BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF040F11

Length=526
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009790112.1|  PREDICTED: aldehyde dehydrogenase                  200   3e-58   Nicotiana sylvestris
ref|XP_009593287.1|  PREDICTED: aldehyde dehydrogenase                  199   8e-58   Nicotiana tomentosiformis
ref|XP_006363887.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    199   9e-58   Solanum tuberosum [potatoes]
ref|XP_004242034.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    196   2e-56   
ref|XP_008219616.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    183   1e-51   Prunus mume [ume]
gb|EYU23872.1|  hypothetical protein MIMGU_mgv1a005640mg                178   7e-50   Erythranthe guttata [common monkey flower]
ref|XP_004290886.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    177   2e-49   Fragaria vesca subsp. vesca
sp|Q8VXQ2.1|ALDH_CRAPL  RecName: Full=Aldehyde dehydrogenase; Alt...    176   4e-49   Craterostigma plantagineum
ref|XP_004290887.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    175   9e-49   Fragaria vesca subsp. vesca
ref|XP_011069490.1|  PREDICTED: aldehyde dehydrogenase-like             174   3e-48   Sesamum indicum [beniseed]
gb|AGC65583.1|  fatty aldehyde dehydrogenase                            173   5e-48   Simmondsia chinensis [goatnut]
ref|XP_009379028.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    173   5e-48   Pyrus x bretschneideri [bai li]
gb|KEH40518.1|  NAD-dependent aldehyde dehydrogenase family protein     173   7e-48   Medicago truncatula
gb|ACJ85852.1|  unknown                                                 173   8e-48   Medicago truncatula
ref|XP_003544699.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    173   8e-48   Glycine max [soybeans]
ref|XP_007048537.1|  Aldehyde dehydrogenase 3I1 isoform 3               172   9e-48   
ref|XP_008378442.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    172   1e-47   
ref|XP_007048536.1|  Aldehyde dehydrogenase 3I1 isoform 2               173   1e-47   
ref|XP_007019116.1|  Aldehyde dehydrogenase 3H1 isoform 1               172   1e-47   
ref|XP_007048535.1|  Aldehyde dehydrogenase 3I1 isoform 1               173   1e-47   
ref|XP_007222253.1|  hypothetical protein PRUPE_ppa004751mg             172   2e-47   Prunus persica
ref|XP_007019117.1|  Aldehyde dehydrogenase 3H1 isoform 2               172   3e-47   
ref|XP_002306641.1|  the aldehyde dehydrogenase cp-ADH from C.pla...    171   3e-47   Populus trichocarpa [western balsam poplar]
ref|XP_002302229.2|  the aldehyde dehydrogenase cp-ADH from C.pla...    171   4e-47   
ref|XP_008365201.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    171   4e-47   Malus domestica [apple tree]
ref|XP_010999403.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    171   5e-47   Populus euphratica
ref|XP_011074837.1|  PREDICTED: aldehyde dehydrogenase                  171   5e-47   Sesamum indicum [beniseed]
ref|XP_011003449.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    171   5e-47   Populus euphratica
ref|XP_004498346.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    171   6e-47   Cicer arietinum [garbanzo]
gb|KDP32847.1|  hypothetical protein JCGZ_12139                         170   8e-47   Jatropha curcas
gb|KGN54554.1|  hypothetical protein Csa_4G361880                       170   1e-46   Cucumis sativus [cucumbers]
ref|XP_010243504.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    171   1e-46   Nelumbo nucifera [Indian lotus]
ref|XP_008368060.1|  PREDICTED: aldehyde dehydrogenase-like             160   1e-46   
ref|XP_010243505.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    171   1e-46   
ref|XP_011027504.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    169   1e-46   Populus euphratica
gb|KJB64494.1|  hypothetical protein B456_010G051500                    166   2e-46   Gossypium raimondii
emb|CBI19000.3|  unnamed protein product                                170   2e-46   Vitis vinifera
ref|XP_009379029.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    169   3e-46   Pyrus x bretschneideri [bai li]
ref|XP_010095408.1|  Aldehyde dehydrogenase family 3 member H1          169   3e-46   
ref|XP_010664200.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    169   3e-46   Vitis vinifera
ref|XP_003544698.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    169   3e-46   Glycine max [soybeans]
ref|XP_002520352.1|  Aldehyde dehydrogenase, putative                   168   4e-46   
ref|XP_010674357.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    169   5e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010674356.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    169   5e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010664198.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    168   5e-46   Vitis vinifera
emb|CAN73659.1|  hypothetical protein VITISV_044129                     169   6e-46   Vitis vinifera
gb|KJB75341.1|  hypothetical protein B456_012G037500                    167   7e-46   Gossypium raimondii
emb|CBI21614.3|  unnamed protein product                                169   7e-46   Vitis vinifera
ref|XP_002273730.2|  PREDICTED: aldehyde dehydrogenase family 3 m...    169   7e-46   Vitis vinifera
ref|XP_010674968.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    167   7e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008444179.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    167   8e-46   Cucumis melo [Oriental melon]
ref|XP_011031097.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    168   1e-45   Populus euphratica
ref|XP_008781593.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    167   1e-45   Phoenix dactylifera
ref|XP_008338656.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    167   1e-45   
gb|EPS67420.1|  aldehyde dehydrogenase                                  160   1e-45   Genlisea aurea
ref|XP_002307060.1|  hypothetical protein POPTR_0005s07090g             167   2e-45   Populus trichocarpa [western balsam poplar]
gb|KJB75338.1|  hypothetical protein B456_012G037500                    167   2e-45   Gossypium raimondii
gb|KJB75340.1|  hypothetical protein B456_012G037500                    167   2e-45   Gossypium raimondii
ref|XP_006575169.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    167   2e-45   Glycine max [soybeans]
ref|XP_010268979.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    166   2e-45   Nelumbo nucifera [Indian lotus]
gb|KJB75339.1|  hypothetical protein B456_012G037500                    167   2e-45   Gossypium raimondii
gb|AAY23279.1|  aldehyde dehydrogenase, putative                        162   3e-45   Oryza sativa Japonica Group [Japonica rice]
gb|KJB64493.1|  hypothetical protein B456_010G051500                    166   3e-45   Gossypium raimondii
ref|XP_009414877.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    166   3e-45   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW70625.1|  hypothetical protein EUGRSUZ_F03800                     166   3e-45   Eucalyptus grandis [rose gum]
ref|XP_010063405.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    166   3e-45   Eucalyptus grandis [rose gum]
ref|XP_010530214.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    166   4e-45   Tarenaya hassleriana [spider flower]
ref|NP_974679.1|  aldehyde dehydrogenase 3I1                            164   4e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006370386.1|  hypothetical protein POPTR_0001s421501g            164   4e-45   
ref|XP_004161166.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    165   6e-45   
gb|KCW70623.1|  hypothetical protein EUGRSUZ_F03800                     166   6e-45   Eucalyptus grandis [rose gum]
gb|KHN20611.1|  Aldehyde dehydrogenase family 3 member H1               166   8e-45   Glycine soja [wild soybean]
ref|XP_004498347.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    165   8e-45   
gb|KCW62442.1|  hypothetical protein EUGRSUZ_H05081                     162   9e-45   Eucalyptus grandis [rose gum]
ref|XP_004502485.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    164   1e-44   Cicer arietinum [garbanzo]
ref|XP_007161479.1|  hypothetical protein PHAVU_001G072600g             164   1e-44   Phaseolus vulgaris [French bean]
gb|KHG30796.1|  Aldehyde dehydrogenase family 3 member H1               164   1e-44   Gossypium arboreum [tree cotton]
gb|KEH40517.1|  NAD-dependent aldehyde dehydrogenase family protein     164   2e-44   Medicago truncatula
gb|KCW62441.1|  hypothetical protein EUGRSUZ_H05081                     162   2e-44   Eucalyptus grandis [rose gum]
gb|KJB29204.1|  hypothetical protein B456_005G089100                    162   2e-44   Gossypium raimondii
ref|XP_002869163.1|  ALDH3I1                                            165   2e-44   Arabidopsis lyrata subsp. lyrata
ref|XP_009420563.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    164   2e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003526638.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    164   2e-44   
gb|AES72293.2|  NAD-dependent aldehyde dehydrogenase family protein     163   3e-44   Medicago truncatula
ref|XP_006283479.1|  hypothetical protein CARUB_v10004527mg             164   3e-44   Capsella rubella
gb|EYU22982.1|  hypothetical protein MIMGU_mgv1a005625mg                163   4e-44   Erythranthe guttata [common monkey flower]
gb|EEC67815.1|  hypothetical protein OsI_35392                          154   4e-44   Oryza sativa Indica Group [Indian rice]
ref|XP_004502484.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    162   4e-44   
emb|CAC84903.1|  aldehyde dehydrogenase                                 163   5e-44   Arabidopsis thaliana [mouse-ear cress]
gb|KHN47009.1|  Aldehyde dehydrogenase family 3 member H1               162   5e-44   Glycine soja [wild soybean]
ref|XP_009383529.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    163   5e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_567962.1|  aldehyde dehydrogenase 3I1                            163   5e-44   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001065921.1|  Os11g0186200                                       162   5e-44   
ref|XP_008444183.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    162   8e-44   Cucumis melo [Oriental melon]
gb|KFK30059.1|  hypothetical protein AALP_AA7G211500                    163   9e-44   Arabis alpina [alpine rockcress]
ref|XP_011002476.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    164   9e-44   Populus euphratica
gb|KJB29202.1|  hypothetical protein B456_005G089100                    162   9e-44   Gossypium raimondii
ref|XP_004502482.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    161   1e-43   Cicer arietinum [garbanzo]
ref|XP_010025726.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    162   2e-43   Eucalyptus grandis [rose gum]
ref|XP_010447116.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    162   2e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010025727.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    162   2e-43   Eucalyptus grandis [rose gum]
ref|XP_004142628.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    161   2e-43   Cucumis sativus [cucumbers]
emb|CDX75414.1|  BnaA01g02880D                                          162   2e-43   
ref|XP_009115014.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    162   2e-43   
ref|XP_009115077.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    162   2e-43   
ref|NP_001288985.1|  aldehyde dehydrogenase family 3 member I1, c...    162   2e-43   Brassica rapa
gb|AID60136.1|  aldehyde dehydrogenase 3                                162   2e-43   Brassica napus [oilseed rape]
gb|KDO80593.1|  hypothetical protein CISIN_1g011107mg                   157   2e-43   Citrus sinensis [apfelsine]
ref|XP_008227606.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    159   2e-43   Prunus mume [ume]
gb|EPS67391.1|  aldehyde dehydrogenase                                  160   3e-43   Genlisea aurea
emb|CDY36336.1|  BnaC08g05150D                                          160   5e-43   Brassica napus [oilseed rape]
ref|XP_010539000.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    160   5e-43   Tarenaya hassleriana [spider flower]
gb|KDO80592.1|  hypothetical protein CISIN_1g011107mg                   157   6e-43   Citrus sinensis [apfelsine]
ref|XP_006434228.1|  hypothetical protein CICLE_v10000949mg             157   6e-43   
ref|XP_006662789.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    159   6e-43   Oryza brachyantha
ref|XP_010432443.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    160   6e-43   Camelina sativa [gold-of-pleasure]
gb|KHG28299.1|  Aldehyde dehydrogenase family 3 member H1               159   9e-43   Gossypium arboreum [tree cotton]
ref|XP_008227591.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    159   1e-42   Prunus mume [ume]
gb|ACU23701.1|  unknown                                                 155   1e-42   Glycine max [soybeans]
ref|XP_006393739.1|  hypothetical protein EUTSA_v10011438mg             159   1e-42   Eutrema salsugineum [saltwater cress]
ref|XP_004503900.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    159   1e-42   Cicer arietinum [garbanzo]
gb|KJB59280.1|  hypothetical protein B456_009G247000                    159   1e-42   Gossypium raimondii
emb|CDX69039.1|  BnaC01g04140D                                          159   2e-42   
gb|KDO80591.1|  hypothetical protein CISIN_1g011107mg                   158   2e-42   Citrus sinensis [apfelsine]
emb|CDY36018.1|  BnaA08g04430D                                          158   2e-42   Brassica napus [oilseed rape]
ref|XP_004503899.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    159   2e-42   Cicer arietinum [garbanzo]
ref|XP_006412252.1|  hypothetical protein EUTSA_v10024844mg             159   2e-42   Eutrema salsugineum [saltwater cress]
ref|XP_010461437.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    158   3e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010437650.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    159   3e-42   Camelina sativa [gold-of-pleasure]
ref|XP_008227590.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    158   3e-42   Prunus mume [ume]
ref|XP_010500136.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    158   3e-42   Camelina sativa [gold-of-pleasure]
gb|ACJ85715.1|  unknown                                                 154   3e-42   Medicago truncatula
ref|XP_010479042.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    157   4e-42   Camelina sativa [gold-of-pleasure]
ref|XP_006434229.1|  hypothetical protein CICLE_v10000949mg             157   5e-42   Citrus clementina [clementine]
ref|XP_006472804.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    157   5e-42   Citrus sinensis [apfelsine]
gb|KHG30273.1|  Aldehyde dehydrogenase family 3 member H1               157   7e-42   Gossypium arboreum [tree cotton]
ref|XP_008444182.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    157   7e-42   Cucumis melo [Oriental melon]
ref|XP_003602042.1|  Aldehyde dehydrogenase family 3 member H1          157   8e-42   
ref|XP_009107480.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    156   8e-42   Brassica rapa
ref|XP_002888606.1|  ALDH3H1                                            156   1e-41   
ref|XP_003630349.1|  Aldehyde dehydrogenase family 3 member H1          157   1e-41   
gb|AET04825.2|  NAD-dependent aldehyde dehydrogenase family protein     156   1e-41   Medicago truncatula
gb|KFK24209.1|  hypothetical protein AALP_AAs42301U000200               155   2e-41   Arabis alpina [alpine rockcress]
ref|XP_003523436.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    155   2e-41   
ref|XP_011468213.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    155   3e-41   Fragaria vesca subsp. vesca
ref|XP_008387507.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    155   3e-41   
gb|ACG29168.1|  aldehyde dehydrogenase, dimeric NADP-preferring         155   4e-41   Zea mays [maize]
emb|CAE51203.1|  putative aldehyde dehydrogenase                        155   4e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001148092.1|  aldehyde dehydrogenase, dimeric NADP-preferring    154   4e-41   
ref|XP_008367720.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    155   4e-41   
gb|AAM61211.1|  aldehyde dehydrogenase, putative                        154   4e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175081.1|  aldehyde dehydrogenase 3H1                            154   5e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004502483.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    154   5e-41   
gb|ACF85700.1|  unknown                                                 154   6e-41   Zea mays [maize]
ref|XP_010930724.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    154   6e-41   Elaeis guineensis
ref|XP_003532071.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    154   7e-41   
ref|XP_007137428.1|  hypothetical protein PHAVU_009G126400g             154   1e-40   Phaseolus vulgaris [French bean]
gb|AAX96338.1|  aldehyde dehydrogenase, putative                        154   1e-40   Oryza sativa Japonica Group [Japonica rice]
emb|CDY25655.1|  BnaC05g25340D                                          152   1e-40   Brassica napus [oilseed rape]
gb|ABR16899.1|  unknown                                                 154   1e-40   Picea sitchensis
ref|XP_009145048.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    153   2e-40   Brassica rapa
ref|XP_009404859.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    152   3e-40   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABA96616.1|  aldehyde dehydrogenase family protein, expressed        152   4e-40   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA38940.1|  TPA: hypothetical protein ZEAMMB73_547503              149   6e-40   
ref|XP_006663868.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    151   6e-40   
gb|EMS67814.1|  Aldehyde dehydrogenase family 3 member I1, chloro...    143   1e-39   Triticum urartu
ref|XP_006304446.1|  hypothetical protein CARUB_v10011079mg             150   1e-39   Capsella rubella
ref|XP_007159875.1|  hypothetical protein PHAVU_002G275200g             151   2e-39   Phaseolus vulgaris [French bean]
dbj|BAK01937.1|  predicted protein                                      150   2e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO80584.1|  hypothetical protein CISIN_1g011107mg                   150   3e-39   Citrus sinensis [apfelsine]
ref|NP_001168661.1|  hypothetical protein                               149   6e-39   Zea mays [maize]
ref|XP_008668343.1|  PREDICTED: hypothetical protein isoform X1         149   1e-38   Zea mays [maize]
ref|XP_003577758.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    148   1e-38   Brachypodium distachyon [annual false brome]
gb|KDO52217.1|  hypothetical protein CISIN_1g009109mg                   145   9e-38   Citrus sinensis [apfelsine]
ref|XP_006432085.1|  hypothetical protein CICLE_v10000776mg             145   9e-38   
gb|KDO52216.1|  hypothetical protein CISIN_1g009109mg                   145   2e-37   Citrus sinensis [apfelsine]
gb|KDO52215.1|  hypothetical protein CISIN_1g009109mg                   145   2e-37   Citrus sinensis [apfelsine]
ref|XP_006432086.1|  hypothetical protein CICLE_v10000776mg             145   3e-37   Citrus clementina [clementine]
ref|XP_009355864.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    144   3e-37   
gb|ABK24239.1|  unknown                                                 143   5e-37   Picea sitchensis
ref|XP_004977224.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    143   5e-37   Setaria italica
ref|XP_004977223.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    144   5e-37   
ref|XP_009355863.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    144   6e-37   Pyrus x bretschneideri [bai li]
ref|XP_010238657.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    142   2e-36   Brachypodium distachyon [annual false brome]
ref|XP_002449124.1|  hypothetical protein SORBIDRAFT_05g005470          141   4e-36   
ref|XP_002441918.1|  hypothetical protein SORBIDRAFT_08g004840          139   1e-35   Sorghum bicolor [broomcorn]
gb|ACL53721.1|  unknown                                                 139   2e-35   Zea mays [maize]
ref|NP_001152171.1|  aldehyde dehydrogenase, dimeric NADP-preferring    139   2e-35   Zea mays [maize]
ref|XP_010547357.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    139   3e-35   Tarenaya hassleriana [spider flower]
gb|EMT33845.1|  Aldehyde dehydrogenase family 3 member H1               137   1e-34   
ref|XP_001780129.1|  variable substrate                                 135   7e-34   
ref|XP_001764841.1|  variable substrate                                 132   5e-33   
ref|XP_002978037.1|  hypothetical protein SELMODRAFT_268146             132   6e-33   
ref|XP_002966702.1|  hypothetical protein SELMODRAFT_168397             131   9e-33   
ref|XP_002966639.1|  hypothetical protein SELMODRAFT_227647             125   2e-30   
ref|XP_002978104.1|  hypothetical protein SELMODRAFT_271300             125   2e-30   
ref|XP_007213817.1|  hypothetical protein PRUPE_ppa005609mg             124   4e-30   
gb|KJB75337.1|  hypothetical protein B456_012G037500                    123   8e-30   Gossypium raimondii
ref|XP_010679827.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    120   8e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001757163.1|  variable substrate                                 119   2e-28   
ref|XP_001197038.2|  PREDICTED: aldehyde dehydrogenase-like             115   2e-28   
ref|WP_002673810.1|  hypothetical protein                               119   3e-28   Treponema denticola
ref|WP_002688230.1|  hypothetical protein                               118   4e-28   Treponema denticola
ref|WP_009627619.1|  Aldehyde Dehydrogenase                             118   5e-28   Pseudanabaena biceps
ref|WP_010698015.1|  hypothetical protein                               117   7e-28   Treponema denticola
ref|WP_006011635.1|  aldehyde dehydrogenase                             117   1e-27   Glaciecola pallidula
gb|EMS62407.1|  Aldehyde dehydrogenase family 3 member H1               117   1e-27   Triticum urartu
ref|WP_002691376.1|  hypothetical protein                               115   3e-27   Treponema denticola
ref|WP_002675966.1|  aldehyde dehydrogenase                             115   3e-27   Treponema denticola
ref|WP_002667397.1|  aldehyde dehydrogenase                             115   3e-27   
gb|AIN92873.1|  aldehyde dehydrogenase                                  115   3e-27   Treponema putidum
ref|WP_010694958.1|  hypothetical protein                               115   3e-27   Treponema denticola
ref|WP_010689581.1|  hypothetical protein                               115   3e-27   Treponema denticola
emb|CDX72584.1|  BnaC07g46060D                                          115   4e-27   
ref|XP_004142629.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...    115   5e-27   
ref|WP_002684196.1|  hypothetical protein                               115   6e-27   Treponema denticola
ref|XP_001767194.1|  variable substrate                                 115   8e-27   
emb|CDP01945.1|  unnamed protein product                                115   9e-27   Coffea canephora [robusta coffee]
ref|WP_028953736.1|  aldehyde dehydrogenase                             114   1e-26   Synechococcus sp. CC9616
ref|XP_009138416.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    114   1e-26   Brassica rapa
emb|CDX77447.1|  BnaA07g05850D                                          114   1e-26   
ref|XP_009138415.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    114   1e-26   Brassica rapa
emb|CDX69216.1|  BnaC01g02370D                                          114   1e-26   
ref|XP_001770374.1|  variable substrate                                 114   1e-26   
ref|XP_009109317.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    114   1e-26   Brassica rapa
ref|WP_041246595.1|  aldehyde dehydrogenase                             114   2e-26   
gb|AEP28780.1|  NAD-dependent aldehyde dehydrogenase                    114   2e-26   Glaciecola nitratireducens FR1064
ref|XP_009145598.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    113   3e-26   Brassica rapa
emb|CDY59717.1|  BnaA03g59170D                                          113   3e-26   Brassica napus [oilseed rape]
