHL+TLVCHI IL LAI FL
Sbjct  53   VHKVLGGGKPADVLLWRNKQVSASVLGGATVVWVLFELLEYHLITLVCHISILTLAILFL  112

Query  426  WSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            WSNASTF+NKSPP+IP ++LP+  VL +ASALRIEINR LAVL
Sbjct  113  WSNASTFVNKSPPEIPQIVLPEKYVLEIASALRIEINRALAVL  155



>ref|XP_011084470.1| PREDICTED: reticulon-like protein B2 [Sesamum indicum]
Length=258

 Score =   205 bits (522),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 140/165 (85%), Gaps = 3/165 (2%)
 Frame = +3

Query  69   MADHAGDHD---SLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRE  239
            MADH G+H+   S AE++++KI++K  G DSSSSDS+D+   K +A AVK+KIYRLFGRE
Sbjct  1    MADHEGEHEKHESAAESLIDKITEKFHGSDSSSSDSDDNKDIKSAAAAVKSKIYRLFGRE  60

Query  240  RHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAIS  419
            + VHKVLGGGKPADIFLWRDKK++  V+G AT IWVLFEL+EYHLLTLVCHILILALA+ 
Sbjct  61   KPVHKVLGGGKPADIFLWRDKKITAGVLGVATAIWVLFELLEYHLLTLVCHILILALALI  120

Query  420  FLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            FLWSNASTFINKSPP+IP +I+P+D VL +A+A RIE NR LA+L
Sbjct  121  FLWSNASTFINKSPPKIPEIIVPEDIVLGIAAAFRIEFNRALAIL  165



>ref|XP_010915765.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=254

 Score =   205 bits (521),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 128/162 (79%), Gaps = 0/162 (0%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MA+H+ +  S  E++MEKI++KL G DSSSS   D+   + SA +VKAKIYRLFGRE  V
Sbjct  1    MAEHSEEASSKPESLMEKIAEKLHGDDSSSSSDSDNEKSESSASSVKAKIYRLFGREEPV  60

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            HKVLGGGKPAD+FLWR+KK+S  V+G AT +WVLFEL++YHLLTLV H L+L+LAI FLW
Sbjct  61   HKVLGGGKPADVFLWRNKKISAGVLGGATAVWVLFELLDYHLLTLVGHCLVLSLAILFLW  120

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNASTFINK PP IP V +P+D  +NVA +LR EINR  AVL
Sbjct  121  SNASTFINKIPPHIPEVSIPEDVAINVALSLRYEINRAFAVL  162



>gb|ABC69764.1| unknown [Vitis pseudoreticulata]
Length=211

 Score =   203 bits (516),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 130/162 (80%), Gaps = 0/162 (0%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MA+HA    + +E+++EKI+DKLQGHDSSSSDS+ D     S   +KAK++RLFGRE+ V
Sbjct  1    MAEHAEGSGAASESLLEKITDKLQGHDSSSSDSDSDSDKAASPSPIKAKVFRLFGREKPV  60

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            H VLGGGK AD+FLWR+KK+S  V+G AT +WVLFEL+EYHLLTLVCHILIL+LAI FLW
Sbjct  61   HTVLGGGKHADVFLWRNKKISAGVLGGATAMWVLFELLEYHLLTLVCHILILSLAILFLW  120

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNA+TFINKSPP+IP V +P+D  L   +ALRIEIN   AVL
Sbjct  121  SNATTFINKSPPRIPDVHIPEDPFLQAVNALRIEINHGFAVL  162



>ref|XP_003633964.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 ref|XP_003633965.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 ref|XP_010661856.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 emb|CBI40444.3| unnamed protein product [Vitis vinifera]
Length=255

 Score =   203 bits (517),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 129/162 (80%), Gaps = 0/162 (0%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MA+HA    + +E+++EKI+DKLQGHDSSSS S+ D     S   +KAK++RLFGRE+ V
Sbjct  1    MAEHAEGSGAASESLLEKITDKLQGHDSSSSGSDSDSDKPASPSPIKAKVFRLFGREKPV  60

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            H VLGGGK AD+FLWR+KK+S  V+G AT +WVLFEL+EYHLLTLVCHILIL+LAI FLW
Sbjct  61   HTVLGGGKHADVFLWRNKKISAGVLGGATAMWVLFELLEYHLLTLVCHILILSLAILFLW  120

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNA+TFINKSPP+IP V +P+D  L   +ALRIEIN   AVL
Sbjct  121  SNATTFINKSPPRIPEVHIPEDPFLQAVNALRIEINCGFAVL  162



>ref|XP_006339640.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=265

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 127/172 (74%), Gaps = 10/172 (6%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKP----------SADAVKAKI  218
            MA+HA + D   E++MEKI+DK  G DSSSS   D    KP            + +K K+
Sbjct  1    MAEHAENSDPKGESLMEKIADKFHGDDSSSSSESDTETKKPVVKSEVEAEPEPETLKNKV  60

Query  219  YRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHIL  398
            +RLFGRE+ VHKV GGGKPAD+FLWR+KK+SG V+G AT IWVLFEL+EYHLLTL+CHIL
Sbjct  61   WRLFGREKPVHKVFGGGKPADVFLWRNKKISGTVLGGATAIWVLFELLEYHLLTLICHIL  120

Query  399  ILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            I+ LA+ FLWSNA+TFINK PP IP V LP+  +L VASALRIEINR L +L
Sbjct  121  IITLAVLFLWSNATTFINKKPPHIPEVHLPEGPILQVASALRIEINRALDLL  172



>ref|XP_006422079.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
 ref|XP_006490603.1| PREDICTED: reticulon-like protein B3-like [Citrus sinensis]
 gb|ESR35319.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
Length=255

 Score =   201 bits (511),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 134/162 (83%), Gaps = 2/162 (1%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MA+HA +H+S  ++++EKI+DK+ GHDSSSSDS+DD     S DA K+K++RLFGRE+ +
Sbjct  1    MAEHAPEHESADKSLVEKITDKIHGHDSSSSDSDDDKPS--SIDAFKSKVFRLFGREKPI  58

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            H VLG GKPADIFLWR+KK+S  V+G AT +WVLFEL+EYHL+TLVCHI IL+LA+ FLW
Sbjct  59   HHVLGAGKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLW  118

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNASTFINKSPP+IP V LP+  VL  ASALR EINR LAVL
Sbjct  119  SNASTFINKSPPEIPVVTLPEKFVLEFASALRYEINRALAVL  160



>gb|KJB24635.1| hypothetical protein B456_004G154600 [Gossypium raimondii]
Length=179

 Score =   198 bits (504),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 126/163 (77%), Gaps = 1/163 (1%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKP-SADAVKAKIYRLFGRERH  245
            MA+ +    S  E++MEKIS K+ GHDSSSS   D   +KP S  +VKAKIYRLFGRER 
Sbjct  1    MAEESESKQSAVESMMEKISQKIHGHDSSSSSDSDSDHEKPASPSSVKAKIYRLFGRERP  60

Query  246  VHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFL  425
            VH VLGGGKPAD+FLWR+KK+S  V+G AT IWVLFEL+EYHLL L+CHI IL LA+ FL
Sbjct  61   VHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLALICHISILCLALLFL  120

Query  426  WSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            WSNA TFI+KSPP+IP + LP++  L VASAL IE+N+ L +L
Sbjct  121  WSNAHTFIHKSPPRIPEIHLPEEPFLQVASALAIELNQGLKLL  163



>gb|KDO56851.1| hypothetical protein CISIN_1g023137mg [Citrus sinensis]
Length=255

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 134/162 (83%), Gaps = 2/162 (1%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MA+HA +H+S  ++++EKI+DK+ GHDSSSSDS+DD     S DA K+K++RLFGRE+ +
Sbjct  1    MAEHAPEHESSDKSLVEKITDKIHGHDSSSSDSDDDKPS--SIDAFKSKVFRLFGREKPI  58

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            H VLG GKPADIFLWR+KK+S  V+G AT +WVLFEL+EYHL+TLVCHI IL+LA+ FLW
Sbjct  59   HHVLGAGKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLW  118

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNASTFINKSPP+IP V LP+  VL  ASALR EINR LAVL
Sbjct  119  SNASTFINKSPPEIPVVTLPEKFVLEFASALRYEINRALAVL  160



>emb|CDP05124.1| unnamed protein product [Coffea canephora]
Length=256

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 138/163 (85%), Gaps = 1/163 (1%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADA-VKAKIYRLFGRERH  245
            MA+HAG+HDS+ ETV EKI++K   HDSSSSDS+DD  DK      +KAKIYRLFGRE+ 
Sbjct  1    MAEHAGEHDSVVETVKEKITEKFHSHDSSSSDSDDDSKDKKPPSKDIKAKIYRLFGREKP  60

Query  246  VHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFL  425
            VHKVLGGGKPAD+FLWRDKK+S +V+G  T IWVLFEL+EY+LLTLVCHILILALA+ FL
Sbjct  61   VHKVLGGGKPADVFLWRDKKISASVLGVVTAIWVLFELLEYYLLTLVCHILILALAVLFL  120

Query  426  WSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            WSNASTFINKSPPQ P VILP+D VL VASALRIE+NR LA L
Sbjct  121  WSNASTFINKSPPQFPEVILPEDIVLGVASALRIEVNRALAAL  163



>ref|XP_008805646.1| PREDICTED: reticulon-like protein B3 [Phoenix dactylifera]
Length=254

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = +3

Query  111  VMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGKPADIFL  290
            +MEKI+DKL GHDSSSS   D+   +PSA +VKAKIYRLFGRE+ VHKVLGGGKPAD+ L
Sbjct  15   LMEKIADKLHGHDSSSSSDSDNEKSEPSASSVKAKIYRLFGREKPVHKVLGGGKPADVLL  74

Query  291  WRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQI  470
            WR+KK+S  V+G AT +WVLFEL+EYHLLTLV H LIL+LAI FLWSNASTFI+K+PP I
Sbjct  75   WRNKKISAGVLGGATAVWVLFELLEYHLLTLVGHCLILSLAILFLWSNASTFISKTPPHI  134

Query  471  PSVILPQDTVLNVASALRIEINRTLAVL  554
            P V +P+D  +NVA +LR EINR  A+L
Sbjct  135  PEVSIPEDLAVNVALSLRYEINRAFAIL  162



>ref|XP_009766982.1| PREDICTED: reticulon-like protein B5 [Nicotiana sylvestris]
Length=266

 Score =   201 bits (511),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 128/173 (74%), Gaps = 11/173 (6%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPS-----------ADAVKAK  215
            MA+H  + D   E++MEKI+DK  G D SSS S+ D   K               +VK K
Sbjct  1    MAEHVENSDPKGESLMEKIADKFHGGDDSSSSSDSDTETKKPAAKEEVVAAAEPSSVKDK  60

Query  216  IYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHI  395
            ++RLFGRE+ VHKV GGGKPAD+FLWR+KK+S +V+G AT IWVLFEL+EYHLLTL+CHI
Sbjct  61   VWRLFGREKPVHKVFGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYHLLTLICHI  120

Query  396  LILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            LI++LA+ FLWSNA+TFINK PP IP + LPQD  L VASALRIEINR LA+L
Sbjct  121  LIISLAVLFLWSNATTFINKKPPHIPEIHLPQDPFLQVASALRIEINRALALL  173



>ref|XP_006422078.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
 gb|ESR35318.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
Length=287

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 134/162 (83%), Gaps = 2/162 (1%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MA+HA +H+S  ++++EKI+DK+ GHDSSSSDS+DD     S DA K+K++RLFGRE+ +
Sbjct  1    MAEHAPEHESADKSLVEKITDKIHGHDSSSSDSDDDKPS--SIDAFKSKVFRLFGREKPI  58

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            H VLG GKPADIFLWR+KK+S  V+G AT +WVLFEL+EYHL+TLVCHI IL+LA+ FLW
Sbjct  59   HHVLGAGKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLW  118

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNASTFINKSPP+IP V LP+  VL  ASALR EINR LAVL
Sbjct  119  SNASTFINKSPPEIPVVTLPEKFVLEFASALRYEINRALAVL  160



>ref|XP_010658515.1| PREDICTED: reticulon-like protein B2 [Vitis vinifera]
 emb|CBI34409.3| unnamed protein product [Vitis vinifera]
Length=252

 Score =   200 bits (508),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 130/162 (80%), Gaps = 3/162 (2%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MADH     S  E++MEKIS+K+ GHDSSSSDS+++ +  PSA   KAK+YR+FGRE+ V
Sbjct  1    MADHEDSTPSPVESMMEKISEKIHGHDSSSSDSDNEKS-SPSA--FKAKVYRIFGREKPV  57

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            HKVLGGGKPAD+ LWR+KK+S  V+G AT +W+LFEL+EYHLLTLVCH  ILALAI FLW
Sbjct  58   HKVLGGGKPADVVLWRNKKISAGVLGGATAVWILFELLEYHLLTLVCHCSILALAILFLW  117

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNA+TFINK+PP IP V +P+D VL  ASALRIEINR   +L
Sbjct  118  SNATTFINKAPPHIPEVHIPEDPVLQFASALRIEINRGFTLL  159



>ref|XP_009597328.1| PREDICTED: reticulon-like protein B5 [Nicotiana tomentosiformis]
Length=268

 Score =   200 bits (509),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 128/175 (73%), Gaps = 13/175 (7%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPS-------------ADAVK  209
            MA+H  + D   E++MEKI+DK  G D SSS S+ D   K                 +VK
Sbjct  1    MAEHVENSDPKGESLMEKIADKFHGGDDSSSSSDSDTETKKPAAKEEVVAAAEAEPSSVK  60

Query  210  AKIYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVC  389
             K++RLFGRE+ VHKV GGGKPAD+FLWR+KK+S +V+G AT IWVLFEL+EYHLLTL+C
Sbjct  61   DKVWRLFGREKPVHKVFGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYHLLTLIC  120

Query  390  HILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            HILI++LA+ FLWSNA+TFINK PP IP + LPQD  L VASALRIEINR LA+L
Sbjct  121  HILIISLAVLFLWSNATTFINKKPPHIPEIHLPQDPFLQVASALRIEINRALALL  175



>gb|KDO56850.1| hypothetical protein CISIN_1g023137mg [Citrus sinensis]
Length=287

 Score =   201 bits (510),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 134/162 (83%), Gaps = 2/162 (1%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MA+HA +H+S  ++++EKI+DK+ GHDSSSSDS+DD     S DA K+K++RLFGRE+ +
Sbjct  1    MAEHAPEHESSDKSLVEKITDKIHGHDSSSSDSDDDKPS--SIDAFKSKVFRLFGREKPI  58

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            H VLG GKPADIFLWR+KK+S  V+G AT +WVLFEL+EYHL+TLVCHI IL+LA+ FLW
Sbjct  59   HHVLGAGKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLW  118

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNASTFINKSPP+IP V LP+  VL  ASALR EINR LAVL
Sbjct  119  SNASTFINKSPPEIPVVTLPEKFVLEFASALRYEINRALAVL  160



>gb|KHG04885.1| Reticulon-like protein B5 [Gossypium arboreum]
Length=255

 Score =   199 bits (507),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 128/163 (79%), Gaps = 1/163 (1%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKP-SADAVKAKIYRLFGRERH  245
            MAD +    S  E++MEKIS+K+ G+DSSSS   D   +KP S  +VKAKIYRLFGRER 
Sbjct  1    MADESESKQSAVESMMEKISEKIHGNDSSSSSDSDSDHEKPASPSSVKAKIYRLFGRERP  60

Query  246  VHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFL  425
            VH VLGGGKPAD+FLWR+KK+S  V+G AT IWVLFEL+EYHLLTL+CHI IL LA+ FL
Sbjct  61   VHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLICHISILCLALLFL  120

Query  426  WSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            WSNA TFI+KSPP+IP + LP++  L VASAL IE+N+ L +L
Sbjct  121  WSNAHTFIHKSPPRIPEIHLPEEPFLQVASALAIELNQGLKLL  163



>ref|XP_004229935.1| PREDICTED: reticulon-like protein B1 [Solanum lycopersicum]
Length=263

 Score =   199 bits (507),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 126/170 (74%), Gaps = 8/170 (5%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPS--------ADAVKAKIYR  224
            MA+H  + D   E+++EKI+DK  G DSSSS   D    KP+         + +K K++R
Sbjct  1    MAEHVENSDPKGESLLEKIADKFHGDDSSSSSESDTETKKPAVKSEVEPETETLKNKVWR  60

Query  225  LFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILIL  404
            LFGRE+ VHKV GGGKPAD+FLWR+KK+S  V+G AT IWVLFEL+EYHLLTL+CHILI+
Sbjct  61   LFGREKPVHKVFGGGKPADVFLWRNKKISATVIGGATAIWVLFELLEYHLLTLICHILII  120

Query  405  ALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
             LA+ FLWSNA+TFINK PP IP V LP+  +L VASALRIEINR L +L
Sbjct  121  TLAVLFLWSNATTFINKKPPHIPEVHLPEGPILQVASALRIEINRALDLL  170



>ref|XP_008796064.1| PREDICTED: reticulon-like protein B2 [Phoenix dactylifera]
Length=253

 Score =   199 bits (506),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 120/148 (81%), Gaps = 1/148 (1%)
 Frame = +3

Query  111  VMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGKPADIFL  290
            +MEKI  KL G DSSSS   D+   KPSA ++KAKIYRLFGRER VH VLGGGKPAD+FL
Sbjct  15   LMEKIVGKLHG-DSSSSSDSDNEKSKPSASSIKAKIYRLFGRERSVHNVLGGGKPADVFL  73

Query  291  WRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQI  470
            WR+KK+S  V+G AT +WVLFEL+EYHLL+LVCH LIL+LAI FLWSNASTFINK+PP+I
Sbjct  74   WRNKKISAGVIGGATAVWVLFELLEYHLLSLVCHCLILSLAILFLWSNASTFINKAPPRI  133

Query  471  PSVILPQDTVLNVASALRIEINRTLAVL  554
            P   +P+D  +NVA +LR EINR  AVL
Sbjct  134  PEASIPEDLAVNVALSLRYEINRAFAVL  161



>ref|XP_011003673.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=251

 Score =   199 bits (505),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 126/162 (78%), Gaps = 4/162 (2%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MA+H G  +S AE++++KI++K+ GHDSSSS   D        DAVK+K++RLFGRER V
Sbjct  1    MAEHEGQRESAAESLVDKITEKISGHDSSSSSDSD----NEKFDAVKSKVFRLFGRERPV  56

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            HKVLGGGKPAD+FLWR+ K+S  V+G ATT+WVLFEL+ YHL+TLVC++ I  LA+ FLW
Sbjct  57   HKVLGGGKPADVFLWRNTKISAGVLGGATTVWVLFELLGYHLITLVCYLSIFFLAVLFLW  116

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SN S F+NK PP+IP V+LP+  V  VASALRIEINR  AVL
Sbjct  117  SNTSDFLNKPPPKIPEVVLPEQCVREVASALRIEINRGFAVL  158



>gb|EYU19605.1| hypothetical protein MIMGU_mgv1a012182mg [Erythranthe guttata]
Length=259

 Score =   199 bits (505),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 138/166 (83%), Gaps = 4/166 (2%)
 Frame = +3

Query  69   MADHAGDHD---SLAETVMEKISDKLQGHdssssdseddha-dKPSADAVKAKIYRLFGR  236
            MAD+A +H+   S AE++++KI++K  G DSSSSDS+DD    K +A + KAKIYRLFGR
Sbjct  1    MADNASEHEKHESAAESLIDKITEKFHGSDSSSSDSDDDDKGIKSAASSAKAKIYRLFGR  60

Query  237  ERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAI  416
            E+ VHKVLGGGKPADIFLWRDKKVS  V+GFAT IWVLFEL+EYHLL+LVCHILIL LAI
Sbjct  61   EQPVHKVLGGGKPADIFLWRDKKVSAGVLGFATAIWVLFELIEYHLLSLVCHILILGLAI  120

Query  417  SFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
             FLWSNAS+FINKSPP+IP V++ +D V+ VA+ALRIE NR  A+L
Sbjct  121  IFLWSNASSFINKSPPKIPEVVVREDIVIGVANALRIEFNRAFAIL  166



>gb|KHG24129.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=250

 Score =   198 bits (504),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 126/149 (85%), Gaps = 3/149 (2%)
 Frame = +3

Query  108  TVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGKPADIF  287
            ++ME+I++K+QG DSSSSDS++D   KPS  ++KAK++RLFGRE+ VH VLGGGKPADIF
Sbjct  12   SLMERIAEKIQGRDSSSSDSDND---KPSESSIKAKVFRLFGREKPVHHVLGGGKPADIF  68

Query  288  LWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQ  467
            LWR+KK+S   +G AT IW+LFE++EYHLLTLVCH+LILALA+ FLWSNA+TFINKSPP+
Sbjct  69   LWRNKKISAGALGVATVIWILFEMLEYHLLTLVCHLLILALAVLFLWSNAATFINKSPPR  128

Query  468  IPSVILPQDTVLNVASALRIEINRTLAVL  554
            IP V +P+D V+  A ALR EINR  AVL
Sbjct  129  IPEVQIPKDPVMEFAQALRFEINRAFAVL  157



>ref|NP_001149653.1| LOC100283279 [Zea mays]
 gb|ACG36248.1| seed maturation protein [Zea mays]
 gb|ACN31840.1| unknown [Zea mays]
 tpg|DAA57749.1| TPA: Seed maturation protein isoform 1 [Zea mays]
 tpg|DAA57750.1| TPA: Seed maturation protein isoform 2 [Zea mays]
Length=257

 Score =   198 bits (504),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 128/167 (77%), Gaps = 7/167 (4%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPS-----ADAVKAKIYRLFG  233
            MADH    + + E+VM+KI++K  G DSSSS S+ D   K S     A+A+KAKIYRLFG
Sbjct  1    MADH--KEEPVPESVMDKITEKFHGGDSSSSSSDSDDEKKGSSLASAAEAMKAKIYRLFG  58

Query  234  RERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALA  413
            RER VH VLGGGKPAD+ LWR++K+SG V+  AT IW+LFE+MEYHLLTLVCH LIL+LA
Sbjct  59   RERPVHSVLGGGKPADLILWRNRKISGGVLAGATAIWLLFEVMEYHLLTLVCHCLILSLA  118

Query  414  ISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            I FLWSNASTFINKSPP IP V +P+D  +NVA +LR EINR  A L
Sbjct  119  ILFLWSNASTFINKSPPNIPEVKIPEDVAVNVALSLRYEINRGFATL  165



>gb|KJB24634.1| hypothetical protein B456_004G154600 [Gossypium raimondii]
Length=255

 Score =   198 bits (503),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 126/163 (77%), Gaps = 1/163 (1%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKP-SADAVKAKIYRLFGRERH  245
            MA+ +    S  E++MEKIS K+ GHDSSSS   D   +KP S  +VKAKIYRLFGRER 
Sbjct  1    MAEESESKQSAVESMMEKISQKIHGHDSSSSSDSDSDHEKPASPSSVKAKIYRLFGRERP  60

Query  246  VHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFL  425
            VH VLGGGKPAD+FLWR+KK+S  V+G AT IWVLFEL+EYHLL L+CHI IL LA+ FL
Sbjct  61   VHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLALICHISILCLALLFL  120

Query  426  WSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            WSNA TFI+KSPP+IP + LP++  L VASAL IE+N+ L +L
Sbjct  121  WSNAHTFIHKSPPRIPEIHLPEEPFLQVASALAIELNQGLKLL  163



>ref|XP_002317731.1| hypothetical protein POPTR_0012s00980g [Populus trichocarpa]
 gb|EEE95951.1| hypothetical protein POPTR_0012s00980g [Populus trichocarpa]
Length=240

 Score =   197 bits (501),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 126/162 (78%), Gaps = 4/162 (2%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MA+H G  +S AE++++KI++K+ GHDSSSS   D        DAVK+KI+RLFGRE+ V
Sbjct  1    MAEHEGQRESAAESLVDKITEKISGHDSSSSSDSD----NEKFDAVKSKIFRLFGREKPV  56

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            HKVLGGGKPAD+FLWR+ K+S  V+G ATT+WVLFEL+ YHL+TLVC++ I +LA+ FLW
Sbjct  57   HKVLGGGKPADVFLWRNTKISAGVLGGATTVWVLFELLGYHLITLVCYLSIFSLAVLFLW  116

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SN S F+NK PP+IP V+LP+  V  VAS LRIEINR  AVL
Sbjct  117  SNTSDFLNKPPPKIPEVVLPEKCVREVASVLRIEINRGFAVL  158



>ref|XP_004503660.1| PREDICTED: reticulon-like protein B2-like [Cicer arietinum]
Length=255

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 128/162 (79%), Gaps = 0/162 (0%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MA+H    +S  E++++KIS K+  HDSSSS   D+    PS   +K+K++RLFGRE+ +
Sbjct  1    MAEHHEHDESKGESLLDKISGKIHDHDSSSSSDSDNEKKNPSPSTLKSKVFRLFGREKPL  60

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            H VLGGGKPAD+FLWR+KK+S  V+G AT  W+LFEL+EYHLLTLVCH+ ILALA+ FLW
Sbjct  61   HNVLGGGKPADVFLWRNKKISATVLGVATASWILFELLEYHLLTLVCHLAILALAVLFLW  120

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNASTFINK+PP+IP V +P++ VL +A+ALRIEINR  AVL
Sbjct  121  SNASTFINKAPPKIPQVHIPEEPVLQIAAALRIEINRVFAVL  162



>ref|XP_007051689.1| Reticulon family protein [Theobroma cacao]
 gb|EOX95846.1| Reticulon family protein [Theobroma cacao]
Length=255

 Score =   197 bits (501),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 126/163 (77%), Gaps = 1/163 (1%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKP-SADAVKAKIYRLFGRERH  245
            MA+ +    S  E+VMEKIS K+ GHDSSSS   D   +KP S   VKAKIYRLFGRER 
Sbjct  1    MAEESESKQSTVESVMEKISGKIHGHDSSSSSDSDSDHEKPASPSPVKAKIYRLFGRERP  60

Query  246  VHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFL  425
            VH VLGGGKPAD+FLWR+KK+S  V+G AT IWVLFEL+EY+LLTLVCHI IL+LA+ FL
Sbjct  61   VHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYNLLTLVCHISILSLALMFL  120

Query  426  WSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            WSNA TFI+KSPP+IP V LP++  L VA+AL  E+N+ L +L
Sbjct  121  WSNAHTFIHKSPPRIPEVHLPEEPFLQVAAALTFELNQALKLL  163



>ref|XP_002511930.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50599.1| conserved hypothetical protein [Ricinus communis]
Length=253

 Score =   197 bits (501),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 129/164 (79%), Gaps = 5/164 (3%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKP--SADAVKAKIYRLFGRER  242
            MA+H    +S  E+VMEKIS+K+  HDSSSS   +  ++K   S  +VKAKI+RLFGRER
Sbjct  1    MAEHP---ESPIESVMEKISEKIHAHDSSSSSDSESDSEKKPTSPSSVKAKIFRLFGRER  57

Query  243  HVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF  422
             VH VLGGGKPAD+FLWR+KK+S +V+G AT IW+LFEL+EYHLLTLVCHI IL LAI F
Sbjct  58   PVHHVLGGGKPADVFLWRNKKISASVLGTATAIWILFELIEYHLLTLVCHISILTLAILF  117

Query  423  LWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            LWSNA TFINK+PP+IP V +P++ VL VASAL +EIN   AVL
Sbjct  118  LWSNAHTFINKTPPRIPQVHIPEEPVLQVASALTMEINHGFAVL  161



>ref|XP_006476478.1| PREDICTED: reticulon-like protein B2-like [Citrus sinensis]
 gb|KDO76366.1| hypothetical protein CISIN_1g039009mg [Citrus sinensis]
Length=256

 Score =   197 bits (501),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 127/164 (77%), Gaps = 2/164 (1%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADA--VKAKIYRLFGRER  242
            MAD     +   E+VMEKI++K+ GHDSSSS S  D  D   +    +K K++RLFGRE+
Sbjct  1    MADEHKHEEPAGESVMEKITEKIHGHDSSSSSSSSDTDDDKKSSTSSLKTKVFRLFGREK  60

Query  243  HVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF  422
             VHKVLGGGKPAD+FLWR+KK+S  V+G AT IWVLF+L+EYHLLTLVCH LI+ALA+ F
Sbjct  61   PVHKVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFQLLEYHLLTLVCHCLIVALAVLF  120

Query  423  LWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            LWSNASTFINKSPP+IP V +P++ VL +ASALR EINR   +L
Sbjct  121  LWSNASTFINKSPPRIPEVYIPEEPVLQLASALRFEINRAFTLL  164



>ref|XP_007038874.1| VIRB2-interacting protein 2 [Theobroma cacao]
 gb|EOY23375.1| VIRB2-interacting protein 2 [Theobroma cacao]
Length=247

 Score =   196 bits (499),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 129/163 (79%), Gaps = 10/163 (6%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKP-SADAVKAKIYRLFGRERH  245
            MA+H        ET++EK+++++QG  SSSS   DD   KP  ADA+K+K+YRLFGRE+ 
Sbjct  1    MAEHE-------ETLVEKVAEEIQGDASSSSSDSDDD--KPFHADALKSKVYRLFGREKP  51

Query  246  VHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFL  425
            +H VLG GKPAD+FLWRDKK+S  V+G AT +W+LFE++EYHL+TL+CH LIL+LAI FL
Sbjct  52   IHHVLGAGKPADVFLWRDKKISAGVLGGATALWILFEMLEYHLITLLCHTLILSLAILFL  111

Query  426  WSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            WSNASTFINKSPP IP V+LP+  VL VASALRIE+NR L V+
Sbjct  112  WSNASTFINKSPPNIPEVVLPEKCVLEVASALRIEVNRALDVV  154