emb|CDY35463.1|  BnaC03g61970D                                          112   6e-26   Brassica napus [oilseed rape]
emb|CDY24790.1|  BnaA08g15200D                                          112   6e-26   Brassica napus [oilseed rape]
ref|WP_008182868.1|  aldehyde dehydrogenase                             112   7e-26   Moorea producens
ref|WP_010353711.1|  aldehyde dehydrogenase                             112   8e-26   Streptomyces acidiscabies
ref|XP_009610375.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    107   8e-26   Nicotiana tomentosiformis
gb|KFK30260.1|  hypothetical protein AALP_AA7G238000                    111   1e-25   Arabis alpina [alpine rockcress]
ref|WP_038001567.1|  aldehyde dehydrogenase                             111   2e-25   
ref|XP_004170348.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    110   2e-25   
gb|EAQ68197.1|  Putative aldehyde dehydrogenase                         111   2e-25   Synechococcus sp. RS9917
ref|XP_010651247.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    110   2e-25   Vitis vinifera
ref|WP_012954453.1|  aldehyde dehydrogenase                             110   2e-25   Candidatus Atelocyanobacterium thalassa
ref|XP_010651245.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    110   2e-25   Vitis vinifera
gb|KJB17707.1|  hypothetical protein B456_003G011600                    110   2e-25   Gossypium raimondii
ref|XP_010651246.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    110   2e-25   Vitis vinifera
gb|KJB17709.1|  hypothetical protein B456_003G011600                    110   3e-25   Gossypium raimondii
gb|KJB17708.1|  hypothetical protein B456_003G011600                    110   3e-25   Gossypium raimondii
gb|EAZ19830.1|  hypothetical protein OsJ_35414                          110   3e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002285466.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    110   3e-25   Vitis vinifera
ref|WP_015772232.1|  aldehyde dehydrogenase                             110   3e-25   Jonesia denitrificans
ref|WP_029949165.1|  aldehyde dehydrogenase                             110   3e-25   Parvimonas micra
ref|XP_002452841.1|  hypothetical protein SORBIDRAFT_04g033420          110   4e-25   Sorghum bicolor [broomcorn]
ref|WP_012597585.1|  aldehyde dehydrogenase                             110   4e-25   Cyanothece sp. PCC 7424
ref|XP_006412015.1|  hypothetical protein EUTSA_v10025045mg             110   4e-25   Eutrema salsugineum [saltwater cress]
gb|KDO71078.1|  hypothetical protein CISIN_1g0386171mg                  104   4e-25   Citrus sinensis [apfelsine]
ref|XP_004142118.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...    110   4e-25   
gb|EAY82454.1|  hypothetical protein OsI_37671                          110   4e-25   Oryza sativa Indica Group [Indian rice]
ref|WP_004832321.1|  aldehyde dehydrogenase                             110   4e-25   Parvimonas micra
gb|KGN54173.1|  hypothetical protein Csa_4G291370                       110   4e-25   Cucumis sativus [cucumbers]
ref|WP_020171844.1|  aldehyde dehydrogenase                             110   5e-25   Gordonia polyisoprenivorans
ref|WP_006373067.1|  aldehyde dehydrogenase                             110   5e-25   Gordonia polyisoprenivorans
gb|KJB17706.1|  hypothetical protein B456_003G011600                    110   5e-25   Gossypium raimondii
ref|WP_015244977.1|  aldehyde dehydrogenase                             109   5e-25   Singulisphaera acidiphila
ref|WP_017654159.1|  aldehyde dehydrogenase                             109   6e-25   Fortiea contorta
ref|WP_038543308.1|  aldehyde dehydrogenase                             109   6e-25   Synechococcus sp. KORDI-100
ref|XP_002115478.1|  hypothetical protein TRIADDRAFT_59449              110   7e-25   Trichoplax adhaerens
ref|XP_009768441.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    109   7e-25   Nicotiana sylvestris
gb|KHG21488.1|  Aldehyde dehydrogenase family 3 member F1               109   9e-25   Gossypium arboreum [tree cotton]
ref|WP_041953568.1|  aldehyde dehydrogenase                             108   1e-24   Parvimonas micra
gb|AII42523.1|  aldehyde dehydrogenase                                  108   1e-24   Synechococcus sp. KORDI-100
ref|WP_043058938.1|  hypothetical protein                               108   1e-24   
ref|WP_006861193.1|  aldehyde dehydrogenase                             108   1e-24   Marvinbryantia formatexigens
ref|XP_008449722.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    108   1e-24   Cucumis melo [Oriental melon]
ref|WP_014678898.1|  aldehyde dehydrogenase                             108   1e-24   Solitalea canadensis
ref|WP_013032890.1|  aldehyde dehydrogenase                             108   1e-24   Nitrosococcus halophilus
ref|XP_009060246.1|  hypothetical protein LOTGIDRAFT_229102             108   2e-24   Lottia gigantea
ref|WP_036776366.1|  aldehyde dehydrogenase                             108   2e-24   
ref|WP_006946046.1|  Aldehyde dehydrogenase                             108   2e-24   Rhodococcus sp. EsD8
ref|XP_006283636.1|  hypothetical protein CARUB_v10004694mg             108   2e-24   Capsella rubella
emb|CAA18131.1|  aldehyde dehydrogenase like protein                    107   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|WP_044449982.1|  aldehyde dehydrogenase                             107   3e-24   Mastigocladus laminosus
ref|WP_010283230.1|  aldehyde dehydrogenase                             107   3e-24   
ref|WP_026722884.1|  aldehyde dehydrogenase                             107   3e-24   
ref|XP_006466887.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    107   3e-24   
ref|WP_036006670.1|  aldehyde dehydrogenase                             107   3e-24   
ref|NP_195348.2|  aldehyde dehydrogenase 3F1                            107   4e-24   
ref|WP_036972443.1|  aldehyde dehydrogenase                             104   4e-24   
emb|CAE48163.1|  putative aldehyde dehydrogenase                        107   4e-24   
ref|WP_026413602.1|  aldehyde dehydrogenase                             107   4e-24   
ref|XP_006340688.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    107   6e-24   
ref|WP_024467250.1|  aldehyde dehydrogenase                             107   6e-24   
ref|XP_002869039.1|  ALDH3F1                                            107   6e-24   
ref|WP_036742947.1|  aldehyde dehydrogenase                             106   7e-24   
ref|WP_038023881.1|  aldehyde dehydrogenase                             106   8e-24   
ref|WP_036667375.1|  aldehyde dehydrogenase                             106   8e-24   
ref|WP_034714402.1|  aldehyde dehydrogenase                             106   8e-24   
gb|EEC73696.1|  hypothetical protein OsI_08280                          106   8e-24   
gb|EAU72958.1|  Putative aldehyde dehydrogenase                         106   9e-24   
ref|XP_004146483.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    106   9e-24   
ref|XP_008803615.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    106   1e-23   
ref|WP_028596714.1|  aldehyde dehydrogenase                             106   1e-23   
gb|EKC37261.1|  Aldehyde dehydrogenase family 3 member B1               102   1e-23   
ref|WP_041308647.1|  aldehyde dehydrogenase                             105   1e-23   
gb|EMT00072.1|  Aldehyde dehydrogenase                                99.8    1e-23   
ref|NP_001047575.1|  Os02g0646500                                       106   1e-23   
ref|WP_005142534.1|  aldehyde dehydrogenase                             105   1e-23   
ref|WP_017321468.1|  hypothetical protein                               105   1e-23   
ref|WP_024470134.1|  aldehyde dehydrogenase                             105   2e-23   
ref|WP_018088578.1|  hypothetical protein                               105   2e-23   
gb|AAD35089.1|AF148877_1  putative aldehyde dehydrogenase OS-ALDH       105   2e-23   
ref|WP_020964984.1|  alcohol dehydrogenase                              105   2e-23   
ref|WP_017310244.1|  aldehyde dehydrogenase                             105   2e-23   
gb|AFW72558.1|  hypothetical protein ZEAMMB73_265586                    104   2e-23   
gb|EEE57473.1|  hypothetical protein OsJ_07716                          106   2e-23   
ref|XP_003547955.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    105   2e-23   
ref|XP_005822267.1|  hypothetical protein GUITHDRAFT_146595             107   2e-23   
ref|WP_021255569.1|  aldehyde dehydrogenase                             105   2e-23   
ref|XP_006425564.1|  hypothetical protein CICLE_v10025492mg             105   2e-23   
ref|WP_019148953.1|  hypothetical protein                               105   2e-23   
gb|AHF62933.1|  putative aldehyde dehydrogenase                         105   2e-23   
ref|XP_001629556.1|  predicted protein                                  105   3e-23   
ref|XP_009023429.1|  hypothetical protein HELRODRAFT_185832             105   3e-23   
ref|XP_010548304.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...    105   3e-23   
gb|EEC73694.1|  hypothetical protein OsI_08277                          105   3e-23   
ref|WP_011128814.1|  aldehyde dehydrogenase                             105   3e-23   
ref|WP_036891691.1|  MULTISPECIES: aldehyde dehydrogenase               104   3e-23   
ref|WP_011124529.1|  aldehyde dehydrogenase                             104   3e-23   
ref|WP_037328500.1|  aldehyde dehydrogenase                             104   3e-23   
ref|NP_001147083.1|  LOC100280692                                       105   3e-23   
ref|WP_026733532.1|  aldehyde dehydrogenase                             104   3e-23   
ref|XP_003520274.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    105   3e-23   
ref|WP_011363503.1|  aldehyde dehydrogenase                             104   3e-23   
ref|WP_027842131.1|  aldehyde dehydrogenase                             104   3e-23   
ref|WP_036910655.1|  MULTISPECIES: aldehyde dehydrogenase               104   3e-23   
ref|XP_008337865.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    105   3e-23   
dbj|BAJ89426.1|  predicted protein                                      103   4e-23   
ref|WP_008846550.1|  aldehyde dehydrogenase                             104   4e-23   
ref|XP_011025893.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    104   4e-23   
ref|XP_010919365.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    104   4e-23   
ref|WP_015221757.1|  aldehyde dehydrogenase                             104   4e-23   
gb|ADU48656.1|  Aldehyde Dehydrogenase                                  104   4e-23   
ref|WP_015130982.1|  aldehyde dehydrogenase                             104   4e-23   
ref|WP_015203433.1|  aldehyde dehydrogenase                             104   4e-23   
ref|XP_003580245.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    104   5e-23   
ref|XP_008453718.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    104   5e-23   
ref|WP_024465425.1|  aldehyde dehydrogenase                             104   5e-23   
gb|AAR21278.1|  fatty aldehyde dehydrogenase 1                          104   5e-23   
ref|WP_011129570.1|  aldehyde dehydrogenase                             104   6e-23   
ref|XP_007132013.1|  hypothetical protein PHAVU_011G059400g             103   6e-23   
ref|XP_006829153.1|  hypothetical protein AMTR_s00001p00269720          104   6e-23   
ref|XP_002310836.1|  mRNA for putative aldehyde dehydrogenase fam...    104   6e-23   
ref|WP_029121416.1|  aldehyde dehydrogenase                             103   6e-23   
ref|WP_020098975.1|  hypothetical protein                               103   6e-23   
ref|WP_009457992.1|  aldehyde dehydrogenase                             103   6e-23   
ref|WP_026294544.1|  aldehyde dehydrogenase                             103   7e-23   
ref|WP_043390663.1|  aldehyde dehydrogenase                             103   7e-23   
ref|WP_006854756.1|  aldehyde dehydrogenase                             103   7e-23   
ref|WP_043983956.1|  aldehyde dehydrogenase                             103   7e-23   
ref|XP_006647606.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    104   7e-23   
ref|WP_011243342.1|  MULTISPECIES: aldehyde dehydrogenase               103   7e-23   
gb|AAB33154.1|  class-3 aldehyde dehydrogenase, class-3 ALDH            103   7e-23   
ref|XP_011090413.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    104   7e-23   
gb|AFK48458.1|  unknown                                                 104   7e-23   
ref|WP_028788951.1|  aldehyde dehydrogenase                             103   7e-23   
ref|WP_017740423.1|  hypothetical protein                               103   7e-23   
ref|XP_007202020.1|  hypothetical protein PRUPE_ppa004971mg             103   8e-23   
ref|XP_003629375.1|  Aldehyde dehydrogenase family 3 member F1          103   8e-23   
ref|WP_014210046.1|  aldehyde dehydrogenase                             103   9e-23   
ref|WP_036471060.1|  aldehyde dehydrogenase                             103   9e-23   
ref|WP_028408697.1|  aldehyde dehydrogenase                             103   1e-22   
gb|ERL90557.1|  hypothetical protein D910_07905                         104   1e-22   
gb|ENN71299.1|  hypothetical protein YQE_12224                          104   1e-22   
ref|WP_006527043.1|  NAD-dependent aldehyde dehydrogenase               103   1e-22   
ref|WP_012689728.1|  aldehyde dehydrogenase                             103   1e-22   
ref|WP_004828364.1|  aldehyde dehydrogenase                             103   1e-22   
ref|WP_029068306.1|  aldehyde dehydrogenase                             103   1e-22   
ref|XP_008643572.1|  PREDICTED: LOC100280692 isoform X1                 104   1e-22   
ref|WP_041650642.1|  aldehyde dehydrogenase                             103   1e-22   
dbj|BAD25530.1|  putative aldehyde dehydrogenase                        103   1e-22   
ref|WP_015167491.1|  NAD-dependent aldehyde dehydrogenase               103   1e-22   
dbj|BAK06135.1|  predicted protein                                    98.2    1e-22   
ref|XP_007132014.1|  hypothetical protein PHAVU_011G059400g             103   2e-22   
ref|WP_037194680.1|  aldehyde dehydrogenase                             102   2e-22   
ref|XP_001362651.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    102   2e-22   
ref|WP_005550650.1|  aldehyde dehydrogenase                             102   2e-22   
ref|NP_001047578.1|  Os02g0647900                                       103   2e-22   
ref|WP_043695178.1|  aldehyde dehydrogenase                             102   2e-22   
ref|WP_038556583.1|  aldehyde dehydrogenase                             102   2e-22   
ref|XP_002901988.1|  aldehyde dehydrogenase, putative                   103   2e-22   
ref|WP_042992525.1|  aldehyde dehydrogenase                             102   2e-22   
ref|WP_036342552.1|  aldehyde dehydrogenase                             102   2e-22   
ref|XP_009378224.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    102   2e-22   
ref|WP_031677664.1|  aldehyde dehydrogenase                             102   2e-22   
ref|WP_043568121.1|  aldehyde dehydrogenase                             102   2e-22   
ref|XP_005104004.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    103   2e-22   
gb|AEN89990.1|  Aldehyde dehydrogenase,Aldehyde dehydrogenase           102   2e-22   
ref|WP_017316439.1|  aldehyde dehydrogenase                             102   2e-22   
ref|WP_016871050.1|  aldehyde dehydrogenase                             102   3e-22   
gb|EGK86425.1|  Aldehyde Dehydrogenase                                  102   3e-22   
ref|WP_030282498.1|  aldehyde dehydrogenase                             102   3e-22   
ref|WP_039887374.1|  aldehyde dehydrogenase                             102   3e-22   
gb|KAW99412.1|  aldehyde dehydrogenase (NAD+)                           102   3e-22   
gb|ERN43063.1|  NAD-dependent aldehyde dehydrogenase                    102   3e-22   
ref|XP_002164581.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...    102   3e-22   
gb|KDP32663.1|  hypothetical protein JCGZ_13661                         102   3e-22   
ref|WP_017711233.1|  hypothetical protein                               102   3e-22   
ref|XP_008891392.1|  hypothetical protein PPTG_02140                    102   3e-22   
gb|ETL43784.1|  hypothetical protein L916_05794                         102   3e-22   
ref|XP_006647605.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    102   3e-22   
gb|EWM24499.1|  aldehyde dehydrogenase                                99.4    3e-22   
gb|ETK90372.1|  hypothetical protein L915_05858                         102   3e-22   
ref|WP_026473262.1|  aldehyde dehydrogenase                             102   4e-22   
ref|WP_039713089.1|  aldehyde dehydrogenase                             102   4e-22   
gb|KEH39462.1|  NAD-dependent aldehyde dehydrogenase family protein     102   4e-22   
ref|WP_006622970.1|  MULTISPECIES: aldehyde dehydrogenase               102   4e-22   
ref|WP_011826780.1|  aldehyde dehydrogenase                             102   4e-22   
ref|XP_008844513.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    100   4e-22   
ref|WP_036620630.1|  aldehyde dehydrogenase                             101   4e-22   
gb|EPY05561.1|  aldehyde dehydrogenase                                  102   4e-22   
gb|AII47030.1|  aldehyde dehydrogenase                                  101   4e-22   
ref|WP_030855051.1|  aldehyde dehydrogenase                             102   4e-22   
ref|XP_010432186.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    102   4e-22   
gb|EJF10084.1|  aldehyde dehydrogenase                                99.4    4e-22   
ref|WP_033220514.1|  aldehyde dehydrogenase                             101   4e-22   
ref|WP_026376419.1|  aldehyde dehydrogenase                             101   4e-22   
ref|WP_043403838.1|  aldehyde dehydrogenase                             101   4e-22   
ref|XP_006596209.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    101   5e-22   
ref|WP_044356636.1|  aldehyde dehydrogenase                             101   5e-22   
dbj|BAJ96457.1|  predicted protein                                      102   5e-22   
ref|WP_016866084.1|  aldehyde dehydrogenase                             101   5e-22   
ref|WP_025157096.1|  aldehyde dehydrogenase                             101   5e-22   
ref|WP_033268258.1|  aldehyde dehydrogenase                             101   5e-22   
gb|ETI50491.1|  hypothetical protein F443_05986                         102   5e-22   
gb|ELP63500.1|  aldehyde dehydrogenase (NAD) family protein             101   5e-22   
ref|WP_004019430.1|  aldehyde dehydrogenase                             101   5e-22   
gb|AEE62582.1|  unknown                                                 102   5e-22   
ref|WP_015205874.1|  NAD-dependent aldehyde dehydrogenase               101   5e-22   
ref|WP_012407600.1|  aldehyde dehydrogenase                             101   5e-22   
ref|WP_044473555.1|  aldehyde dehydrogenase                             101   5e-22   
ref|WP_013785591.1|  aldehyde dehydrogenase                             101   5e-22   
gb|KJB55350.1|  hypothetical protein B456_009G072900                    100   6e-22   
ref|XP_003597427.1|  Aldehyde dehydrogenase family 3 member F1          102   6e-22   
ref|WP_035862271.1|  aldehyde dehydrogenase                             101   6e-22   
gb|EAQ74199.1|  Putative aldehyde dehydrogenase                         101   6e-22   
ref|XP_008241772.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    101   6e-22   
gb|ADR22209.1|  Aldehyde Dehydrogenase                                  101   6e-22   
ref|WP_026236448.1|  aldehyde dehydrogenase                             101   6e-22   
gb|KGX87596.1|  aldehyde dehydrogenase                                  101   7e-22   
ref|WP_029321502.1|  MULTISPECIES: aldehyde dehydrogenase               101   7e-22   
ref|WP_039808096.1|  aldehyde dehydrogenase                             101   7e-22   
gb|ETM50100.1|  hypothetical protein L914_05808                         101   7e-22   
ref|XP_003774240.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  96.3    7e-22   
ref|XP_011430143.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    101   7e-22   
gb|ADE69169.1|  Aldehyde dehydrogenase family protein                   101   7e-22   
ref|WP_032367167.1|  aldehyde dehydrogenase                             100   8e-22   
gb|EQF78377.1|  aldehyde dehydrogenase family protein                 97.8    8e-22   
ref|XP_010919366.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    100   9e-22   
ref|WP_025752153.1|  aldehyde dehydrogenase                             100   9e-22   
gb|AII50316.1|  aldehyde dehydrogenase                                  100   9e-22   
ref|WP_013220446.1|  aldehyde dehydrogenase                             100   9e-22   
ref|WP_034922974.1|  aldehyde dehydrogenase                             100   9e-22   
ref|WP_037681124.1|  aldehyde dehydrogenase                             100   9e-22   
ref|XP_007156099.1|  hypothetical protein PHAVU_003G258500g             101   9e-22   
ref|WP_010154891.1|  aldehyde dehydrogenase                             100   9e-22   
ref|WP_041391013.1|  aldehyde dehydrogenase                             100   9e-22   
gb|KFM97843.1|  aldehyde dehydrogenase family protein                   100   9e-22   
ref|WP_015181603.1|  NAD-dependent aldehyde dehydrogenase               100   9e-22   
ref|WP_034668698.1|  aldehyde dehydrogenase                             100   1e-21   
ref|WP_036729187.1|  aldehyde dehydrogenase                             100   1e-21   
ref|WP_034265746.1|  aldehyde dehydrogenase                             100   1e-21   
ref|WP_034655191.1|  aldehyde dehydrogenase                             100   1e-21   
gb|EFI42116.1|  aldehyde dehydrogenase                                  100   1e-21   
ref|WP_039856588.1|  aldehyde dehydrogenase                             100   1e-21   
gb|KJB55352.1|  hypothetical protein B456_009G072900                    100   1e-21   
ref|WP_044163147.1|  aldehyde dehydrogenase                             100   1e-21   
ref|WP_043982168.1|  aldehyde dehydrogenase                             100   1e-21   
ref|XP_003569983.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    100   1e-21   
ref|WP_032509173.1|  aldehyde dehydrogenase                             100   1e-21   
ref|WP_035760982.1|  aldehyde dehydrogenase                           99.4    1e-21   
ref|XP_011285426.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  99.8    1e-21   
gb|EQE53622.1|  aldehyde dehydrogenase family protein                   100   1e-21   
ref|WP_008184284.1|  aldehyde dehydrogenase                             100   1e-21   
ref|WP_013082967.1|  aldehyde dehydrogenase                             100   1e-21   
ref|WP_040458478.1|  aldehyde dehydrogenase                             100   1e-21   
ref|WP_028083267.1|  aldehyde dehydrogenase                             100   1e-21   
ref|XP_004976400.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    100   1e-21   
ref|WP_041042503.1|  aldehyde dehydrogenase                             100   1e-21   
ref|WP_015157396.1|  aldehyde dehydrogenase                             100   1e-21   
ref|WP_002760356.1|  aldehyde dehydrogenase                             100   1e-21   
ref|WP_014263013.1|  aldehyde dehydrogenase                             100   1e-21   
gb|EHO48515.1|  aldehyde dehydrogenase family protein                   100   1e-21   
ref|XP_008844512.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    100   1e-21   
ref|XP_006652592.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    100   1e-21   
ref|WP_037979919.1|  aldehyde dehydrogenase                             100   1e-21   
ref|WP_030550478.1|  aldehyde dehydrogenase                             100   1e-21   
ref|XP_008338017.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...    100   1e-21   
ref|XP_005660673.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  99.8    1e-21   
ref|WP_040863110.1|  aldehyde dehydrogenase                             100   1e-21   
ref|XP_007518743.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  99.4    2e-21   
ref|WP_030279505.1|  aldehyde dehydrogenase                             100   2e-21   
ref|WP_033167551.1|  aldehyde dehydrogenase                             100   2e-21   
ref|WP_002786901.1|  aldehyde dehydrogenase                             100   2e-21   



>ref|XP_009790112.1| PREDICTED: aldehyde dehydrogenase [Nicotiana sylvestris]
Length=477

 Score =   200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  160  MDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFV  339
            +DA A V ELRET+A+GKTK+YEWRVSQLKA+LKIAEHHEK I+DAL SDLSKPELE FV
Sbjct  4    VDAEAIVKELRETYASGKTKNYEWRVSQLKALLKIAEHHEKEIVDALNSDLSKPELECFV  63

Query  340  HEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLS  519
            HEI+ +K SCK ALKELKRWMKPE VK++  T+PSSA+IV EP GVVLVISAWNYPF+LS
Sbjct  64   HEISMMKTSCKHALKELKRWMKPEKVKTSLTTFPSSAEIVPEPFGVVLVISAWNYPFLLS  123

Query  520  LD  525
            LD
Sbjct  124  LD  125



>ref|XP_009593287.1| PREDICTED: aldehyde dehydrogenase [Nicotiana tomentosiformis]
Length=477

 Score =   199 bits (506),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  160  MDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFV  339
            +DA A V ELRET+A+GKTK+YEWRVSQLKA+LKIAEHHEK I+DAL SDLSKPELE FV
Sbjct  4    VDAEAIVKELRETYASGKTKNYEWRVSQLKALLKIAEHHEKEIVDALNSDLSKPELECFV  63

Query  340  HEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLS  519
            HEI+ +K SCK ALK+LKRWMKPE VK++  T+PSSA+IV EP GVVLVISAWNYPF+LS
Sbjct  64   HEISMMKTSCKHALKQLKRWMKPEKVKTSLTTFPSSAEIVPEPFGVVLVISAWNYPFLLS  123

Query  520  LD  525
            LD
Sbjct  124  LD  125



>ref|XP_006363887.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Solanum 
tuberosum]
Length=474