>gb|KDP28552.1| hypothetical protein JCGZ_14323 [Jatropha curcas]
Length=254

 Score =   196 bits (497),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 131/165 (79%), Gaps = 6/165 (4%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddh--adKP-SADAVKAKIYRLFGRE  239
            MA+H   H++  E+VMEKIS+ +  HDSSSS S+ D     KP S  +VKAKI+RLFGRE
Sbjct  1    MAEH---HENPIESVMEKISETIHAHDSSSSSSDSDSDSEKKPTSPSSVKAKIFRLFGRE  57

Query  240  RHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAIS  419
            R VH VLGGGKPAD+ LWR+KK+S +V+G AT IWVLFEL+EYHLLTL CHILIL+LA+ 
Sbjct  58   RPVHHVLGGGKPADVLLWRNKKISASVLGVATAIWVLFELIEYHLLTLACHILILSLAVL  117

Query  420  FLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            FLWSNA TFINK+PP+IP + LP++  L VASAL +EINR LAVL
Sbjct  118  FLWSNAHTFINKTPPRIPQIHLPEEPFLLVASALTLEINRGLAVL  162



>ref|XP_009388111.1| PREDICTED: reticulon-like protein B1 [Musa acuminata subsp. malaccensis]
Length=258

 Score =   196 bits (497),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 132/168 (79%), Gaps = 9/168 (5%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddh-----adKPSA-DAVKAKIYRLF  230
            MA+H    +S+AE+++EKI++K  G DSSSSDS+ +      +  PSA + VKAKIYRLF
Sbjct  1    MAEH---EESVAESLLEKITEKFHGGDSSSSDSDGEKSSVVDSSAPSAAEVVKAKIYRLF  57

Query  231  GRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILAL  410
            GRE+ VHKVLGGGKPAD+FLWR+KKVS A +G AT IWVLFELMEYHLLT VCH LIL+L
Sbjct  58   GREKPVHKVLGGGKPADVFLWRNKKVSAATLGGATAIWVLFELMEYHLLTFVCHSLILSL  117

Query  411  AISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            AI FLWSNASTFINKSPP+IP V +P+D  +N+A +LR EIN   A L
Sbjct  118  AIMFLWSNASTFINKSPPRIPEVSIPEDMAVNIALSLRYEINWAFAAL  165



>gb|KJB06452.1| hypothetical protein B456_001G157900 [Gossypium raimondii]
Length=186

 Score =   193 bits (491),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 128/165 (78%), Gaps = 3/165 (2%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddha--dKP-SADAVKAKIYRLFGRE  239
            MA+      S  E+VMEKIS+K+ GHDSSSS   D  +  +KP S  +VKAKIYRLFGRE
Sbjct  1    MAEETESMQSAVESVMEKISEKIHGHDSSSSSDSDSDSDHEKPASPSSVKAKIYRLFGRE  60

Query  240  RHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAIS  419
            R +H VLGGGKPAD+FLWR+KK+S  V+G AT IWVLFEL+EYHLLTL+CHI IL+LA+ 
Sbjct  61   RPLHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLLCHISILSLAVL  120

Query  420  FLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            FLWSN  TFI+K+PP+IP V LP++  L +ASAL IE+N+ L +L
Sbjct  121  FLWSNVHTFIHKTPPRIPQVHLPEEPFLQIASALTIELNQALELL  165



>ref|NP_001056102.1| Os05g0526400 [Oryza sativa Japonica Group]
 gb|AAU44062.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18016.1| Os05g0526400 [Oryza sativa Japonica Group]
 dbj|BAG96540.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00639.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64429.1| hypothetical protein OsJ_19273 [Oryza sativa Japonica Group]
Length=251

 Score =   195 bits (496),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 127/162 (78%), Gaps = 3/162 (2%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MA+H  + +SL E+VM+KISDKL G   SSS S D   ++ +AD +KAKIYRLFGRE+ V
Sbjct  1    MAEHK-EEESLVESVMDKISDKLHGRGGSSSSSSDSDGER-TAD-LKAKIYRLFGREKPV  57

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            H VLGGGKPAD+FLWR+KK+S  V+  AT IW+LFE+M+YHLLTL+CH +IL LA+ FLW
Sbjct  58   HSVLGGGKPADLFLWRNKKISVGVLAGATAIWLLFEVMDYHLLTLLCHCIILTLAMLFLW  117

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNASTFINKSPP IP V +P+D  +NVA +LR EINR  A L
Sbjct  118  SNASTFINKSPPNIPEVKIPEDLAVNVARSLRFEINRGFATL  159



>ref|XP_006439447.1| hypothetical protein CICLE_v10021801mg [Citrus clementina]
 gb|ESR52687.1| hypothetical protein CICLE_v10021801mg [Citrus clementina]
Length=256

 Score =   195 bits (496),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 127/164 (77%), Gaps = 2/164 (1%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADA--VKAKIYRLFGRER  242
            MAD     +   E+V EKI++K+ GHDSSSS S  D  D   + A  +K K++RLFGRE+
Sbjct  1    MADEHKHEEPAGESVKEKITEKIHGHDSSSSSSSSDSDDDKKSSASSLKTKVFRLFGREK  60

Query  243  HVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF  422
             VHKVLGGGKPAD+FLWR+KK+S  V+G AT IWVLFEL+EYHLLTLVCH LI+ALA+ F
Sbjct  61   PVHKVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELLEYHLLTLVCHCLIVALAVLF  120

Query  423  LWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            LWSNASTFINKSPP+IP V +P++ VL +ASALR EINR   +L
Sbjct  121  LWSNASTFINKSPPRIPEVYIPEEPVLQLASALRFEINRAFPLL  164



>ref|XP_002299504.1| reticulon family protein [Populus trichocarpa]
 gb|ABK93406.1| unknown [Populus trichocarpa]
 gb|EEE84309.1| reticulon family protein [Populus trichocarpa]
Length=254

 Score =   195 bits (495),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 131/162 (81%), Gaps = 1/162 (1%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MA+H  D DS+ E+V EKIS+K  GHDSSS    D    K + D++K+KIYRLFGRE+ V
Sbjct  1    MAEHDKD-DSVVESVTEKISEKTHGHDSSSVSDSDHEKSKSNPDSLKSKIYRLFGREKPV  59

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            HKVLGGGKPAD+FLWR+KK+S  V+G AT IWVLFEL+EY+L+TLVCH LILALA+ FLW
Sbjct  60   HKVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELLEYNLVTLVCHCLILALALLFLW  119

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNASTFINKSPP+IP V +P++ VL  A+ALRIEIN+  +VL
Sbjct  120  SNASTFINKSPPRIPEVCIPEEPVLQTAAALRIEINQGFSVL  161



>ref|XP_010251601.1| PREDICTED: reticulon-like protein B2 [Nelumbo nucifera]
Length=254

 Score =   194 bits (494),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 127/163 (78%), Gaps = 3/163 (2%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQ-GHdssssdseddhadKPSADAVKAKIYRLFGRERH  245
            M +HAG     +E++MEKI++KL+ GHDSSSS   D+    PSA  V A +YRLFGR++ 
Sbjct  1    MEEHAGGSAPASESIMEKITEKLRLGHDSSSSSDSDNEESSPSA--VTAAVYRLFGRQKP  58

Query  246  VHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFL  425
            VHKV GGGKPAD+FLWR+KK+S  V+G AT  WVLFEL+EYHLLTLVCH LI++LA+ FL
Sbjct  59   VHKVFGGGKPADVFLWRNKKISAGVLGGATATWVLFELLEYHLLTLVCHCLIVSLAVLFL  118

Query  426  WSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            +SNA  F++K+PP+IP V +P+D VL  ASALRIEINR  AVL
Sbjct  119  YSNAIAFMHKTPPRIPEVYIPEDPVLQFASALRIEINRAFAVL  161



>ref|XP_008810936.1| PREDICTED: reticulon-like protein B5 [Phoenix dactylifera]
Length=253

 Score =   194 bits (494),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 116/145 (80%), Gaps = 0/145 (0%)
 Frame = +3

Query  120  KISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGKPADIFLWRD  299
            KI++K    DSSSS   D+   +PSA +VKAKIYRLFGRE+ VH VLGGGKPADIFLWR+
Sbjct  16   KITEKFHQEDSSSSSDSDNEKPQPSASSVKAKIYRLFGREKPVHTVLGGGKPADIFLWRN  75

Query  300  KKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSV  479
            KK+S  V+G AT IWVLFELMEYHLLTLVCH LIL+LAI FLWSNASTFINKS P IP V
Sbjct  76   KKISAGVLGVATAIWVLFELMEYHLLTLVCHCLILSLAILFLWSNASTFINKSSPHIPEV  135

Query  480  ILPQDTVLNVASALRIEINRTLAVL  554
             +P+D  ++VA +LR EINR  AVL
Sbjct  136  SIPEDVAVDVALSLRYEINRGFAVL  160



>ref|XP_011093062.1| PREDICTED: reticulon-like protein B1 [Sesamum indicum]
Length=257

 Score =   194 bits (493),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 125/165 (76%), Gaps = 3/165 (2%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSAD---AVKAKIYRLFGRE  239
            MA+     D   ++++++IS+K+ G D +SS S+ D   K +A    +VKAKIYRLFGRE
Sbjct  1    MAEQEEISDPRTDSLVDRISEKIHGGDDTSSSSDSDSQVKEAASPPASVKAKIYRLFGRE  60

Query  240  RHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAIS  419
            + VHKV GGGKPADIFLWR+KK+S  V+G AT +WVLFEL+EYHLLTLVCH+ ILAL++ 
Sbjct  61   KPVHKVFGGGKPADIFLWRNKKISATVLGGATAVWVLFELLEYHLLTLVCHVSILALSLL  120

Query  420  FLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            FLWSNA+TFINK PP IP V LP+D  L VAS LR EINR  AVL
Sbjct  121  FLWSNATTFINKRPPHIPEVRLPEDPFLEVASVLRTEINRGFAVL  165



>ref|XP_009415169.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=251

 Score =   194 bits (492),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 126/152 (83%), Gaps = 1/152 (1%)
 Frame = +3

Query  102  AETVMEKISDKLQGHdssssdseddhadKPS-ADAVKAKIYRLFGRERHVHKVLGGGKPA  278
             ET++EKI +K+ G DSSSSDS+D+ +     A+AVK+KI+RLFGRE+ VH++LGGGKPA
Sbjct  7    GETLIEKIKEKIHGGDSSSSDSDDEKSKASEVAEAVKSKIFRLFGREKPVHRILGGGKPA  66

Query  279  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKS  458
            D+FLW++KK S  V+G AT IWVLFELMEYHLLTLVCH LIL+LAI FLWSNA+TFINKS
Sbjct  67   DVFLWKNKKASAIVLGGATAIWVLFELMEYHLLTLVCHCLILSLAILFLWSNATTFINKS  126

Query  459  PPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            PP IP VI+P+D  +N+A +LR EINR  AVL
Sbjct  127  PPHIPEVIIPEDLSVNIALSLRYEINRGFAVL  158



>ref|XP_011026963.1| PREDICTED: reticulon-like protein B2 [Populus euphratica]
Length=254

 Score =   194 bits (492),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 133/162 (82%), Gaps = 1/162 (1%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MA+H  D DS+ E+V EKIS+K+ GHDSSS    D    K + D++K+KIYRLFGRE+ V
Sbjct  1    MAEHDKD-DSVVESVTEKISEKIHGHDSSSGSDSDHEKSKSNPDSLKSKIYRLFGREKPV  59

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            HKVLGGGKPAD+FLWR+KK+S  V+G AT IWVLFEL+EYHLLTLVCH LILALA+ FLW
Sbjct  60   HKVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELLEYHLLTLVCHCLILALALLFLW  119

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNASTFINKSPP+IP V +P++ VL +A+ALRIEIN+  AVL
Sbjct  120  SNASTFINKSPPRIPEVHIPEEPVLQIAAALRIEINQGFAVL  161



>gb|EAY98759.1| hypothetical protein OsI_20691 [Oryza sativa Indica Group]
Length=251

 Score =   193 bits (491),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 127/162 (78%), Gaps = 3/162 (2%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MA+H  + +SL E+VM+KISDKL G   SSS S D   ++ +AD +KAKIYRLFGRE+ V
Sbjct  1    MAEHK-EEESLVESVMDKISDKLHGRGGSSSSSSDSDGER-TAD-LKAKIYRLFGREKPV  57

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            H VLGGGKPAD+FLWR+KK+S  V+  AT IW+LFE+M+YHLLTL+CH +IL LA+ FLW
Sbjct  58   HSVLGGGKPADLFLWRNKKISVGVLTGATAIWLLFEVMDYHLLTLLCHCIILTLAMLFLW  117

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNASTFINKSPP IP V +P+D  +NVA ++R EINR  A L
Sbjct  118  SNASTFINKSPPNIPEVKIPEDLAVNVARSVRFEINRGFATL  159



>gb|KJB06451.1| hypothetical protein B456_001G157900 [Gossypium raimondii]
Length=257

 Score =   193 bits (491),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 128/165 (78%), Gaps = 3/165 (2%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddha--dKP-SADAVKAKIYRLFGRE  239
            MA+      S  E+VMEKIS+K+ GHDSSSS   D  +  +KP S  +VKAKIYRLFGRE
Sbjct  1    MAEETESMQSAVESVMEKISEKIHGHDSSSSSDSDSDSDHEKPASPSSVKAKIYRLFGRE  60

Query  240  RHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAIS  419
            R +H VLGGGKPAD+FLWR+KK+S  V+G AT IWVLFEL+EYHLLTL+CHI IL+LA+ 
Sbjct  61   RPLHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLLCHISILSLAVL  120

Query  420  FLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            FLWSN  TFI+K+PP+IP V LP++  L +ASAL IE+N+ L +L
Sbjct  121  FLWSNVHTFIHKTPPRIPQVHLPEEPFLQIASALTIELNQALELL  165



>ref|XP_010545343.1| PREDICTED: reticulon-like protein B3 [Tarenaya hassleriana]
Length=259

 Score =   193 bits (490),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 125/163 (77%), Gaps = 1/163 (1%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddh-adKPSADAVKAKIYRLFGRERH  245
            MA+     +S AE+++EKI++K++G+D  SS S D     K S  ++KAKIYRLFGRE  
Sbjct  1    MAEEHKHEESAAESIIEKIAEKIRGYDDGSSSSSDSDDEKKASLSSLKAKIYRLFGRENP  60

Query  246  VHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFL  425
            VH VLGGGKPADI LWR+KKVSG V+G AT  WVLFEL+EYHLL+LVCH  ILALA+ FL
Sbjct  61   VHNVLGGGKPADIVLWRNKKVSGGVLGAATAAWVLFELLEYHLLSLVCHSSILALAVLFL  120

Query  426  WSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            WSNASTFI+K+PP+IP V +P++ VL +AS LR EINR  A L
Sbjct  121  WSNASTFIHKTPPRIPEVHIPEEHVLQLASGLRTEINRGFAAL  163



>ref|NP_001130478.1| Seed maturation protein [Zea mays]
 ref|XP_008654247.1| PREDICTED: seed maturation protein isoform X1 [Zea mays]
 ref|XP_008654248.1| PREDICTED: seed maturation protein isoform X1 [Zea mays]
 gb|ACF78704.1| unknown [Zea mays]
 gb|ACF84299.1| unknown [Zea mays]
 gb|ACG48055.1| seed maturation protein [Zea mays]
 gb|ACR34851.1| unknown [Zea mays]
 gb|AFW85129.1| Seed maturation protein [Zea mays]
Length=253

 Score =   193 bits (490),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 125/167 (75%), Gaps = 10/167 (6%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSA-----DAVKAKIYRLFG  233
            MADH  +     ++VM+KIS+K  G DSSSS   DD   K S+     +A+KAKIYRLFG
Sbjct  1    MADHKEE-----QSVMDKISEKFHGGDSSSSSDSDDEKKKGSSSASATEAMKAKIYRLFG  55

Query  234  RERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALA  413
            RER VH VLGGGKPAD+ LWR+KK+SG V+  AT IW+LFE+MEYHLLTLVCH LI++LA
Sbjct  56   RERPVHSVLGGGKPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVCHCLIVSLA  115

Query  414  ISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            I FLWSNAS+FINKSPP IP V +P+D  +NVA  LR EINR  A L
Sbjct  116  ILFLWSNASSFINKSPPNIPEVKIPEDVSVNVALTLRYEINRGFATL  162



>ref|NP_001239711.1| uncharacterized protein LOC100811024 [Glycine max]
 gb|ACU21063.1| unknown [Glycine max]
 gb|KHN16777.1| Reticulon-like protein B2 [Glycine soja]
Length=254

 Score =   192 bits (489),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 126/162 (78%), Gaps = 1/162 (1%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MA+H    +   E+++EKIS K+  HDSSSS   D+     S D++K+K++RLFGRE+ +
Sbjct  1    MAEHHEHEEVKGESLLEKISGKIHDHDSSSSSDSDNEKTSAS-DSLKSKVFRLFGREKPI  59

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            H VLGGGKPAD+FLWR+KK+S + +G AT IWVLFEL+EYHLLTLVCH LIL LA+ FLW
Sbjct  60   HHVLGGGKPADVFLWRNKKISASTLGVATAIWVLFELLEYHLLTLVCHFLILGLAVLFLW  119

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNASTFINKSPP+IP V +P+  VL  ASALR+EINR  A+L
Sbjct  120  SNASTFINKSPPKIPQVHIPEKPVLEFASALRVEINRAFALL  161



>ref|XP_010533622.1| PREDICTED: reticulon-like protein B4 [Tarenaya hassleriana]
Length=259

 Score =   192 bits (488),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 126/163 (77%), Gaps = 1/163 (1%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSA-DAVKAKIYRLFGRERH  245
            MA+     +S AE++MEKI++K++GHD  SS S D   +K S+  ++KAKIYRLFGRE+ 
Sbjct  1    MAEEHKHEESTAESIMEKIAEKIRGHDDGSSSSSDSDDEKKSSPSSLKAKIYRLFGREKP  60

Query  246  VHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFL  425
            VH VLGGGKPADIFLWR+KKVSG  +G AT  WVLFEL+EYHLLTLVCH  I ALA+ FL
Sbjct  61   VHSVLGGGKPADIFLWRNKKVSGGALGVATAAWVLFELLEYHLLTLVCHSSIFALAVLFL  120

Query  426  WSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            WSNASTFI+K+PP+IP V +P++ V+ +AS LR E+NR    L
Sbjct  121  WSNASTFIHKTPPRIPHVHIPEEPVIQLASGLRFEVNRGFTAL  163



>gb|KJB06453.1| hypothetical protein B456_001G157900 [Gossypium raimondii]
Length=288

 Score =   192 bits (489),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 128/165 (78%), Gaps = 3/165 (2%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddha--dKP-SADAVKAKIYRLFGRE  239
            MA+      S  E+VMEKIS+K+ GHDSSSS   D  +  +KP S  +VKAKIYRLFGRE
Sbjct  1    MAEETESMQSAVESVMEKISEKIHGHDSSSSSDSDSDSDHEKPASPSSVKAKIYRLFGRE  60

Query  240  RHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAIS  419
            R +H VLGGGKPAD+FLWR+KK+S  V+G AT IWVLFEL+EYHLLTL+CHI IL+LA+ 
Sbjct  61   RPLHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLLCHISILSLAVL  120

Query  420  FLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            FLWSN  TFI+K+PP+IP V LP++  L +ASAL IE+N+ L +L
Sbjct  121  FLWSNVHTFIHKTPPRIPQVHLPEEPFLQIASALTIELNQALELL  165



>ref|XP_003569752.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=257

 Score =   191 bits (485),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 124/165 (75%), Gaps = 3/165 (2%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadK---PSADAVKAKIYRLFGRE  239
            M +H  + +S+ +++M+K+SDKL G   SSS S D   +K    SA A+K+KIYRLFGRE
Sbjct  1    MTEHKEESESVVQSMMDKVSDKLHGSGDSSSSSSDSDDEKKGSSSAAAMKSKIYRLFGRE  60

Query  240  RHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAIS  419
            + VH VLGGGKPAD+ LWR+KK SG V+  AT+IW+LFE+MEYHLL LVCH LIL+LA  
Sbjct  61   KPVHSVLGGGKPADLVLWRNKKTSGVVLAGATSIWLLFEVMEYHLLNLVCHCLILSLATL  120

Query  420  FLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            FLWSNA TFINKSPP IP V +P+D  +N+A +LR EINR  + L
Sbjct  121  FLWSNACTFINKSPPNIPEVKIPEDLTVNIALSLRYEINRGFSTL  165



>ref|XP_010518282.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=255

 Score =   191 bits (485),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 124/163 (76%), Gaps = 3/163 (2%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKP-SADAVKAKIYRLFGRERH  245
            MA+         E++MEKIS+K+  HDSSSS   +    KP S  AVKAKIYRLFGRE+ 
Sbjct  1    MAEEIEKSVPAEESLMEKISEKIHHHDSSSSSESEYE--KPDSPSAVKAKIYRLFGREKP  58

Query  246  VHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFL  425
            VHKVLGGGKPAD+FLWRDKK+S AV+G AT IWVLFEL+EYHLL+L+CHI ILAL   FL
Sbjct  59   VHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFL  118

Query  426  WSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            WSNA TFINK+PPQIP V +P+D  L +AS+LR E+N+   +L
Sbjct  119  WSNAHTFINKTPPQIPEVHVPEDAFLVIASSLRNELNQAFVIL  161



>ref|XP_003525365.1| PREDICTED: reticulon-like protein B2-like isoform 1 [Glycine 
max]
 gb|KHM99936.1| Reticulon-like protein B2 [Glycine soja]
Length=254

 Score =   191 bits (484),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 125/163 (77%), Gaps = 3/163 (2%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSA-DAVKAKIYRLFGRERH  245
            MA+H    +   E+++EKIS K+   D  SS S D   DK SA D+ K+ ++RLFGRE+ 
Sbjct  1    MAEHHEHEEVKGESLLEKISGKIH--DHDSSSSSDSDNDKTSATDSFKSNVFRLFGREKP  58

Query  246  VHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFL  425
            +H VLGGGKPAD+FLWR+KK+S + +G AT IWVLFEL+EYHLLTLVCH LILALA  FL
Sbjct  59   IHHVLGGGKPADVFLWRNKKISASTLGVATAIWVLFELLEYHLLTLVCHFLILALAGLFL  118

Query  426  WSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            WSNASTFINKSPP+IP V +P++ VL  ASALRIEINR  AVL
Sbjct  119  WSNASTFINKSPPKIPQVHIPEEPVLKFASALRIEINRAFAVL  161



>gb|ABK94480.1| unknown [Populus trichocarpa]
Length=251

 Score =   191 bits (484),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 124/162 (77%), Gaps = 3/162 (2%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MA+ + D     E+VM KIS+K+    SSS    D       +++VK KI+RLFGRE+ V
Sbjct  1    MAEQSEDP---IESVMGKISEKIHHESSSSDSESDSEKKSYPSESVKDKIWRLFGREKPV  57

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            H+VLGGGKPAD+FLWR+KKVS  V+GFAT IWVLFEL+EY+LLTLVCHILIL+LA+SFLW
Sbjct  58   HRVLGGGKPADVFLWRNKKVSAGVLGFATAIWVLFELVEYNLLTLVCHILILSLALSFLW  117

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNA +FINKSPP+IP V LP++ VL VASAL +EIN    VL
Sbjct  118  SNAHSFINKSPPRIPQVHLPEEPVLQVASALCVEINGAFVVL  159



>ref|XP_009626481.1| PREDICTED: reticulon-like protein B5 isoform X2 [Nicotiana tomentosiformis]
Length=192

 Score =   189 bits (479),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 109/129 (84%), Gaps = 1/129 (1%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MADHAG+H+S+ E+VM+KI+DKL    SSS   ++     P  +AVKAKIYRLFGRER V
Sbjct  1    MADHAGEHESVVESVMDKINDKLHHDSSSSDSEDEKEKISP-VEAVKAKIYRLFGRERPV  59

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            HKVLGGGKPADIFLWRDKK++  V+GFAT IWVLFEL+EYHLLTLVCHILILALA+ FLW
Sbjct  60   HKVLGGGKPADIFLWRDKKITAGVLGFATAIWVLFELLEYHLLTLVCHILILALAVLFLW  119

Query  429  SNASTFINK  455
            SNASTFINK
Sbjct  120  SNASTFINK  128



>gb|KDP25363.1| hypothetical protein JCGZ_20519 [Jatropha curcas]
Length=257

 Score =   191 bits (484),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 130/165 (79%), Gaps = 4/165 (2%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdse---ddhadKPSADAVKAKIYRLFGRE  239
            MA+H  + +S+ E+VMEKIS+K+ GHDSSSS      +      S  ++K+KIYR+FGRE
Sbjct  1    MAEHHKE-ESVIESVMEKISEKIHGHDSSSSSDSDNDEKSKSSSSPSSMKSKIYRIFGRE  59

Query  240  RHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAIS  419
            + VHKVLGGGKPADIFLWR+KK+S  V+G AT IWVLFEL+EYHLLTL+CH LIL+LA+ 
Sbjct  60   KPVHKVLGGGKPADIFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLICHGLILSLAVL  119

Query  420  FLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            FLWSNASTFINKSPP+IP V +P++ VL VA ALR EIN   AVL
Sbjct  120  FLWSNASTFINKSPPRIPEVYIPEEPVLQVADALRSEINWGFAVL  164



>ref|XP_002320163.1| reticulon family protein [Populus trichocarpa]
 gb|ABK92738.1| unknown [Populus trichocarpa]
 gb|EEE98478.1| reticulon family protein [Populus trichocarpa]
Length=251

 Score =   190 bits (483),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = +3

Query  81   AGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVL  260
            A   ++  E+VM KIS+K+    SSS    D       +++VK KI+RLFGRE+ VH+VL
Sbjct  2    AEQSENPIESVMGKISEKIHHESSSSDSESDSEKKSYPSESVKDKIWRLFGREKPVHRVL  61

Query  261  GGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNAS  440
            GGGKPAD+FLWR+KKVS  V+GFAT IWVLFEL+EY+LLTLVCHILIL+LA+SFLWSNA 
Sbjct  62   GGGKPADVFLWRNKKVSAGVLGFATAIWVLFELVEYNLLTLVCHILILSLALSFLWSNAH  121

Query  441  TFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            +FINKSPP+IP V LP++ VL VASAL +EIN    VL
Sbjct  122  SFINKSPPRIPQVHLPEEPVLQVASALCVEINGAFVVL  159



>ref|XP_010506615.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=255

 Score =   190 bits (483),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 124/163 (76%), Gaps = 3/163 (2%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKP-SADAVKAKIYRLFGRERH  245
            MA+         E++MEKIS+K+  HDSSSS   +    KP S  AVKAKIYR+FGRE+ 
Sbjct  1    MAEEIEKSVPAEESLMEKISEKIHHHDSSSSSESEYE--KPDSPSAVKAKIYRMFGREKP  58

Query  246  VHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFL  425
            VHKVLGGGKPAD+FLWRDKK+S AV+G AT IWVLFEL+EYHLL+L+CHI ILAL   FL
Sbjct  59   VHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFL  118

Query  426  WSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            WSNA TFINK+PPQIP V +P+D  L +AS+LR E+N+   +L
Sbjct  119  WSNAHTFINKTPPQIPEVHVPEDAFLVIASSLRNELNQAFVIL  161



>ref|XP_007160119.1| hypothetical protein PHAVU_002G294100g [Phaseolus vulgaris]
 gb|ESW32113.1| hypothetical protein PHAVU_002G294100g [Phaseolus vulgaris]
Length=254

 Score =   190 bits (482),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 127/162 (78%), Gaps = 1/162 (1%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MA+H    ++  E++++KIS K+  HDSSSS   D+    PS D++K+K++RLFGRE+ +
Sbjct  1    MAEHHEHEEAKGESLLDKISGKIHDHDSSSSSDSDNEKTGPS-DSLKSKVFRLFGREKPI  59

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            H VLGGGK AD+FLWR+KK+S + +G AT IW+LFEL+EYHLLTLVCH +ILALA  FLW
Sbjct  60   HHVLGGGKQADVFLWRNKKISASTLGVATVIWILFELLEYHLLTLVCHFVILALAGLFLW  119

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNASTFINK PP+IP V +P+D +L  ASALRIEINR  +VL
Sbjct  120  SNASTFINKRPPKIPQVHIPEDPILQFASALRIEINRAFSVL  161



>ref|XP_002509881.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51268.1| conserved hypothetical protein [Ricinus communis]
Length=260

 Score =   190 bits (483),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 127/167 (76%), Gaps = 5/167 (3%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssd-----seddhadKPSADAVKAKIYRLFG  233
            MAD     +S  E++M+KIS+K+ GHDSSSS       +       S  ++K+KIYRLFG
Sbjct  1    MADEHHHEESKGESLMDKISEKIHGHDSSSSSDSDNDEKLKPKSPSSPSSIKSKIYRLFG  60

Query  234  RERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALA  413
            RE+ VH VLGGGKPADIFLWR+KKVS  V+GFAT +WVLFEL+EYHLLTL+CH  ILALA
Sbjct  61   REKPVHHVLGGGKPADIFLWRNKKVSAGVLGFATAVWVLFELIEYHLLTLICHGFILALA  120

Query  414  ISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            I FLWSNASTFINKSPP IP V +P++ VL VA+ALR+EIN   A+L
Sbjct  121  ILFLWSNASTFINKSPPHIPEVHIPEEPVLQVAAALRMEINYAFAIL  167



>emb|CDP12094.1| unnamed protein product [Coffea canephora]
Length=252

 Score =   190 bits (482),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 122/162 (75%), Gaps = 3/162 (2%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MADH  + D+ AE+++EK  DK+ G   +   S     D+    ++KAK++RLFGRE+ V
Sbjct  1    MADHHHEEDAKAESLIEKTRDKVHG---ADDSSSSSSDDEGKTSSLKAKVFRLFGREKPV  57