 Score =   199 bits (506),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +1

Query  160  MDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFV  339
            MDA A V ELR T+  GKTKSYEWRVSQLKA+ KIAE+HEK I DAL+SDLSKPELE+F+
Sbjct  1    MDAEAIVKELRGTYGTGKTKSYEWRVSQLKALFKIAENHEKEITDALYSDLSKPELEAFI  60

Query  340  HEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLS  519
            HEI+ +K +CKLALKELKRWMKPE VK++  ++PSSA+IV EPLGVVLVISAWNYPF+LS
Sbjct  61   HEISMMKTACKLALKELKRWMKPEKVKTSLTSFPSSAEIVPEPLGVVLVISAWNYPFLLS  120

Query  520  LD  525
            LD
Sbjct  121  LD  122



>ref|XP_004242034.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Solanum 
lycopersicum]
Length=474

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  160  MDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFV  339
            MDA A V ELR T+ +GKTKSYEWRVSQLKA+LKIAE+HEK I DAL+SDLSKPELE+F+
Sbjct  1    MDAEAIVKELRGTYGSGKTKSYEWRVSQLKALLKIAENHEKEITDALYSDLSKPELEAFI  60

Query  340  HEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLS  519
            HE++ +K +CKLALKELK WMKPE VK++  ++PSSA+IV EPLGVVLVISAWNYPF+LS
Sbjct  61   HEVSMMKTACKLALKELKWWMKPEKVKTSLTSFPSSAEIVPEPLGVVLVISAWNYPFLLS  120

Query  520  LD  525
            LD
Sbjct  121  LD  122



>ref|XP_008219616.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Prunus mume]
Length=491

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            DA   V ELR ++ +GKT+SYEWR SQLK +LK+AEHHE+ I+DAL SDLSKPE E++V 
Sbjct  16   DALTMVEELRGSYGSGKTRSYEWRESQLKNLLKVAEHHEQEIVDALRSDLSKPEFEAYVQ  75

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            EI+ +K+SCKLALKEL+ WMKPE  K++  T+PSSA+IVSEPLGV+L+ISAWNYPF+LSL
Sbjct  76   EISMLKSSCKLALKELRNWMKPEKAKTSLTTFPSSAEIVSEPLGVILIISAWNYPFLLSL  135

Query  523  D  525
            D
Sbjct  136  D  136



>gb|EYU23872.1| hypothetical protein MIMGU_mgv1a005640mg [Erythranthe guttata]
Length=476

 Score =   178 bits (452),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +1

Query  154  LEMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  333
            +E  A AAV ELR T ++GKTKSYEWR+SQLKA+LKI  HHE  I++AL SDL+KPE E+
Sbjct  1    MENMAEAAVKELRSTVSSGKTKSYEWRISQLKAILKIVTHHENEIIEALRSDLNKPEHEA  60

Query  334  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  513
            F+HEI  V +SCKLALKEL+RWMKP+ VK+   T+PSS +IV EPLGVVLVIS WNYPF+
Sbjct  61   FIHEIFSVASSCKLALKELRRWMKPQKVKTGMLTFPSSGEIVPEPLGVVLVISTWNYPFL  120

Query  514  LSLD  525
            +++D
Sbjct  121  IAVD  124



>ref|XP_004290886.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=489

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            +AAA V ELR ++ +GKT+SYEWRVSQLK + KI E HEK I++AL SDLSKPE ESFV 
Sbjct  14   EAAAMVEELRGSYRSGKTRSYEWRVSQLKKLKKITEFHEKEIVEALRSDLSKPETESFVQ  73

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            EI  +K++CKLA+K+LK WMKPE  K++  T+PSSA+IVSEPLGV+L+ISAWNYPF+LSL
Sbjct  74   EIGMLKSACKLAIKQLKSWMKPETAKTSMTTFPSSAEIVSEPLGVILIISAWNYPFLLSL  133

Query  523  D  525
            D
Sbjct  134  D  134



>sp|Q8VXQ2.1|ALDH_CRAPL RecName: Full=Aldehyde dehydrogenase; AltName: Full=Cp-ALDH [Craterostigma 
plantagineum]
 emb|CAC84900.1| aldehyde dehydrogenase [Craterostigma plantagineum]
Length=479

 Score =   176 bits (446),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +1

Query  157  EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  336
            ++DA   V  LR T+ +GKTKSYEWRVSQLKA+LKI  HH+K +++AL +DL KPE E++
Sbjct  3    QVDAEGVVDGLRRTYISGKTKSYEWRVSQLKALLKITTHHDKEVVEALRADLKKPEHEAY  62

Query  337  VHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFML  516
            VHEI  V  +CK ALKEL +WMKP+ VK++ ATYPSSA+IVSEPLGVVLVI+AWNYPF+L
Sbjct  63   VHEIFMVSNACKSALKELHQWMKPQKVKTSLATYPSSAEIVSEPLGVVLVITAWNYPFLL  122

Query  517  SLD  525
            +LD
Sbjct  123  ALD  125



>ref|XP_004290887.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=486

 Score =   175 bits (444),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            AAA V +LR +FA+ KT+SY+WRVSQLKA+LK+A  HE  I+DAL SDLSKPE E+ V+E
Sbjct  12   AAALVKDLRASFASSKTRSYQWRVSQLKALLKLATDHEAEIVDALSSDLSKPEFETIVYE  71

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I  +K++CKLA+K+LK WMKPE  K++  T+PSSA+IVSEPLGV+L+ISAWNYPF+LSLD
Sbjct  72   IGMLKSACKLAIKQLKSWMKPETAKTSMTTFPSSAEIVSEPLGVILIISAWNYPFLLSLD  131



>ref|XP_011069490.1| PREDICTED: aldehyde dehydrogenase-like [Sesamum indicum]
Length=476

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 99/124 (80%), Gaps = 0/124 (0%)
 Frame = +1

Query  154  LEMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  333
            + +       ELR  +A GKTK++EWRVSQLKA+LKI  HHEK I++AL SDL KPELE+
Sbjct  1    MALGVEGVAGELRSIYATGKTKTFEWRVSQLKAILKITAHHEKEIVEALHSDLKKPELEA  60

Query  334  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  513
            F++E++ V + CK ALKEL RWM PE VK++ ATYPSSA+IVSEPLGVVLVIS WNYPF+
Sbjct  61   FLYEVSGVSSVCKYALKELHRWMMPEKVKTSMATYPSSAEIVSEPLGVVLVISTWNYPFL  120

Query  514  LSLD  525
            LSL+
Sbjct  121  LSLE  124



>gb|AGC65583.1| fatty aldehyde dehydrogenase [Simmondsia chinensis]
Length=492

 Score =   173 bits (439),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = +1

Query  139  EERK*LEMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSK  318
            EE+K     AA+ V+ELR TFAAGKT+SYEWRV+QL  ++K+ E+HE+ I++AL  DL+K
Sbjct  2    EEKKFDTEAAASTVTELRRTFAAGKTRSYEWRVAQLNGMIKMVENHEQEIVEALRLDLNK  61

Query  319  PELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAW  498
            PE ES ++EI  +K+SCK+ALKELK+WM PE VK++  T+PSSA+IV EPLG+VLVISAW
Sbjct  62   PEFESILYEIMLLKSSCKVALKELKQWMMPEKVKTSLTTFPSSAEIVPEPLGIVLVISAW  121

Query  499  NYPFMLSLD  525
            NYP +LSLD
Sbjct  122  NYPLLLSLD  130



>ref|XP_009379028.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009379041.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Pyrus x bretschneideri]
Length=491

 Score =   173 bits (439),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 105/132 (80%), Gaps = 3/132 (2%)
 Frame = +1

Query  139  EERK*LEMDAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSD  309
            EE+K +  D+  A   V ELR ++ +GKT+SYEWR SQL  +LK+ EHHE+ I+DAL SD
Sbjct  5    EEQKRMYFDSKYALTMVEELRASYNSGKTRSYEWRESQLNNLLKVVEHHEQEIVDALRSD  64

Query  310  LSKPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVI  489
            LSKPE E++V EIA +K SC LA+KEL++WMKPE VK++   +P+SA+IVSEPLG +LVI
Sbjct  65   LSKPEFEAYVQEIAMIKNSCNLAIKELRKWMKPEKVKTSITVFPASAEIVSEPLGAILVI  124

Query  490  SAWNYPFMLSLD  525
            SAWNYPF+LSLD
Sbjct  125  SAWNYPFLLSLD  136



>gb|KEH40518.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=488

 Score =   173 bits (438),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            +A+  V +LR TF +GKT+SYEW+VSQLKA+L++ E HEK I++AL+SDLSK E ESF+ 
Sbjct  15   EASTTVKDLRITFDSGKTRSYEWKVSQLKALLELTEKHEKEIVEALYSDLSKSEAESFIQ  74

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            E+  +K SCK ALKELK WM PE VK++  T+PSSA+IVSEP GVVLVISAWNYPF+LSL
Sbjct  75   EVGMLKNSCKTALKELKHWMAPEKVKTSITTFPSSAEIVSEPFGVVLVISAWNYPFLLSL  134

Query  523  D  525
            D
Sbjct  135  D  135



>gb|ACJ85852.1| unknown [Medicago truncatula]
Length=488

 Score =   173 bits (438),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            +A+  V +LR TF +GKT+SYEW+VSQLKA+L++ E HEK I++AL+SDLSK E ESF+ 
Sbjct  15   EASTTVKDLRITFDSGKTRSYEWKVSQLKALLELTEKHEKEIVEALYSDLSKSEAESFIQ  74

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            E+  +K SCK ALKELK WM PE VK++  T+PSSA+IVSEP GVVLVISAWNYPF+LSL
Sbjct  75   EVGMLKNSCKTALKELKHWMAPEKVKTSITTFPSSAEIVSEPFGVVLVISAWNYPFLLSL  134

Query  523  D  525
            D
Sbjct  135  D  135



>ref|XP_003544699.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoformX2 
[Glycine max]
Length=487

 Score =   173 bits (438),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            +A   V ELR TF  GKT+SYEWR+SQLKA++K+ E +E+ I  AL SDLSK E E+FV 
Sbjct  15   EALMMVKELRVTFDCGKTRSYEWRISQLKAIIKLTEENEQQIYQALHSDLSKCETEAFVQ  74

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            EIA +K SC++ALKELK WM PE VK++ AT+PSSA+IVSEPLGVVLVISAWNYPF+LSL
Sbjct  75   EIAMLKNSCRIALKELKHWMTPEKVKTSIATFPSSAEIVSEPLGVVLVISAWNYPFLLSL  134

Query  523  D  525
            D
Sbjct  135  D  135



>ref|XP_007048537.1| Aldehyde dehydrogenase 3I1 isoform 3 [Theobroma cacao]
 gb|EOX92694.1| Aldehyde dehydrogenase 3I1 isoform 3 [Theobroma cacao]
Length=487

 Score =   172 bits (437),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 108/130 (83%), Gaps = 1/130 (1%)
 Frame = +1

Query  139  EERK*LEMDAAAA-VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  315
            E ++  ++D AA  V ELR+TF++GKTKSYEWR+SQL+++ K+ +  EK I++AL  DLS
Sbjct  3    EAKQTFDVDKAAVLVKELRKTFSSGKTKSYEWRMSQLESISKMIDEKEKEIIEALHKDLS  62

Query  316  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  495
            KPELE+F+ EI+  K+SCKLALKELK WM P+ V+++ ATYPSSAKIVSEPLGVVLVIS 
Sbjct  63   KPELEAFISEISMTKSSCKLALKELKHWMMPKKVETSMATYPSSAKIVSEPLGVVLVIST  122

Query  496  WNYPFMLSLD  525
            WN+PF+LSLD
Sbjct  123  WNFPFLLSLD  132



>ref|XP_008378442.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Malus 
domestica]
 ref|XP_008365200.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Malus domestica]
Length=491

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            DA   V ELR ++ +GKT+SYEWR SQL  +LK+AE HE+ I+DAL SDLSKPE E++V 
Sbjct  16   DALTMVEELRASYNSGKTRSYEWRESQLNNLLKVAELHEQEIVDALRSDLSKPEFEAYVQ  75

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            EIA +K SC LA+KEL++WMKPE VK++ A +P+SA+IVSEPLG +LVISAWNYPF+LSL
Sbjct  76   EIAMLKNSCNLAIKELRKWMKPEKVKTSIAVFPASAEIVSEPLGAILVISAWNYPFLLSL  135

Query  523  D  525
            D
Sbjct  136  D  136



>ref|XP_007048536.1| Aldehyde dehydrogenase 3I1 isoform 2 [Theobroma cacao]
 gb|EOX92693.1| Aldehyde dehydrogenase 3I1 isoform 2 [Theobroma cacao]
Length=542

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 108/130 (83%), Gaps = 1/130 (1%)
 Frame = +1

Query  139  EERK*LEMDAAAA-VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  315
            E ++  ++D AA  V ELR+TF++GKTKSYEWR+SQL+++ K+ +  EK I++AL  DLS
Sbjct  58   EAKQTFDVDKAAVLVKELRKTFSSGKTKSYEWRMSQLESISKMIDEKEKEIIEALHKDLS  117

Query  316  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  495
            KPELE+F+ EI+  K+SCKLALKELK WM P+ V+++ ATYPSSAKIVSEPLGVVLVIS 
Sbjct  118  KPELEAFISEISMTKSSCKLALKELKHWMMPKKVETSMATYPSSAKIVSEPLGVVLVIST  177

Query  496  WNYPFMLSLD  525
            WN+PF+LSLD
Sbjct  178  WNFPFLLSLD  187



>ref|XP_007019116.1| Aldehyde dehydrogenase 3H1 isoform 1 [Theobroma cacao]
 gb|EOY16341.1| Aldehyde dehydrogenase 3H1 isoform 1 [Theobroma cacao]
Length=489

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 105/130 (81%), Gaps = 1/130 (1%)
 Frame = +1

Query  139  EERK*LEMDAAA-AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  315
            E++   + D+A   V ELR +F AGKTKSYEWRV+QLKA+LK+ E +E  I  AL  DLS
Sbjct  6    EKKAVFDTDSAKEVVKELRASFVAGKTKSYEWRVAQLKALLKMTEENEPQIAAALRDDLS  65

Query  316  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  495
            KPELES+++EIA +K SC+LALKE+KRW+ PE  K++  T+PSSA+IVSEPLGVVLVISA
Sbjct  66   KPELESYIYEIAMLKNSCRLALKEMKRWIMPEKAKTSLTTFPSSAEIVSEPLGVVLVISA  125

Query  496  WNYPFMLSLD  525
            WNYPF+LSLD
Sbjct  126  WNYPFLLSLD  135



>ref|XP_007048535.1| Aldehyde dehydrogenase 3I1 isoform 1 [Theobroma cacao]
 gb|EOX92692.1| Aldehyde dehydrogenase 3I1 isoform 1 [Theobroma cacao]
Length=547

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 108/130 (83%), Gaps = 1/130 (1%)
 Frame = +1

Query  139  EERK*LEMDAAAA-VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  315
            E ++  ++D AA  V ELR+TF++GKTKSYEWR+SQL+++ K+ +  EK I++AL  DLS
Sbjct  63   EAKQTFDVDKAAVLVKELRKTFSSGKTKSYEWRMSQLESISKMIDEKEKEIIEALHKDLS  122

Query  316  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  495
            KPELE+F+ EI+  K+SCKLALKELK WM P+ V+++ ATYPSSAKIVSEPLGVVLVIS 
Sbjct  123  KPELEAFISEISMTKSSCKLALKELKHWMMPKKVETSMATYPSSAKIVSEPLGVVLVIST  182