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            HK+LGGGKPAD+F+WR+K++S  V+G AT IWVLFE++EYHLLTLVCH LI+ LA+ FLW
Sbjct  58   HKLLGGGKPADVFMWRNKQISAGVLGVATAIWVLFEILEYHLLTLVCHGLIIVLAVLFLW  117

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNASTFINKSPP+IP V +P+  VL  AS  R+ IN+T A+L
Sbjct  118  SNASTFINKSPPRIPEVSVPEKPVLQFASDARVAINQTFALL  159



>ref|XP_011047748.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=254

 Score =   190 bits (482),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 129/164 (79%), Gaps = 5/164 (3%)
 Frame = +3

Query  69   MADHAGDHDS--LAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRER  242
            MA+H G+ +   + E++++KI++K+  H SSSS S+ D       DAVK+KI+RLFGRE+
Sbjct  1    MAEHEGEREREPVVESMVDKITEKIHDHHSSSSSSDSDDD---KLDAVKSKIFRLFGREK  57

Query  243  HVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF  422
             VHKVLGGGKPAD+FLWR+KK+S  V+G AT +WV FEL+EYHL+TLVC++ I +LA+ F
Sbjct  58   PVHKVLGGGKPADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCYLSIFSLAVLF  117

Query  423  LWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            LWSNAS F+NKSPP+IP V+LP+  V  VAS LRIEINR +AVL
Sbjct  118  LWSNASNFLNKSPPKIPEVLLPEKCVREVASGLRIEINRGVAVL  161



>ref|XP_006374288.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52085.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=199

 Score =   188 bits (477),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 123/163 (75%), Gaps = 3/163 (2%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKL-QGHdssssdseddhadKPSADAVKAKIYRLFGRERH  245
            MA+H G+ +   E V+E ++DK+ +      S S    +D   +DAVK+KI+RLFGRE+ 
Sbjct  10   MAEHEGERER--EPVVESMADKITEKTHDHDSSSSSSDSDDDKSDAVKSKIFRLFGREKP  67

Query  246  VHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFL  425
            VHKVLGGGKPAD+FLWR+KK+S  V+G AT +WV FEL+EYHL+TLVCH+ I +LA+ FL
Sbjct  68   VHKVLGGGKPADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCHLSIFSLAVLFL  127

Query  426  WSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            WSNAS F+NKSPP+IP V+LP+  V  VAS LRIEINR  AVL
Sbjct  128  WSNASNFLNKSPPKIPEVLLPEKWVREVASGLRIEINRGFAVL  170



>ref|XP_006374287.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52084.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=193

 Score =   187 bits (476),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 123/163 (75%), Gaps = 3/163 (2%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKL-QGHdssssdseddhadKPSADAVKAKIYRLFGRERH  245
            MA+H G+ +   E V+E ++DK+ +      S S    +D   +DAVK+KI+RLFGRE+ 
Sbjct  10   MAEHEGERER--EPVVESMADKITEKTHDHDSSSSSSDSDDDKSDAVKSKIFRLFGREKP  67

Query  246  VHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFL  425
            VHKVLGGGKPAD+FLWR+KK+S  V+G AT +WV FEL+EYHL+TLVCH+ I +LA+ FL
Sbjct  68   VHKVLGGGKPADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCHLSIFSLAVLFL  127

Query  426  WSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            WSNAS F+NKSPP+IP V+LP+  V  VAS LRIEINR  AVL
Sbjct  128  WSNASNFLNKSPPKIPEVLLPEKWVREVASGLRIEINRGFAVL  170



>gb|KCW46474.1| hypothetical protein EUGRSUZ_K00300 [Eucalyptus grandis]
Length=218

 Score =   188 bits (478),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 121/163 (74%), Gaps = 5/163 (3%)
 Frame = +3

Query  72   ADHAGDHDSLAETVMEKISDKLQ--GHdssssdseddhadKPSADAVKAKIYRLFGRERH  245
            ADHAGD +    ++MEK ++K+      S+SS S+ D       D+ K+K+YRLFGRE+ 
Sbjct  3    ADHAGDAEP---SLMEKNTEKIHVPDPPSASSSSDSDDDKPSVVDSAKSKVYRLFGREKP  59

Query  246  VHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFL  425
            VHKVLGGGKPADIFLWRDKKVS  V+G AT IW+LFELMEYHL+TLVCHILI  LAI FL
Sbjct  60   VHKVLGGGKPADIFLWRDKKVSAGVLGVATAIWILFELMEYHLITLVCHILIATLAIIFL  119

Query  426  WSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            W++AST I KSPP IP V LP+  VL VAS LR E NR LA+L
Sbjct  120  WASASTHITKSPPNIPEVQLPEKCVLEVASVLRFEANRGLALL  162



>gb|AEZ00899.1| putative 24 kDa seed maturation protein [Elaeis guineensis]
Length=253

 Score =   189 bits (481),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 125/156 (80%), Gaps = 0/156 (0%)
 Frame = +3

Query  87   DHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGG  266
            + +S+ E++MEKI++K    DSSSS   D+    PS+ +V++KIYRLFGRE+ VH VLGG
Sbjct  5    NEESVGESLMEKITEKFHHEDSSSSSDSDNEKSLPSSSSVQSKIYRLFGREKPVHTVLGG  64

Query  267  GKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTF  446
            GKPADIFLWR+KK+S  V+G AT IWVLFELMEYHLL+LVCH LIL+LAI FLWSNA+TF
Sbjct  65   GKPADIFLWRNKKISAGVLGGATAIWVLFELMEYHLLSLVCHCLILSLAILFLWSNATTF  124

Query  447  INKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            INKSPP IP V +P+D  ++VA +LR +INR  AVL
Sbjct  125  INKSPPHIPEVSIPEDVAVSVALSLRYDINRAFAVL  160



>gb|EYU23406.1| hypothetical protein MIMGU_mgv1a012325mg [Erythranthe guttata]
Length=254

 Score =   189 bits (481),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 124/162 (77%), Gaps = 1/162 (1%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MADH  + +   E+ MEKI++K+ GH SSSS S  D  D+ +A ++K+K+YRLFGRE+ V
Sbjct  1    MADHIKEEEKHGESFMEKIAEKIHGHGSSSSSSSSDSDDEKTA-SLKSKVYRLFGREKPV  59

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            HKVLGGG+PAD+ LW+DKKVSG V+G  T IWVLF+L+EYHLL LVCH LIL L   FL+
Sbjct  60   HKVLGGGQPADLLLWKDKKVSGGVLGGVTAIWVLFDLLEYHLLALVCHGLILGLVGLFLY  119

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNASTFI KSPP+IP V +P++ VLN ASALRI IN   A L
Sbjct  120  SNASTFIKKSPPKIPVVSIPEEPVLNFASALRIGINEGFATL  161



>ref|XP_006397801.1| hypothetical protein EUTSA_v10001599mg [Eutrema salsugineum]
 gb|ESQ39254.1| hypothetical protein EUTSA_v10001599mg [Eutrema salsugineum]
Length=253

 Score =   189 bits (480),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 124/163 (76%), Gaps = 3/163 (2%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKP-SADAVKAKIYRLFGRERH  245
            MA+         E++MEKI++K+  HDSSSS   +    KP S  AVKAKIYRLFGRE+ 
Sbjct  1    MAEEIEKSVPAEESLMEKIAEKIHHHDSSSSSESEYE--KPDSPSAVKAKIYRLFGREKP  58

Query  246  VHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFL  425
            VHKVLGGGKPAD+FLWRDKK+S AV+G AT IWVLFEL+EYHLL+L+CHI ILAL   FL
Sbjct  59   VHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFL  118

Query  426  WSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            WSNA TFINK+PPQIP V +P++  L +AS+LR E+N+   +L
Sbjct  119  WSNAHTFINKTPPQIPEVHVPEEAFLTIASSLRNELNQAFVIL  161



>ref|XP_010112604.1| Reticulon-like protein [Morus notabilis]
 gb|EXC34329.1| Reticulon-like protein [Morus notabilis]
Length=254

 Score =   189 bits (480),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 135/167 (81%), Gaps = 8/167 (5%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadK-----PSADAVKAKIYRLFG  233
            MA+    H+   E+++EKI+DK+ GHDSSSS S  D  D       S+ ++K+KIYRLFG
Sbjct  1    MAETQHHHE---ESLLEKITDKIHGHDSSSSSSSSDSDDDKKSEAQSSSSLKSKIYRLFG  57

Query  234  RERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALA  413
            RE+ VHKVLGGGKPADIFLWR+KKVS  V+G AT IW+LFEL+EYHLLTLVCH+LILALA
Sbjct  58   REKPVHKVLGGGKPADIFLWRNKKVSAGVLGVATVIWILFELVEYHLLTLVCHLLILALA  117

Query  414  ISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            + FLWSNASTFINKSPP++P V +P+D VL VA+ALRIEINR LA+L
Sbjct  118  LLFLWSNASTFINKSPPRLPDVYIPEDPVLQVAAALRIEINRGLAIL  164



>ref|XP_009603968.1| PREDICTED: reticulon-like protein B1 [Nicotiana tomentosiformis]
 ref|XP_009603969.1| PREDICTED: reticulon-like protein B1 [Nicotiana tomentosiformis]
Length=263

 Score =   189 bits (479),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 125/171 (73%), Gaps = 10/171 (6%)
 Frame = +3

Query  69   MADHAGDHDSL--AETVMEKISDKLQGHdssssdseddhadKP-------SADAVKAKIY  221
            MA+HA DH      E+++EKI DK+     SSS S+ D   KP       S  +VKA I+
Sbjct  1    MAEHA-DHSEYNEEESLIEKIEDKIHFDHFSSSSSDSDTEKKPASAPEAASPSSVKAAIW  59

Query  222  RLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI  401
            RLFGRE+ VH+V GGGKPAD+FLWR+KKVS +V+G AT IWVLFEL+EYHLL LVCH+LI
Sbjct  60   RLFGREKPVHQVFGGGKPADVFLWRNKKVSASVLGGATAIWVLFELLEYHLLGLVCHLLI  119

Query  402  LALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
              LAI FLWSNA+TFINK  P IP V LP++ +L +ASALRIEIN TL VL
Sbjct  120  FTLAILFLWSNATTFINKKRPHIPEVHLPEEPILEIASALRIEINYTLRVL  170



>ref|XP_006358652.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=255

 Score =   188 bits (478),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 123/162 (76%), Gaps = 0/162 (0%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MA+     +   E++MEKI+DK+    SSSSDSE   A  P A +VKAKI+RLFGRE+ V
Sbjct  1    MAEQVEHSEHKEESLMEKIADKIHFDRSSSSDSEVKPAAAPEASSVKAKIWRLFGREKPV  60

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            H V GGGKPAD+FLWR+KK+S +V+G AT IWVLFEL+EY L+ LVCH+LI  LA+ FLW
Sbjct  61   HHVFGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYFLVGLVCHLLIFTLAVLFLW  120

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNA+TFINK  P IP V LP++ +L +ASAL IEINR L++L
Sbjct  121  SNATTFINKKRPHIPEVQLPEEPILEIASALSIEINRALSML  162



>ref|XP_008376662.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=261

 Score =   188 bits (478),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 108/124 (87%), Gaps = 1/124 (1%)
 Frame = +3

Query  186  KPSA-DAVKAKIYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELM  362
            KPSA D+VK+KI+RLFGRE+ VHKVLGGGKPAD+ LWR+KK+S +V+G AT +WV FEL+
Sbjct  45   KPSAHDSVKSKIFRLFGREKPVHKVLGGGKPADVLLWRNKKISASVLGGATVLWVFFELL  104

Query  363  EYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRT  542
            EYHL+TLVCH+LIL+LA+ FLWS ASTFINKSPPQIP V +P+ TVL +ASALRIEIN+ 
Sbjct  105  EYHLITLVCHLLILSLAVFFLWSYASTFINKSPPQIPKVQIPEKTVLELASALRIEINKG  164

Query  543  LAVL  554
              VL
Sbjct  165  FYVL  168



>ref|XP_010676393.1| PREDICTED: reticulon-like protein B2 [Beta vulgaris subsp. vulgaris]
Length=248

 Score =   188 bits (477),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 120/162 (74%), Gaps = 7/162 (4%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MA+H       AE++MEKI+DK+         S D   DKP+  ++K+KIYRLFGR++ V
Sbjct  1    MAEHEAPK---AESIMEKIADKIH----HHDSSSDSDDDKPAPSSLKSKIYRLFGRDKPV  53

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            HKVLGGGKPADI LWRDKK+S  V+G  T +W LFE+ EYHLL+L+CH+L+L + + FLW
Sbjct  54   HKVLGGGKPADILLWRDKKISATVLGTVTAVWALFEIFEYHLLSLICHLLMLTITVLFLW  113

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNASTFINK+PP+IP V +P+  VL +ASAL+ EINR LA L
Sbjct  114  SNASTFINKAPPKIPDVRIPEGPVLEIASALKYEINRGLASL  155



>ref|XP_008234814.1| PREDICTED: reticulon-like protein B1 [Prunus mume]
Length=259

 Score =   188 bits (478),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 108/124 (87%), Gaps = 1/124 (1%)
 Frame = +3

Query  186  KPSA-DAVKAKIYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELM  362
            KPS  D+VK+KI+RLFGRE+ VHKVLGGGKPAD+ LWR+KK+S +V+G AT +WV FEL+
Sbjct  43   KPSTHDSVKSKIFRLFGREKPVHKVLGGGKPADVLLWRNKKISASVLGGATVLWVFFELL  102

Query  363  EYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRT  542
            EYHL+TLVCH+LIL+LA+ FLWSNASTFINKSPPQIP V L + TVL++ASALRIE+NR 
Sbjct  103  EYHLITLVCHLLILSLAVFFLWSNASTFINKSPPQIPKVQLSERTVLDLASALRIELNRA  162

Query  543  LAVL  554
              +L
Sbjct  163  FHIL  166



>ref|XP_010508058.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=256

 Score =   188 bits (477),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 120/150 (80%), Gaps = 3/150 (2%)
 Frame = +3

Query  108  TVMEKISDKLQGHdssssdseddhadKP-SADAVKAKIYRLFGRERHVHKVLGGGKPADI  284
            ++MEKIS+K+  HDSSSS   +    KP S  AVKAKIYR+FGRE+ VHKVLGGGKPAD+
Sbjct  15   SLMEKISEKIHHHDSSSSSESEYE--KPDSPSAVKAKIYRMFGREKPVHKVLGGGKPADV  72

Query  285  FLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPP  464
            FLWRDKK+S AV+G AT IWVLFEL+EYHLL+L+CHI ILAL   FLWSNA TFINK+PP
Sbjct  73   FLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNAHTFINKTPP  132

Query  465  QIPSVILPQDTVLNVASALRIEINRTLAVL  554
            QIP V +P+D  L +AS+LR E+N+   +L
Sbjct  133  QIPEVHVPEDAFLVIASSLRNELNQAFVIL  162



>ref|XP_006374289.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52086.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=254

 Score =   188 bits (477),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 123/163 (75%), Gaps = 3/163 (2%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKL-QGHdssssdseddhadKPSADAVKAKIYRLFGRERH  245
            MA+H G+ +   E V+E ++DK+ +      S S    +D   +DAVK+KI+RLFGRE+ 
Sbjct  1    MAEHEGERER--EPVVESMADKITEKTHDHDSSSSSSDSDDDKSDAVKSKIFRLFGREKP  58

Query  246  VHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFL  425
            VHKVLGGGKPAD+FLWR+KK+S  V+G AT +WV FEL+EYHL+TLVCH+ I +LA+ FL
Sbjct  59   VHKVLGGGKPADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCHLSIFSLAVLFL  118

Query  426  WSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            WSNAS F+NKSPP+IP V+LP+  V  VAS LRIEINR  AVL
Sbjct  119  WSNASNFLNKSPPKIPEVLLPEKWVREVASGLRIEINRGFAVL  161



>ref|XP_010916969.1| PREDICTED: reticulon-like protein B3 [Elaeis guineensis]
Length=310

 Score =   189 bits (481),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 126/156 (81%), Gaps = 0/156 (0%)
 Frame = +3

Query  87   DHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGG  266
            + +S+ E++MEKI++K    DSSSS   D+   +PS+ +V++KIYRLFGRE+ VH VLGG
Sbjct  5    NEESVGESLMEKITEKFHHEDSSSSSDSDNEKSQPSSSSVQSKIYRLFGREKPVHTVLGG  64

Query  267  GKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTF  446
            GKPADIFLWR+KK+S  V+G AT IWVLFELMEYHLL+LVCH LIL+LAI FLWSNA+TF
Sbjct  65   GKPADIFLWRNKKISAGVLGGATAIWVLFELMEYHLLSLVCHCLILSLAILFLWSNATTF  124

Query  447  INKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            INKSPP IP V +P+D  ++VA +LR +INR  AVL
Sbjct  125  INKSPPHIPEVSIPEDVAVSVALSLRYDINRAFAVL  160



>ref|XP_008437352.1| PREDICTED: reticulon-like protein B2 [Cucumis melo]
Length=257

 Score =   188 bits (477),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 125/151 (83%), Gaps = 2/151 (1%)
 Frame = +3

Query  102  AETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGKPAD  281
             E++++KI++K+  HDSSSSDS+DD  D  ++ ++K+KIYRLFGRER VHKV GGGKPAD
Sbjct  16   GESLLDKITEKIHAHDSSSSDSDDDKGD--TSASIKSKIYRLFGRERPVHKVFGGGKPAD  73

Query  282  IFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSP  461
            IFLWRDKK+SG V+G AT  W+LFEL+EYH LTL+CHI + ALA+ FLWSNAS FINKS 
Sbjct  74   IFLWRDKKLSGGVLGGATIAWILFELLEYHFLTLICHIFMAALAVVFLWSNASFFINKSL  133

Query  462  PQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            P IP V +P+D V+ +ASALR+EINR +AVL
Sbjct  134  PHIPQVHIPEDPVIEIASALRVEINRAIAVL  164



>ref|XP_006654676.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=247

 Score =   187 bits (476),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 118/162 (73%), Gaps = 7/162 (4%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MA+H  +     E+VM+ ISDKL  H    S S    +D     AVKAKIYRLFGRE+ V
Sbjct  1    MAEHKEE-----ESVMDTISDKL--HGRGGSSSSSLDSDGERTAAVKAKIYRLFGREKPV  53

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            H VLGGGKPAD+FLWR+KK+S  V+  AT IW+LFE+M+YHLLTL+CH +IL LAI FLW
Sbjct  54   HSVLGGGKPADLFLWRNKKISVGVLAGATAIWLLFEVMDYHLLTLLCHCVILTLAILFLW  113

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNASTFINKSPP IP V +P+D  +NVA +LR EINR  A L
Sbjct  114  SNASTFINKSPPNIPEVRIPEDLAVNVARSLRFEINRGFATL  155



>ref|XP_006374290.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52087.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=263

 Score =   188 bits (477),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 123/163 (75%), Gaps = 3/163 (2%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKL-QGHdssssdseddhadKPSADAVKAKIYRLFGRERH  245
            MA+H G+ +   E V+E ++DK+ +      S S    +D   +DAVK+KI+RLFGRE+ 
Sbjct  10   MAEHEGERER--EPVVESMADKITEKTHDHDSSSSSSDSDDDKSDAVKSKIFRLFGREKP  67

Query  246  VHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFL  425
            VHKVLGGGKPAD+FLWR+KK+S  V+G AT +WV FEL+EYHL+TLVCH+ I +LA+ FL
Sbjct  68   VHKVLGGGKPADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCHLSIFSLAVLFL  127

Query  426  WSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            WSNAS F+NKSPP+IP V+LP+  V  VAS LRIEINR  AVL
Sbjct  128  WSNASNFLNKSPPKIPEVLLPEKWVREVASGLRIEINRGFAVL  170



>ref|NP_001118533.1| reticulon-like protein B5 [Arabidopsis thaliana]
 gb|AEC10652.1| reticulon-like protein B5 [Arabidopsis thaliana]
Length=187

 Score =   185 bits (470),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 120/151 (79%), Gaps = 3/151 (2%)
 Frame = +3

Query  105  ETVMEKISDKLQGHdssssdseddhadKP-SADAVKAKIYRLFGRERHVHKVLGGGKPAD  281
            E++MEKIS+K+  HDSSSS   +    KP S  AVKAKIYR+FGRE+ VHKVLGGGKPAD
Sbjct  13   ESLMEKISEKIHHHDSSSSSESEYE--KPDSPSAVKAKIYRMFGREKPVHKVLGGGKPAD  70

Query  282  IFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSP  461
            +FLWRDKK+SGAV+G AT IWVLFEL+EYHLL+L+CHI ILAL   FLWSNA T INK+ 
Sbjct  71   VFLWRDKKLSGAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNAHTLINKTS  130

Query  462  PQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            PQIP + +P++  L VAS+LR E+N+   +L
Sbjct  131  PQIPEIHVPEEAFLVVASSLRNELNQAFVIL  161



>ref|XP_010035177.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW46473.1| hypothetical protein EUGRSUZ_K00300 [Eucalyptus grandis]
Length=255

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 121/163 (74%), Gaps = 5/163 (3%)
 Frame = +3

Query  72   ADHAGDHDSLAETVMEKISDKLQ--GHdssssdseddhadKPSADAVKAKIYRLFGRERH  245
            ADHAGD +    ++MEK ++K+      S+SS S+ D       D+ K+K+YRLFGRE+ 
Sbjct  3    ADHAGDAEP---SLMEKNTEKIHVPDPPSASSSSDSDDDKPSVVDSAKSKVYRLFGREKP  59

Query  246  VHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFL  425
            VHKVLGGGKPADIFLWRDKKVS  V+G AT IW+LFELMEYHL+TLVCHILI  LAI FL
Sbjct  60   VHKVLGGGKPADIFLWRDKKVSAGVLGVATAIWILFELMEYHLITLVCHILIATLAIIFL  119

Query  426  WSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            W++AST I KSPP IP V LP+  VL VAS LR E NR LA+L
Sbjct  120  WASASTHITKSPPNIPEVQLPEKCVLEVASVLRFEANRGLALL  162



>ref|XP_007218819.1| hypothetical protein PRUPE_ppa010065mg [Prunus persica]
 gb|EMJ20018.1| hypothetical protein PRUPE_ppa010065mg [Prunus persica]
Length=265

 Score =   187 bits (476),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 108/124 (87%), Gaps = 1/124 (1%)
 Frame = +3

Query  186  KPSA-DAVKAKIYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELM  362
            KPS  D+VK+KI+RLFGRE+ VHKVLGGGKPAD+ LWR+KK+S +V+G AT +WV FEL+
Sbjct  49   KPSTHDSVKSKIFRLFGREKPVHKVLGGGKPADVLLWRNKKISASVLGGATVLWVFFELL  108

Query  363  EYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRT  542
            EYHL+TLVCH+LIL+LA+ FLWSNASTFINKSPPQIP V L + TVL++ASALRIE+NR 
Sbjct  109  EYHLITLVCHLLILSLAVFFLWSNASTFINKSPPQIPKVQLSERTVLDLASALRIELNRA  168

Query  543  LAVL  554
              +L
Sbjct  169  FHIL  172



>ref|XP_009368711.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=250

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = +3

Query  186  KPSA-DAVKAKIYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELM  362
            KPS  D+VK+KI+RLFGRE+ VHKVLGGGKPAD+ LWR+KK+S +V+G AT +WV FEL+
Sbjct  34   KPSVQDSVKSKIFRLFGREKPVHKVLGGGKPADVLLWRNKKISASVLGGATVLWVFFELL  93

Query  363  EYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRT  542
            EYHL+TLVCH+LIL+LA+ FLWS ASTFINKSPPQIP V +P+ TVL +ASALRIEIN+ 
Sbjct  94   EYHLITLVCHLLILSLAVFFLWSYASTFINKSPPQIPKVQIPEKTVLELASALRIEINKG  153

Query  543  LAVL  554
              VL
Sbjct  154  FYVL  157



>gb|AFK42129.1| unknown [Medicago truncatula]
Length=199

 Score =   185 bits (470),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 126/167 (75%), Gaps = 5/167 (3%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadK-----PSADAVKAKIYRLFG  233
            MADH    +  +E++++KIS K+  H  SSS S D   DK      S  ++K K++RLFG
Sbjct  1    MADHNEHEEVKSESLLDKISGKIHDHHDSSSSSSDSDNDKKEKKVSSPTSLKNKVFRLFG  60

Query  234  RERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALA  413
            RE+ +H VLGGGKPAD+FLWR+KK+S   +G AT +WVLFEL+EYHLLTL+ H+ ILALA
Sbjct  61   REKPLHNVLGGGKPADVFLWRNKKISATTLGVATALWVLFELLEYHLLTLISHLAILALA  120

Query  414  ISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            + FLWSNASTFINKSPP+IP V +P++ VL +ASA+RIEINR  A+L
Sbjct  121  VLFLWSNASTFINKSPPKIPQVHIPEEPVLQIASAIRIEINRAFAIL  167



>ref|XP_010105716.1| Reticulon-like protein [Morus notabilis]
 gb|EXC05936.1| Reticulon-like protein [Morus notabilis]
Length=264

 Score =   187 bits (475),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 132/163 (81%), Gaps = 7/163 (4%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPS-ADAVKAKIYRLFGRERH  245
            MA+HAG+ +SL    +EKI+DK+ GHDSSSS   DD   KPS  + V+AKI+RLFGRE+ 
Sbjct  1    MAEHAGEPESL----IEKIADKIHGHDSSSSSDSDDD--KPSKVEEVQAKIFRLFGREKP  54

Query  246  VHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFL  425
            +HKVLGGGKPAD+FLWR+KK+S  V+G AT +WVLFEL+EYHL+TLVCHILIL+LA+ FL
Sbjct  55   IHKVLGGGKPADVFLWRNKKLSAGVLGGATILWVLFELLEYHLITLVCHILILSLALLFL  114

Query  426  WSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            WSNAST INKSPPQIP V +P+  VL VAS LR E+N  LAVL
Sbjct  115  WSNASTLINKSPPQIPEVRIPEKIVLEVASVLRAEVNYALAVL  157



>emb|CAN77759.1| hypothetical protein VITISV_034907 [Vitis vinifera]
Length=245

 Score =   186 bits (472),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 120/162 (74%), Gaps = 1/162 (1%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MADHAG+ +S  E+VME I+ KL G+ S SS   +D   K   +AVK+K YRLFGRE+ +
Sbjct  1    MADHAGESESAMESVMEXITAKLHGYXSPSSSDSEDGK-KSLVEAVKSKSYRLFGREKPL  59

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            HKVLGGGKPAD+FLWR+KK+S +V+G AT IWVLFE++EY LL L+CHIL+L+LA  FLW
Sbjct  60   HKVLGGGKPADVFLWRNKKISASVLGCATAIWVLFEMLEYQLLPLLCHILMLSLASLFLW  119

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNAS  I KSPP IP V +P+  V+ + SAL   INR L  L
Sbjct  120  SNASIVIKKSPPNIPEVGVPEKAVMEITSALLYAINRGLTSL  161



>ref|XP_002275520.1| PREDICTED: reticulon-like protein B5 [Vitis vinifera]
 emb|CBI22609.3| unnamed protein product [Vitis vinifera]
Length=254

 Score =   186 bits (472),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 121/162 (75%), Gaps = 1/162 (1%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MADHAG+ +S  E+VME I+ KL G+DS SS   +D   K   +AVK+K YRLFGRE+ +
Sbjct  1    MADHAGESESAMESVMETITAKLHGYDSPSSSDSEDGK-KSLVEAVKSKSYRLFGREKPL  59

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            HKVLGGGKPAD+FLWR+KK+S +V+G AT IWVLFE++EY LL L+CHIL+L+LA  FLW
Sbjct  60   HKVLGGGKPADVFLWRNKKISASVLGCATAIWVLFEMLEYQLLPLLCHILMLSLASLFLW  119

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNAS  I KSPP IP V +P+  V+ + SAL   INR L  L
Sbjct  120  SNASIVIKKSPPNIPEVGVPEKAVMEITSALLYAINRGLTSL  161



>gb|KHG29253.1| Reticulon-like protein B5 [Gossypium arboreum]
Length=251

 Score =   186 bits (472),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 123/163 (75%), Gaps = 5/163 (3%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSAD-AVKAKIYRLFGRERH  245
            MA+      S  E+VMEKI     GHDSSSS   D   +KP++  +VKAKIYRLFGRER 
Sbjct  1    MAEETESKQSAVESVMEKI----HGHDSSSSSDSDSDHEKPASPISVKAKIYRLFGRERP  56

Query  246  VHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFL  425
            +H VLGGGKPAD+FLWR+KK+S  V+G AT IWVLFEL+EYHLLTL+CHI IL LA+ FL
Sbjct  57   LHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLLCHISILCLAVLFL  116

Query  426  WSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            WSN  TFI+K+PP+IP V LP++  L +ASAL IE+N+ L +L
Sbjct  117  WSNVHTFIHKTPPRIPQVHLPEEPFLQIASALTIELNQALKLL  159



>gb|ACJ84486.1| unknown [Medicago truncatula]
 gb|AFK36476.1| unknown [Medicago truncatula]
 gb|KEH21160.1| seed maturation protein [Medicago truncatula]
Length=260

 Score =   186 bits (472),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 126/167 (75%), Gaps = 5/167 (3%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKP-----SADAVKAKIYRLFG  233
            MADH    +  +E++++KIS K+  H  SSS S D   DK      S  ++K K++RLFG
Sbjct  1    MADHNEHEEVKSESLLDKISGKIHDHHDSSSSSSDSDNDKKEKKVSSPTSLKNKVFRLFG  60

Query  234  RERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALA  413
            RE+ +H VLGGGKPAD+FLWR+KK+S   +G AT +WVLFEL+EYHLLTL+ H+ ILALA
Sbjct  61   REKPLHNVLGGGKPADVFLWRNKKISATTLGVATALWVLFELLEYHLLTLISHLAILALA  120