Query  496  WNYPFMLSLD  525
            WN+PF+LSLD
Sbjct  183  WNFPFLLSLD  192



>ref|XP_007222253.1| hypothetical protein PRUPE_ppa004751mg [Prunus persica]
 gb|EMJ23452.1| hypothetical protein PRUPE_ppa004751mg [Prunus persica]
Length=493

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            A+A   ELR TFA+ KT+SY+WR SQLK++LK+   +E AI+DAL SDLSKPELES V+E
Sbjct  19   ASALAKELRATFASAKTRSYQWRESQLKSLLKLTTSNEPAIVDALRSDLSKPELESQVYE  78

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I+ +K SCKLALKEL+ WMKPE  K++  T+PSSA+IVSEPLGV+L+ISAWNYPF+LSLD
Sbjct  79   ISMLKNSCKLALKELRNWMKPEKAKTSLTTFPSSAEIVSEPLGVILIISAWNYPFLLSLD  138



>ref|XP_007019117.1| Aldehyde dehydrogenase 3H1 isoform 2 [Theobroma cacao]
 gb|EOY16342.1| Aldehyde dehydrogenase 3H1 isoform 2 [Theobroma cacao]
Length=515

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 105/130 (81%), Gaps = 1/130 (1%)
 Frame = +1

Query  139  EERK*LEMDAAA-AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  315
            E++   + D+A   V ELR +F AGKTKSYEWRV+QLKA+LK+ E +E  I  AL  DLS
Sbjct  6    EKKAVFDTDSAKEVVKELRASFVAGKTKSYEWRVAQLKALLKMTEENEPQIAAALRDDLS  65

Query  316  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  495
            KPELES+++EIA +K SC+LALKE+KRW+ PE  K++  T+PSSA+IVSEPLGVVLVISA
Sbjct  66   KPELESYIYEIAMLKNSCRLALKEMKRWIMPEKAKTSLTTFPSSAEIVSEPLGVVLVISA  125

Query  496  WNYPFMLSLD  525
            WNYPF+LSLD
Sbjct  126  WNYPFLLSLD  135



>ref|XP_002306641.1| the aldehyde dehydrogenase cp-ADH from C.plantagineum family 
protein [Populus trichocarpa]
 gb|EEE93637.1| the aldehyde dehydrogenase cp-ADH from C.plantagineum family 
protein [Populus trichocarpa]
Length=488

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 105/130 (81%), Gaps = 1/130 (1%)
 Frame = +1

Query  139  EERK*LEMDAAAAVS-ELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  315
            EE    +++AA  ++ ELR+ FA+GKT+SYEWR+SQLK+++K+ + HE+ I+DAL  DLS
Sbjct  6    EENTVFDVEAANVLTKELRDVFASGKTRSYEWRISQLKSIVKMCDEHEEDIVDALRQDLS  65

Query  316  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  495
            KP+LES V+E+  VK SC LA+KELK WM PE  K++  T+PSSA+IVSEPLG VL+ISA
Sbjct  66   KPQLESIVYELTMVKNSCTLAIKELKHWMMPEKAKTSLTTFPSSAEIVSEPLGAVLIISA  125

Query  496  WNYPFMLSLD  525
            WNYPF+LS+D
Sbjct  126  WNYPFLLSMD  135



>ref|XP_002302229.2| the aldehyde dehydrogenase cp-ADH from C.plantagineum family 
protein [Populus trichocarpa]
 gb|EEE81502.2| the aldehyde dehydrogenase cp-ADH from C.plantagineum family 
protein [Populus trichocarpa]
Length=488

 Score =   171 bits (433),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 105/135 (78%), Gaps = 3/135 (2%)
 Frame = +1

Query  130  LGREERK*LEMDAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDAL  300
            +  EE K +  D  AA     ELR+ FA+GKT+SYEWR+SQLK+++K+ + HE+ I+DAL
Sbjct  1    MATEEEKQMVFDVEAANMLTKELRDVFASGKTRSYEWRISQLKSMIKMCDEHEEDIVDAL  60

Query  301  FSDLSKPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVV  480
              DLSKP+LES V+EI  +K SC LA+KELK+WM PE  K++  T+PSSA+IV EPLGVV
Sbjct  61   HQDLSKPKLESIVYEITMLKNSCTLAIKELKQWMMPEKAKTSLLTFPSSAEIVPEPLGVV  120

Query  481  LVISAWNYPFMLSLD  525
            L+ISAWNYPF+LSLD
Sbjct  121  LIISAWNYPFLLSLD  135



>ref|XP_008365201.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Malus domestica]
Length=486

 Score =   171 bits (433),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            A+A V ELR TFA+GKT+SY+WRVSQL+ +LK+   +E  I++AL SDLSKPELES V+E
Sbjct  12   ASAVVKELRVTFASGKTRSYQWRVSQLECILKLLTENELEIVNALRSDLSKPELESKVYE  71

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            IA +K SC LA+KEL++WMKPE VK++ A +P+SA+IVSEPLG +LVISAWNYPF+LSLD
Sbjct  72   IAMLKNSCNLAIKELRKWMKPEKVKTSIAVFPASAEIVSEPLGAILVISAWNYPFLLSLD  131



>ref|XP_010999403.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Populus 
euphratica]
Length=488

 Score =   171 bits (433),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 106/130 (82%), Gaps = 1/130 (1%)
 Frame = +1

Query  139  EERK*LEMDAAAAVS-ELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  315
            EE    +++AA  ++ +LR+ FA+GKT+SYEWR+SQLK+++K+ + HE+ I+DAL  DLS
Sbjct  6    EENTVFDVEAANVLAKDLRDVFASGKTRSYEWRISQLKSIVKMCDEHEEDIVDALRQDLS  65

Query  316  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  495
            KP+LES V+E+  VK SC LA+KELKRWM PE  K++  T+PSSA+I+SEPLG VL+ISA
Sbjct  66   KPQLESIVYELTMVKNSCTLAIKELKRWMMPEKAKTSLTTFPSSAEILSEPLGAVLIISA  125

Query  496  WNYPFMLSLD  525
            WNYPF+LS+D
Sbjct  126  WNYPFLLSMD  135



>ref|XP_011074837.1| PREDICTED: aldehyde dehydrogenase [Sesamum indicum]
Length=476

 Score =   171 bits (432),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +1

Query  178  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  357
            V ELR T+ +GKTK+ EWR SQLKA+++IA HHE  I++AL SDL KPELESFVHEI  V
Sbjct  9    VKELRSTYTSGKTKTLEWRASQLKAIIRIATHHENEIVEALRSDLKKPELESFVHEICAV  68

Query  358  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
             ++CKLALKEL RWMKP+ VK++  T+P+S +IV EPLGVVLVIS WNYPF+LSL+
Sbjct  69   LSACKLALKELHRWMKPQKVKTSMTTFPASGEIVPEPLGVVLVISTWNYPFLLSLE  124



>ref|XP_011003449.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Populus 
euphratica]
Length=488

 Score =   171 bits (432),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 106/130 (82%), Gaps = 1/130 (1%)
 Frame = +1

Query  139  EERK*LEMDAAAAVS-ELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  315
            EE    +++AA  ++ +LR+ FA+GKT+SYEWR+SQLK+++K+ + HE+ I+DAL  DLS
Sbjct  6    EENTVFDVEAANVLAKDLRDVFASGKTRSYEWRISQLKSIVKMCDEHEEDIVDALRQDLS  65

Query  316  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  495
            KP+LES V+E+  VK SC LA+KELKRWM PE  K++  T+PSSA+I+SEPLG VL+ISA
Sbjct  66   KPQLESIVYELTMVKNSCTLAIKELKRWMMPEKAKTSLTTFPSSAEILSEPLGAVLIISA  125

Query  496  WNYPFMLSLD  525
            WNYPF+LS+D
Sbjct  126  WNYPFLLSMD  135



>ref|XP_004498346.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Cicer arietinum]
Length=488

 Score =   171 bits (432),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            +A A V +LR TF +GKT+SY+WRVSQLKA+  + E HEK I+ +L+SDLSK E ESF+ 
Sbjct  15   EAFATVKDLRVTFDSGKTRSYKWRVSQLKALFDLTEGHEKEIVASLYSDLSKSETESFIQ  74

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            EIA +K SC+ A+KELK WM PE VK++  T+PSSA+IVSEPLGVVLVISAWNYPF+LSL
Sbjct  75   EIAMLKNSCQAAIKELKHWMAPEKVKTSLTTFPSSAEIVSEPLGVVLVISAWNYPFLLSL  134

Query  523  D  525
            D
Sbjct  135  D  135



>gb|KDP32847.1| hypothetical protein JCGZ_12139 [Jatropha curcas]
Length=493

 Score =   170 bits (431),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 103/124 (83%), Gaps = 3/124 (2%)
 Frame = +1

Query  163  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  333
            DA AA   V EL   FA+GKT+SYEWRV+QLK +LK+ + +EK I++AL  DLSKPELES
Sbjct  15   DAEAARDLVKELTGNFASGKTRSYEWRVAQLKNMLKLCDENEKEIVEALRLDLSKPELES  74

Query  334  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  513
             ++EIA +K SCKLALKELK W+KPE V+++  T+PSSA+IVSEPLGVVL+ISAWNYPF+
Sbjct  75   TIYEIALLKNSCKLALKELKHWIKPEKVRTSLTTFPSSAEIVSEPLGVVLIISAWNYPFL  134

Query  514  LSLD  525
            LSLD
Sbjct  135  LSLD  138



>gb|KGN54554.1| hypothetical protein Csa_4G361880 [Cucumis sativus]
Length=484

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 3/124 (2%)
 Frame = +1

Query  163  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  333
            DAAAA   V+ELR  F +G T+SYEWRVSQL+++LK+   HE+ I DAL SDLSKP LES
Sbjct  8    DAAAATDLVNELRAIFNSGNTRSYEWRVSQLESLLKLCVDHEEDICDALRSDLSKPALES  67

Query  334  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  513
             +HEI  VK SCKLA+KE+  WMKPE V++   ++PSSA IVSEPLGVVL+IS WNYPF 
Sbjct  68   IIHEIGMVKGSCKLAIKEIGNWMKPEKVQTTMTSFPSSAAIVSEPLGVVLIISPWNYPFF  127

Query  514  LSLD  525
            LSLD
Sbjct  128  LSLD  131



>ref|XP_010243504.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Nelumbo nucifera]
Length=568

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            AA+ + ELR TFA+GKTKSYEWRV QLK ++K+ + +E+AIM+AL  DL+KP  ESFV E
Sbjct  91   AASLLKELRGTFASGKTKSYEWRVQQLKNMIKMIDDNERAIMEALQQDLAKPRFESFVSE  150

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I+  KA+C  ALKELK WMKPE  K+A  T+PSSA+IVSEP G+VL+ISAWNYPF+LSLD
Sbjct  151  ISLTKAACNHALKELKHWMKPEKAKTAITTFPSSAEIVSEPFGIVLIISAWNYPFLLSLD  210



>ref|XP_008368060.1| PREDICTED: aldehyde dehydrogenase-like [Malus domestica]
Length=139

 Score =   160 bits (406),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +1

Query  157  EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  336
            E  A+A V ELR +F +GKT+SY+WRVSQLK + K+    E+ I+DAL SDLSKPELES 
Sbjct  19   EEAASAVVKELRASFVSGKTRSYQWRVSQLKGIXKLITKKEREIVDALRSDLSKPELESQ  78

Query  337  VHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFML  516
            V+ I+ +  SCKLA+KELK+WMKPE VK++ A +P+SA+IVSEPLG +LVISAWNYPF L
Sbjct  79   VYVISMLSNSCKLAIKELKKWMKPEKVKTSIAVFPASAEIVSEPLGAILVISAWNYPFSL  138



>ref|XP_010243505.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Nelumbo nucifera]
Length=567

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            AA+ + ELR TFA+GKTKSYEWRV QLK ++K+ + +E+AIM+AL  DL+KP  ESFV E
Sbjct  90   AASLLKELRGTFASGKTKSYEWRVQQLKNMIKMIDDNERAIMEALQQDLAKPRFESFVSE  149

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I+  KA+C  ALKELK WMKPE  K+A  T+PSSA+IVSEP G+VL+ISAWNYPF+LSLD
Sbjct  150  ISLTKAACNHALKELKHWMKPEKAKTAITTFPSSAEIVSEPFGIVLIISAWNYPFLLSLD  209



>ref|XP_011027504.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Populus 
euphratica]
Length=488

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 104/135 (77%), Gaps = 3/135 (2%)
 Frame = +1

Query  130  LGREERK*LEMDAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDAL  300
            +  EE K    D  AA     ELR+ FA+GKT+SYEWR+SQLK+++K+ + HE+ I+DAL
Sbjct  1    MATEEEKQTVFDVEAANMLTKELRDVFASGKTRSYEWRISQLKSMIKMCDEHEEDIVDAL  60

Query  301  FSDLSKPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVV  480
              DLSKP+LES V+EI  +K SC LA+KELK+WM PE  K++  T+PSSA+IV EPLGVV
Sbjct  61   HQDLSKPKLESIVYEITMLKNSCTLAIKELKQWMMPEKAKTSLLTFPSSAEIVPEPLGVV  120

Query  481  LVISAWNYPFMLSLD  525
            L+ISAWNYPF+LSLD
Sbjct  121  LIISAWNYPFLLSLD  135



>gb|KJB64494.1| hypothetical protein B456_010G051500 [Gossypium raimondii]
Length=344

 Score =   166 bits (420),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 104/130 (80%), Gaps = 1/130 (1%)
 Frame = +1

Query  139  EERK*LEMDAAA-AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  315
            E++   ++D+A   V ELR +F AGKTK YEWR +QLKA+LK+ + +E  I+ AL  DLS
Sbjct  6    EKKAVFDIDSAKEVVQELRASFVAGKTKDYEWRRTQLKAMLKMMDENEPQIVAALRDDLS  65

Query  316  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  495
            KPELES ++EIA +K SCKLALK++K WM PE  K++ AT+PSSA+IVSEPLGVVLVISA
Sbjct  66   KPELESSIYEIAMLKNSCKLALKKMKHWMMPEKAKTSLATFPSSAEIVSEPLGVVLVISA  125

Query  496  WNYPFMLSLD  525
            WNYPF+LSLD
Sbjct  126  WNYPFLLSLD  135



>emb|CBI19000.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 109/142 (77%), Gaps = 9/142 (6%)
 Frame = +1

Query  127  CLGR--------EERK*LEMDAAAAV-SELRETFAAGKTKSYEWRVSQLKAVLKIAEHHE  279
            C GR        E +K  + +AAA++  ELR T+A+GKT+SYEWRV+QLK ++KI + HE
Sbjct  56   CCGRKSSMAEDSETKKVFDAEAAASLMKELRGTYASGKTRSYEWRVAQLKNLMKIVDDHE  115

Query  280  KAIMDALFSDLSKPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIV  459
            K I+DA+ +DLSKPE ES++ EI+ +K+SC  AL EL RWMKPE VK++  T+PSSA+IV
Sbjct  116  KDILDAIRADLSKPEQESYIAEISIIKSSCTRALGELNRWMKPEKVKTSITTFPSSAEIV  175

Query  460  SEPLGVVLVISAWNYPFMLSLD  525
            SEPLGVVL+I AWN+P +L+LD
Sbjct  176  SEPLGVVLIIGAWNFPLLLALD  197



>ref|XP_009379029.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009379042.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Pyrus x bretschneideri]
Length=486

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            A+A   ELR TFA+GKT+SY+WRVSQL+ +LK+   +E  I++AL SDLSKPELES V+E
Sbjct  12   ASAVAKELRVTFASGKTRSYQWRVSQLECILKLLTENELEIVNALRSDLSKPELESQVYE  71

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            IA +K SC LA+KEL++WMKPE VK++   +P+SA+IVSEPLG +LVISAWNYPF+LSLD
Sbjct  72   IAMIKNSCNLAIKELRKWMKPEKVKTSITVFPASAEIVSEPLGAILVISAWNYPFLLSLD  131



>ref|XP_010095408.1| Aldehyde dehydrogenase family 3 member H1 [Morus notabilis]
 gb|EXB60100.1| Aldehyde dehydrogenase family 3 member H1 [Morus notabilis]
Length=497

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 102/133 (77%), Gaps = 1/133 (1%)
 Frame = +1

Query  130  LGREERK*LEM-DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFS  306
            +G EE    +  DA     ELRE+FA+GKT+SYEWR SQLK +LKI ++HE+ ++ AL S
Sbjct  1    MGSEEANAFDAKDAPKIAGELRESFASGKTRSYEWRTSQLKTILKILDNHEQDMILALRS  60

Query  307  DLSKPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLV  486
            DLSKPE+ES++ EIA +K SCK  LK LK WM PE  K++  T+PSSA+IVSEPLGV+L+
Sbjct  61   DLSKPEMESYIQEIAMLKNSCKATLKSLKGWMVPEKAKTSMTTFPSSAEIVSEPLGVILI  120

Query  487  ISAWNYPFMLSLD  525
            ISAWNYPF LS+D
Sbjct  121  ISAWNYPFYLSID  133



>ref|XP_010664200.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X2 [Vitis vinifera]
Length=488

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 106/130 (82%), Gaps = 1/130 (1%)
 Frame = +1

Query  139  EERK*LEMDAAAAV-SELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  315
            E +K  + +AAA++  ELR T+A+GKT+SYEWRV+QLK ++KI + HEK I+DA+ +DLS
Sbjct  6    ETKKVFDAEAAASLMKELRGTYASGKTRSYEWRVAQLKNLMKIVDDHEKDILDAIRADLS  65

Query  316  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  495
            KPE ES++ EI+ +K+SC  AL EL RWMKPE VK++  T+PSSA+IVSEPLGVVL+I A
Sbjct  66   KPEQESYIAEISIIKSSCTRALGELNRWMKPEKVKTSITTFPSSAEIVSEPLGVVLIIGA  125

Query  496  WNYPFMLSLD  525
            WN+P +L+LD
Sbjct  126  WNFPLLLALD  135



>ref|XP_003544698.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoformX1 
[Glycine max]
 gb|KHN20143.1| Aldehyde dehydrogenase family 3 member H1 [Glycine soja]
Length=496

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 100/124 (81%), Gaps = 3/124 (2%)
 Frame = +1

Query  163  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  333
            DA AA   V+ELR  FA+GKT+SYEWR+ QL A+ K+   HE+ I+DAL +DL KP LE+
Sbjct  21   DALAASRLVTELRGNFASGKTRSYEWRLLQLNAIAKLVVDHEQEIVDALRNDLGKPPLET  80

Query  334  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  513
              +EIA +K SC++ALKELK WM PE VK++ AT+PSSA+IVSEPLGVVLVISAWNYPF+
Sbjct  81   VAYEIAMLKNSCRIALKELKHWMTPEKVKTSIATFPSSAEIVSEPLGVVLVISAWNYPFL  140

Query  514  LSLD  525
            LSLD
Sbjct  141  LSLD  144



>ref|XP_002520352.1| Aldehyde dehydrogenase, putative [Ricinus communis]
 gb|EEF42138.1| Aldehyde dehydrogenase, putative [Ricinus communis]
Length=495

 Score =   168 bits (426),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            + ++ + ELR +F +GKT+SYEWRV+Q+K+++K+ + HEK I+DAL  DLSKPELES V+
Sbjct  19   EGSSMMKELRGSFGSGKTRSYEWRVTQIKSLVKLCDFHEKEIVDALRLDLSKPELESTVY  78

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            EI  +K SC++ALKELK WM+PE  K++ AT+PS+A+IV EP GVVL+ISAWNYPF+LSL
Sbjct  79   EIGMLKNSCRVALKELKHWMRPEKAKTSIATFPSAAEIVPEPFGVVLIISAWNYPFLLSL  138

Query  523  D  525
            D
Sbjct  139  D  139



>ref|XP_010674357.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=549

 Score =   169 bits (428),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 109/148 (74%), Gaps = 9/148 (6%)
 Frame = +1

Query  109  IYKYIYC-------LGREERK*L--EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLK  261
            I  +I+C       +  E+RK L    +A   V ELR  F +GKTK+YEWR +Q+K++ +
Sbjct  47   ISTHIHCSTAAVPIMAEEKRKSLFDANEAGILVKELRRQFGSGKTKTYEWREAQIKSLSQ  106

Query  262  IAEHHEKAIMDALFSDLSKPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYP  441
            + +  EK I++AL  DL KPE E FV EIA +K+SCKLAL++LK+WMKPE VK++  TYP
Sbjct  107  MIDDREKEIIEALHEDLCKPEFEGFVAEIAMIKSSCKLALRDLKQWMKPEKVKTSLTTYP  166

Query  442  SSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            SSA+IVSEPLGVVLVISAWNYPF+LSLD
Sbjct  167  SSAEIVSEPLGVVLVISAWNYPFLLSLD  194



>ref|XP_010674356.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=550

 Score =   169 bits (427),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 109/148 (74%), Gaps = 9/148 (6%)
 Frame = +1

Query  109  IYKYIYC-------LGREERK*L--EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLK  261
            I  +I+C       +  E+RK L    +A   V ELR  F +GKTK+YEWR +Q+K++ +
Sbjct  48   ISTHIHCSTAAVPIMAEEKRKSLFDANEAGILVKELRRQFGSGKTKTYEWREAQIKSLSQ  107

Query  262  IAEHHEKAIMDALFSDLSKPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYP  441
            + +  EK I++AL  DL KPE E FV EIA +K+SCKLAL++LK+WMKPE VK++  TYP
Sbjct  108  MIDDREKEIIEALHEDLCKPEFEGFVAEIAMIKSSCKLALRDLKQWMKPEKVKTSLTTYP  167

Query  442  SSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            SSA+IVSEPLGVVLVISAWNYPF+LSLD
Sbjct  168  SSAEIVSEPLGVVLVISAWNYPFLLSLD  195



>ref|XP_010664198.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Vitis vinifera]
 ref|XP_010664199.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Vitis vinifera]
Length=516

 Score =   168 bits (426),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 106/130 (82%), Gaps = 1/130 (1%)
 Frame = +1

Query  139  EERK*LEMDAAAAV-SELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  315
            E +K  + +AAA++  ELR T+A+GKT+SYEWRV+QLK ++KI + HEK I+DA+ +DLS
Sbjct  6    ETKKVFDAEAAASLMKELRGTYASGKTRSYEWRVAQLKNLMKIVDDHEKDILDAIRADLS  65

Query  316  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  495
            KPE ES++ EI+ +K+SC  AL EL RWMKPE VK++  T+PSSA+IVSEPLGVVL+I A
Sbjct  66   KPEQESYIAEISIIKSSCTRALGELNRWMKPEKVKTSITTFPSSAEIVSEPLGVVLIIGA  125

Query  496  WNYPFMLSLD  525
            WN+P +L+LD
Sbjct  126  WNFPLLLALD  135



>emb|CAN73659.1| hypothetical protein VITISV_044129 [Vitis vinifera]
Length=541

 Score =   169 bits (427),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 105/133 (79%), Gaps = 1/133 (1%)
 Frame = +1

Query  130  LGREERK*LEMDAAAA-VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFS  306
            +  E++K  ++++AA+ V ELR +F AGKTKSYEWR++QLK + K+ +  EK I++AL  
Sbjct  62   MADEKKKVFDVESAASLVKELRGSFNAGKTKSYEWRIAQLKGIEKMIDEREKDIIEALHE  121

Query  307  DLSKPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLV  486
            DLSKPELE+FV EI+  K +CKLALKEL  WMKPE  K++  TYPSSA+IVSEPLGVVLV
Sbjct  122  DLSKPELEAFVSEISMSKGACKLALKELGHWMKPEKAKTSMTTYPSSAEIVSEPLGVVLV  181

Query  487  ISAWNYPFMLSLD  525
            IS WNYP +LS+D
Sbjct  182  ISTWNYPLLLSID  194



>gb|KJB75341.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
 gb|KJB75342.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=488

 Score =   167 bits (424),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            AA  V+ELR+TF +GKTKSYEWR+SQL+++ K+ +  EK I++AL  DLSKPELE+F+ E
Sbjct  14   AAVLVNELRKTFNSGKTKSYEWRISQLESISKMIDEKEKEIVEALRKDLSKPELEAFLSE  73

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I   ++SCKLALKELK+WM P+ V+++ ATYPSSA+IV+EPLGVVLVIS WN+PF LSLD
Sbjct  74   ILMARSSCKLALKELKQWMMPQKVETSLATYPSSAEIVAEPLGVVLVISTWNFPFSLSLD  133



>emb|CBI21614.3| unnamed protein product [Vitis vinifera]
Length=548

 Score =   169 bits (427),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 105/133 (79%), Gaps = 1/133 (1%)
 Frame = +1

Query  130  LGREERK*LEMDAAAA-VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFS  306
            +  E++K  ++++AA+ V ELR +F AGKTKSYEWR++QLK + K+ +  EK I++AL  
Sbjct  61   MADEKKKVFDVESAASLVKELRGSFNAGKTKSYEWRIAQLKGIEKMIDEREKDIIEALHE  120

Query  307  DLSKPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLV  486
            DLSKPELE+FV EI+  K +CKLALKEL  WMKPE  K++  TYPSSA+IVSEPLGVVLV
Sbjct  121  DLSKPELEAFVSEISMSKGACKLALKELGHWMKPEKAKTSMTTYPSSAEIVSEPLGVVLV  180

Query  487  ISAWNYPFMLSLD  525
            IS WNYP +LS+D
Sbjct  181  ISTWNYPLLLSID  193



>ref|XP_002273730.2| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Vitis 
vinifera]
Length=549

 Score =   169 bits (427),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 105/133 (79%), Gaps = 1/133 (1%)
 Frame = +1

Query  130  LGREERK*LEMDAAAA-VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFS  306
            +  E++K  ++++AA+ V ELR +F AGKTKSYEWR++QLK + K+ +  EK I++AL  
Sbjct  62   MADEKKKVFDVESAASLVKELRGSFNAGKTKSYEWRIAQLKGIEKMIDEREKDIIEALHE  121

Query  307  DLSKPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLV  486
            DLSKPELE+FV EI+  K +CKLALKEL  WMKPE  K++  TYPSSA+IVSEPLGVVLV
Sbjct  122  DLSKPELEAFVSEISMSKGACKLALKELGHWMKPEKAKTSMTTYPSSAEIVSEPLGVVLV  181

Query  487  ISAWNYPFMLSLD  525
            IS WNYP +LS+D
Sbjct  182  ISTWNYPLLLSID  194



>ref|XP_010674968.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Beta vulgaris 
subsp. vulgaris]
Length=487

 Score =   167 bits (424),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +1

Query  154  LEMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  333
            +E+  A  V+ELR TF +GKT+SYEWRVSQLK+++K+ E  E  I++AL SDL+KP  ES
Sbjct  1    MEVTTADMVNELRRTFVSGKTRSYEWRVSQLKSIVKMIEECETQIVEALRSDLNKPPFES  60

Query  334  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  513
             ++EI+ +K+SC++ALKELK+WMKPE VK+    +PSSA+IV+EPLGVVLVISAWNYP +
Sbjct  61   ILYEISMLKSSCRVALKELKQWMKPEKVKTPIVAFPSSAEIVAEPLGVVLVISAWNYPIL  120

Query  514  LSLD  525
            LSLD
Sbjct  121  LSLD  124



>ref|XP_008444179.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
melo]
 ref|XP_008444180.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
melo]
Length=484

 Score =   167 bits (424),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 96/124 (77%), Gaps = 3/124 (2%)
 Frame = +1

Query  163  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  333
            DAAAA   V ELR  F +G T+SYEWRVSQL+++LK+   HE+ I DAL SDLSKP LES
Sbjct  8    DAAAATELVKELRAIFISGNTRSYEWRVSQLESLLKLCVDHEEDICDALRSDLSKPALES  67

Query  334  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  513
             +HEI  VK SCKLA+KE++ WMKPE V++   ++PS+A IV EPLGVVL+IS WNYPF 
Sbjct  68   IIHEIGMVKGSCKLAIKEIRNWMKPEKVQTTITSFPSTAAIVPEPLGVVLIISPWNYPFF  127

Query  514  LSLD  525
            LSLD
Sbjct  128  LSLD  131



>ref|XP_011031097.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Populus 
euphratica]
Length=553

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            +A + V EL+E+F  G+T+SYEWRVSQLK + KI E  EK I +AL+ DLSKPE E+FV 
Sbjct  78   EAPSLVKELKESFRTGRTRSYEWRVSQLKGIEKIVEEREKDISEALYKDLSKPEFEAFVS  137

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            EIA VK+SC+ ALKELK+WMKPE  K++   YPSSA+IVSEPLG VLVIS WNYPF+LS+
Sbjct  138  EIAAVKSSCEEALKELKQWMKPEKAKTSMTAYPSSAEIVSEPLGAVLVISTWNYPFLLSI  197

Query  523  D  525
            D
Sbjct  198  D  198



>ref|XP_008781593.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Phoenix 
dactylifera]
Length=495

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            AA  V+ELRETF +G+T+S EWR +QLKA++++ E  E  IM AL++DL+KP+LES++HE
Sbjct  20   AAEMVAELRETFRSGRTRSLEWRAAQLKALVRMIEEKESDIMGALYADLAKPQLESYLHE  79

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I+ VK++C  ALK+LKRWMKPE V ++  T+PS+A+IVSEPLGVVL+ISAWNYP +LS+D
Sbjct  80   ISLVKSACSFALKQLKRWMKPEKVPASITTFPSTAEIVSEPLGVVLIISAWNYPVLLSID  139



>ref|XP_008338656.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Malus 
domestica]
Length=496

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            A+A V ELR +F +GKT+SY+WRVSQLK + K+    E+ I+DAL SDLSKPELES V+ 
Sbjct  22   ASAVVKELRASFVSGKTRSYQWRVSQLKGIXKLITKKEREIVDALRSDLSKPELESQVYV  81

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I+ +  SCKLA+KELK+WMKPE VK++ A +P+SA+IVSEPLG +LVISAWNYPF+LSLD
Sbjct  82   ISMLXNSCKLAIKELKKWMKPEKVKTSIAVFPASAEIVSEPLGAILVISAWNYPFLLSLD  141



>gb|EPS67420.1| aldehyde dehydrogenase, partial [Genlisea aurea]
Length=225

 Score =   160 bits (406),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +1

Query  160  MDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFV  339
            +DA A V ELR TFA+G+T+S++WRVSQLKA +KI  +HE+ I++AL SDL+KP+LE+ V
Sbjct  2    VDAEALVGELRSTFASGRTRSFDWRVSQLKAFIKILTYHEEEIVEALRSDLNKPQLEAVV  61

Query  340  HEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLS  519
            HEIA + ++C  +LK+LK+WMKP+ V ++  T+PSSAK++ EPLGVVLVIS WNYP +LS
Sbjct  62   HEIAPLLSACTRSLKKLKQWMKPQKVNTSLLTFPSSAKLMMEPLGVVLVISTWNYPVLLS  121