Query  414  ISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            + FLWSNASTFINKSPP+IP V +P++ VL +ASA+RIEINR  A+L
Sbjct  121  VLFLWSNASTFINKSPPKIPQVHIPEEPVLQIASAIRIEINRAFAIL  167



>gb|EAY75742.1| hypothetical protein OsI_03655 [Oryza sativa Indica Group]
Length=253

 Score =   186 bits (471),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 124/166 (75%), Gaps = 9/166 (5%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPS----ADAVKAKIYRLFGR  236
            MA+H  +     ++VMEK+S+KL G  SSSS   DD     S    A A+KAKIYRLFGR
Sbjct  1    MAEHKEE-----QSVMEKLSEKLHGDSSSSSSDSDDDKKGSSSSSSAAAMKAKIYRLFGR  55

Query  237  ERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAI  416
            ER VH VLGGGKPAD+ LWR+KK+SG V+  AT IW+LFE+MEYHLLTLVCH LIL+LA+
Sbjct  56   ERPVHSVLGGGKPADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVCHCLILSLAV  115

Query  417  SFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
             FLWSNASTFI+KSPP IP V +P+D  +N+A +LR EINR  A L
Sbjct  116  LFLWSNASTFIHKSPPNIPEVKIPEDLTVNIALSLRYEINRGFATL  161



>gb|ACU23452.1| unknown [Glycine max]
Length=253

 Score =   186 bits (471),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 124/163 (76%), Gaps = 4/163 (2%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSA-DAVKAKIYRLFGRERH  245
            MA+H    +   E+++EKI    + HD  SS S D   DK SA D+ K+ ++RLFGRE+ 
Sbjct  1    MAEHHEHEEVKGESLLEKIG---KIHDHDSSSSSDSDNDKTSATDSFKSNVFRLFGREKP  57

Query  246  VHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFL  425
            +H VLGGGKPAD+FLWR+KK+S + +G AT IWVLFEL+EYHLLTLVCH LILALA  FL
Sbjct  58   IHHVLGGGKPADVFLWRNKKISASTLGVATAIWVLFELLEYHLLTLVCHFLILALAGLFL  117

Query  426  WSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            WSNASTFINKSPP+IP V +P++ VL  ASALRIEINR  AVL
Sbjct  118  WSNASTFINKSPPKIPQVHIPEEPVLKFASALRIEINRAFAVL  160



>ref|NP_176592.1| reticulon-like protein B3 [Arabidopsis thaliana]
 sp|Q9SH59.1|RTNLC_ARATH RecName: Full=Reticulon-like protein B3; Short=AtRTNLB3 [Arabidopsis 
thaliana]
 gb|AAF24576.1|AC007764_18 F22C12.15 [Arabidopsis thaliana]
 gb|AAL36421.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51418.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE99051.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE34190.1| reticulon-like protein B3 [Arabidopsis thaliana]
Length=255

 Score =   186 bits (471),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 120/150 (80%), Gaps = 1/150 (1%)
 Frame = +3

Query  105  ETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGKPADI  284
            E++MEKIS+K+ GHD SSS S D   DK SA ++K KIYRLFGRE+ +HK+ GGGKPADI
Sbjct  9    ESIMEKISEKIHGHDDSSSSSSDSDDDKNSA-SLKTKIYRLFGREQPLHKLFGGGKPADI  67

Query  285  FLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPP  464
            FLWR+KKVSG V+G AT  W+LFEL+EY+LLTL  HI ILALA+ FLWS+ASTFI+KSP 
Sbjct  68   FLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILALAVLFLWSSASTFIHKSPL  127

Query  465  QIPSVILPQDTVLNVASALRIEINRTLAVL  554
             IP V +P+D VL +AS LRIEINR   VL
Sbjct  128  HIPEVHIPEDVVLQLASGLRIEINRGFTVL  157



>ref|NP_566065.1| reticulon-like protein B5 [Arabidopsis thaliana]
 sp|O82352.1|RTNLE_ARATH RecName: Full=Reticulon-like protein B5; Short=AtRTNLB5 [Arabidopsis 
thaliana]
 gb|AAC62889.1| expressed protein [Arabidopsis thaliana]
 gb|AAK96651.1| At2g46170/T3F17.18 [Arabidopsis thaliana]
 gb|AAL69534.1| At2g46170/T3F17.18 [Arabidopsis thaliana]
 gb|AEC10651.1| reticulon-like protein B5 [Arabidopsis thaliana]
Length=255

 Score =   185 bits (470),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 123/163 (75%), Gaps = 3/163 (2%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKP-SADAVKAKIYRLFGRERH  245
            MA+         E++MEKIS+K+  HDSSSS   +    KP S  AVKAKIYR+FGRE+ 
Sbjct  1    MAEEIEKSVPTEESLMEKISEKIHHHDSSSSSESEYE--KPDSPSAVKAKIYRMFGREKP  58

Query  246  VHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFL  425
            VHKVLGGGKPAD+FLWRDKK+SGAV+G AT IWVLFEL+EYHLL+L+CHI ILAL   FL
Sbjct  59   VHKVLGGGKPADVFLWRDKKLSGAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFL  118

Query  426  WSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            WSNA T INK+ PQIP + +P++  L VAS+LR E+N+   +L
Sbjct  119  WSNAHTLINKTSPQIPEIHVPEEAFLVVASSLRNELNQAFVIL  161



>ref|XP_010541290.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score =   186 bits (471),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 121/151 (80%), Gaps = 1/151 (1%)
 Frame = +3

Query  105  ETVMEKISDKLQ-GHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGKPAD  281
            E++++KIS+K+  G DSSSS  ++D     S  +++AK+YRLFGRE+ VHKVLGGGKPAD
Sbjct  24   ESLLDKISEKIHHGGDSSSSSDDEDEKKASSLSSLQAKVYRLFGREKPVHKVLGGGKPAD  83

Query  282  IFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSP  461
            IF+WR+KK+SG V+G  T +WVLFELM+YHLLTL CHILI+ LA+ FLWSNAS FINKSP
Sbjct  84   IFMWRNKKMSGGVLGGITAVWVLFELMQYHLLTLFCHILIVVLAVLFLWSNASIFINKSP  143

Query  462  PQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            P+IP V +P++ +L +AS LRIEINR    L
Sbjct  144  PKIPEVHIPEEHILQLASGLRIEINRAFTCL  174



>ref|XP_004143883.1| PREDICTED: reticulon-like protein B2-like [Cucumis sativus]
 ref|XP_004170740.1| PREDICTED: reticulon-like protein B2-like [Cucumis sativus]
 gb|KGN50045.1| hypothetical protein Csa_5G151610 [Cucumis sativus]
Length=257

 Score =   185 bits (469),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 124/151 (82%), Gaps = 2/151 (1%)
 Frame = +3

Query  102  AETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGKPAD  281
             E++++KI++K+  HDSSSSDS+DD  D  ++ ++K+KIYRLFGRER VHKV GGGKPAD
Sbjct  16   GESLLDKITEKIHAHDSSSSDSDDDKGD--ASASIKSKIYRLFGRERPVHKVFGGGKPAD  73

Query  282  IFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSP  461
            IFLWRDKK+SG V+G AT  W+LFEL+EYH LTL+CHI + ALA+ FLWSNAS FINKS 
Sbjct  74   IFLWRDKKLSGGVLGGATIAWILFELLEYHFLTLICHIFMAALAVVFLWSNASFFINKSL  133

Query  462  PQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            P IP V +P+  V+ +ASALR+EINR +AVL
Sbjct  134  PHIPQVHIPEGPVVEIASALRVEINRAIAVL  164



>emb|CDY57657.1| BnaC01g15350D [Brassica napus]
Length=275

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = +3

Query  192  SADAVKAKIYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYH  371
            S  ++K+K+YRLFGRE+ VHKVLGGGKPADIF+W+DKK+SG V+G AT  WVLFELMEYH
Sbjct  62   SPSSMKSKVYRLFGREKPVHKVLGGGKPADIFMWKDKKISGGVLGGATAAWVLFELMEYH  121

Query  372  LLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAV  551
            LLTL+CH++I+ LA+ FLWSNA+ FINKSPP+IP V +P++ +L +AS LRIEINR L+ 
Sbjct  122  LLTLLCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGLSS  181

Query  552  L  554
            L
Sbjct  182  L  182



>emb|CDY44123.1| BnaA01g13310D [Brassica napus]
Length=276

 Score =   185 bits (469),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = +3

Query  192  SADAVKAKIYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYH  371
            S  ++K+K+YRLFGRE+ VHKVLGGGKPADIF+W+DKK+SG V+G AT  WVLFELMEYH
Sbjct  63   SPSSMKSKVYRLFGREKPVHKVLGGGKPADIFMWKDKKMSGGVLGGATAAWVLFELMEYH  122

Query  372  LLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAV  551
            LLTL+CH++I+ LA+ FLWSNA+ FINKSPP+IP V +P++ +L +AS LRIEINR L+ 
Sbjct  123  LLTLLCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGLSS  182

Query  552  L  554
            L
Sbjct  183  L  183



>ref|XP_003568063.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=244

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 116/162 (72%), Gaps = 10/162 (6%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MA+H        E+VM+KIS+KL       S S  D     +A AVKAKIYRLFGRE+ V
Sbjct  1    MAEHK------EESVMDKISEKLH----GGSSSGSDDESSSAAAAVKAKIYRLFGREKPV  50

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            H VLGGGKPAD+FLWR+KK+SG V+  AT IW+LFE+MEYHLLTL+CH  IL L I FLW
Sbjct  51   HSVLGGGKPADLFLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLLCHCFILTLGILFLW  110

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNAS FINKSPP IP V +P+D  +NVA +LR EINR  A L
Sbjct  111  SNASAFINKSPPNIPEVRIPEDLAVNVARSLRYEINRGFASL  152



>gb|KJB37517.1| hypothetical protein B456_006G208500 [Gossypium raimondii]
Length=210

 Score =   182 bits (463),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 114/162 (70%), Gaps = 7/162 (4%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            M +H   H+   E++M K+++K+ GHDSSS    D    KPS  ++KAK++RLFGRER V
Sbjct  1    MGEHEEKHE---ESLMVKLAEKIHGHDSSSDSDID----KPSESSIKAKVFRLFGRERSV  53

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            H V GGGK AD FLWR+KK+S  V+G AT IWVLFEL+EYHLLTLVCH+LI AL I FLW
Sbjct  54   HHVFGGGKSADTFLWRNKKISAGVLGVATVIWVLFELLEYHLLTLVCHVLIFALVILFLW  113

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNA  FINKSP  IP V +P+D V+  A ALR E N    V 
Sbjct  114  SNAYAFINKSPLCIPEVHIPKDPVIEFAEALRFETNLAFTVF  155



>ref|XP_006294850.1| hypothetical protein CARUB_v10023902mg [Capsella rubella]
 gb|EOA27748.1| hypothetical protein CARUB_v10023902mg [Capsella rubella]
Length=255

 Score =   184 bits (466),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 123/163 (75%), Gaps = 3/163 (2%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKP-SADAVKAKIYRLFGRERH  245
            MA+         E++MEKI++K+  HDSSSS   +    KP S  AVKAKIYR+FGRE+ 
Sbjct  1    MAEEIEKSVPAEESLMEKIAEKIHHHDSSSSSESEYE--KPDSPSAVKAKIYRMFGREKP  58

Query  246  VHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFL  425
            VHKVLGGGKPAD+FLWRDKK+S AV+G AT IWVLFEL+EYHLL+L+CHI ILAL   FL
Sbjct  59   VHKVLGGGKPADVFLWRDKKLSAAVLGVATVIWVLFELVEYHLLSLLCHISILALGGLFL  118

Query  426  WSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            WSNA TFINK+ PQIP + +P++  L +AS+LR E+N+   +L
Sbjct  119  WSNAHTFINKTSPQIPEIHVPEEAFLVIASSLRNELNQAFVIL  161



>ref|XP_008343772.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=251

 Score =   184 bits (466),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 106/124 (85%), Gaps = 1/124 (1%)
 Frame = +3

Query  186  KPSA-DAVKAKIYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELM  362
            KPSA DAVK+KI+RLFGRE+ VHKVLGGGKPAD+ LWR+KK+S +V+  AT +WV FEL+
Sbjct  35   KPSARDAVKSKIFRLFGREKPVHKVLGGGKPADVLLWRNKKISASVLAGATVLWVFFELL  94

Query  363  EYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRT  542
            EYHL+TLVCH+LIL+LA+ +LWSNAS FINKS PQIP V +P+ TVL +ASALRIE+N+ 
Sbjct  95   EYHLITLVCHLLILSLAVFYLWSNASNFINKSQPQIPKVQIPEKTVLELASALRIELNKG  154

Query  543  LAVL  554
              VL
Sbjct  155  FYVL  158



>ref|XP_009416410.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=251

 Score =   183 bits (465),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 123/164 (75%), Gaps = 8/164 (5%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPS--ADAVKAKIYRLFGRER  242
            MA+H        ET++E+I++K+ G   SSS   DD   K S  A+AVK+KIY LFGRE+
Sbjct  1    MAEHG------EETLIEQINEKIHGDGDSSSSDSDDEKSKASVVAEAVKSKIYHLFGREK  54

Query  243  HVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF  422
             VH++LGGGKPAD+FLW++KK S  V+G AT IW+LFELMEYHLLTLVCH LIL+LAI F
Sbjct  55   PVHQILGGGKPADVFLWKNKKASAVVLGGATAIWILFELMEYHLLTLVCHCLILSLAILF  114

Query  423  LWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            LWSNA+T INKSPP IP V +P+D  +N++ +L  EINR  +VL
Sbjct  115  LWSNATTLINKSPPHIPVVSIPEDLAVNISRSLTYEINRGFSVL  158



>ref|XP_009142682.1| PREDICTED: reticulon-like protein B5 [Brassica rapa]
 emb|CDX79993.1| BnaA05g01630D [Brassica napus]
Length=251

 Score =   183 bits (465),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 119/151 (79%), Gaps = 5/151 (3%)
 Frame = +3

Query  105  ETVMEKISDKLQGHdssssdseddhadKP-SADAVKAKIYRLFGRERHVHKVLGGGKPAD  281
            +++M+KIS+K+  HDSSS    +    KP S  AVKAKIYRLFGRE+ VHKVLGGGKPAD
Sbjct  13   QSLMDKISEKIHHHDSSSDSEYE----KPDSPSAVKAKIYRLFGREKPVHKVLGGGKPAD  68

Query  282  IFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSP  461
            +FLWRDKK+S AV+G AT IWVLFEL+EYHLL+L+CH+ ILAL   FLWSNA TFI KSP
Sbjct  69   VFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHVSILALGGLFLWSNAHTFIKKSP  128

Query  462  PQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            PQIP + +P++  L +AS+LR E+N+   +L
Sbjct  129  PQIPEIHVPEEPFLLIASSLRNELNQGFVIL  159



>emb|CDY42012.1| BnaC04g00900D [Brassica napus]
Length=251

 Score =   183 bits (465),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 119/151 (79%), Gaps = 5/151 (3%)
 Frame = +3

Query  105  ETVMEKISDKLQGHdssssdseddhadKP-SADAVKAKIYRLFGRERHVHKVLGGGKPAD  281
            +++M+KIS+K+  HDSSS    +    KP S  AVKAKIYRLFGRE+ VHKVLGGGKPAD
Sbjct  13   QSLMDKISEKIHHHDSSSDSEYE----KPDSPSAVKAKIYRLFGREKPVHKVLGGGKPAD  68

Query  282  IFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSP  461
            +FLWRDKK+S AV+G AT IWVLFEL+EYHLL+L+CH+ ILAL   FLWSNA TFI KSP
Sbjct  69   VFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHVSILALGGLFLWSNAHTFIKKSP  128

Query  462  PQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            PQIP + +P++  L +AS+LR E+N+   +L
Sbjct  129  PQIPEIHVPEEPFLLIASSLRNELNQGFVIL  159



>emb|CDY08353.1| BnaC09g12430D [Brassica napus]
Length=250

 Score =   183 bits (464),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 119/150 (79%), Gaps = 3/150 (2%)
 Frame = +3

Query  105  ETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGKPADI  284
            E++MEKI++K+ GHD+SSS   DD   +  A ++K KIYRLFGRE+ VHKV GGGKPADI
Sbjct  9    ESIMEKIAEKIHGHDNSSSSDSDD---EKKASSIKTKIYRLFGREKPVHKVFGGGKPADI  65

Query  285  FLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPP  464
            FLWR+KKVSG V+G AT  W+LFEL +Y+LLTL  HI ILALA+ FLWS+ASTFI+K PP
Sbjct  66   FLWRNKKVSGGVLGAATLSWILFELFQYNLLTLFGHISILALAVLFLWSSASTFIHKKPP  125

Query  465  QIPSVILPQDTVLNVASALRIEINRTLAVL  554
            +IP V +P++ VL +AS LRIEINR   +L
Sbjct  126  RIPEVHIPEEVVLQLASGLRIEINRGFTLL  155



>ref|XP_008354289.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=251

 Score =   183 bits (464),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 106/124 (85%), Gaps = 1/124 (1%)
 Frame = +3

Query  186  KPSA-DAVKAKIYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELM  362
            KPSA DAVK+KI+RLFGRE+ VHKVLGGGKPAD+ LWR+KK+S +V+  AT +WV FEL+
Sbjct  35   KPSARDAVKSKIFRLFGREKPVHKVLGGGKPADVLLWRNKKISASVLAGATVLWVFFELL  94

Query  363  EYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRT  542
            EYHL+TLVCH+LIL+LA+ +LWSNAS FINKS PQIP V +P+ TVL +ASALRIE+N+ 
Sbjct  95   EYHLITLVCHLLILSLAVFYLWSNASNFINKSQPQIPXVQIPEKTVLELASALRIELNKG  154

Query  543  LAVL  554
              VL
Sbjct  155  FYVL  158



>gb|EMS62606.1| Reticulon-like protein B1 [Triticum urartu]
Length=248

 Score =   183 bits (464),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 116/150 (77%), Gaps = 1/150 (1%)
 Frame = +3

Query  105  ETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGKPADI  284
            E+VM+KI++K  G  SSSS S+D+     S+ +VKAKIYRLFGRE+ VH VLGGGKPAD+
Sbjct  7    ESVMDKITEKFHGGSSSSSSSDDEGRSG-SSSSVKAKIYRLFGREKPVHSVLGGGKPADL  65

Query  285  FLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPP  464
            FLWR+KK+SG V+  AT IW+LFE++EYHLLTL+CH  IL L I FLWSNAS F+NK PP
Sbjct  66   FLWRNKKISGGVLAGATAIWLLFEVLEYHLLTLLCHGFILTLGILFLWSNASAFVNKCPP  125

Query  465  QIPSVILPQDTVLNVASALRIEINRTLAVL  554
             IP V +P+D  +NVA +LR EINR  A L
Sbjct  126  NIPEVKIPEDLAVNVARSLRYEINRGFASL  155



>ref|XP_006391670.1| hypothetical protein EUTSA_v10023649mg [Eutrema salsugineum]
 gb|ESQ28956.1| hypothetical protein EUTSA_v10023649mg [Eutrema salsugineum]
Length=256

 Score =   183 bits (464),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 118/152 (78%), Gaps = 2/152 (1%)
 Frame = +3

Query  105  ETVMEKISDKLQGHdssssdseddhadKPSAD--AVKAKIYRLFGRERHVHKVLGGGKPA  278
            E++MEKI++K+ GHD SSS S D   +K SA   ++K KIYRLFGRE+ VHKV GGGKPA
Sbjct  9    ESIMEKIAEKIHGHDGSSSSSSDSDDEKKSASPSSMKKKIYRLFGREKPVHKVFGGGKPA  68

Query  279  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKS  458
            DIFLWR+KKVSG V+G AT  WVLFEL+EY+LLTL  HI ILALA  FLWS+A TFI+K+
Sbjct  69   DIFLWRNKKVSGGVLGVATISWVLFELLEYNLLTLFGHITILALACLFLWSSAITFIHKT  128

Query  459  PPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            PP IP + +P++ VL +AS LRIEINR    L
Sbjct  129  PPHIPEIHIPEEVVLQLASGLRIEINRGFTTL  160



>ref|XP_006396933.1| hypothetical protein EUTSA_v10028886mg [Eutrema salsugineum]
 dbj|BAJ34499.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ38386.1| hypothetical protein EUTSA_v10028886mg [Eutrema salsugineum]
Length=265

 Score =   183 bits (464),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 118/150 (79%), Gaps = 1/150 (1%)
 Frame = +3

Query  105  ETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGKPADI  284
            E++MEKIS+K+  H   SS S     D+    ++K+K+YRLFGRER VHKVLGGGKPADI
Sbjct  24   ESLMEKISEKVH-HKGDSSSSSSSSDDENEKKSLKSKVYRLFGRERPVHKVLGGGKPADI  82

Query  285  FLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPP  464
            F+W++KK+SG V G AT  WVLFEL+EYHLLTL+CH++I+ LA+ FLWSNA+ FI+KSPP
Sbjct  83   FMWKNKKMSGGVFGGATVAWVLFELIEYHLLTLLCHVMIVLLAVLFLWSNATMFIHKSPP  142

Query  465  QIPSVILPQDTVLNVASALRIEINRTLAVL  554
            +IP V +P++ +L +AS LRIEINR  + L
Sbjct  143  KIPEVHIPEEPLLQLASGLRIEINRGFSSL  172



>gb|KFK40472.1| hypothetical protein AALP_AA2G000200 [Arabis alpina]
Length=254

 Score =   182 bits (463),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 118/150 (79%), Gaps = 0/150 (0%)
 Frame = +3

Query  105  ETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGKPADI  284
            E++MEKIS+K+ GH  SSS S D   +K S  ++K KIYRLFGRE+ VHKV GGGKPADI
Sbjct  9    ESLMEKISEKIHGHGDSSSSSSDSDDEKKSDSSLKTKIYRLFGREKPVHKVFGGGKPADI  68

Query  285  FLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPP  464
            FLWR+KKVSG V+G AT  W+LFEL+EY+LLTL  H+ ILALA+ FLWS+A+TFI+K+PP
Sbjct  69   FLWRNKKVSGGVLGAATISWILFELLEYNLLTLFGHVSILALAVLFLWSSATTFIHKTPP  128

Query  465  QIPSVILPQDTVLNVASALRIEINRTLAVL  554
             IP + +P+  VL +AS LRIEINR   VL
Sbjct  129  HIPEIHIPEKIVLELASGLRIEINRGFTVL  158



>ref|XP_009137263.1| PREDICTED: reticulon-like protein B1 [Brassica rapa]
Length=276

 Score =   183 bits (465),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  AVKAKIYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLT  380
            ++K+K+YRLFGRE+ VHKVLGGGKPADIF+W+DKK+SG V+G AT  WVLFELMEYHLLT
Sbjct  66   SMKSKVYRLFGREKPVHKVLGGGKPADIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLT  125

Query  381  LVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            L+CH++I+ LA+ FLWSNA+ FINKSPP+IP V +P++ +L +AS LRIEINR L+ L
Sbjct  126  LLCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGLSSL  183



>ref|XP_010544774.1| PREDICTED: reticulon-like protein B6 [Tarenaya hassleriana]
Length=253

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 123/162 (76%), Gaps = 1/162 (1%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MAD         E+++EKI++K+  HDSSSS   D+   + S  AVK KIYRLFGRE+ V
Sbjct  1    MADEMEKSAPAEESLLEKIAEKIHDHDSSSSSDSDNEKME-SPMAVKDKIYRLFGREKPV  59

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            HKV GGGKPAD+ LWRDKK+S AV+G AT IWVLFEL+EYHLL+LVCHILILAL++ FLW
Sbjct  60   HKVFGGGKPADVLLWRDKKLSAAVLGTATAIWVLFELVEYHLLSLVCHILILALSVLFLW  119

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNA +FINKSPPQIP + L ++  L VASALR E+N+   VL
Sbjct  120  SNAHSFINKSPPQIPEIHLHEEHFLLVASALRNEVNQAFTVL  161



>ref|XP_002880222.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56481.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
Length=255

 Score =   182 bits (463),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 122/163 (75%), Gaps = 3/163 (2%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKP-SADAVKAKIYRLFGRERH  245
            MA+         E++MEKI++K+  HDSSSS   +    KP S  AVKAKIYRLFGRE+ 
Sbjct  1    MAEEIEKSVPAEESLMEKIAEKIHHHDSSSSSESEYE--KPDSPSAVKAKIYRLFGREKP  58

Query  246  VHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFL  425
            VHKVLGGGKPAD+FLWRDKK+S AV+G AT IWVLFEL+EYHLL+L+CHI ILAL   FL
Sbjct  59   VHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFL  118

Query  426  WSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            WSN  TFINK+ PQIP + +P++  L +AS+LR E+N+   +L
Sbjct  119  WSNVHTFINKASPQIPEIHVPEEAFLVIASSLRNELNQAFVIL  161



>gb|KFK37395.1| hypothetical protein AALP_AA4G251600 [Arabis alpina]
Length=249

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 119/163 (73%), Gaps = 7/163 (4%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKP-SADAVKAKIYRLFGRERH  245
            MA+       + E++MEKI      H   SS S +   +KP S  AVKAKIYRLFGRE+ 
Sbjct  1    MAEEIEKSVEVEESLMEKI------HHHDSSSSSESEYEKPDSPSAVKAKIYRLFGREKP  54

Query  246  VHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFL  425
            VHKVLGGGKPAD+FLWRDKK+S AV+G AT IWVLFEL+EYHLL+L+CHI ILAL   FL
Sbjct  55   VHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFL  114

Query  426  WSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            WSNA TFI KSPPQIP + +P++  L +AS+LR E+N+   +L
Sbjct  115  WSNAHTFIKKSPPQIPEIHVPEEAFLVIASSLRNEVNQAFVIL  157



>gb|KHG15548.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=248

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 115/162 (71%), Gaps = 7/162 (4%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            M +H   H+    ++MEK+++K+ GHDSSS    D    KPS  ++KAK++RLFGRER V
Sbjct  1    MGEHEEKHEG---SLMEKLAEKIHGHDSSSDSDND----KPSESSIKAKVFRLFGRERSV  53

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            H V GGGK AD FLWR+KK+S  V+G AT IWVLFEL+EYHLLTLVCH+LI AL I FLW
Sbjct  54   HHVFGGGKSADTFLWRNKKISAGVLGVATVIWVLFELLEYHLLTLVCHVLIFALVILFLW  113

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNA  FINKSP  IP V +P+D V+  A ALR E N    VL
Sbjct  114  SNAYAFINKSPLCIPEVHIPKDPVIEFAEALRFESNLAFTVL  155



>emb|CDY25557.1| BnaC09g11820D [Brassica napus]
Length=251

 Score =   182 bits (461),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 119/150 (79%), Gaps = 3/150 (2%)
 Frame = +3

Query  105  ETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGKPADI  284
            E++MEKI++K+ GHD+SSS   DD   +  A ++K KIYRLFGRE+ VHKV GGGKPADI
Sbjct  9    ESIMEKIAEKIHGHDNSSSSDSDD---EKKASSIKTKIYRLFGREKPVHKVFGGGKPADI  65

Query  285  FLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPP  464
            FLWR+KKVSG V+G AT  W+LFEL++Y+LLTL  HI ILALA+ FLWS+A+TFI+K+PP
Sbjct  66   FLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHISILALAVLFLWSSATTFIHKTPP  125

Query  465  QIPSVILPQDTVLNVASALRIEINRTLAVL  554
             IP V +P+D VL +AS LR EINR   +L
Sbjct  126  HIPEVHIPEDVVLQLASGLRNEINRGFTLL  155



>ref|XP_009375555.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
 ref|XP_009375556.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=264

 Score =   182 bits (461),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = +3

Query  186  KPSA-DAVKAKIYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELM  362
            KPSA D+VK+KI+RLFGRE+ VHKVLGGGKPAD+FLWR+KK+S +V+  AT +WV FEL+
Sbjct  48   KPSARDSVKSKIFRLFGREKPVHKVLGGGKPADVFLWRNKKISASVLAGATVLWVFFELL  107

Query  363  EYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRT  542
            EYHL+TLVCH+LI  LA+ +LWSNAS FINKS PQIP V +P+ TVL +ASALRIE+N+ 
Sbjct  108  EYHLITLVCHLLITFLAVFYLWSNASNFINKSQPQIPKVQIPEKTVLELASALRIELNKG  167

Query  543  LAVL  554
              VL
Sbjct  168  FYVL  171



>gb|AFK48295.1| unknown [Lotus japonicus]
Length=193

 Score =   179 bits (455),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 115/151 (76%), Gaps = 4/151 (3%)
 Frame = +3

Query  102  AETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGKPAD  281
             E++++KISDKL GHDSSS    +    KPS  +VK KI+RLFGRE+ +H VLGGGKPAD
Sbjct  16   GESLLDKISDKLHGHDSSSDSDSE----KPSLSSVKQKIFRLFGREKPLHSVLGGGKPAD  71

Query  282  IFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSP  461
            + LW++KKVS   +G AT +W+ FEL+EYHLLTLVCHILIL++ + FLWSNA T ++K+P
Sbjct  72   VLLWKNKKVSAGALGVATAVWLFFELLEYHLLTLVCHILILSITLLFLWSNAHTLLHKAP  131

Query  462  PQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            P+IP   LP++  L +ASALRIEIN   A L
Sbjct  132  PRIPVFHLPEEPFLEIASALRIEINHGFAAL  162



>emb|CDY34396.1| BnaA09g11380D [Brassica napus]
Length=251

 Score =   181 bits (459),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 120/150 (80%), Gaps = 3/150 (2%)
 Frame = +3

Query  105  ETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGKPADI  284
            E++MEKI++K+ GHD+SSS   DD   +  A ++K KI+RLFGRE+ VHKV GGGKPADI
Sbjct  9    ESIMEKIAEKIHGHDNSSSSDSDD---EKKASSIKTKIFRLFGREKPVHKVFGGGKPADI  65

Query  285  FLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPP  464
            FLWR+KKVSG V+G AT  W+LFEL++Y+LLTL  H+ ILALA+ FLWS+A+TFI+K+PP
Sbjct  66   FLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHVSILALAVLFLWSSATTFIHKTPP  125

Query  465  QIPSVILPQDTVLNVASALRIEINRTLAVL  554
             IP V +P++ VL +AS LRIEINR   +L
Sbjct  126  HIPEVHIPEEVVLQLASGLRIEINRGFTIL  155



>ref|XP_010439153.1| PREDICTED: reticulon-like protein B1 isoform X2 [Camelina sativa]
Length=199

 Score =   179 bits (455),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +3

Query  204  VKAKIYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTL  383
            +++K+YRLFGRE+ VHKVLGGGKPADIF+W++KK+SG V+G AT  WVLFELMEYHLLTL
Sbjct  67   MQSKVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTL  126

Query  384  VCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            +CH++I+ LA+ FLWSNA+ FINKSPP+IP V +P++ +L +AS LRIEINR  + L
Sbjct  127  ICHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSSL  183



>ref|XP_006644671.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=253

 Score =   181 bits (459),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 121/166 (73%), Gaps = 9/166 (5%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAK----IYRLFGR  236
            MA+H  +     ++VMEK+S+KL G  SSSS   DD     S+ +  A     IYRLFGR
Sbjct  1    MAEHKEE-----QSVMEKLSEKLHGDSSSSSSDSDDEKKGSSSSSSAAAVKAKIYRLFGR  55

Query  237  ERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAI  416
            ER VH VLGGGKPAD+ LWR+KK+SG V+  AT IW+LFE+MEYHLLTLVCH LIL+LA+
Sbjct  56   ERPVHSVLGGGKPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVCHCLILSLAV  115

Query  417  SFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
             FLWSNASTFINKSPP IP V +P+D  +N+A +LR EINR  A L
Sbjct  116  LFLWSNASTFINKSPPNIPEVKIPEDLTVNIALSLRYEINRGFATL  161



>emb|CDP08746.1| unnamed protein product [Coffea canephora]
Length=263

 Score =   181 bits (459),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 130/170 (76%), Gaps = 8/170 (5%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGH------dssssdseddhadKP--SADAVKAKIYR  224
            MADHA D D   ET++EK ++K+ G        SS SDSE     KP  S  +VK KI+R
Sbjct  1    MADHAEDLDKKEETLIEKPAEKVHGDHDSSSSASSESDSEKKVKSKPASSPTSVKDKIFR  60

Query  225  LFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILIL  404
            LFGRE+ VH+V GGGKPAD+FLWR+K++S AV+G AT +WVLFEL+EYHLLTLVCHILIL
Sbjct  61   LFGREKPVHQVFGGGKPADVFLWRNKRISAAVLGGATAVWVLFELLEYHLLTLVCHILIL  120

Query  405  ALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            ALAI FLWSNA+TFINKSPP+IP V L ++  L VA+A+R EINR LAVL
Sbjct  121  ALAILFLWSNATTFINKSPPRIPEVRLSEEPFLQVAAAVRFEINRALAVL  170



>gb|EMT06999.1| Reticulon-like protein B1 [Aegilops tauschii]
Length=248

 Score =   181 bits (458),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 120/162 (74%), Gaps = 2/162 (1%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MA+H    + +AE++M+KISDK  G DSSSS S+ D   K  A  VKAKIYRLFGRE+ V
Sbjct  1    MAEH--KEEPVAESMMDKISDKFHGGDSSSSSSDSDDDKKGPAAGVKAKIYRLFGREKPV  58

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            H VLGGGKPAD+ LWR+KKVSG V+  AT IW+LFE+MEYHLLTLV H LIL+LA  FL+
Sbjct  59   HAVLGGGKPADLVLWRNKKVSGGVLAGATAIWLLFEVMEYHLLTLVGHCLILSLATLFLY  118

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SN   FI+KSPP IP V +P+D  +N+A +LR EINR    L
Sbjct  119  SNVCIFIHKSPPNIPEVKIPEDMTVNIALSLRHEINRGFFTL  160



>ref|XP_009406786.1| PREDICTED: reticulon-like protein B1 isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406787.1| PREDICTED: reticulon-like protein B1 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=252

 Score =   180 bits (457),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 123/164 (75%), Gaps = 7/164 (4%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPS--ADAVKAKIYRLFGRER  242
            MA+HA   ++L E V EKI D   G DSSSS   DD   K S   +AVK+KI RLFGRE+
Sbjct  1    MAEHA--EETLIEQVTEKIRD---GVDSSSSSDSDDEKSKASVVTEAVKSKINRLFGREK  55

Query  243  HVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF  422
             VH++LGGGKPAD+FLW++KK S AV+G AT IW+ FELMEYHLLTL CH LIL+LAI F
Sbjct  56   PVHQILGGGKPADVFLWKNKKASAAVLGGATAIWIFFELMEYHLLTLFCHCLILSLAIIF  115

Query  423  LWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            LWSNA+  INKSPP IP V +P++ V+++A +LR EINR  AVL
Sbjct  116  LWSNATFLINKSPPHIPVVSIPENLVVDIALSLRYEINRGFAVL  159



>ref|XP_010669728.1| PREDICTED: reticulon-like protein B4 [Beta vulgaris subsp. vulgaris]
Length=285

 Score =   181 bits (460),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +3

Query  204  VKAKIYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTL  383
            V+AKIYRLFGRE+ VHKVLGGGKPAD+FLWR+KK+SG+V+  AT IW+LFEL+EYHLLTL
Sbjct  76   VQAKIYRLFGREKPVHKVLGGGKPADVFLWRNKKISGSVLASATAIWILFELLEYHLLTL  135

Query  384  VCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            +CH LI +LA+ FLW+NASTFINKSPP IP VILP+  +L   + LR E+NR LA+L
Sbjct  136  ICHSLIFSLAVLFLWANASTFINKSPPHIPEVILPEKPILEAVAGLRHELNRGLAML  192



>ref|XP_010924771.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=252

 Score =   180 bits (457),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 123/154 (80%), Gaps = 1/154 (1%)
 Frame = +3

Query  93   DSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGK  272
            +S+ E+VMEKI +K    DSSSSDS+++ +   S+  VK++IYRLFGRE+ VH VLGGG 
Sbjct  7    ESVGESVMEKIMEKFHDDDSSSSDSDNEKSKP-SSSPVKSQIYRLFGREKPVHTVLGGGT  65

Query  273  PADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFIN  452
            PAD+FLWR+KK+S  V+G AT IWVLFELMEYHLL LVCH LIL+LAI FLWSNASTFI+
Sbjct  66   PADVFLWRNKKISAGVLGGATAIWVLFELMEYHLLALVCHCLILSLAILFLWSNASTFIH  125

Query  453  KSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            KSPP+IP V +P+D  +NVA +LR EINR   VL
Sbjct  126  KSPPRIPEVSIPEDVAVNVALSLRYEINRGFTVL  159



>gb|ACF87936.1| unknown [Zea mays]
Length=208

 Score =   179 bits (453),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +3

Query  204  VKAKIYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTL  383
            +KAKIYRLFGRER VH VLGGGKPAD+ LWR+KK+SG V+  AT IW+LFE+MEYHLLTL
Sbjct  1    MKAKIYRLFGRERPVHSVLGGGKPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTL  60

Query  384  VCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            VCH LI++LAI FLWSNAS+FINKSPP IP V +P+D  +NVA  LR EINR  A L
Sbjct  61   VCHCLIVSLAILFLWSNASSFINKSPPNIPEVKIPEDVSVNVALTLRYEINRGFATL  117



>gb|EMS49910.1| Reticulon-like protein B3 [Triticum urartu]
Length=327

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 121/162 (75%), Gaps = 2/162 (1%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MA+H    + +AE++M+KISDK  G DSSSS S+ D   K SA  VKAKIYRLFGRE+ V
Sbjct  1    MAEH--KEEPVAESMMDKISDKFHGGDSSSSSSDSDDEKKGSAAGVKAKIYRLFGREKPV  58

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            H VLGGGKPAD+ LWR+KKVSG V+  AT IW+LFE+MEYHLLTLV H LIL+LA  FL+
Sbjct  59   HAVLGGGKPADLVLWRNKKVSGGVLAGATAIWLLFEVMEYHLLTLVGHCLILSLATLFLY  118

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SN   FI+KSPP IP V +P+D  +N+A +LR EINR    L
Sbjct  119  SNVCIFIHKSPPNIPEVKIPEDMTVNIALSLRHEINRGFFTL  160



>ref|XP_010529625.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score =   181 bits (458),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 120/151 (79%), Gaps = 1/151 (1%)
 Frame = +3

Query  105  ETVMEKISDKLQ-GHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGKPAD  281
            E++++KIS+K+  G DSSSS  ++D     S  ++KAK+YRLFGRE+ VHKVLGGGKPAD
Sbjct  24   ESLLDKISEKIHHGSDSSSSSDDEDEKKASSPSSLKAKVYRLFGREKPVHKVLGGGKPAD  83

Query  282  IFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSP  461
            IF+WR+KK+S +V+G  T +WVLFEL EYHLLTL+CH+LI  +A+ FLWSNAS FI+KSP
Sbjct  84   IFMWRNKKMSASVLGGITAVWVLFELAEYHLLTLLCHVLIAVIAVLFLWSNASMFIHKSP  143

Query  462  PQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            P+IP V +P++ +L +AS LRIEINR    L
Sbjct  144  PKIPEVHIPEEPILQLASGLRIEINRAFTCL  174



>dbj|BAJ89699.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=257

 Score =   180 bits (456),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 118/164 (72%), Gaps = 2/164 (1%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssds--eddhadKPSADAVKAKIYRLFGRER  242
            M++      S  E++M+KI++K  G  SSSS S  E   A   S+ +VKAKIYRLFGRE+
Sbjct  1    MSEQGAGQGSKEESLMDKITEKFHGSSSSSSSSDDEAGRAAGSSSSSVKAKIYRLFGREK  60

Query  243  HVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF  422
             VH VLGGGKPAD+ LWR+KK+SG V+  AT IW+LFE++EYHLLTL+CH  IL L I F
Sbjct  61   PVHSVLGGGKPADLLLWRNKKISGGVLAGATAIWLLFEVLEYHLLTLLCHGFILTLGILF  120

Query  423  LWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            LWSNAS F+NK PP IP V +P+D  +NVA +LR EINR  A L
Sbjct  121  LWSNASAFVNKCPPNIPEVKIPEDLAVNVARSLRYEINRGFASL  164



>gb|AFK41983.1| unknown [Medicago truncatula]
Length=237

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +3

Query  192  SADAVKAKIYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYH  371
            S  ++K K++RLFGRE+ +H VLGGGKPAD+FLWR+KK+S   +G AT +WVLFEL+EYH
Sbjct  24   SPTSLKNKVFRLFGREKPLHNVLGGGKPADVFLWRNKKISATTLGVATALWVLFELLEYH  83

Query  372  LLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAV  551
            LLTL+ H+ ILALA+ FLWSNASTFINKSPP+IP V +P++ VL +ASA+RIEINR  A+
Sbjct  84   LLTLISHLAILALAVLFLWSNASTFINKSPPKIPQVHIPEEPVLQIASAIRIEINRAFAI  143

Query  552  L  554
            L
Sbjct  144  L  144



>ref|XP_010418453.1| PREDICTED: reticulon-like protein B3 [Camelina sativa]
 ref|XP_010473656.1| PREDICTED: reticulon-like protein B3 isoform X1 [Camelina sativa]
 ref|XP_010473657.1| PREDICTED: reticulon-like protein B3 isoform X2 [Camelina sativa]
Length=254

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 116/150 (77%), Gaps = 0/150 (0%)
 Frame = +3

Query  105  ETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGKPADI  284
            E++MEKI++K+ GH  SSS S  D  D   + ++K K+YRLFGRE+ VHKV GGGKPADI
Sbjct  9    ESIMEKIAEKIHGHGDSSSSSSSDSDDDKKSSSLKTKVYRLFGREQPVHKVFGGGKPADI  68

Query  285  FLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPP  464
            FLWR+KKVSG V+G AT  W+LFEL+EY+LLTL  HI IL LA+ FLWS+ASTFI+K+ P
Sbjct  69   FLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILTLAVLFLWSSASTFIHKTTP  128

Query  465  QIPSVILPQDTVLNVASALRIEINRTLAVL  554
             IP V +P++ VL +AS LRIEINR   VL
Sbjct  129  HIPEVHIPEEVVLQLASGLRIEINRGFTVL  158



>ref|XP_010473658.1| PREDICTED: reticulon-like protein B3 isoform X3 [Camelina sativa]
Length=267

 Score =   180 bits (456),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 116/150 (77%), Gaps = 0/150 (0%)
 Frame = +3

Query  105  ETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGKPADI  284
            E++MEKI++K+ GH  SSS S  D  D   + ++K K+YRLFGRE+ VHKV GGGKPADI
Sbjct  22   ESIMEKIAEKIHGHGDSSSSSSSDSDDDKKSSSLKTKVYRLFGREQPVHKVFGGGKPADI  81

Query  285  FLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPP  464
            FLWR+KKVSG V+G AT  W+LFEL+EY+LLTL  HI IL LA+ FLWS+ASTFI+K+ P
Sbjct  82   FLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILTLAVLFLWSSASTFIHKTTP  141

Query  465  QIPSVILPQDTVLNVASALRIEINRTLAVL  554
             IP V +P++ VL +AS LRIEINR   VL
Sbjct  142  HIPEVHIPEEVVLQLASGLRIEINRGFTVL  171



>emb|CDY52012.1| BnaC06g42920D [Brassica napus]
Length=254

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 121/162 (75%), Gaps = 0/162 (0%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MA+ +       E++MEKI++K+  H  SSS S+ DH    S  A+KAKIYRLFGRE+ V
Sbjct  1    MAEESEKPVHAEESLMEKIAEKIHDHHDSSSSSDSDHEKPESPSALKAKIYRLFGREKPV  60

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            HKVLGGG PAD+FLWRDKK+S AV+G AT IWVLFEL+EYHLL+LVCHILI +LA  FLW
Sbjct  61   HKVLGGGLPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLVCHILIFSLAAMFLW  120

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNA  F+ KSPP+IP V + ++  L +ASALR E+N+   +L
Sbjct  121  SNAHAFMKKSPPKIPEVHVKEEHFLLIASALRNELNQAFVIL  162



>ref|XP_006413534.1| hypothetical protein EUTSA_v10025959mg [Eutrema salsugineum]
 gb|ESQ54987.1| hypothetical protein EUTSA_v10025959mg [Eutrema salsugineum]
Length=222

 Score =   178 bits (452),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +3

Query  204  VKAKIYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTL  383
            +++K+YRLFGRE+ VHKVLGGGKPADIF+W++KK+SG V+G AT  WVLFELMEYHLLTL
Sbjct  66   MQSKVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGAATAAWVLFELMEYHLLTL  125

Query  384  VCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            +CH++I+ LA+ FLWSNA+ FINKSPP+IP V +P++ +L +AS LRIEINR  + L
Sbjct  126  LCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSSL  182



>ref|XP_009112901.1| PREDICTED: reticulon-like protein B3 [Brassica rapa]
Length=251

 Score =   179 bits (454),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 118/150 (79%), Gaps = 3/150 (2%)
 Frame = +3

Query  105  ETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGKPADI  284
            E++MEKI++K+ GHD+SSS   DD   +  A ++K KI+RLFGRE+ VHKV GGGKPADI
Sbjct  9    ESIMEKIAEKIHGHDNSSSSDSDD---EKKASSIKTKIFRLFGREKPVHKVFGGGKPADI  65

Query  285  FLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPP  464
            FLWR+KKVSG V+G AT  W+LFEL++Y+LLTL  H+ ILALA+ FLWS+A+TFI+K PP
Sbjct  66   FLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHVSILALAVLFLWSSATTFIHKKPP  125

Query  465  QIPSVILPQDTVLNVASALRIEINRTLAVL  554
             IP V +P++  L +AS LRIEINR   +L
Sbjct  126  HIPEVHIPEEVALQLASGLRIEINRGFTIL  155



>ref|XP_010433883.1| PREDICTED: reticulon-like protein B1 [Camelina sativa]
Length=276

 Score =   180 bits (456),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +3

Query  204  VKAKIYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTL  383
            +++K+YRLFGRE+ VHKVLGGGKPADIF+W++KK+SG V+G AT  WVLFELMEYHLLTL
Sbjct  67   MQSKVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTL  126

Query  384  VCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            +CH++I+ LA+ FLWSNA+ FINKSPP+IP V +P++ +L +AS LRIEINR  + L
Sbjct  127  ICHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSTL  183



>ref|XP_010523772.1| PREDICTED: reticulon-like protein B5 [Tarenaya hassleriana]
Length=253

 Score =   179 bits (454),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 119/162 (73%), Gaps = 1/162 (1%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MAD   +     E+++EKI+DK+  HDSSSS   D+   + S  AVK KIYRLFGRE+ V
Sbjct  1    MADEMENSTPAEESLLEKIADKIHDHDSSSSSDSDNEKME-SPSAVKEKIYRLFGREKPV  59

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            HKV GGGKPAD+ LWRDKK+S AV+G  T +WVLFEL+EYHLL+ VCHI IL LA+ FLW
Sbjct  60   HKVFGGGKPADVLLWRDKKLSAAVLGTTTAVWVLFELVEYHLLSFVCHISILTLAVLFLW  119

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNA +FINKSPPQIP + + ++  L +ASA+R E+N    VL
Sbjct  120  SNAHSFINKSPPQIPEIHVAEEPFLLIASAIRNEVNHAFTVL  161



>ref|XP_006284300.1| hypothetical protein CARUB_v10005469mg [Capsella rubella]
 gb|ACC91263.1| reticulon family protein [Capsella rubella]
 gb|EOA17198.1| hypothetical protein CARUB_v10005469mg [Capsella rubella]
Length=274

 Score =   179 bits (455),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 117/158 (74%), Gaps = 8/158 (5%)
 Frame = +3

Query  105  ETVMEKISDKLQG--------HdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVL  260
            E++M+KIS+K+ G              D +       S  ++++K+YRLFGRE+ VHKVL
Sbjct  24   ESLMDKISEKIHGGDSSSSSSSSDDDDDKKKKKKKPSSPSSMQSKVYRLFGREKPVHKVL  83

Query  261  GGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNAS  440
            GGGKPADIF+W++KK+SG V+G AT  WVLFELMEYHLLTL+CH++I+ LA+ FLWSNA+
Sbjct  84   GGGKPADIFMWKNKKMSGGVLGAATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNAT  143

Query  441  TFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
             FINKSPP+IP V +P++ +L +AS LRIEINR  + L
Sbjct  144  MFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSSL  181



>ref|XP_009104316.1| PREDICTED: reticulon-like protein B6 [Brassica rapa]
 emb|CDY53913.1| BnaA07g38210D [Brassica napus]
Length=254

 Score =   179 bits (453),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 120/162 (74%), Gaps = 0/162 (0%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MA+ +       E++MEKI++K+  H  SSS S+ DH    S  A+KAKIYRLFGRE+ V
Sbjct  1    MAEESEKPVHTEESLMEKIAEKIHDHHDSSSSSDSDHEKPESQSALKAKIYRLFGREKPV  60

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            HKVLGGG PAD+FLWRDKK+S AV+G AT IWVLFEL+EYH L+LVCHILI +LA  FLW
Sbjct  61   HKVLGGGLPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHFLSLVCHILIFSLAAMFLW  120

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNA  F+ KSPP+IP + + ++  L +ASALR E+N+   +L
Sbjct  121  SNAHAFMKKSPPKIPEIQVKEEHFLLIASALRNELNQAFVIL  162



>ref|XP_010439152.1| PREDICTED: reticulon-like protein B1 isoform X1 [Camelina sativa]
Length=276

 Score =   179 bits (454),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +3

Query  204  VKAKIYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTL  383
            +++K+YRLFGRE+ VHKVLGGGKPADIF+W++KK+SG V+G AT  WVLFELMEYHLLTL
Sbjct  67   MQSKVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTL  126

Query  384  VCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            +CH++I+ LA+ FLWSNA+ FINKSPP+IP V +P++ +L +AS LRIEINR  + L
Sbjct  127  ICHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSSL  183



>ref|XP_004248066.1| PREDICTED: reticulon-like protein B1 [Solanum lycopersicum]
Length=263

 Score =   179 bits (453),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 124/170 (73%), Gaps = 8/170 (5%)
 Frame = +3

Query  69   MADHAGDH-DSLAETVMEKISDKLQ-GHdssssdseddhadKPSA------DAVKAKIYR  224
            MA+    H +   E+ MEKI+DK+     SSSS S+ D   KP+A       +VKAKI+R
Sbjct  1    MAEQVEQHSEHKEESFMEKIADKIHFDRSSSSSSSDSDSEVKPAAAPEASPSSVKAKIWR  60

Query  225  LFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILIL  404
            LFGRE+ VH V GGGKPAD+FLWR+KK+S +V+G AT IWVLFEL+EY L+ LVCH+LI 
Sbjct  61   LFGREKPVHHVFGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYFLVGLVCHLLIF  120

Query  405  ALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
             LA+ FLWSNA+TFINK  P IP V LP++ +L +ASAL IEINR L++L
Sbjct  121  TLAVLFLWSNATTFINKKRPHIPEVQLPEEPILEIASALSIEINRALSML  170



>ref|NP_001044177.1| Os01g0736900 [Oryza sativa Japonica Group]
 dbj|BAB89453.1| putative 24 kDa seed maturation protein [Oryza sativa Japonica 
Group]
 dbj|BAF06091.1| Os01g0736900 [Oryza sativa Japonica Group]
 dbj|BAG89426.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00393.1| unnamed protein product [Oryza sativa Japonica Group]
Length=253

 Score =   178 bits (452),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 121/166 (73%), Gaps = 9/166 (5%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAK----IYRLFGR  236
            MA+H  +     ++VMEK+S+KL G  SSSS   DD     S+ +  A     IYRLFGR
Sbjct  1    MAEHKEE-----QSVMEKLSEKLHGDSSSSSSDSDDDKKGSSSSSAAAAMKAKIYRLFGR  55

Query  237  ERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAI  416
            ER VH VLGGGKPAD+ LWR+KK+SG V+  AT IW+LFE+MEYHLLTLVCH LIL+LA+
Sbjct  56   ERPVHSVLGGGKPADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVCHCLILSLAV  115

Query  417  SFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
             FLWSNASTFI+KSPP IP V +P+D  +N+A +LR EINR  A L
Sbjct  116  LFLWSNASTFIHKSPPNIPEVKIPEDLTVNIALSLRYEINRGFATL  161



>ref|XP_009763462.1| PREDICTED: reticulon-like protein B1 isoform X2 [Nicotiana sylvestris]
Length=263

 Score =   178 bits (452),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 122/171 (71%), Gaps = 10/171 (6%)
 Frame = +3

Query  69   MADHAGDHDSL--AETVMEKISDKLQGHdssssdseddhadKP-------SADAVKAKIY  221
            MA+HA +H      E+++EKI DK+    SS S S+ D   KP       S  +VKA I+
Sbjct  1    MAEHA-EHSEYKEEESLIEKIEDKIHFDHSSFSSSDSDTEKKPASAPEAASPSSVKATIW  59

Query  222  RLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI  401
            RLFGRE+ VH+V GGGKPAD+FLWR+KK+S +V+G AT IWVLFEL+EYHLL LVCH+LI
Sbjct  60   RLFGREKPVHQVFGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYHLLGLVCHLLI  119

Query  402  LALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
              LAI FLWSNA+TFINK  P IP   L ++ +L +ASALRIEIN  L VL
Sbjct  120  FTLAILFLWSNATTFINKKRPHIPEFHLLEEPILEIASALRIEINHILHVL  170



>ref|XP_006413535.1| hypothetical protein EUTSA_v10025959mg [Eutrema salsugineum]
 gb|ESQ54988.1| hypothetical protein EUTSA_v10025959mg [Eutrema salsugineum]
Length=275

 Score =   179 bits (453),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +3

Query  204  VKAKIYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTL  383
            +++K+YRLFGRE+ VHKVLGGGKPADIF+W++KK+SG V+G AT  WVLFELMEYHLLTL
Sbjct  66   MQSKVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGAATAAWVLFELMEYHLLTL  125

Query  384  VCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            +CH++I+ LA+ FLWSNA+ FINKSPP+IP V +P++ +L +AS LRIEINR  + L
Sbjct  126  LCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSSL  182



>ref|XP_009763461.1| PREDICTED: reticulon-like protein B6 isoform X1 [Nicotiana sylvestris]
Length=267

 Score =   178 bits (452),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 122/171 (71%), Gaps = 10/171 (6%)
 Frame = +3

Query  69   MADHAGDHDSL--AETVMEKISDKLQGHdssssdseddhadKP-------SADAVKAKIY  221
            MA+HA +H      E+++EKI DK+    SS S S+ D   KP       S  +VKA I+
Sbjct  1    MAEHA-EHSEYKEEESLIEKIEDKIHFDHSSFSSSDSDTEKKPASAPEAASPSSVKATIW  59

Query  222  RLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI  401
            RLFGRE+ VH+V GGGKPAD+FLWR+KK+S +V+G AT IWVLFEL+EYHLL LVCH+LI
Sbjct  60   RLFGREKPVHQVFGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYHLLGLVCHLLI  119

Query  402  LALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
              LAI FLWSNA+TFINK  P IP   L ++ +L +ASALRIEIN  L VL
Sbjct  120  FTLAILFLWSNATTFINKKRPHIPEFHLLEEPILEIASALRIEINHILHVL  170



>ref|XP_010509305.1| PREDICTED: reticulon-like protein B1 [Camelina sativa]
Length=275

 Score =   178 bits (452),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +3

Query  204  VKAKIYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTL  383
            +++K+YRLFGRE+ VHKVLGGGKPADIF+W++KK+SG V+G AT  WVLFELMEYHLLTL
Sbjct  66   MQSKVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTL  125

Query  384  VCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            +CH++I+ LA+ FLWSNA+ FINKSPP+IP + +P++ +L +AS LRIEINR  + L
Sbjct  126  ICHVMIVVLAVLFLWSNATMFINKSPPKIPEIHIPEEPILQLASGLRIEINRGFSSL  182



>ref|NP_001241367.1| uncharacterized protein LOC100796111 [Glycine max]
 gb|ACU22605.1| unknown [Glycine max]
Length=256

 Score =   177 bits (450),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 118/151 (78%), Gaps = 1/151 (1%)
 Frame = +3

Query  102  AETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGKPAD  281
             E++++KI++K+ GH  SSS S+ D   K ++ ++K K++RLFGRE+ VH VLGGGKPAD
Sbjct  14   GESLLDKIAEKIHGHHDSSSSSDSDSEKKETS-SIKEKVFRLFGREKPVHSVLGGGKPAD  72

Query  282  IFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSP  461
            + LWR+KK+S +V+G AT +W+ FEL+EYHLLTLVCHI IL LA+ FLWSNA TFI+K+P
Sbjct  73   VLLWRNKKISASVLGVATAVWIFFELLEYHLLTLVCHISILVLAVLFLWSNAHTFIHKAP  132

Query  462  PQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            P IP+V LP++ +   ASAL IEINR  A L
Sbjct  133  PCIPTVHLPEEPIRQFASALTIEINRGFAAL  163



>ref|XP_002887921.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64180.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
Length=254

 Score =   177 bits (450),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 118/150 (79%), Gaps = 0/150 (0%)
 Frame = +3

Query  105  ETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGKPADI  284
            E++MEKI++K+ GHD  SS S  D  D   + ++K KIYRLFGRE+ +HKV GGGKPADI
Sbjct  9    ESIMEKIAEKIHGHDDGSSSSSSDSDDDKKSASLKTKIYRLFGREQPLHKVFGGGKPADI  68

Query  285  FLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPP  464
            FLWR+KKVSG V+G AT  W+LFEL+EY+LLTL  HI ILALA+ FLWS+A+TFI+KSPP
Sbjct  69   FLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILALAVLFLWSSATTFIHKSPP  128

Query  465  QIPSVILPQDTVLNVASALRIEINRTLAVL  554
             IP V +P++ VL +AS LRIEINR   VL
Sbjct  129  HIPEVHIPEEVVLELASGLRIEINRGFTVL  158



>ref|XP_010261408.1| PREDICTED: reticulon-like protein B2 [Nelumbo nucifera]
 ref|XP_010261409.1| PREDICTED: reticulon-like protein B2 [Nelumbo nucifera]
Length=255

 Score =   177 bits (450),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 125/164 (76%), Gaps = 4/164 (2%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MA+HA D  S  E+VM KI++KL  H    S S D   +K S  +VKA +YRLFGR++ V
Sbjct  1    MAEHAEDSGSTVESVMHKIAEKL--HHKDDSSSSDSDNEKSSPSSVKAAVYRLFGRQKPV  58

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            HKVLGGGKPAD+FLWR+KK+S +V+G AT  WVLFEL+EYH LTLVCH LIL+L++ FLW
Sbjct  59   HKVLGGGKPADVFLWRNKKISASVLGGATAAWVLFELLEYHFLTLVCHCLILSLSLLFLW  118

Query  429  SNASTFINK--SPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNA+TFINK  SPP+IP V +P+D VL  ASALRIEIN   +VL
Sbjct  119  SNATTFINKSQSPPRIPEVYIPEDPVLQFASALRIEINSGFSVL  162



>ref|XP_008232963.1| PREDICTED: reticulon-like protein B6 [Prunus mume]
Length=257

 Score =   177 bits (450),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 123/166 (74%), Gaps = 4/166 (2%)
 Frame = +3

Query  69   MADHAGDHDSLAE---TVMEKISDKLQGHdssssdseddhadKP-SADAVKAKIYRLFGR  236
            MAD +    S  E   ++MEKIS+K+  H+SSSS S D   +KP S  + K K++R+FGR
Sbjct  1    MADQSESAGSTVEHDKSLMEKISEKIHDHESSSSSSSDSDNEKPESPKSEKPKVFRIFGR  60