Query  520  LD  525
            L+
Sbjct  122  LE  123



>ref|XP_002307060.1| hypothetical protein POPTR_0005s07090g [Populus trichocarpa]
 gb|EEE94056.1| hypothetical protein POPTR_0005s07090g [Populus trichocarpa]
Length=488

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            +A + V EL+E+F  G+T+SYEWRVSQLK + K+ E  EK I +AL+ DLSKPE E+FV 
Sbjct  13   EAPSLVKELKESFRTGRTRSYEWRVSQLKGIEKMVEEREKDISEALYKDLSKPEFEAFVS  72

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            EIA VK+SC+ ALKELK+WMKPE  K++   YPSSA+IVSEPLG VLVIS WNYPF+LS+
Sbjct  73   EIAAVKSSCEEALKELKQWMKPEKAKTSMTAYPSSAEIVSEPLGAVLVISTWNYPFLLSI  132

Query  523  D  525
            D
Sbjct  133  D  133



>gb|KJB75338.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=544

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            AA  V+ELR+TF +GKTKSYEWR+SQL+++ K+ +  EK I++AL  DLSKPELE+F+ E
Sbjct  70   AAVLVNELRKTFNSGKTKSYEWRISQLESISKMIDEKEKEIVEALRKDLSKPELEAFLSE  129

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I   ++SCKLALKELK+WM P+ V+++ ATYPSSA+IV+EPLGVVLVIS WN+PF LSLD
Sbjct  130  ILMARSSCKLALKELKQWMMPQKVETSLATYPSSAEIVAEPLGVVLVISTWNFPFSLSLD  189



>gb|KJB75340.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=547

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            AA  V+ELR+TF +GKTKSYEWR+SQL+++ K+ +  EK I++AL  DLSKPELE+F+ E
Sbjct  73   AAVLVNELRKTFNSGKTKSYEWRISQLESISKMIDEKEKEIVEALRKDLSKPELEAFLSE  132

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I   ++SCKLALKELK+WM P+ V+++ ATYPSSA+IV+EPLGVVLVIS WN+PF LSLD
Sbjct  133  ILMARSSCKLALKELKQWMMPQKVETSLATYPSSAEIVAEPLGVVLVISTWNFPFSLSLD  192



>ref|XP_006575169.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Glycine 
max]
Length=496

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 100/124 (81%), Gaps = 3/124 (2%)
 Frame = +1

Query  163  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  333
            DA AA   V+ELR  FA+ KT+SYEWR+SQL A+ K+   HE+ I+DAL +DL KP LE+
Sbjct  21   DAEAASRLVNELRRNFASNKTRSYEWRLSQLNALEKLVVVHEQEIVDALRNDLGKPPLET  80

Query  334  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  513
              +EIA +K SC++ALKELK WM PE VK++ AT+PSSA+IVSEPLGVVLVISAWNYPF+
Sbjct  81   VAYEIAMLKNSCRIALKELKHWMTPEKVKTSIATFPSSAEIVSEPLGVVLVISAWNYPFL  140

Query  514  LSLD  525
            LSLD
Sbjct  141  LSLD  144



>ref|XP_010268979.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Nelumbo 
nucifera]
Length=489

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            AAA + ELR +FA+GKTKSY WRV QLK VL++ + +EKAI++AL  DL+KP+ E+FV+E
Sbjct  15   AAALLKELRVSFASGKTKSYGWRVQQLKNVLRMVDENEKAIVEALRLDLAKPKFEAFVNE  74

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I+ VKA+CK +L +LK WMKP+  K++  T+PSSAKIVSEPLGVVL+ISAWNYPF+LSLD
Sbjct  75   ISLVKAACKHSLTKLKHWMKPQKAKTSIITFPSSAKIVSEPLGVVLIISAWNYPFLLSLD  134



>gb|KJB75339.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=547

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            AA  V+ELR+TF +GKTKSYEWR+SQL+++ K+ +  EK I++AL  DLSKPELE+F+ E
Sbjct  70   AAVLVNELRKTFNSGKTKSYEWRISQLESISKMIDEKEKEIVEALRKDLSKPELEAFLSE  129

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I   ++SCKLALKELK+WM P+ V+++ ATYPSSA+IV+EPLGVVLVIS WN+PF LSLD
Sbjct  130  ILMARSSCKLALKELKQWMMPQKVETSLATYPSSAEIVAEPLGVVLVISTWNFPFSLSLD  189



>gb|AAY23279.1| aldehyde dehydrogenase, putative [Oryza sativa Japonica Group]
 gb|ABA91776.2| aldehyde dehydrogenase family protein, expressed [Oryza sativa 
Japonica Group]
Length=321

 Score =   162 bits (411),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = +1

Query  157  EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  336
            E + AA V ELR +F +G+T++ EWR +QL+ ++++ E  E  I DAL SDL+KP +ES+
Sbjct  3    EEEVAAVVGELRGSFRSGRTRAAEWRAAQLRGIVRMVEEREGDISDALHSDLAKPRMESY  62

Query  337  VHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFML  516
            +HEI+  KA+C  ALK LK WMKPE V +A  T+PS+A+IVSEPLGVVLVISAWNYPF+L
Sbjct  63   LHEISLAKAACTFALKGLKNWMKPEKVPAALTTFPSTAQIVSEPLGVVLVISAWNYPFLL  122

Query  517  SLD  525
            S+D
Sbjct  123  SID  125



>gb|KJB64493.1| hypothetical protein B456_010G051500 [Gossypium raimondii]
Length=490

 Score =   166 bits (420),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 104/130 (80%), Gaps = 1/130 (1%)
 Frame = +1

Query  139  EERK*LEMDAAA-AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  315
            E++   ++D+A   V ELR +F AGKTK YEWR +QLKA+LK+ + +E  I+ AL  DLS
Sbjct  6    EKKAVFDIDSAKEVVQELRASFVAGKTKDYEWRRTQLKAMLKMMDENEPQIVAALRDDLS  65

Query  316  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  495
            KPELES ++EIA +K SCKLALK++K WM PE  K++ AT+PSSA+IVSEPLGVVLVISA
Sbjct  66   KPELESSIYEIAMLKNSCKLALKKMKHWMMPEKAKTSLATFPSSAEIVSEPLGVVLVISA  125

Query  496  WNYPFMLSLD  525
            WNYPF+LSLD
Sbjct  126  WNYPFLLSLD  135



>ref|XP_009414877.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009414878.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
Length=493

 Score =   166 bits (420),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 103/134 (77%), Gaps = 3/134 (2%)
 Frame = +1

Query  133  GREERK*LEMDAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALF  303
            G E  K    D A A   V+ LR +FA+G+T+S+EWR +QLK ++++ +  E AIM AL 
Sbjct  5    GEERGKGAGFDGAMAAELVAGLRRSFASGRTRSHEWRAAQLKGIVRMIDEKESAIMAALH  64

Query  304  SDLSKPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVL  483
             DL+KP++ES++HEI+  KA+C  ALKE+KRWMKPE V ++  T+PSSA+I+SEPLGVVL
Sbjct  65   EDLAKPQMESYLHEISLAKAACTFALKEMKRWMKPEKVPTSLTTFPSSAEIISEPLGVVL  124

Query  484  VISAWNYPFMLSLD  525
            VISAWNYPF+LS+D
Sbjct  125  VISAWNYPFLLSID  138



>gb|KCW70625.1| hypothetical protein EUGRSUZ_F03800 [Eucalyptus grandis]
Length=479

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 104/132 (79%), Gaps = 3/132 (2%)
 Frame = +1

Query  139  EERK*LEMDAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSD  309
            E++K    D+ AA   V+ELR  FA+G T+SY+WR SQL+ +L++ + HE+ I+ AL SD
Sbjct  4    EDKKQQPFDSKAASSLVAELRGAFASGTTRSYQWRESQLRGLLRMTDEHEQDIVAALRSD  63

Query  310  LSKPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVI  489
            L KPELES ++E A ++ SCK ALKEL+RWM PE VK++  T+PSSA+IVSEPLGVVL+I
Sbjct  64   LGKPELESVLYEAAMLRNSCKFALKELQRWMMPEKVKTSLTTFPSSAEIVSEPLGVVLII  123

Query  490  SAWNYPFMLSLD  525
            SAWNYP++LSLD
Sbjct  124  SAWNYPYLLSLD  135



>ref|XP_010063405.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Eucalyptus 
grandis]
 gb|KCW70624.1| hypothetical protein EUGRSUZ_F03800 [Eucalyptus grandis]
Length=488

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 104/132 (79%), Gaps = 3/132 (2%)
 Frame = +1

Query  139  EERK*LEMDAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSD  309
            E++K    D+ AA   V+ELR  FA+G T+SY+WR SQL+ +L++ + HE+ I+ AL SD
Sbjct  4    EDKKQQPFDSKAASSLVAELRGAFASGTTRSYQWRESQLRGLLRMTDEHEQDIVAALRSD  63

Query  310  LSKPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVI  489
            L KPELES ++E A ++ SCK ALKEL+RWM PE VK++  T+PSSA+IVSEPLGVVL+I
Sbjct  64   LGKPELESVLYEAAMLRNSCKFALKELQRWMMPEKVKTSLTTFPSSAEIVSEPLGVVLII  123

Query  490  SAWNYPFMLSLD  525
            SAWNYP++LSLD
Sbjct  124  SAWNYPYLLSLD  135



>ref|XP_010530214.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Tarenaya 
hassleriana]
 ref|XP_010530215.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Tarenaya 
hassleriana]
Length=482

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +1

Query  160  MDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFV  339
            +DA   V+ELR +F AG T+ YEWRV+QLK +LKI +HHE  I+ AL  DL KPELES V
Sbjct  8    VDAIELVTELRRSFDAGVTRGYEWRVAQLKNLLKICDHHEPEIVSALRDDLGKPELESSV  67

Query  340  HEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLS  519
            +E+A ++ S KLALK LK WM PE  K++  T+P+SA+IVSEPLGVVLVISAWNYPF+LS
Sbjct  68   YEVALLRNSIKLALKHLKDWMTPEKAKTSLTTFPASAEIVSEPLGVVLVISAWNYPFLLS  127

Query  520  LD  525
            LD
Sbjct  128  LD  129



>ref|NP_974679.1| aldehyde dehydrogenase 3I1 [Arabidopsis thaliana]
 gb|AEE86346.1| aldehyde dehydrogenase 3I1 [Arabidopsis thaliana]
Length=390

 Score =   164 bits (414),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            +AA  V ELR  F +G+TKSYEWR+SQL+ + ++ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  74   EAALLVDELRSNFNSGRTKSYEWRISQLQNIARMIDEKEKCITEALYQDLSKPELEAFLA  133

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            EI+  K+SC LA+KELK WM PE VK++  T+PSSA+IVSEPLGVVLVISAWN+PF+LS+
Sbjct  134  EISNTKSSCMLAIKELKNWMAPETVKTSVTTFPSSAQIVSEPLGVVLVISAWNFPFLLSV  193

Query  523  D  525
            +
Sbjct  194  E  194



>ref|XP_006370386.1| hypothetical protein POPTR_0001s421501g, partial [Populus trichocarpa]
 gb|ERP66955.1| hypothetical protein POPTR_0001s421501g, partial [Populus trichocarpa]
Length=423

 Score =   164 bits (416),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            +AA  V EL E+F  GKTKSYEWRVSQLK + K+    EK I +AL+ DLSKPE E+FV 
Sbjct  76   EAAWLVKELNESFRTGKTKSYEWRVSQLKGIEKMVVEREKDICEALYKDLSKPEYEAFVS  135

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            EIA VK+SC+ ALKELK+WMKPE  K++ ATYPSSA+IVSEPLG VLVIS WNYPF LS+
Sbjct  136  EIAMVKSSCEEALKELKQWMKPEKAKTSMATYPSSAEIVSEPLGAVLVISTWNYPFSLSV  195



>ref|XP_004161166.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
sativus]
Length=484

 Score =   165 bits (418),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 96/124 (77%), Gaps = 3/124 (2%)
 Frame = +1

Query  163  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  333
            DAAAA   V+ELR  F +G T+SYEWRVSQL+++LK+   HE+ I DAL SDLS+  LES
Sbjct  8    DAAAATDLVNELRAIFNSGNTRSYEWRVSQLESLLKLCVDHEEDICDALRSDLSQAALES  67

Query  334  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  513
             +HEI  VK SCKLA+KE+  WMKPE V++   ++PSSA IVSEPLGVVL+IS WNYPF 
Sbjct  68   IIHEIGMVKGSCKLAIKEIGNWMKPEKVQTTMTSFPSSAAIVSEPLGVVLIISPWNYPFF  127

Query  514  LSLD  525
            LSLD
Sbjct  128  LSLD  131



>gb|KCW70623.1| hypothetical protein EUGRSUZ_F03800 [Eucalyptus grandis]
Length=514

 Score =   166 bits (419),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 104/132 (79%), Gaps = 3/132 (2%)
 Frame = +1

Query  139  EERK*LEMDAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSD  309
            E++K    D+ AA   V+ELR  FA+G T+SY+WR SQL+ +L++ + HE+ I+ AL SD
Sbjct  4    EDKKQQPFDSKAASSLVAELRGAFASGTTRSYQWRESQLRGLLRMTDEHEQDIVAALRSD  63

Query  310  LSKPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVI  489
            L KPELES ++E A ++ SCK ALKEL+RWM PE VK++  T+PSSA+IVSEPLGVVL+I
Sbjct  64   LGKPELESVLYEAAMLRNSCKFALKELQRWMMPEKVKTSLTTFPSSAEIVSEPLGVVLII  123

Query  490  SAWNYPFMLSLD  525
            SAWNYP++LSLD
Sbjct  124  SAWNYPYLLSLD  135



>gb|KHN20611.1| Aldehyde dehydrogenase family 3 member H1 [Glycine soja]
Length=614

 Score =   166 bits (421),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 100/124 (81%), Gaps = 3/124 (2%)
 Frame = +1

Query  163  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  333
            DA AA   V+ELR  FA+ KT+SYEWR+SQL A+ K+   HE+ I+DAL +DL KP LE+
Sbjct  139  DAEAASRLVNELRRNFASNKTRSYEWRLSQLNALEKLVVVHEQEIVDALRNDLGKPPLET  198

Query  334  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  513
              +EIA +K SC++ALKELK WM PE VK++ AT+PSSA+IVSEPLGVVLVISAWNYPF+
Sbjct  199  VAYEIAMLKNSCRIALKELKHWMTPEKVKTSIATFPSSAEIVSEPLGVVLVISAWNYPFL  258

Query  514  LSLD  525
            LSLD
Sbjct  259  LSLD  262



>ref|XP_004498347.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Cicer arietinum]
Length=526

 Score =   165 bits (418),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            DA + V+ELR +FA GKT+SY+WR+SQL  + ++ + HE+ I+DAL +D+ KP LE+  +
Sbjct  53   DAESTVNELRASFATGKTRSYKWRLSQLNQLFELTQFHEQEIVDALKNDIDKPPLETVTY  112

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            EIA +K SC+ A+KELK WM PE VK++  T+PSSA+IVSEPLGVVLVISAWNYPF+LSL
Sbjct  113  EIAMLKNSCQAAIKELKHWMAPEKVKTSLTTFPSSAEIVSEPLGVVLVISAWNYPFLLSL  172

Query  523  D  525
            D
Sbjct  173  D  173



>gb|KCW62442.1| hypothetical protein EUGRSUZ_H05081 [Eucalyptus grandis]
Length=386