Query  237  ERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAI  416
            E+ VH V GGGKPAD+FLWR+KKVS  V+G AT +WVLFEL+EYHLLTLV HILI  LA+
Sbjct  61   EKPVHHVFGGGKPADVFLWRNKKVSAGVLGGATAVWVLFELLEYHLLTLVGHILIGTLAV  120

Query  417  SFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
             FLWSNA +FI+K+PP+IP V LP++  L VAS LR++IN   AVL
Sbjct  121  LFLWSNAHSFIHKTPPRIPEVHLPEEPFLQVASELRLQINWAFAVL  166



>gb|KHN15986.1| Reticulon-like protein B5, partial [Glycine soja]
Length=242

 Score =   177 bits (448),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 118/150 (79%), Gaps = 1/150 (1%)
 Frame = +3

Query  105  ETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGKPADI  284
            E++++KI++K+ GH  SSS S+ D   K ++ ++K K++RLFGRE+ VH VLGGGKPAD+
Sbjct  1    ESLLDKIAEKIHGHHDSSSSSDSDSEKKETS-SIKEKVFRLFGREKPVHSVLGGGKPADV  59

Query  285  FLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPP  464
             LWR+KK+S +V+G AT +W+ FEL+EYHLLTLVCHI IL LA+ FLWSNA TFI+K+PP
Sbjct  60   LLWRNKKISASVLGVATAVWIFFELLEYHLLTLVCHISILVLAVLFLWSNAHTFIHKAPP  119

Query  465  QIPSVILPQDTVLNVASALRIEINRTLAVL  554
             IP+V LP++ +   ASAL IEINR  A L
Sbjct  120  CIPTVHLPEEPIRQFASALTIEINRGFAAL  149



>gb|KJB52211.1| hypothetical protein B456_008G250900 [Gossypium raimondii]
Length=192

 Score =   175 bits (444),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 124/149 (83%), Gaps = 3/149 (2%)
 Frame = +3

Query  108  TVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGKPADIF  287
            ++M++I++K+Q HDSSSSDS++D   KPS   +KAK++ LFGRE+ VH VLGGGKPADIF
Sbjct  12   SLMDRIAEKIQAHDSSSSDSDND---KPSESTIKAKVFHLFGREKPVHHVLGGGKPADIF  68

Query  288  LWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQ  467
            LWR+KK+S   +G AT IW+LFE++EYHLLTLVCH+LILALA+ FLWSNA+TF+NKSPP+
Sbjct  69   LWRNKKISAGALGVATVIWILFEMLEYHLLTLVCHLLILALALLFLWSNAATFVNKSPPR  128

Query  468  IPSVILPQDTVLNVASALRIEINRTLAVL  554
            IP V +P+D V+  A ALR EINR  AVL
Sbjct  129  IPEVQIPKDPVMEFAQALRFEINRAFAVL  157



>ref|XP_009395750.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=253

 Score =   177 bits (449),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 122/166 (73%), Gaps = 10/166 (6%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQG-HdssssdseddhadK-PSA--DAVKAKIYRLFGR  236
            MA+H        E+++EKI++K  G H SS  DS+D+ + + PSA  +AVKAKIYRLFGR
Sbjct  1    MAEHR------EESLLEKITEKFHGRHSSSVVDSDDEKSSRGPSAAAEAVKAKIYRLFGR  54

Query  237  ERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAI  416
            E+ VHKVLGGGKPAD+FLWR+KKVS +  G  T IWV FELMEYHL+TLVCH LIL+LAI
Sbjct  55   EKPVHKVLGGGKPADVFLWRNKKVSASTFGAVTAIWVFFELMEYHLITLVCHGLILSLAI  114

Query  417  SFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
             FLW NA+TFI+KS P +P V + +D  LNV  +LR  INR L  L
Sbjct  115  IFLWCNATTFISKSRPHVPEVSISEDLALNVVLSLRYVINRGLVAL  160



>ref|XP_006302727.1| hypothetical protein CARUB_v10020840mg [Capsella rubella]
 gb|EOA35625.1| hypothetical protein CARUB_v10020840mg [Capsella rubella]
Length=253

 Score =   177 bits (448),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 116/150 (77%), Gaps = 2/150 (1%)
 Frame = +3

Query  105  ETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGKPADI  284
            E++MEKI++K+ GHD SSS S+ D      +  +K KIYRLFGRE+ VHK+ GGGKPADI
Sbjct  9    ESIMEKIAEKIHGHDDSSSSSDSDDDK--KSSTLKTKIYRLFGREQPVHKIFGGGKPADI  66

Query  285  FLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPP  464
            FLWR+KKVSG V+G AT  W+LFEL+EY+LLTL  HI IL LA+ FLWS+A+TFI+K+PP
Sbjct  67   FLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILTLAVLFLWSSATTFIHKTPP  126

Query  465  QIPSVILPQDTVLNVASALRIEINRTLAVL  554
             IP V +P++ VL +AS LRIEINR    L
Sbjct  127  HIPEVHIPEEVVLQLASGLRIEINRGFTAL  156



>ref|NP_192861.1| reticulon-like protein B2 [Arabidopsis thaliana]
 sp|Q9SUT9.1|RTNLB_ARATH RecName: Full=Reticulon-like protein B2; Short=AtRTNLB2; AltName: 
Full=VirB2-interacting protein 2 [Arabidopsis thaliana]
 emb|CAB51406.1| putative protein [Arabidopsis thaliana]
 emb|CAB81223.1| putative protein [Arabidopsis thaliana]
 gb|AAK59408.1| unknown protein [Arabidopsis thaliana]
 gb|AAK82535.1| AT4g11220/F8L21_10 [Arabidopsis thaliana]
 gb|AAL14401.1| AT4g11220/F8L21_10 [Arabidopsis thaliana]
 gb|AAM64366.1| unknown [Arabidopsis thaliana]
 gb|AAN86201.1| unknown protein [Arabidopsis thaliana]
 gb|AEE82986.1| reticulon-like protein B2 [Arabidopsis thaliana]
Length=271

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = +3

Query  216  IYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHI  395
            +YRLFGRER VHKVLGGGKPADIF+W+DKK+SG V G AT  WVLFELMEYHLLTL+CH+
Sbjct  66   VYRLFGRERPVHKVLGGGKPADIFMWKDKKMSGGVFGGATVAWVLFELMEYHLLTLLCHV  125

Query  396  LILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            +I+ALA+ FLWSNA+ FI+KSPP+IP V +P++ +L +AS LRIEINR ++ L
Sbjct  126  MIVALAVLFLWSNATMFIHKSPPKIPEVHIPEEPLLQLASGLRIEINRGISSL  178



>ref|XP_010455527.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=268

 Score =   177 bits (449),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = +3

Query  216  IYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHI  395
            +YRLFGRER VHKVLGGGKPADIF+W++KK+SG V+G AT  WVLFELMEYHLLTL+CH+
Sbjct  63   VYRLFGRERPVHKVLGGGKPADIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLTLLCHV  122

Query  396  LILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            +I+ALA+ FLWSNA+ FI+KSPP+IP + +P+D +L +AS LRIEINR  + L
Sbjct  123  MIVALAVLFLWSNATMFIHKSPPKIPEIHIPEDPLLQLASGLRIEINRGFSSL  175



>ref|XP_009137373.1| PREDICTED: reticulon-like protein B1 [Brassica rapa]
Length=268

 Score =   177 bits (449),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 120/152 (79%), Gaps = 2/152 (1%)
 Frame = +3

Query  105  ETVMEKISDKLQ--GHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGKPA  278
            E++M+KIS+KL   G  SSS + E       S  ++K+K+YRLFGRE+ VHKVLGGGKPA
Sbjct  24   ESLMDKISEKLHHGGDSSSSDEDEKKKKSSESPSSMKSKVYRLFGREKPVHKVLGGGKPA  83

Query  279  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKS  458
            DIF+W++KK+SG V+G AT  WVLFELMEYHLLTL+CH++I+ LA+ FLWSNA+ FINKS
Sbjct  84   DIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFINKS  143

Query  459  PPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            PP+IP V +P++ +L +AS LR+EINR  + L
Sbjct  144  PPKIPEVHIPEEPILQLASGLRVEINRGFSSL  175



>gb|KJB24287.1| hypothetical protein B456_004G137000 [Gossypium raimondii]
Length=208

 Score =   175 bits (444),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 127/162 (78%), Gaps = 4/162 (2%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            M+DH   H+   E+++EKIS+K++GHD SSS S+ D     S  ++KAK++RLFGRER V
Sbjct  1    MSDHEDKHE---ESLLEKISEKVKGHDLSSSSSDSDDDKP-SESSMKAKVFRLFGRERPV  56

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            H V GGGK ADIFLWR+KK+S   +G AT IWVLFEL+EYHLLTLVCH+LILALA+ FLW
Sbjct  57   HDVFGGGKQADIFLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLW  116

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNA+TFI+KSPP+IP V +P+D VL  A ALR EINR  AVL
Sbjct  117  SNAATFIHKSPPRIPEVQIPKDPVLEFAQALRFEINRGFAVL  158



>ref|XP_009134231.1| PREDICTED: reticulon-like protein B2 [Brassica rapa]
Length=267

 Score =   177 bits (448),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = +3

Query  216  IYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHI  395
            +YRLFGRER VHKVLGGGKPADIF+W++KK+SG V+G AT  WVLFELMEYHLLTL+CH+
Sbjct  62   VYRLFGRERPVHKVLGGGKPADIFMWKNKKMSGGVLGGATVAWVLFELMEYHLLTLLCHV  121

Query  396  LILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            +I+ALA+ FLWSNA+ FI+KSPP+IP V +P+D +L +AS LRIEINR  + L
Sbjct  122  MIVALAVLFLWSNATMFIHKSPPKIPEVHIPEDPLLQLASGLRIEINRGFSSL  174



>ref|XP_006288443.1| hypothetical protein CARUB_v10001704mg [Capsella rubella]
 gb|EOA21341.1| hypothetical protein CARUB_v10001704mg [Capsella rubella]
Length=271

 Score =   177 bits (448),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = +3

Query  216  IYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHI  395
            +YRLFGRER VHKVLGGGKPADIF+W++KK+SG V+G AT  WVLFELMEYHLLTL+CH+
Sbjct  66   VYRLFGRERPVHKVLGGGKPADIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLTLLCHV  125

Query  396  LILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            +I+ALA+ FLWSNA+ FI+KSPP+IP V +P++ +L +AS LRIEINR  + L
Sbjct  126  MIVALAVLFLWSNATMFIHKSPPKIPEVHIPEEPLLQLASGLRIEINRGFSSL  178



>dbj|BAJ33905.1| unnamed protein product [Thellungiella halophila]
Length=275

 Score =   177 bits (448),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +3

Query  204  VKAKIYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTL  383
            +++K+YRLFGRE+ VHKVLGGGKPA+IF+W++KK+SG V+G AT  WVLFELMEYHLLTL
Sbjct  66   MQSKVYRLFGREKPVHKVLGGGKPAEIFMWKNKKMSGGVLGAATAAWVLFELMEYHLLTL  125

Query  384  VCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            +CH++I+ LA+ FLWSNA+ FINKSPP+IP V +P++ +L +AS LRIEINR  + L
Sbjct  126  LCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSSL  182



>ref|XP_004969875.1| PREDICTED: reticulon-like protein B1-like [Setaria italica]
Length=257

 Score =   176 bits (446),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 121/167 (72%), Gaps = 7/167 (4%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQG-----HdssssdseddhadKPSADAVKAKIYRLFG  233
            MA+H    + + E+VM+KIS+K  G        S  + +   +   +A+A+KAKIYRLFG
Sbjct  1    MAEH--KEEPVLESVMDKISEKFHGGDSSSSSDSDDEKKKGSSSASAAEAMKAKIYRLFG  58

Query  234  RERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALA  413
            RER VH VLGGGK AD+ LWR+KK+SG V+  AT IW+LFE+MEYHLLTLVCH LIL+LA
Sbjct  59   RERDVHSVLGGGKTADLVLWRNKKISGGVLASATAIWLLFEVMEYHLLTLVCHCLILSLA  118

Query  414  ISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            I FLWSNASTFINKSPP IP V + +D  +NVA +LR EINR  A L
Sbjct  119  ILFLWSNASTFINKSPPNIPEVKISEDVAVNVALSLRYEINRGFATL  165



>ref|XP_010422067.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=265

 Score =   176 bits (447),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = +3

Query  216  IYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHI  395
            +YRLFGRER VHKVLGGGKPADIF+W++KK+SG V+G AT  WVLFELMEYHLLTL+CH+
Sbjct  60   VYRLFGRERPVHKVLGGGKPADIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLTLLCHV  119

Query  396  LILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            +I+ALA+ FLWSNA+ FI+KSPP+IP V +P++ +L +AS LRIEINR  + L
Sbjct  120  MIVALAVLFLWSNATMFIHKSPPKIPEVHIPEEPLLQLASGLRIEINRGFSSL  172



>ref|XP_007218267.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
 gb|EMJ19466.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
Length=280

 Score =   177 bits (448),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 123/166 (74%), Gaps = 4/166 (2%)
 Frame = +3

Query  69   MADHAGDHDSLAE---TVMEKISDKLQGHdssssdseddhadKP-SADAVKAKIYRLFGR  236
            MAD +    S  E   ++MEKIS+K+  H+SSSS S D   +KP S  + K K++R+FGR
Sbjct  83   MADQSESAGSTVEHEKSLMEKISEKIHDHNSSSSSSSDSDNEKPESPKSEKPKVFRIFGR  142

Query  237  ERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAI  416
            E+ VH V GGGKPAD+FLWR+KKVS  V+G AT +WVLFEL+EYHLLTLV HILI  LA+
Sbjct  143  EKPVHHVFGGGKPADVFLWRNKKVSAGVLGGATAVWVLFELLEYHLLTLVGHILIGTLAV  202

Query  417  SFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
             FLWSNA +FI+K+PP+IP V LP++  L VAS LR++IN   AVL
Sbjct  203  LFLWSNAHSFIHKTPPRIPEVHLPEEPFLQVASELRLQINWAFAVL  248



>ref|XP_011022600.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=250

 Score =   176 bits (446),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 124/162 (77%), Gaps = 5/162 (3%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MA+H  + DS+ E+VMEK+ D    H++SS    D    K  +D++K+KIYRLFGRE+ V
Sbjct  1    MAEHDKE-DSVIESVMEKVHD----HETSSDSDSDHGKPKSESDSLKSKIYRLFGREKPV  55

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            HKVLGGGKPADIFLWR+KK+S  ++G AT IWVLFEL+E HLLTLVC+ LILAL + FLW
Sbjct  56   HKVLGGGKPADIFLWRNKKISAGLLGGATAIWVLFELLECHLLTLVCYFLILALVLLFLW  115

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNASTFINKSPP IP V +P++ VL +A+AL  EIN   +VL
Sbjct  116  SNASTFINKSPPHIPEVRIPEEPVLQIAAALTTEINWAFSVL  157



>gb|EAZ13460.1| hypothetical protein OsJ_03377 [Oryza sativa Japonica Group]
Length=253

 Score =   176 bits (446),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 120/166 (72%), Gaps = 9/166 (5%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAK----IYRLFGR  236
            MA+H  +     ++VMEK+S+KL G  SSSS   DD     S+ +  A     IYRLFGR
Sbjct  1    MAEHKEE-----QSVMEKLSEKLHGDSSSSSSDSDDDKKGSSSSSAAAAMKAKIYRLFGR  55

Query  237  ERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAI  416
            ER V  VLGGGKPAD+ LWR+KK+SG V+  AT IW+LFE+MEYHLLTLVCH LIL+LA+
Sbjct  56   ERPVQSVLGGGKPADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVCHCLILSLAV  115

Query  417  SFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
             FLWSNASTFI+KSPP IP V +P+D  +N+A +LR EINR  A L
Sbjct  116  LFLWSNASTFIHKSPPNIPEVKIPEDLTVNIALSLRYEINRGFATL  161



>ref|XP_004149448.1| PREDICTED: reticulon-like protein B1-like [Cucumis sativus]
 ref|XP_004167648.1| PREDICTED: reticulon-like protein B1-like [Cucumis sativus]
 gb|KGN57883.1| hypothetical protein Csa_3G363160 [Cucumis sativus]
Length=250

 Score =   176 bits (445),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  198  DAVKAKIYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLL  377
            DAVK  +YRLFGR++ VH VLGGGKPAD+FLW++KK S  V+G AT +W+LFEL+EY L+
Sbjct  39   DAVKCHVYRLFGRDKPVHTVLGGGKPADVFLWKNKKNSAGVLGGATALWILFELLEYQLI  98

Query  378  TLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            TLVCHILI+ LAI FLWS A+TFINK+PPQIP V LP+D +L V ++LRIEINR ++ L
Sbjct  99   TLVCHILIILLAIPFLWSYANTFINKTPPQIPDVRLPEDCLLQVVTSLRIEINRIISTL  157



>ref|XP_008792381.1| PREDICTED: reticulon-like protein B2 isoform X2 [Phoenix dactylifera]
Length=251

 Score =   176 bits (445),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 121/155 (78%), Gaps = 1/155 (1%)
 Frame = +3

Query  90   HDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGG  269
             +S+ E+VMEK  ++   HD SSS   D+   KPS+ +VK+KI RLFGRE+ VH VLGGG
Sbjct  6    EESVGESVMEKKVEEFH-HDDSSSSDSDNEKSKPSSSSVKSKICRLFGREKPVHTVLGGG  64

Query  270  KPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFI  449
            KPADIFLWR+KK+S  V+G AT IWVLF+LMEYHLL LVCH LIL+LAI FLWSNA+TFI
Sbjct  65   KPADIFLWRNKKISAGVLGGATAIWVLFDLMEYHLLALVCHCLILSLAILFLWSNATTFI  124

Query  450  NKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            NKSPP+IP V +P+D  ++ A +LR EINR  AVL
Sbjct  125  NKSPPRIPEVSIPEDVAVSFALSLRYEINRGFAVL  159



>gb|KJB52210.1| hypothetical protein B456_008G250900 [Gossypium raimondii]
Length=250

 Score =   176 bits (445),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 124/149 (83%), Gaps = 3/149 (2%)
 Frame = +3

Query  108  TVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGKPADIF  287
            ++M++I++K+Q HDSSSSDS++D   KPS   +KAK++ LFGRE+ VH VLGGGKPADIF
Sbjct  12   SLMDRIAEKIQAHDSSSSDSDND---KPSESTIKAKVFHLFGREKPVHHVLGGGKPADIF  68

Query  288  LWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQ  467
            LWR+KK+S   +G AT IW+LFE++EYHLLTLVCH+LILALA+ FLWSNA+TF+NKSPP+
Sbjct  69   LWRNKKISAGALGVATVIWILFEMLEYHLLTLVCHLLILALALLFLWSNAATFVNKSPPR  128

Query  468  IPSVILPQDTVLNVASALRIEINRTLAVL  554
            IP V +P+D V+  A ALR EINR  AVL
Sbjct  129  IPEVQIPKDPVMEFAQALRFEINRAFAVL  157



>gb|KJB52212.1| hypothetical protein B456_008G250900 [Gossypium raimondii]
Length=222

 Score =   174 bits (442),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 124/149 (83%), Gaps = 3/149 (2%)
 Frame = +3

Query  108  TVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGKPADIF  287
            ++M++I++K+Q HDSSSSDS++D   KPS   +KAK++ LFGRE+ VH VLGGGKPADIF
Sbjct  12   SLMDRIAEKIQAHDSSSSDSDND---KPSESTIKAKVFHLFGREKPVHHVLGGGKPADIF  68

Query  288  LWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQ  467
            LWR+KK+S   +G AT IW+LFE++EYHLLTLVCH+LILALA+ FLWSNA+TF+NKSPP+
Sbjct  69   LWRNKKISAGALGVATVIWILFEMLEYHLLTLVCHLLILALALLFLWSNAATFVNKSPPR  128

Query  468  IPSVILPQDTVLNVASALRIEINRTLAVL  554
            IP V +P+D V+  A ALR EINR  AVL
Sbjct  129  IPEVQIPKDPVMEFAQALRFEINRAFAVL  157



>gb|KJB24285.1| hypothetical protein B456_004G137000 [Gossypium raimondii]
Length=255

 Score =   176 bits (445),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 127/162 (78%), Gaps = 4/162 (2%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            M+DH   H+   E+++EKIS+K++GHD SSS S+ D     S  ++KAK++RLFGRER V
Sbjct  1    MSDHEDKHE---ESLLEKISEKVKGHDLSSSSSDSDDDKP-SESSMKAKVFRLFGRERPV  56

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            H V GGGK ADIFLWR+KK+S   +G AT IWVLFEL+EYHLLTLVCH+LILALA+ FLW
Sbjct  57   HDVFGGGKQADIFLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLW  116

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNA+TFI+KSPP+IP V +P+D VL  A ALR EINR  AVL
Sbjct  117  SNAATFIHKSPPRIPEVQIPKDPVLEFAQALRFEINRGFAVL  158



>ref|XP_002303615.1| reticulon family protein [Populus trichocarpa]
 gb|EEE78594.1| reticulon family protein [Populus trichocarpa]
Length=250

 Score =   175 bits (444),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 124/162 (77%), Gaps = 5/162 (3%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MA+H    DS+ E+VMEKI D  +    SS    D    K  +D++K+KIYR+FGRE+ V
Sbjct  1    MAEH-DKEDSVIESVMEKIHDHDK----SSDSDSDHGKPKSESDSLKSKIYRIFGREKPV  55

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            HKVLGGGKPADIFLWR+KK+S  V+G AT IWVLFEL+E HLLTLVC+ LILALA+ FLW
Sbjct  56   HKVLGGGKPADIFLWRNKKISAGVLGGATAIWVLFELLECHLLTLVCYFLILALALLFLW  115

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNASTFINKSPP IP V +P++ VL +A+ALRIEIN   +VL
Sbjct  116  SNASTFINKSPPHIPEVRIPEEPVLQIAAALRIEINWAFSVL  157



>ref|XP_010430525.1| PREDICTED: reticulon-like protein B3 [Camelina sativa]
Length=255

 Score =   175 bits (444),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 118/151 (78%), Gaps = 1/151 (1%)
 Frame = +3

Query  105  ETVMEKISDKLQGH-dssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGKPAD  281
            E++MEKI++K+ GH DSSSS S  D  D   + ++K K+YRLFGRE+ VHKV GGGKPAD
Sbjct  9    ESIMEKIAEKIHGHGDSSSSSSSSDSDDDKKSSSLKTKVYRLFGREQPVHKVFGGGKPAD  68

Query  282  IFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSP  461
            IFLWR+KKVSG V+G AT  W+LFEL+EY+LLTL  HI IL LA+ FLWS+ASTFI+K+ 
Sbjct  69   IFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILTLAVLFLWSSASTFIHKTT  128

Query  462  PQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            P IP V +P++ VL +AS LRIEINR   VL
Sbjct  129  PHIPEVHIPEEVVLQLASGLRIEINRGFTVL  159



>ref|XP_008792378.1| PREDICTED: reticulon-like protein B3 isoform X1 [Phoenix dactylifera]
 ref|XP_008792379.1| PREDICTED: reticulon-like protein B3 isoform X1 [Phoenix dactylifera]
Length=280

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 121/155 (78%), Gaps = 1/155 (1%)
 Frame = +3

Query  90   HDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGG  269
             +S+ E+VMEK  ++   HD SSS   D+   KPS+ +VK+KI RLFGRE+ VH VLGGG
Sbjct  6    EESVGESVMEKKVEEFH-HDDSSSSDSDNEKSKPSSSSVKSKICRLFGREKPVHTVLGGG  64

Query  270  KPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFI  449
            KPADIFLWR+KK+S  V+G AT IWVLF+LMEYHLL LVCH LIL+LAI FLWSNA+TFI
Sbjct  65   KPADIFLWRNKKISAGVLGGATAIWVLFDLMEYHLLALVCHCLILSLAILFLWSNATTFI  124

Query  450  NKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            NKSPP+IP V +P+D  ++ A +LR EINR  AVL
Sbjct  125  NKSPPRIPEVSIPEDVAVSFALSLRYEINRGFAVL  159



>ref|XP_009406784.1| PREDICTED: reticulon-like protein B1 isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406785.1| PREDICTED: reticulon-like protein B1 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=253

 Score =   175 bits (443),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 123/165 (75%), Gaps = 8/165 (5%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPS--ADAVKAKIYRLFGRER  242
            MA+HA   ++L E V EKI D   G DSSSS   DD   K S   +AVK+KI RLFGRE+
Sbjct  1    MAEHA--EETLIEQVTEKIRD---GVDSSSSSDSDDEKSKASVVTEAVKSKINRLFGREK  55

Query  243  HVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF  422
             VH++LGGGKPAD+FLW++KK S AV+G AT IW+ FELMEYHLLTL CH LIL+LAI F
Sbjct  56   PVHQILGGGKPADVFLWKNKKASAAVLGGATAIWIFFELMEYHLLTLFCHCLILSLAIIF  115

Query  423  LWSNASTFI-NKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            LWSNA+  I N+SPP IP V +P++ V+++A +LR EINR  AVL
Sbjct  116  LWSNATFLINNRSPPHIPVVSIPENLVVDIALSLRYEINRGFAVL  160



>ref|XP_007139766.1| hypothetical protein PHAVU_008G057300g [Phaseolus vulgaris]
 gb|ESW11760.1| hypothetical protein PHAVU_008G057300g [Phaseolus vulgaris]
Length=205

 Score =   173 bits (439),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 118/150 (79%), Gaps = 2/150 (1%)
 Frame = +3

Query  105  ETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGKPADI  284
            E++++KIS+KL GHDSSSS   D    K    +VK K++RLFGRER VH VLG GKPAD+
Sbjct  17   ESLLDKISEKLHGHDSSSSSDSDSE--KTVTSSVKDKVFRLFGRERPVHSVLGAGKPADV  74

Query  285  FLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPP  464
             LWR+KK+S  V+G AT +WVLFEL+EYH LTLVCHILIL LA+ FLWSNA TFI+KSPP
Sbjct  75   LLWRNKKISAGVLGGATAVWVLFELLEYHFLTLVCHILILLLAVLFLWSNAHTFIHKSPP  134

Query  465  QIPSVILPQDTVLNVASALRIEINRTLAVL  554
            +IP V LP++ +L VAS LRIEINR  AVL
Sbjct  135  RIPDVHLPEEPILQVASVLRIEINRGFAVL  164



>gb|KHG20258.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=251

 Score =   174 bits (442),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 126/162 (78%), Gaps = 4/162 (2%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            M+DH   H+   E+++EKIS+K +GHD SSS S+ D     S  ++KAK++RLFGRER V
Sbjct  1    MSDHEDKHE---ESLLEKISEKNKGHDLSSSSSDSDDDKP-SESSMKAKVFRLFGRERPV  56

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            H V GGGK ADIFLWR+KK+S   +G AT IWVLFEL+EYHLLTLVCH+LILALA+ FLW
Sbjct  57   HDVFGGGKQADIFLWRNKKISAGTLGVATVIWVLFELLEYHLLTLVCHLLILALALLFLW  116

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNA+TFI+KSPP+IP V +P+D VL  A ALR EINR  AVL
Sbjct  117  SNAATFIHKSPPRIPEVQIPKDPVLEFAQALRFEINRGFAVL  158



>emb|CDM81762.1| unnamed protein product [Triticum aestivum]
Length=253

 Score =   174 bits (442),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 119/163 (73%), Gaps = 3/163 (2%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKP-SADAVKAKIYRLFGRERH  245
            MA+H    + +AE++M+KISDK  G   SSS S D   +K  SA  VKAKIYRLFGRE+ 
Sbjct  1    MAEH--KEEPVAESMMDKISDKFHGGGDSSSSSSDSDDEKKGSAAGVKAKIYRLFGREKP  58

Query  246  VHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFL  425
            VH VLGGGKPAD+ LWR+KK+SG V+  AT IW+LFE+MEYHLLTLV H LIL+LA  FL
Sbjct  59   VHAVLGGGKPADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVGHCLILSLATLFL  118

Query  426  WSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            +SN   F++KSPP IP V +P+D  +N+A +LR EINR    L
Sbjct  119  YSNVCIFVHKSPPNIPEVKIPEDMTVNIALSLRHEINRGFFTL  161



>emb|CDY10954.1| BnaA03g46130D [Brassica napus]
Length=270

 Score =   175 bits (443),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = +3

Query  216  IYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHI  395
            +YRLFGRE+ VHKVLGGGKPADIF+W++KK+SG V+G AT  WVLFELMEYHLLTL+CH+
Sbjct  65   VYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLLCHV  124

Query  396  LILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            +I+ LA+ FLWSNA+ FINKSPP+IP V +P++ +L +AS LR+EINR  + L
Sbjct  125  MIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRVEINRGFSSL  177



>ref|XP_007218268.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
 gb|EMJ19467.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
Length=339

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 123/166 (74%), Gaps = 4/166 (2%)
 Frame = +3

Query  69   MADHAGDHDSLAE---TVMEKISDKLQGHdssssdseddhadKP-SADAVKAKIYRLFGR  236
            MAD +    S  E   ++MEKIS+K+  H+SSSS S D   +KP S  + K K++R+FGR
Sbjct  83   MADQSESAGSTVEHEKSLMEKISEKIHDHNSSSSSSSDSDNEKPESPKSEKPKVFRIFGR  142

Query  237  ERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAI  416
            E+ VH V GGGKPAD+FLWR+KKVS  V+G AT +WVLFEL+EYHLLTLV HILI  LA+
Sbjct  143  EKPVHHVFGGGKPADVFLWRNKKVSAGVLGGATAVWVLFELLEYHLLTLVGHILIGTLAV  202

Query  417  SFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
             FLWSNA +FI+K+PP+IP V LP++  L VAS LR++IN   AVL
Sbjct  203  LFLWSNAHSFIHKTPPRIPEVHLPEEPFLQVASELRLQINWAFAVL  248



>dbj|BAJ98297.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97542.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=255

 Score =   174 bits (441),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 119/164 (73%), Gaps = 3/164 (2%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPS--ADAVKAKIYRLFGRER  242
            MA+H  + + +AE++M+KISDK  G   SSS S  D  D     A  VKAKIYRLFGRE+
Sbjct  1    MAEHK-EEEPVAESMMDKISDKFHGGGGSSSSSSSDSDDDKKGSAAGVKAKIYRLFGREQ  59

Query  243  HVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF  422
             VH VLGGGKPAD+ LWR+KK+SG V+  AT IW+LFE+MEYHLLTLV H LIL+LA  F
Sbjct  60   PVHAVLGGGKPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVGHCLILSLATLF  119

Query  423  LWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            LWSN   FI+KSPP IP V +P+D  +N+A +LR EINR L  L
Sbjct  120  LWSNVCIFIHKSPPNIPEVKIPEDLTVNIALSLRHEINRGLFTL  163



>ref|XP_011080892.1| PREDICTED: reticulon-like protein B2 [Sesamum indicum]
Length=257

 Score =   174 bits (441),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 119/164 (73%), Gaps = 2/164 (1%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADA--VKAKIYRLFGRER  242
            MADH  + ++  E++++K++DK+  HDSSSS S    +D        +K K+YRLFGRE+
Sbjct  1    MADHHKEEENKGESLIDKVTDKMHAHDSSSSSSSSSSSDSDDDRKARLKTKVYRLFGREK  60

Query  243  HVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF  422
             VHK+LGGG+ AD+ LWRDKKVS  V+G A  +W LF+++EYH LTL+CH LIL L   F
Sbjct  61   PVHKILGGGQGADVLLWRDKKVSAGVLGGAAALWFLFDVLEYHFLTLICHGLILGLVAMF  120

Query  423  LWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            L SNASTF+ K+PP+IP V+LP++ VL  ASALRIEINR  A L
Sbjct  121  LLSNASTFVKKAPPRIPEVVLPEEPVLKFASALRIEINRVFADL  164



>gb|AFK34557.1| unknown [Medicago truncatula]
 gb|KEH18780.1| seed maturation protein [Medicago truncatula]
Length=267

 Score =   174 bits (442),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 110/154 (71%), Gaps = 0/154 (0%)
 Frame = +3

Query  93   DSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGK  272
            DSL E + EK+  +      S S S  +   KP  ++VK K++RLFGRE+ VH VLGGGK
Sbjct  18   DSLLEKITEKLHFEDDSSSDSDSHSHSELDKKPVIESVKEKVFRLFGREKPVHSVLGGGK  77

Query  273  PADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFIN  452
            PAD+FLW++KK+S   +  AT IWV FEL+EYH LTL+CHI IL LA+ FLWSNA TF++
Sbjct  78   PADVFLWKNKKLSAGTLATATAIWVFFELLEYHFLTLICHISILVLALLFLWSNAHTFVH  137

Query  453  KSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            K+PP IP V LP++  L +ASALRIEINR  + L
Sbjct  138  KTPPHIPIVHLPEEPFLQIASALRIEINRGFSAL  171



>emb|CDY38194.1| BnaA09g11950D [Brassica napus]
Length=250

 Score =   174 bits (440),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 113/150 (75%), Gaps = 3/150 (2%)
 Frame = +3

Query  105  ETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGKPADI  284
            E++MEKI++K+         S  D  D+  A ++K KI+RLFGRE+ VHKV GGGKPADI
Sbjct  9    ESIMEKIAEKIH---GHDGSSSSDSDDEKKASSIKTKIFRLFGREKPVHKVFGGGKPADI  65

Query  285  FLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPP  464
            FLWR+KKVSG V+G AT  W+LFEL++Y+LLTL  H+ ILALA+ FLWS+A+TFI+K PP
Sbjct  66   FLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHVSILALAVLFLWSSATTFIHKKPP  125

Query  465  QIPSVILPQDTVLNVASALRIEINRTLAVL  554
             IP V +P++ VL +AS LRIEINR   +L
Sbjct  126  HIPEVHIPEEVVLQLASGLRIEINRGFTIL  155



>ref|XP_007139767.1| hypothetical protein PHAVU_008G057300g [Phaseolus vulgaris]
 gb|ESW11761.1| hypothetical protein PHAVU_008G057300g [Phaseolus vulgaris]
Length=256

 Score =   174 bits (441),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 118/150 (79%), Gaps = 2/150 (1%)
 Frame = +3

Query  105  ETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGKPADI  284
            E++++KIS+KL GHDSSSS   D    K    +VK K++RLFGRER VH VLG GKPAD+
Sbjct  17   ESLLDKISEKLHGHDSSSSSDSDSE--KTVTSSVKDKVFRLFGRERPVHSVLGAGKPADV  74

Query  285  FLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPP  464
             LWR+KK+S  V+G AT +WVLFEL+EYH LTLVCHILIL LA+ FLWSNA TFI+KSPP
Sbjct  75   LLWRNKKISAGVLGGATAVWVLFELLEYHFLTLVCHILILLLAVLFLWSNAHTFIHKSPP  134

Query  465  QIPSVILPQDTVLNVASALRIEINRTLAVL  554
            +IP V LP++ +L VAS LRIEINR  AVL
Sbjct  135  RIPDVHLPEEPILQVASVLRIEINRGFAVL  164



>emb|CDY24806.1| BnaA08g15040D [Brassica napus]
Length=274

 Score =   174 bits (441),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = +3

Query  216  IYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHI  395
            +YRLFGRE+ VHKVLGGGKPADIF+W+DKK+SG V+G AT  WVLFELMEYHLLTL+CH+
Sbjct  69   VYRLFGREKPVHKVLGGGKPADIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTLLCHV  128

Query  396  LILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            +I+ LA+ FLWSNA+ FI+KSPP+IP V +P++ VL +AS LRIEINR    L
Sbjct  129  MIVVLAVLFLWSNATMFIHKSPPKIPEVHIPEEPVLQLASGLRIEINRGFYSL  181



>ref|XP_002869770.1| VIRB2-interacting protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46029.1| VIRB2-interacting protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=272

 Score =   174 bits (441),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = +3

Query  216  IYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHI  395
            +YRLFGRE+ VHKVLGGGKPADIF+W++KK+SG V+G AT  WV+FELMEYHLLTL+CH+
Sbjct  67   VYRLFGREQPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVVFELMEYHLLTLLCHV  126

Query  396  LILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            +I+ LA+ FLWSNA+ FINKSPP+IP V +P++ +L +AS LRIEINR  + L
Sbjct  127  MIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSTL  179



>ref|XP_007209494.1| hypothetical protein PRUPE_ppa010244mg [Prunus persica]
 gb|EMJ10693.1| hypothetical protein PRUPE_ppa010244mg [Prunus persica]
Length=257

 Score =   174 bits (440),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 119/166 (72%), Gaps = 5/166 (3%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKP----SADAVKAKIYRLFGR  236
            MA+H  +  + AE++M+KI+DK+ GHDS  S + +   +K      A ++KAK Y LFGR
Sbjct  1    MAEHTEEVKA-AESLMDKIADKIHGHDSPVSPAVESLHEKAVSSGHAASLKAKAYSLFGR  59

Query  237  ERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAI  416
            E+ VH V GGGK AD+FLWRDKK S +V+   T IWV FEL+ YHLLTL+ H LIL LA+
Sbjct  60   EKPVHNVFGGGKAADVFLWRDKKGSASVLIAITIIWVFFELLGYHLLTLMAHCLILVLAM  119

Query  417  SFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
             FLWSNASTFINKSPP+IP V +P+  VL +ASA+ IEINR   +L
Sbjct  120  LFLWSNASTFINKSPPRIPQVKIPEKPVLQIASAITIEINRAFVIL  165



>ref|NP_001239653.1| uncharacterized protein LOC100793862 [Glycine max]
 gb|ACU21118.1| unknown [Glycine max]
Length=257

 Score =   173 bits (439),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 120/150 (80%), Gaps = 0/150 (0%)
 Frame = +3

Query  105  ETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGKPADI  284
            E++++KI++KL GHDSSSS S D  ++K    +VK +++RLFGRER VH V G GKPAD+
Sbjct  16   ESLLDKITEKLHGHDSSSSSSSDSDSEKTVTSSVKDRVFRLFGRERPVHSVFGAGKPADV  75

Query  285  FLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPP  464
             LWR+KK+S  V+G AT +WVLFEL+EYHLLTLVCHILIL LA+ FLWSNA TFI+KSPP
Sbjct  76   LLWRNKKISAGVLGGATAVWVLFELLEYHLLTLVCHILILLLAVLFLWSNAHTFIHKSPP  135

Query  465  QIPSVILPQDTVLNVASALRIEINRTLAVL  554
            +IP V LP++    VASALRIEINR  A+L
Sbjct  136  RIPEVHLPEEPFQQVASALRIEINRGFAIL  165



>gb|KDO86332.1| hypothetical protein CISIN_1g025719mg [Citrus sinensis]
Length=213

 Score =   172 bits (435),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = +3

Query  81   AGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADA-VKAKIYRLFGRERHVHKV  257
            A   ++ AE  MEK+S+K+  HDSSSS S D   ++P+A + VKA IYRLFGRER VH+V
Sbjct  2    AEREENPAEPPMEKVSEKIHDHDSSSSSSSDSDNEEPAAQSSVKADIYRLFGRERPVHQV  61

Query  258  LGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNA  437
             GGGKPAD+FLWR+KK+S  V+G AT IWVLFEL EYHLLTLVCH LILALAI FLW+NA
Sbjct  62   FGGGKPADVFLWRNKKISAGVLGGATAIWVLFELFEYHLLTLVCHTLILALAILFLWANA  121

Query  438  STFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
             TFI K+PP IP V LP++  L VASA RIE+N   AVL
Sbjct  122  HTFIKKAPPCIPEVHLPEEPFLQVASAFRIELNHAFAVL  160



>emb|CDY05135.1| BnaC03g29330D [Brassica napus]
Length=313

 Score =   175 bits (443),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +3

Query  216  IYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHI  395
            +YRLFGRER VHKVLGGGKPADIF+W++KKVSG V+G AT  WVLFELMEYHLLTL+CH+
Sbjct  108  VYRLFGRERPVHKVLGGGKPADIFMWKNKKVSGGVLGGATVAWVLFELMEYHLLTLLCHV  167

Query  396  LILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            +I+ LA  FLWSNA+ FI KSPP+IP V +P+D +L +AS LRIEINR  + L
Sbjct  168  MIVTLAALFLWSNATMFIRKSPPKIPEVHIPEDPLLQLASGLRIEINRGFSSL  220



>ref|NP_194094.1| VIRB2-interacting protein 1 [Arabidopsis thaliana]
 sp|Q9SUR3.1|RTNLA_ARATH RecName: Full=Reticulon-like protein B1; Short=AtRTNLB1; AltName: 
Full=VirB2-interacting protein 1 [Arabidopsis thaliana]
 emb|CAA23029.1| putative protein [Arabidopsis thaliana]
 emb|CAB79318.1| putative protein [Arabidopsis thaliana]
 gb|AAK91338.1| AT4g23630/F9D16_100 [Arabidopsis thaliana]
 gb|AAM65433.1| unknown [Arabidopsis thaliana]
 gb|AAM91465.1| AT4g23630/F9D16_100 [Arabidopsis thaliana]
 gb|AEE84787.1| VIRB2-interacting protein 1 [Arabidopsis thaliana]
Length=275

 Score =   174 bits (440),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = +3

Query  216  IYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHI  395
            +YRLFGRE+ VHKVLGGGKPADIF+W++KK+SG V+G AT  WV+FELMEYHLLTL+CH+
Sbjct  70   VYRLFGREQPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVVFELMEYHLLTLLCHV  129

Query  396  LILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            +I+ LA+ FLWSNA+ FINKSPP+IP V +P++ +L +AS LRIEINR  + L
Sbjct  130  MIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSSL  182



>gb|AFK42059.1| unknown [Lotus japonicus]
Length=258

 Score =   173 bits (438),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 112/151 (74%), Gaps = 4/151 (3%)
 Frame = +3

Query  102  AETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGKPAD  281
             E++++KISDKL         S D  ++KPS  +VK KI+RLFGRE+ +H VLGGGKPAD
Sbjct  16   GESLLDKISDKLH----DHDSSSDSDSEKPSLSSVKQKIFRLFGREKPLHSVLGGGKPAD  71

Query  282  IFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSP  461
            + LW++KKVS   +G AT +W+ FEL+EYHLLTLVCHILIL++ + FLWSNA T ++K+P
Sbjct  72   VLLWKNKKVSAGALGVATAVWLFFELLEYHLLTLVCHILILSITLLFLWSNAHTLLHKAP  131

Query  462  PQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            P+IP   LP++  L +ASALRIEIN   A L
Sbjct  132  PRIPVFHLPEEPFLEIASALRIEINHGFAAL  162



>ref|XP_003528823.2| PREDICTED: reticulon-like protein B1-like [Glycine max]
Length=314

 Score =   174 bits (442),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 124/164 (76%), Gaps = 3/164 (2%)
 Frame = +3

Query  69   MADHAGDHDSLA--ETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRER  242
            MAD +    + A  E++++KI++K+ GHD SSS S+ D   K  + ++K K++RLFGRE+
Sbjct  59   MADESEHTAAPAAGESLLDKIAEKIHGHDDSSSSSDSDSDKK-ESSSIKEKVFRLFGREK  117

Query  243  HVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF  422
             VH VLGGGKPAD+ LWR+KK+S  V+G AT IW+ FEL+EYHLLTLVCHI IL LA+ F
Sbjct  118  PVHSVLGGGKPADVLLWRNKKISAGVLGVATAIWIFFELLEYHLLTLVCHISILLLAVLF  177

Query  423  LWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            LWSNA TFI+K+PP+IP V +P++ +L  ASAL IEINR  A L
Sbjct  178  LWSNAHTFIHKAPPRIPVVHIPEEPILQFASALTIEINRGFAAL  221



>ref|XP_010435260.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=273

 Score =   173 bits (439),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = +3

Query  216  IYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHI  395
            +YRLFGRER VHKVLGGGKPADIF+W++KK+SG V+G AT  WVLFELMEYHLL ++CH+
Sbjct  68   VYRLFGRERPVHKVLGGGKPADIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLAVLCHV  127

Query  396  LILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            +I+ALA+ FLWSNA+ FI+KSPP+IP V +P++ +L +AS LRIEINR  + L
Sbjct  128  MIVALAVLFLWSNATMFIHKSPPKIPEVHIPEEPLLQLASGLRIEINRGFSSL  180



>emb|CDY41666.1| BnaC03g62180D [Brassica napus]
Length=276

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = +3

Query  216  IYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHI  395
            +YRLFGRE+ VHKVLGGGKPADIF+W+DKK+SG V+G AT  WVLFELMEYHLLTL+CH+
Sbjct  71   VYRLFGREKPVHKVLGGGKPADIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTLLCHV  130

Query  396  LILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            +I+ LA+ FLWSN + FI+KSPP+IP V +P++ VL +AS LRIEINR  + L
Sbjct  131  MIVVLAVLFLWSNVTRFIHKSPPKIPQVHIPEEPVLQLASGLRIEINRGFSSL  183



>gb|KDO86331.1| hypothetical protein CISIN_1g025719mg [Citrus sinensis]
Length=249

 Score =   172 bits (436),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = +3

Query  81   AGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADA-VKAKIYRLFGRERHVHKV  257
            A   ++ AE  MEK+S+K+  HDSSSS S D   ++P+A + VKA IYRLFGRER VH+V
Sbjct  2    AEREENPAEPPMEKVSEKIHDHDSSSSSSSDSDNEEPAAQSSVKADIYRLFGRERPVHQV  61

Query  258  LGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNA  437
             GGGKPAD+FLWR+KK+S  V+G AT IWVLFEL EYHLLTLVCH LILALAI FLW+NA
Sbjct  62   FGGGKPADVFLWRNKKISAGVLGGATAIWVLFELFEYHLLTLVCHTLILALAILFLWANA  121

Query  438  STFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
             TFI K+PP IP V LP++  L VASA RIE+N   AVL
Sbjct  122  HTFIKKAPPCIPEVHLPEEPFLQVASAFRIELNHAFAVL  160



>ref|XP_006444935.1| hypothetical protein CICLE_v10021860mg [Citrus clementina]
 ref|XP_006491199.1| PREDICTED: reticulon-like protein B5-like [Citrus sinensis]
 gb|ESR58175.1| hypothetical protein CICLE_v10021860mg [Citrus clementina]
Length=249

 Score =   172 bits (435),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = +3

Query  81   AGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADA-VKAKIYRLFGRERHVHKV  257
            A   ++ AE  MEK+S+K+  HDSSSS S D   ++P+A + VKA IYRLFGRER VH+V
Sbjct  2    AEREENPAEPPMEKVSEKIHDHDSSSSSSSDSDNEEPAAQSSVKADIYRLFGRERPVHQV  61

Query  258  LGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNA  437
             GGGKPAD+FLWR+KK+S  V+G AT IWVLFEL EYHLLTLVCH LILALAI FLW+NA
Sbjct  62   FGGGKPADVFLWRNKKISAGVLGGATAIWVLFELFEYHLLTLVCHTLILALAILFLWANA  121

Query  438  STFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
             TFI K+PP IP V LP++  L VASA RIE+N   AVL
Sbjct  122  HTFIKKAPPCIPEVHLPEEPFLQVASAFRIELNHAFAVL  160



>ref|NP_001185307.1| reticulon-like protein B3 [Arabidopsis thaliana]
 gb|AEE34191.1| reticulon-like protein B3 [Arabidopsis thaliana]
Length=271

 Score =   172 bits (437),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 119/166 (72%), Gaps = 17/166 (10%)
 Frame = +3

Query  105  ETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGK----  272
            E++MEKIS+K+ GHD SSS S D   DK SA ++K KIYRLFGRE+ +HK+ GGGK    
Sbjct  9    ESIMEKISEKIHGHDDSSSSSSDSDDDKNSA-SLKTKIYRLFGREQPLHKLFGGGKHSEN  67

Query  273  ------------PADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAI  416
                         ADIFLWR+KKVSG V+G AT  W+LFEL+EY+LLTL  HI ILALA+
Sbjct  68   QDINERFGLVFAAADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILALAV  127

Query  417  SFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
             FLWS+ASTFI+KSP  IP V +P+D VL +AS LRIEINR   VL
Sbjct  128  LFLWSSASTFIHKSPLHIPEVHIPEDVVLQLASGLRIEINRGFTVL  173



>ref|XP_002870630.1| VIRB2-interacting protein 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46889.1| VIRB2-interacting protein 3 [Arabidopsis lyrata subsp. lyrata]
Length=257

 Score =   172 bits (435),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 112/159 (70%), Gaps = 4/159 (3%)
 Frame = +3

Query  87   DHDSLAETVMEKISDKLQGH---dssssdseddhadKPSADAVKAKIYRLFGRERHVHKV  257
            DH    E++MEKI +K+ GH    S S   +D  +   S+ + K+KIYRLFGRE+ VHKV
Sbjct  4    DHKH-EESIMEKIVEKIHGHGDSSSLSDSDDDKKSTSSSSSSFKSKIYRLFGREKPVHKV  62

Query  258  LGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNA  437
            LGGGKPADIFLWR+KKVSG V G  T  WVLFEL EYHLL  +CH  I ALA  FLWSNA
Sbjct  63   LGGGKPADIFLWRNKKVSGGVFGAVTASWVLFELFEYHLLAFLCHFAIFALAALFLWSNA  122

Query  438  STFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
             TFI+K+ P IP V +P+D VL + S LRIEINR L VL
Sbjct  123  CTFIHKASPHIPEVNIPEDPVLQLVSGLRIEINRGLTVL  161



>ref|XP_010092876.1| Reticulon-like protein [Morus notabilis]
 gb|EXB52694.1| Reticulon-like protein [Morus notabilis]
Length=255

 Score =   171 bits (434),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 117/162 (72%), Gaps = 0/162 (0%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            MA+ + +  S  ++V+EKI        SS S+SE +     S  +VKAKI+RLFGRE+ V
Sbjct  1    MAEPSENAKSTVDSVIEKIHGDDSSSSSSESESESEAVKPESPSSVKAKIFRLFGREKPV  60

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            H+VLGGGKPAD+ LWR+KK+S + +G  T  WV FEL+EYHLLTLVC+ LI++LAI FLW
Sbjct  61   HQVLGGGKPADVLLWRNKKISASFLGGVTGAWVFFELLEYHLLTLVCYTLIVSLAILFLW  120

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            SNA TFI+KSPP+IP V +P+D  L V SAL IEIN+  A L
Sbjct  121  SNAHTFIHKSPPRIPEVHIPEDPFLQVVSALTIEINQGFAAL  162



>ref|XP_004245560.1| PREDICTED: reticulon-like protein B4 [Solanum lycopersicum]
Length=270

 Score =   172 bits (435),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 116/172 (67%), Gaps = 12/172 (7%)
 Frame = +3

Query  75   DHAGDHDSLAETVMEKISDKLQ------------GHdssssdseddhadKPSADAVKAKI  218
            DH  + +   E++M+KIS+KL                 S  + +   +  P+  +  +K+
Sbjct  6    DHKVEKEEHDESLMDKISEKLHFSNHSSSPAPASSSSDSDDEKKKPTSPAPATSSFGSKV  65

Query  219  YRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHIL  398
             RLFGRER VHKV GGGKPAD+FLWR+KK+S   +G AT IWVLFE++EYHLLTL+CH L
Sbjct  66   RRLFGRERPVHKVFGGGKPADVFLWRNKKISAGFLGGATAIWVLFEVVEYHLLTLLCHGL  125

Query  399  ILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            ++ALA  FLWSNASTFI+KS P IP V +P+  VL  ASALR EINR LAVL
Sbjct  126  MIALAGLFLWSNASTFIHKSAPHIPEVHIPEKPVLEFASALRNEINRALAVL  177



>ref|XP_009380544.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=252

 Score =   171 bits (434),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 117/165 (71%), Gaps = 8/165 (5%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISD---KLQGHdssssdseddhadKPSADAVKAKIYRLFGRE  239
            MA+H+ +      TV EKI +   K  G  SSSSDSE D  +   + +VKAK+YRLFGRE
Sbjct  1    MAEHSEE-----STVTEKIEEEPRKPAGSSSSSSDSESDCEEPVQSSSVKAKVYRLFGRE  55

Query  240  RHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAIS  419
            + VH+VLGGGK AD+ LWRDKK+S   +  AT IWV+FEL+ YHLLT VCH LIL+L I 
Sbjct  56   KPVHQVLGGGKSADVMLWRDKKISAGALSAATAIWVMFELVGYHLLTFVCHGLILSLVIL  115

Query  420  FLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            FLWS A TFINKSPP+IP V +P+D  + VA  LR E+NR LAVL
Sbjct  116  FLWSKACTFINKSPPRIPEVSIPEDQAVQVARTLRYEMNRALAVL  160



>ref|XP_002301382.1| hypothetical protein POPTR_0002s16690g [Populus trichocarpa]
 gb|EEE80655.1| hypothetical protein POPTR_0002s16690g [Populus trichocarpa]
Length=251

 Score =   171 bits (433),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = +3

Query  81   AGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVL  260
            A   +S  E+VMEKI +K+  H+SSSSDSE D       ++VKAKI+RLFGRE+ VH VL
Sbjct  2    AEQSESPTESVMEKIIEKVHHHESSSSDSELDSDKPDPLESVKAKIWRLFGREKPVHHVL  61

Query  261  GGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNAS  440
            GGGKPAD+FLWR+KKVS  V+GF T +WVLFEL+EYHLLTLVCHILILA A+ FLWSNA 
Sbjct  62   GGGKPADVFLWRNKKVSAGVLGFVTAMWVLFELIEYHLLTLVCHILILAAALLFLWSNAC  121

Query  441  TFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            T INKSPP+IP V LP+  VL VASAL +EIN   A L
Sbjct  122  TLINKSPPRIPEVHLPEKLVLQVASALCVEINSAFAGL  159



>gb|KJB52682.1| hypothetical protein B456_008G272900 [Gossypium raimondii]
Length=183

 Score =   169 bits (428),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +3

Query  195  ADAVKAKIYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHL  374
            A A+KAK+YRLFGRE+ +H+VLG GKPADI LWR+KK+SG V+G  T++W LFE+++YHL
Sbjct  39   AVALKAKVYRLFGREKPLHQVLGAGKPADILLWRNKKLSGGVLGGVTSLWFLFEMLDYHL  98

Query  375  LTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            +TL+CH++ILAL++ FLWSNAS FIN SPP IP V++P+  +L  AS    EINRTL ++
Sbjct  99   ITLICHLMILALSVLFLWSNASNFINNSPPTIPEVVIPEKCLLKAASCFTFEINRTLDIV  158



>ref|XP_004308034.1| PREDICTED: reticulon-like protein B2 [Fragaria vesca subsp. vesca]
Length=275

 Score =   172 bits (435),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  198  DAVKAKIYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLL  377
            D+VK+  +R+FGRE+ VHKVLGGGKPAD+ LWRDKK S +V+G AT +W+ FE +EYHL+
Sbjct  64   DSVKSNKFRIFGREKPVHKVLGGGKPADVLLWRDKKESASVLGAATVLWIFFECLEYHLI  123

Query  378  TLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            TL CHI+IL LA+ FLWSN S+FINK+PP+IP V +P+  VL++ASALRIE+N+   VL
Sbjct  124  TLFCHIMILFLAVFFLWSNGSSFINKAPPEIPKVQIPEKCVLDIASALRIELNKGFHVL  182



>ref|NP_191715.2| reticulon-like protein B6 [Arabidopsis thaliana]
 sp|Q6DBN4.1|RTNLF_ARATH RecName: Full=Reticulon-like protein B6; Short=AtRTNLB6 [Arabidopsis 
thaliana]
 gb|AAT70439.1| At3g61560 [Arabidopsis thaliana]
 gb|AAV85700.1| At3g61560 [Arabidopsis thaliana]
 gb|AEE80222.1| reticulon-like protein B6 [Arabidopsis thaliana]
Length=253

 Score =   171 bits (433),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 115/151 (76%), Gaps = 3/151 (2%)
 Frame = +3

Query  105  ETVMEKISDKLQGHdssssdseddhadKP-SADAVKAKIYRLFGRERHVHKVLGGGKPAD  281
            E++MEKI+DK+   D  SS S D   +KP S  A+KAKIYRLFGRE+ VHKVLGGG PAD
Sbjct  13   ESLMEKIADKIH--DHDSSSSSDSEHEKPESPSALKAKIYRLFGREKPVHKVLGGGLPAD  70

Query  282  IFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSP  461
            +FLWRDKK+S +V+G AT IWVLFEL+EYH L+LVCHILI ALA  FL SNA  F+NK+P
Sbjct  71   VFLWRDKKLSASVLGVATAIWVLFELVEYHFLSLVCHILIFALAALFLLSNAHAFMNKTP  130

Query  462  PQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            P+IP + + ++  L + SALR E+N+   +L
Sbjct  131  PKIPEIHIKEEHFLMIVSALRNELNQAFVIL  161



>ref|XP_004298843.1| PREDICTED: reticulon-like protein B2 [Fragaria vesca subsp. vesca]
Length=246

 Score =   171 bits (432),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 110/151 (73%), Gaps = 3/151 (2%)
 Frame = +3

Query  102  AETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGKPAD  281
            AE++MEKI DK+ GH  S +          S  +++ K++R+FGRER VH V GGGK AD
Sbjct  7    AESLMEKIEDKILGHHDSPAPEVVH---HDSPRSMQDKVFRIFGRERPVHHVFGGGKLAD  63

Query  282  IFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSP  461
            IFLWRDKK+SG ++G AT +W+LFEL+EYHLLTLV H+LI A+ + FLWSN   FINKSP
Sbjct  64   IFLWRDKKLSGGILGGATVMWLLFELLEYHLLTLVAHVLIAAITLFFLWSNGLGFINKSP  123

Query  462  PQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            P+IP + +P+ T+L + S++  EINR L V+
Sbjct  124  PKIPEIQIPEKTLLQIVSSITFEINRALVVI  154



>ref|XP_009349323.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=259

 Score =   171 bits (432),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 123/168 (73%), Gaps = 6/168 (4%)
 Frame = +3

Query  69   MAD--HAGDHDSLAETVMEKISDKLQG----HdssssdseddhadKPSADAVKAKIYRLF  230
            MAD  +AG       +++EKI +K+ G      SSSS   DD   +  A++VKAK++R+F
Sbjct  1    MADEKNAGSPVEHEPSLLEKIGEKIHGGDRHSSSSSSSDSDDEKSEKKAESVKAKVFRIF  60

Query  231  GRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILAL  410
            GRE+ VH VLGGGK AD+FLWR+KKVSG V+G AT +WVLFEL++YHLLTLV HILI  L
Sbjct  61   GREKPVHHVLGGGKSADVFLWRNKKVSGGVLGGATVVWVLFELLQYHLLTLVAHILIATL  120

Query  411  AISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            AI FLWSNA TFI+K+PP+IP V LP++  L VAS LR+ IN + A+L
Sbjct  121  AILFLWSNAHTFIHKTPPRIPEVRLPEEPFLQVASELRVVINCSFALL  168



>ref|XP_006402470.1| hypothetical protein EUTSA_v10006190mg [Eutrema salsugineum]
 gb|ESQ43923.1| hypothetical protein EUTSA_v10006190mg [Eutrema salsugineum]
Length=253

 Score =   171 bits (432),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 119/163 (73%), Gaps = 3/163 (2%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKP-SADAVKAKIYRLFGRERH  245
            MAD         E+++EKI++K+   D  SS S +   +KP S  A+KAKIYRLFGRE+ 
Sbjct  1    MADVLEKSVPTEESLIEKIAEKIH--DHDSSSSSESEHEKPDSPSALKAKIYRLFGREKP  58

Query  246  VHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFL  425
            VHKVLGGG PAD+FLWRDKK+S AV+G AT IWVLFEL+EYH L+LVCHILI ALA+ FL
Sbjct  59   VHKVLGGGLPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHFLSLVCHILIFALAVLFL  118

Query  426  WSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
             SNA  F+ KSPP+IP + + ++  L +ASALR E+N+   +L
Sbjct  119  LSNAHAFMKKSPPKIPEIHIKEEHFLLIASALRNELNQAFVIL  161



>ref|XP_009338786.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=259

 Score =   170 bits (431),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 122/168 (73%), Gaps = 6/168 (4%)
 Frame = +3

Query  69   MAD--HAGDHDSLAETVMEKISDKLQG----HdssssdseddhadKPSADAVKAKIYRLF  230
            MAD  +AG       +++EKI +K+ G      SSSS   DD   +  A++VKAK++R+F
Sbjct  1    MADEKNAGSPVEHEPSLLEKIGEKIHGGDRHSSSSSSSDSDDEKSEKKAESVKAKVFRIF  60

Query  231  GRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILAL  410
            GRE+ VH VLGGGK AD+FLWR+KKVSG V+G AT +WVLFEL++YHLLTLV HILI  L
Sbjct  61   GREKPVHHVLGGGKSADVFLWRNKKVSGGVLGGATVVWVLFELLQYHLLTLVAHILIATL  120

Query  411  AISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            AI FLWSNA TFI+K+PP+IP V LP++  L VAS LR+ IN   A+L
Sbjct  121  AILFLWSNAHTFIHKTPPRIPEVRLPEEPFLQVASELRVVINCAFALL  168



>gb|KJB52679.1| hypothetical protein B456_008G272900 [Gossypium raimondii]
Length=247

 Score =   170 bits (430),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +3

Query  195  ADAVKAKIYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHL  374
            A A+KAK+YRLFGRE+ +H+VLG GKPADI LWR+KK+SG V+G  T++W LFE+++YHL
Sbjct  39   AVALKAKVYRLFGREKPLHQVLGAGKPADILLWRNKKLSGGVLGGVTSLWFLFEMLDYHL  98

Query  375  LTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            +TL+CH++ILAL++ FLWSNAS FIN SPP IP V++P+  +L  AS    EINRTL ++
Sbjct  99   ITLICHLMILALSVLFLWSNASNFINNSPPTIPEVVIPEKCLLKAASCFTFEINRTLDIV  158



>ref|XP_006291739.1| hypothetical protein CARUB_v10017909mg [Capsella rubella]
 gb|EOA24637.1| hypothetical protein CARUB_v10017909mg [Capsella rubella]
Length=249

 Score =   169 bits (429),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 116/163 (71%), Gaps = 7/163 (4%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKP-SADAVKAKIYRLFGRERH  245
            MA+         E++MEKI      H   SS S D   +KP S  A+KAKIYRLFGRE+ 
Sbjct  1    MAEELEKPIPTEESLMEKI------HGHDSSSSSDSEHEKPESPSALKAKIYRLFGREKP  54

Query  246  VHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFL  425
            VHKVLGGG PAD+FLWRDKK+S AV+G AT IWVLFEL+EYH L+LVCHILI ALA+ FL
Sbjct  55   VHKVLGGGLPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHFLSLVCHILIFALAVLFL  114

Query  426  WSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
             SNA  F+NK+PP+IP + + ++  + +ASALR E+N+   +L
Sbjct  115  LSNAHAFMNKTPPKIPEIHIKEEHFILIASALRNELNQAFVIL  157



>dbj|BAH57206.1| AT1G64090 [Arabidopsis thaliana]
Length=240

 Score =   169 bits (428),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +3

Query  192  SADAVKAKIYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYH  371
            ++ ++K KIYRLFGRE+ +HK+ GGGKPADIFLWR+KKVSG V+G AT  W+LFEL+EY+
Sbjct  22   NSASLKTKIYRLFGREQPLHKLFGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYN  81

Query  372  LLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAV  551
            LLTL  HI ILALA+ FLWS+ASTFI+KSP  IP V +P+D VL +AS LRIEINR   V
Sbjct  82   LLTLFGHISILALAVLFLWSSASTFIHKSPLHIPEVHIPEDVVLQLASGLRIEINRGFTV  141

Query  552  L  554
            L
Sbjct  142  L  142



>ref|NP_198975.1| reticulon-like protein B4 [Arabidopsis thaliana]
 sp|Q9FFS0.1|RTNLD_ARATH RecName: Full=Reticulon-like protein B4; Short=AtRTNLB4; AltName: 
Full=VirB2-interacting protein 3 [Arabidopsis thaliana]
 dbj|BAB11466.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK59673.1| unknown protein [Arabidopsis thaliana]
 gb|AAL15269.1| AT5g41600/MBK23_13 [Arabidopsis thaliana]
 gb|AAN12890.1| unknown protein [Arabidopsis thaliana]
 gb|AED94696.1| reticulon-like protein B4 [Arabidopsis thaliana]
Length=257

 Score =   169 bits (429),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 113/159 (71%), Gaps = 4/159 (3%)
 Frame = +3

Query  87   DHDSLAETVMEKISDKLQGH---dssssdseddhadKPSADAVKAKIYRLFGRERHVHKV  257
            DH    E+++EKI +K+ GH    S S   +D  +   S+ + K+KIYRLFGRE+ VHKV
Sbjct  4    DHKH-EESILEKIVEKIHGHGDSSSLSDSDDDKKSTSSSSSSFKSKIYRLFGREKPVHKV  62

Query  258  LGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNA  437
            LGGGKPADIFLWR+KKVSG V+G  T  WVLFEL EYHLL  +CH  I ALA  FLWSNA
Sbjct  63   LGGGKPADIFLWRNKKVSGGVLGAVTASWVLFELFEYHLLAFLCHFAIFALAALFLWSNA  122

Query  438  STFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
             TFI+KS P IP V +P+D +L + S LRIEINR L +L
Sbjct  123  CTFIHKSTPHIPEVHIPEDPILQLVSGLRIEINRGLTLL  161



>ref|XP_009112802.1| PREDICTED: reticulon-like protein B3 [Brassica rapa]
Length=250

 Score =   169 bits (429),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 111/150 (74%), Gaps = 3/150 (2%)
 Frame = +3

Query  105  ETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGKPADI  284
            E++MEKI++K+         S  D  D+  A ++K KI+RLFGRE+ VHKV GGGKPADI
Sbjct  9    ESIMEKIAEKIH---GHDGSSSSDSDDEKKASSIKTKIFRLFGREKPVHKVFGGGKPADI  65

Query  285  FLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPP  464
            FLWR+KKVSG V+G AT  W+LFEL++Y+LLTL  H+ ILALA+ F W +A+TFI+K PP
Sbjct  66   FLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHVSILALAVLFSWPSATTFIHKKPP  125

Query  465  QIPSVILPQDTVLNVASALRIEINRTLAVL  554
             IP V +P++ VL +AS LRIEINR   +L
Sbjct  126  HIPEVHIPEEVVLQLASGLRIEINRGFTIL  155



>gb|KHF99856.1| Reticulon-like protein B1 [Gossypium arboreum]
Length=174

 Score =   167 bits (422),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = +3

Query  195  ADAVKAKIYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHL  374
            A A+KAK+YRLFGRE+ +H+VLG GKPADI LWR+KK+SG V+G  T++W LFE+++YHL
Sbjct  39   AVALKAKVYRLFGREKPLHQVLGAGKPADILLWRNKKLSGGVLGGVTSLWFLFEMLDYHL  98

Query  375  LTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            +TL+CH++ILAL++ FLWSN S FIN SPP IP V++P+  +L  AS    EINRTL ++
Sbjct  99   ITLICHLMILALSVLFLWSNVSNFINNSPPTIPEVVIPEKCLLKAASCFTFEINRTLDIV  158



>ref|XP_002874678.1| VIRB2-interacting protein 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50937.1| VIRB2-interacting protein 2 [Arabidopsis lyrata subsp. lyrata]
Length=271

 Score =   170 bits (430),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +3

Query  216  IYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHI  395
            +YRLFGRER VHKVLGGGKPADIF+W++KK+SG V G AT  WVLFELMEYHLLTL+CH+
Sbjct  66   VYRLFGRERPVHKVLGGGKPADIFMWKNKKMSGGVFGGATVAWVLFELMEYHLLTLLCHV  125

Query  396  LILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            +I+ALA+ FLWSNA+ FI+KSPP+IP V +P++ +L + S LRIEIN   + L
Sbjct  126  MIVALAVLFLWSNATMFIHKSPPKIPEVHIPEEPLLQLVSGLRIEINCGFSSL  178



>ref|XP_011023265.1| PREDICTED: reticulon-like protein B5 [Populus euphratica]
 ref|XP_011023266.1| PREDICTED: reticulon-like protein B5 [Populus euphratica]
Length=252

 Score =   169 bits (427),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/158 (64%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = +3

Query  81   AGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVL  260
            A   +S  +++MEKI +K+  H+SSSSDSE D       ++VKAKI+RLFGRE+ VH VL
Sbjct  2    AEQSESPTKSIMEKIIEKVHHHESSSSDSELDSDKPDRLESVKAKIWRLFGREKPVHHVL  61

Query  261  GGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNAS  440
            GGGKPAD+FLWR+KKVS  V+GF T +WVLFEL+EYHLLTLVCHILILA A+ FLWSNA 
Sbjct  62   GGGKPADVFLWRNKKVSAGVLGFVTAMWVLFELIEYHLLTLVCHILILAAALLFLWSNAC  121

Query  441  TFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            T INKSPP+IP + LP+  VL VASAL +EIN   A L
Sbjct  122  TLINKSPPRIPEIHLPEKLVLQVASALCVEINSAFAGL  159



>ref|XP_010469092.1| PREDICTED: reticulon-like protein B6 [Camelina sativa]
Length=249

 Score =   168 bits (426),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 114/163 (70%), Gaps = 7/163 (4%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKP-SADAVKAKIYRLFGRERH  245
            MA+         E++MEKI      H   SS S D   +KP S  A+KAKIYRLFGRE+ 
Sbjct  1    MAEELEKTMPTEESLMEKI------HGHDSSSSSDSEHEKPESPSALKAKIYRLFGREKP  54

Query  246  VHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFL  425
            VHKVLGGG PAD+FLWRDKK+S AV+G AT IWVLFEL+EYH L+LVCHILI ALA  FL
Sbjct  55   VHKVLGGGLPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHFLSLVCHILIFALAALFL  114

Query  426  WSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
             SNA  F+NK+PP+IP + + ++  L +ASALR E+N+    L
Sbjct  115  LSNAHAFMNKTPPKIPEISVKEEHFLLIASALRNELNQAFVTL  157



>gb|KCW72351.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=224

 Score =   167 bits (424),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 119/170 (70%), Gaps = 9/170 (5%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadK--------PSADAVKAKIYR  224
            MADH  +    AE+++EK ++K+ GH    S S  D  D+        P  +  K KI+R
Sbjct  1    MADHE-EQPHKAESLLEKFAEKIHGHHHDGSSSSSDSDDERKKPSAPPPPKEEEKPKIFR  59

Query  225  LFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILIL  404
            LFGRER VHKVLGGGKPAD+FLWR+KK+S   +G AT +W+LFEL+EYHLLTLVCH+LIL
Sbjct  60   LFGRERPVHKVLGGGKPADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLIL  119

Query  405  ALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
             LAI FLWSNA+TFI+K PP IP V +P+  VL  AS L  EIN+ +A L
Sbjct  120  GLAILFLWSNATTFIHKMPPHIPEVSIPEKPVLEFASVLSSEINQGIATL  169



>ref|NP_001240231.1| uncharacterized protein LOC100778096 [Glycine max]
 gb|ACU20901.1| unknown [Glycine max]
Length=259

 Score =   169 bits (427),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 120/152 (79%), Gaps = 2/152 (1%)
 Frame = +3

Query  105  ETVMEKISDKLQGHdssssdseddha--dKPSADAVKAKIYRLFGRERHVHKVLGGGKPA  278
            E++++KI++KL GHDSSSS S D  +  +K    +VK K++RLFGRER VH V G GKPA
Sbjct  16   ESLLDKITEKLHGHDSSSSSSSDSDSDSEKTVTSSVKDKVFRLFGRERPVHSVFGAGKPA  75

Query  279  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKS  458
            D+ LWR+KK+S  ++G AT +WVLFEL+EYHLLTLVCHILIL LA+ FLWSNA TFI+KS
Sbjct  76   DVLLWRNKKISAGMLGGATAVWVLFELLEYHLLTLVCHILILLLAVLFLWSNAHTFIHKS  135

Query  459  PPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            PP+IP   LP++  L VASALRIE+NR  AVL
Sbjct  136  PPRIPEFHLPEEPFLQVASALRIEVNRGFAVL  167



>gb|KHN40449.1| Reticulon-like protein B5 [Glycine soja]
Length=259

 Score =   169 bits (427),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 120/152 (79%), Gaps = 2/152 (1%)
 Frame = +3

Query  105  ETVMEKISDKLQGHdssssdseddha--dKPSADAVKAKIYRLFGRERHVHKVLGGGKPA  278
            E++++KI++KL GHDSSSS S D  +  +K    +VK K++RLFGRER VH V G GKPA
Sbjct  16   ESLLDKITEKLHGHDSSSSSSSDSDSDSEKTVTSSVKDKVFRLFGRERPVHSVFGAGKPA  75

Query  279  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKS  458
            D+ LWR+KK+S  ++G AT +WVLFEL+EYHLLTLVCHILIL LA+ FLWSNA TFI+KS
Sbjct  76   DVLLWRNKKISAGMLGGATAVWVLFELLEYHLLTLVCHILILLLAVLFLWSNAHTFIHKS  135

Query  459  PPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            PP+IP   LP++  L VASALRIE+NR  AVL
Sbjct  136  PPRIPEFHLPEEPFLQVASALRIEVNRGFAVL  167



>ref|XP_010055800.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW72349.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=262

 Score =   169 bits (427),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +3

Query  216  IYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHI  395
            I+RLFGRER VHKVLGGGKPAD+FLWR+KK+S   +G AT +W+LFEL+EYHLLTLVCH+
Sbjct  57   IFRLFGRERPVHKVLGGGKPADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHV  116

Query  396  LILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            LIL LAI FLWSNA+TFI+K PP IP V +P+  VL  AS L  EIN+ +A L
Sbjct  117  LILGLAILFLWSNATTFIHKMPPHIPEVSIPEKPVLEFASVLSSEINQGIATL  169



>gb|KCW72350.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=232

 Score =   167 bits (424),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +3

Query  216  IYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHI  395
            I+RLFGRER VHKVLGGGKPAD+FLWR+KK+S   +G AT +W+LFEL+EYHLLTLVCH+
Sbjct  57   IFRLFGRERPVHKVLGGGKPADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHV  116

Query  396  LILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            LIL LAI FLWSNA+TFI+K PP IP V +P+  VL  AS L  EIN+ +A L
Sbjct  117  LILGLAILFLWSNATTFIHKMPPHIPEVSIPEKPVLEFASVLSSEINQGIATL  169



>gb|KCW72347.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=265

 Score =   169 bits (427),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +3

Query  216  IYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHI  395
            I+RLFGRER VHKVLGGGKPAD+FLWR+KK+S   +G AT +W+LFEL+EYHLLTLVCH+
Sbjct  57   IFRLFGRERPVHKVLGGGKPADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHV  116

Query  396  LILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            LIL LAI FLWSNA+TFI+K PP IP V +P+  VL  AS L  EIN+ +A L
Sbjct  117  LILGLAILFLWSNATTFIHKMPPHIPEVSIPEKPVLEFASVLSSEINQGIATL  169



>ref|XP_011073415.1| PREDICTED: reticulon-like protein B1 isoform X2 [Sesamum indicum]
Length=172

 Score =   165 bits (418),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 117/162 (72%), Gaps = 7/162 (4%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHV  248
            M +H  + +   E+++EKI+DK+ GHDSSSS S  D  D     ++KAK+YRLFGRE+ V
Sbjct  1    MDEHHKEEEKKDESLIEKIADKVHGHDSSSSSSSSDSDDD-KTSSLKAKVYRLFGREKPV  59

Query  249  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW  428
            H+VLGGGKPADIFLW          G AT IWVLF+++EYHLLTLVCH LI+ LA+ FLW
Sbjct  60   HRVLGGGKPADIFLWX------XXXGGATAIWVLFDVLEYHLLTLVCHGLIVGLALLFLW  113

Query  429  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            S+  TFINKSPP+IP V +P++  L  ASALR+EIN   AVL
Sbjct  114  SSIMTFINKSPPRIPEVSIPEEPALKFASALRVEINHGFAVL  155



>ref|XP_006343915.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=270

 Score =   168 bits (426),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +3

Query  189  PSADAVKAKIYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEY  368
            P   +  +K+ RLFGRER VHKV GGGKPAD+FLWR+KK+S   +G AT IWVLFE++EY
Sbjct  56   PETSSFGSKVRRLFGRERPVHKVFGGGKPADVFLWRNKKISAGFLGGATAIWVLFEVVEY  115

Query  369  HLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLA  548
            HLLTL+CH L++ALA  FLWSNASTFI+KS P IP V +P+  VL  ASALR EINR LA
Sbjct  116  HLLTLLCHGLMVALAGLFLWSNASTFIHKSAPHIPEVHIPEKPVLAFASALRNEINRALA  175

Query  549  VL  554
            VL
Sbjct  176  VL  177



>gb|KCW72348.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=296

 Score =   169 bits (427),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +3

Query  216  IYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHI  395
            I+RLFGRER VHKVLGGGKPAD+FLWR+KK+S   +G AT +W+LFEL+EYHLLTLVCH+
Sbjct  57   IFRLFGRERPVHKVLGGGKPADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHV  116

Query  396  LILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            LIL LAI FLWSNA+TFI+K PP IP V +P+  VL  AS L  EIN+ +A L
Sbjct  117  LILGLAILFLWSNATTFIHKMPPHIPEVSIPEKPVLEFASVLSSEINQGIATL  169



>ref|XP_009345612.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
 ref|XP_009345624.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=260

 Score =   168 bits (425),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 121/169 (72%), Gaps = 7/169 (4%)
 Frame = +3

Query  69   MAD---HAGDHDSLAETVMEKISDKLQ--GHdssssdseddhadKPS--ADAVKAKIYRL  227
            MAD   HAG       +++EKI DK+    HDSSSS S D   +K     ++VKAK++R+
Sbjct  1    MADEKEHAGSSVEDEPSLLEKIGDKIHVGDHDSSSSSSSDSDNEKSEKKTESVKAKVFRI  60

Query  228  FGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILA  407
            FGRER VH VLGGGKPAD+FLWR+KKVS  V+   T IWVLFEL+EYHLLTLV +ILI A
Sbjct  61   FGRERPVHHVLGGGKPADVFLWRNKKVSAGVLIGTTAIWVLFELLEYHLLTLVGYILICA  120

Query  408  LAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            LAI FLWSNA  FI+K+PP IP V LP++  L VAS LR++IN   A+L
Sbjct  121  LAILFLWSNAHAFIHKTPPHIPKVHLPEEPFLQVASELRVQINCGFALL  169



>gb|KHN29299.1| Reticulon-like protein B5 [Glycine soja]
Length=250

 Score =   167 bits (423),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 115/149 (77%), Gaps = 0/149 (0%)
 Frame = +3

Query  108  TVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRERHVHKVLGGGKPADIF  287
            T    I++KL GHDSSSS S D  ++K    +VK +++RLFGRER VH V G GKPAD+ 
Sbjct  10   TTGAPITEKLHGHDSSSSSSSDSDSEKTVTSSVKDRVFRLFGRERPVHSVFGAGKPADVL  69

Query  288  LWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQ  467
            LWR+KK+S  V+G AT +WVLFEL+EYHLLTLVCHILIL LA+ FLWSNA TFI+KSPP+
Sbjct  70   LWRNKKISAGVLGGATAVWVLFELLEYHLLTLVCHILILLLAVLFLWSNAHTFIHKSPPR  129

Query  468  IPSVILPQDTVLNVASALRIEINRTLAVL  554
            IP V LP++    VASALRIEINR  A+L
Sbjct  130  IPEVHLPEEPFQQVASALRIEINRGFAIL  158



>ref|XP_008375931.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=255

 Score =   167 bits (424),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 116/164 (71%), Gaps = 2/164 (1%)
 Frame = +3

Query  69   MAD--HAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRLFGRER  242
            MAD  +AG       ++MEKI         SSS   D+   +  A++VK K++R+FGRE+
Sbjct  1    MADEKNAGSPVEHEPSLMEKIHGGDHDSSLSSSSDSDNEKSEKKAESVKTKVFRIFGREK  60

Query  243  HVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF  422
             VH VLGGGK AD+FLWR+KKVSG V+G AT +W+LFEL+EY+LLTLV HILI  LAI F
Sbjct  61   PVHHVLGGGKTADVFLWRNKKVSGGVLGGATVVWILFELLEYNLLTLVAHILIATLAILF  120

Query  423  LWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            LWSNA TFI+K+PP+IP V LP++  L VAS LR+ IN   A+L
Sbjct  121  LWSNAHTFIHKTPPRIPEVRLPEEPFLQVASELRVVINCAFALL  164



>ref|XP_008377768.1| PREDICTED: reticulon-like protein B2 [Malus domestica]
Length=258

 Score =   167 bits (424),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 110/164 (67%), Gaps = 21/164 (13%)
 Frame = +3

Query  102  AETVMEKISDKLQGHdssssdseddhadKPSADAV-------------KAKIYRLFGRER  242
            AE+ M++ISDK+ GHDSSS+         PS+ AV             K+K+ RLFGRE+
Sbjct  11   AESSMDRISDKIHGHDSSSAV--------PSSGAVHDKGIGGGHSTSLKSKVNRLFGREK  62

Query  243  HVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF  422
             VH V GGGK AD+FLWRDKK S  V+   T IWV FEL EYHLLTLV H+LIL +A  F
Sbjct  63   PVHHVFGGGKAADVFLWRDKKASAGVLIALTIIWVFFELFEYHLLTLVSHLLILGIASLF  122

Query  423  LWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            LWSNASTFINKSPP IP V +P+  VL +AS + +EINR   +L
Sbjct  123  LWSNASTFINKSPPHIPQVQIPEKLVLQIASVITLEINRAFVIL  166



>ref|XP_009334492.1| PREDICTED: reticulon-like protein B2 [Pyrus x bretschneideri]
Length=258

 Score =   167 bits (424),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 108/156 (69%), Gaps = 5/156 (3%)
 Frame = +3

Query  102  AETVMEKISDKLQGHdssssdseddhadKPS-----ADAVKAKIYRLFGRERHVHKVLGG  266
            AE++M++ISDK+ GHDSSS                 + ++K+K+ RLFGRE+ VH V GG
Sbjct  11   AESLMDRISDKIHGHDSSSVVPSSGVVHDKGIGGGHSTSLKSKVNRLFGREKPVHHVFGG  70

Query  267  GKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTF  446
            GK AD+FLWRDKK S  V+   T IWV FEL EYHLLTLV H+LIL +A  FLWSNASTF
Sbjct  71   GKAADVFLWRDKKASAGVLIALTIIWVFFELFEYHLLTLVSHLLILGIASLFLWSNASTF  130

Query  447  INKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            INKSPP IP V +P+  VL +AS + +EINR   +L
Sbjct  131  INKSPPHIPQVQIPEKPVLQIASVITMEINRAFVIL  166



>ref|XP_008367699.1| PREDICTED: reticulon-like protein B2 [Malus domestica]
Length=258

 Score =   167 bits (424),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 116/167 (69%), Gaps = 6/167 (4%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhadKPS-----ADAVKAKIYRLFG  233
            MA+HA D    AE++++K+ DK+ GHDSSS+    +           + ++K+K+ RLFG
Sbjct  1    MAEHA-DEVKAAESLLDKVPDKIHGHDSSSALPPSEAVRDKGIGGGYSASLKSKVNRLFG  59

Query  234  RERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALA  413
            RE+ VH V GGGK ADIFLWR KKVS  V+   T IWV FEL+EYHLLTLV H+LI+ + 
Sbjct  60   REKPVHHVFGGGKAADIFLWRGKKVSAGVLIALTIIWVFFELLEYHLLTLVSHLLIIGIV  119

Query  414  ISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            + FLWSNASTFINKSPP IP V +P+  VL +ASA+  EINR   ++
Sbjct  120  MLFLWSNASTFINKSPPHIPQVQIPEKPVLQIASAITSEINRAFVIV  166



>ref|XP_010512508.1| PREDICTED: reticulon-like protein B6 [Camelina sativa]
Length=249

 Score =   167 bits (422),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 98/124 (79%), Gaps = 1/124 (1%)
 Frame = +3

Query  186  KP-SADAVKAKIYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELM  362
            KP S  A+KAKIYRLFGRE+ VHKVLGGG PAD+FLWRDKK+S AV+G AT IWVLFEL+
Sbjct  34   KPESPSALKAKIYRLFGREKPVHKVLGGGLPADVFLWRDKKLSAAVLGVATAIWVLFELV  93

Query  363  EYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRT  542
            EYH L+LVCHILI ALA  FL SNA  F+NK+PP+IP + + ++  L +ASALR E+N+ 
Sbjct  94   EYHFLSLVCHILIFALAALFLLSNAHAFMNKTPPKIPEISVKEEHFLLIASALRNELNQA  153

Query  543  LAVL  554
               L
Sbjct  154  FVTL  157



>ref|XP_009341126.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=260

 Score =   167 bits (423),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 121/169 (72%), Gaps = 7/169 (4%)
 Frame = +3

Query  69   MAD---HAGDHDSLAETVMEKISDKLQ--GHdssssdseddhadKPS--ADAVKAKIYRL  227
            MAD   HAG       +++EKI DK+    HDSSSS S D   +K     ++VKAK++R+
Sbjct  1    MADEKEHAGSPVEDEPSLLEKIGDKIHVGDHDSSSSSSSDSDNEKSEKKTESVKAKVFRI  60

Query  228  FGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILA  407
            FGRER VH VLGGGKPAD+FLWR+KKVS  V+   T IWVLFEL+EYHLLTLV +ILI A
Sbjct  61   FGRERPVHHVLGGGKPADVFLWRNKKVSAGVLIGTTAIWVLFELLEYHLLTLVGYILICA  120

Query  408  LAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            LAI FLWSNA  FI+K+PP IP V LP++  L VAS LR++IN   A+L
Sbjct  121  LAILFLWSNAHAFIHKTPPHIPKVHLPEEPFLQVASELRVQINCGFALL  169



>ref|XP_010413382.1| PREDICTED: reticulon-like protein B6 [Camelina sativa]
Length=241

 Score =   166 bits (421),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 98/124 (79%), Gaps = 1/124 (1%)
 Frame = +3

Query  186  KP-SADAVKAKIYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELM  362
            KP S  A+KAKIYRLFGRE+ VHKVLGGG PAD+FLWRDKK+S AV+G AT IWVLFEL+
Sbjct  26   KPESPSALKAKIYRLFGREKPVHKVLGGGLPADVFLWRDKKLSAAVLGVATAIWVLFELV  85

Query  363  EYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRT  542
            EYH L+LVCHILI ALA  FL SNA  F+NK+PP+IP + + ++  L +ASALR E+N+ 
Sbjct  86   EYHFLSLVCHILIFALAALFLLSNAHAFMNKTPPKIPEINVKEEHFLLIASALRNELNQA  145

Query  543  LAVL  554
               L
Sbjct  146  FVTL  149



>ref|XP_008344578.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=260

 Score =   167 bits (422),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 118/169 (70%), Gaps = 7/169 (4%)
 Frame = +3

Query  69   MAD---HAG----DHDSLAETVMEKISDKLQGHdssssdseddhadKPSADAVKAKIYRL  227
            MAD   H+G    D  SL E + +KI        SSSS   D+   +   ++VKAK++R+
Sbjct  1    MADEKEHSGSTVEDEPSLLEKMGDKIHGGDHHSSSSSSSDSDNEKSEKKTESVKAKVFRI  60

Query  228  FGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILA  407
            FGRER VH VLGGGK AD+FLWR+KKVS  V+  AT IWVLFEL++YHLLTLV HILI A
Sbjct  61   FGRERPVHHVLGGGKXADVFLWRNKKVSAGVLSGATVIWVLFELLQYHLLTLVGHILIGA  120

Query  408  LAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
            LAI FLWSNA  FI+K+PP+IP V LP++  L VAS LR++IN   A+L
Sbjct  121  LAILFLWSNAHAFIHKTPPRIPEVRLPEEPFLQVASELRVQINCAFALL  169



>ref|XP_004306726.1| PREDICTED: reticulon-like protein B5 [Fragaria vesca subsp. vesca]
Length=257

 Score =   167 bits (422),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 120/166 (72%), Gaps = 5/166 (3%)
 Frame = +3

Query  69   MADHAGDHDSLAETVMEKISDKLQGHdssssdseddhad---KPSAD-AVKAKIYRLFGR  236
            MA+H  D  +    +MEK+++K+  H  SSS S  D      KP+A+ + K K++RLFGR
Sbjct  1    MAEHGEDAKA-EHGLMEKMTEKIHDHHDSSSSSSSDSDTEKPKPAAEESPKEKVFRLFGR  59

Query  237  ERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAI  416
            ER VH VLGGGKPAD+FLWR+KK+S  V+G AT ++VLFEL+EYHLLTL+CHILI ALA+
Sbjct  60   ERPVHHVLGGGKPADVFLWRNKKISAGVLGGATVVYVLFELVEYHLLTLICHILIGALAV  119

Query  417  SFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL  554
             FLWSNA T  +K+ P IP V LP++  L VAS LR++IN   A+L
Sbjct  120  MFLWSNAHTIFHKTAPHIPEVSLPEEPFLQVASELRLQINWAFALL  165



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 603802497760