 Score =   162 bits (411),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            AA  V ELR++F +GKTKSYEWR +QL+++ K+ +  EK I+ AL  DLSKPELE+FV E
Sbjct  71   AALLVQELRKSFNSGKTKSYEWRAAQLQSISKMIDEREKEIIQALQLDLSKPELEAFVSE  130

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I+  ++SC+ ALK+LKRWM PE V ++  TYPSSA+IVSEP GVVL+IS WNYPF+LSLD
Sbjct  131  ISMTQSSCQKALKDLKRWMAPEKVSTSITTYPSSAEIVSEPFGVVLIISTWNYPFLLSLD  190



>ref|XP_004502485.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cicer 
arietinum]
Length=486

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            A++ V ELRE F++GKT+SYEWR+SQ+KA+LK+    +  I+DAL SDL+KP LE+  +E
Sbjct  16   ASSLVKELRENFSSGKTQSYEWRISQVKALLKMVVEQQDQIIDALRSDLAKPPLETVAYE  75

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I  +K SCK+ LKELK+WM PE VK++  T+PSSA+IV EPLGVVLVISAWNYP +LSLD
Sbjct  76   IGMLKNSCKVTLKELKQWMSPEKVKTSITTFPSSAEIVPEPLGVVLVISAWNYPLLLSLD  135



>ref|XP_007161479.1| hypothetical protein PHAVU_001G072600g [Phaseolus vulgaris]
 gb|ESW33473.1| hypothetical protein PHAVU_001G072600g [Phaseolus vulgaris]
Length=493

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 100/124 (81%), Gaps = 3/124 (2%)
 Frame = +1

Query  163  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  333
            DA AA   V+ELR  FA+GK  SYEWRVSQ+KA+ K+   HE+ I+DAL  DL+KP LE+
Sbjct  17   DAPAASRLVTELRGAFASGKPSSYEWRVSQVKALAKLVADHEQEIVDALQKDLAKPPLET  76

Query  334  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  513
              +EIA +K SCK+ALKELK W+ PE VK++ A++PSSA+IVSEPLGVVLVISAWNYPF+
Sbjct  77   VAYEIAMLKNSCKVALKELKHWITPEKVKTSLASFPSSAEIVSEPLGVVLVISAWNYPFL  136

Query  514  LSLD  525
            LSLD
Sbjct  137  LSLD  140



>gb|KHG30796.1| Aldehyde dehydrogenase family 3 member H1 [Gossypium arboreum]
Length=490

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 103/130 (79%), Gaps = 1/130 (1%)
 Frame = +1

Query  139  EERK*LEMDAAA-AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  315
            E++   ++D+A   V ELR +F AGKTK YEWR +QLKA+LK+ + +E  I+ AL  DLS
Sbjct  6    EKKAVFDIDSAKEVVQELRASFVAGKTKDYEWRRTQLKAMLKMMDENEPQIVAALRDDLS  65

Query  316  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  495
            KPELES ++EIA +K SCKLALK++K WM PE  K++ AT+PSSA+IVSEPLGVVLVISA
Sbjct  66   KPELESSIYEIAMLKNSCKLALKKMKHWMMPEKAKTSLATFPSSAEIVSEPLGVVLVISA  125

Query  496  WNYPFMLSLD  525
            WNYP +LSLD
Sbjct  126  WNYPLLLSLD  135



>gb|KEH40517.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=488

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 101/130 (78%), Gaps = 2/130 (2%)
 Frame = +1

Query  142  ERK*LEMDAAAA--VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  315
            ERK +  + A +  V+ELRETF +GKT++Y+W+VSQLK + K+   HE+ I+DAL +D+ 
Sbjct  6    ERKNMFDNEAGSMLVNELRETFGSGKTRNYDWKVSQLKQLFKLLNFHEEEIIDALRNDID  65

Query  316  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  495
            KP LE+  +E+  +K SCK ALKELK WM PE VK++  T+PSSA+IVSEP GVVLVISA
Sbjct  66   KPPLETVAYEVGMLKNSCKTALKELKHWMAPEKVKTSITTFPSSAEIVSEPFGVVLVISA  125

Query  496  WNYPFMLSLD  525
            WNYPF+LSLD
Sbjct  126  WNYPFLLSLD  135



>gb|KCW62441.1| hypothetical protein EUGRSUZ_H05081 [Eucalyptus grandis]
Length=395

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            AA  V ELR++F +GKTKSYEWR +QL+++ K+ +  EK I+ AL  DLSKPELE+FV E
Sbjct  71   AALLVQELRKSFNSGKTKSYEWRAAQLQSISKMIDEREKEIIQALQLDLSKPELEAFVSE  130

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I+  ++SC+ ALK+LKRWM PE V ++  TYPSSA+IVSEP GVVL+IS WNYPF+LSLD
Sbjct  131  ISMTQSSCQKALKDLKRWMAPEKVSTSITTYPSSAEIVSEPFGVVLIISTWNYPFLLSLD  190



>gb|KJB29204.1| hypothetical protein B456_005G089100 [Gossypium raimondii]
Length=415

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +1

Query  178  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  357
            V ELR +FA GKTKSYEWR++QL A++K+ E  E  I+ AL  DLSKPELES ++EIA +
Sbjct  20   VKELRASFATGKTKSYEWRLTQLNAMVKMMEEKEPQIVAALHDDLSKPELESSIYEIAML  79

Query  358  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            K SC+LA+K +K WM PE  K++  T+PSSA+IVSEPLGVVLVISAWNYPF+LSLD
Sbjct  80   KNSCRLAVKNMKHWMMPEKAKTSLVTFPSSAEIVSEPLGVVLVISAWNYPFLLSLD  135



>ref|XP_002869163.1| ALDH3I1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45422.1| ALDH3I1 [Arabidopsis lyrata subsp. lyrata]
Length=548

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            +AA  V ELR  F  G+TKSYEWR+SQL+++ K+ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  72   EAALLVEELRSNFNTGRTKSYEWRISQLQSIAKMIDEKEKCITEALYQDLSKPELEAFLA  131

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            EI+  K+SC LA+KELK WM PE VK++  T+PSSA+IVSEPLGVVLVISAWN+PF+LS+
Sbjct  132  EISNTKSSCMLAIKELKNWMAPETVKTSVTTFPSSAQIVSEPLGVVLVISAWNFPFLLSV  191

Query  523  D  525
            +
Sbjct  192  E  192



>ref|XP_009420563.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
Length=484

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            AA  V+ELRE+F +G+T+S+EWRV+QLK + ++    E  I  AL  DL+KP++ESF+ E
Sbjct  10   AAEVVAELRESFESGRTRSFEWRVAQLKGIARLIVEKEAEITAALDDDLAKPQIESFIGE  69

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I+ V+ SC+ ALKELKRWMKPE V ++  T+PSSAK+VSEPLGVVL+ISAWNYPF+LS+D
Sbjct  70   ISMVRESCRFALKELKRWMKPEKVATSVTTFPSSAKVVSEPLGVVLIISAWNYPFLLSID  129



>ref|XP_003526638.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Glycine 
max]
Length=491

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            A++ V ELR+ F +G+T+SYEWRVSQ+KA+LK    +E+ I+DAL SDL+KP LE+ V+E
Sbjct  19   ASSLVKELRDNFGSGRTRSYEWRVSQVKALLKAVVDNEEQIVDALRSDLAKPPLETIVYE  78

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            +   K SC++ LKELK+WMKPE VK++  T+PSSA+IV EPLGVVLVISAWNYP +LSLD
Sbjct  79   VGMFKNSCEVILKELKQWMKPEKVKTSIRTFPSSAEIVPEPLGVVLVISAWNYPILLSLD  138



>gb|AES72293.2| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=490

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            A++ V ELR +F++GKT+SYEWR+SQ+KA+LK+ +  +  I+DAL SDL+KP LE+ V+E
Sbjct  18   ASSLVKELRVSFSSGKTRSYEWRISQVKALLKMVDEQQDQIIDALRSDLAKPPLETVVYE  77

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I   K SC++ LKELK+WM PE  K++  T+PSSA+IV EPLGVVLVISAWNYPF+LSLD
Sbjct  78   IGMFKNSCEVTLKELKQWMAPEKAKTSVTTFPSSAEIVPEPLGVVLVISAWNYPFLLSLD  137



>ref|XP_006283479.1| hypothetical protein CARUB_v10004527mg [Capsella rubella]
 gb|EOA16377.1| hypothetical protein CARUB_v10004527mg [Capsella rubella]
Length=546

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            +AA  V ELR  F  G+TKSYEWR+SQL+ + ++ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  69   EAALLVDELRTNFNTGRTKSYEWRISQLQNISRMLDDKEKCITEALYQDLSKPELEAFLA  128

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            EI+  K+SC LA+KELK+WM PE VK++  T+PSSA+IVSEPLGVVLVISAWN+PF+LS+
Sbjct  129  EISNTKSSCTLAIKELKKWMAPETVKTSVTTFPSSAQIVSEPLGVVLVISAWNFPFLLSV  188

Query  523  D  525
            +
Sbjct  189  E  189



>gb|EYU22982.1| hypothetical protein MIMGU_mgv1a005625mg [Erythranthe guttata]
Length=476

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +1

Query  184  ELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFVKA  363
            ELR  +  GKT+  EWRVSQLKA+LKI   HE  I++AL SDL+KPE E+FVHEIA   +
Sbjct  11   ELRAAYGGGKTRDLEWRVSQLKALLKIINLHENEIVEALRSDLNKPEYEAFVHEIAGASS  70

Query  364  SCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            +CKLALKEL+RW  PE VK+   TYPSSA IVSEPLGVVLVIS WNYPF+LS++
Sbjct  71   ACKLALKELRRWTMPEKVKTTMTTYPSSAHIVSEPLGVVLVISTWNYPFILSIE  124



>gb|EEC67815.1| hypothetical protein OsI_35392 [Oryza sativa Indica Group]
Length=140

 Score =   154 bits (389),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = +1

Query  157  EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  336
            E + AA V ELR +F +G+T++ EWR +QL+ ++++ E  E  I DAL SDL+KP +ES+
Sbjct  3    EEEVAAVVGELRGSFRSGRTRAAEWRAAQLRGIVRMVEEREGDISDALHSDLAKPRMESY  62

Query  337  VHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPF  510
            +HEI+  KA+C  ALK LK WMKPE V +A  T+PS+A+IVSEPLGVVLVISAWNYPF
Sbjct  63   LHEISLAKAACTFALKGLKNWMKPEKVPAALTTFPSTAQIVSEPLGVVLVISAWNYPF  120



>ref|XP_004502484.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X3 [Cicer arietinum]
Length=422

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            A++ V ELR +F++GKT+SYEWR+SQ+KA+LK+    +  I+ AL SDL+KP LE+ V+E
Sbjct  16   ASSLVKELRGSFSSGKTQSYEWRISQVKALLKMVVEQQDQIIHALRSDLAKPPLETVVYE  75

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I   K SC++ LKELK+WM PE VKS+  T+PSSA+IV EPLGVVLVISAWNYPF+LSLD
Sbjct  76   IGMFKNSCEVTLKELKQWMAPEKVKSSITTFPSSAEIVPEPLGVVLVISAWNYPFLLSLD  135



>emb|CAC84903.1| aldehyde dehydrogenase [Arabidopsis thaliana]
Length=550

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            +AA  V ELR  F +G+TKSYEWR+SQL+ + ++ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  74   EAALLVDELRSNFNSGRTKSYEWRISQLQNIARMIDEKEKCITEALYQDLSKPELEAFLA  133

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            EI+  K+SC LA+KELK WM PE VK++  T+PSSA+IVSEPLGVVLVISAWN+PF+LS+
Sbjct  134  EISNTKSSCMLAIKELKNWMAPETVKTSVTTFPSSAQIVSEPLGVVLVISAWNFPFLLSV  193

Query  523  D  525
            +
Sbjct  194  E  194



>gb|KHN47009.1| Aldehyde dehydrogenase family 3 member H1 [Glycine soja]
Length=491

 Score =   162 bits (411),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            A++ V ELR+ F +G+T+SYEWRVSQLKA+LK    +E+ I+DAL SDL+KP LE+ V+E
Sbjct  19   ASSLVKELRDNFGSGRTRSYEWRVSQLKALLKAVVDNEEQIVDALRSDLAKPPLETVVYE  78

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I   K SC++ LKELK WM PE VK++  T+PSSA+IV EPLGVVLVISAWNYP +LSLD
Sbjct  79   IGMFKNSCEVILKELKHWMTPEKVKTSIRTFPSSAEIVPEPLGVVLVISAWNYPILLSLD  138



>ref|XP_009383529.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
Length=493

 Score =   163 bits (412),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            AA  V+ LR  FA+G+T+SYEWR +QLK ++++ +  E  IM AL  DL+KP +ES++HE
Sbjct  19   AAVLVAGLRRGFASGRTRSYEWRAAQLKGIVRMIDDKEAEIMAALHDDLAKPHMESYLHE  78

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I+  KA+C  ALKE+KRWMKPE V ++  T+PSSA+IVSEP+GVVLVISAWNYPF+LS+D
Sbjct  79   ISLAKAACTFALKEMKRWMKPEKVPTSITTFPSSAEIVSEPVGVVLVISAWNYPFLLSID  138



>ref|NP_567962.1| aldehyde dehydrogenase 3I1 [Arabidopsis thaliana]
 sp|Q8W033.2|AL3I1_ARATH RecName: Full=Aldehyde dehydrogenase family 3 member I1, chloroplastic; 
Short=AtALDH3; Short=Ath-ALDH3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK96824.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AAM10094.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AEE86347.1| aldehyde dehydrogenase 3I1 [Arabidopsis thaliana]
Length=550

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            +AA  V ELR  F +G+TKSYEWR+SQL+ + ++ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  74   EAALLVDELRSNFNSGRTKSYEWRISQLQNIARMIDEKEKCITEALYQDLSKPELEAFLA  133

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            EI+  K+SC LA+KELK WM PE VK++  T+PSSA+IVSEPLGVVLVISAWN+PF+LS+
Sbjct  134  EISNTKSSCMLAIKELKNWMAPETVKTSVTTFPSSAQIVSEPLGVVLVISAWNFPFLLSV  193

Query  523  D  525
            +
Sbjct  194  E  194



>ref|NP_001065921.1| Os11g0186200 [Oryza sativa Japonica Group]
 gb|AAY23278.1| aldehyde dehydrogenase, putative [Oryza sativa Japonica Group]
 gb|ABA91775.2| aldehyde dehydrogenase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27766.1| Os11g0186200 [Oryza sativa Japonica Group]
 dbj|BAG96824.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96923.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67818.1| hypothetical protein OsI_35395 [Oryza sativa Indica Group]
 gb|EEE51777.1| hypothetical protein OsJ_33226 [Oryza sativa Japonica Group]
Length=482

 Score =   162 bits (411),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = +1

Query  157  EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  336
            E + AA V ELR +F +G+T++ EWR +QL+ ++++ E  E  I DAL SDL+KP +ES+
Sbjct  3    EEEVAAVVGELRGSFRSGRTRAAEWRAAQLRGIVRMVEEREGDISDALHSDLAKPRMESY  62

Query  337  VHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFML  516
            +HEI+  KA+C  ALK LK WMKPE V +A  T+PS+A+IVSEPLGVVLVISAWNYPF+L
Sbjct  63   LHEISLAKAACTFALKGLKNWMKPEKVPAALTTFPSTAQIVSEPLGVVLVISAWNYPFLL  122

Query  517  SLD  525
            S+D
Sbjct  123  SID  125



>ref|XP_008444183.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X2 [Cucumis melo]
Length=484

 Score =   162 bits (410),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 98/129 (76%), Gaps = 1/129 (1%)
 Frame = +1

Query  142  ERK*LEMDAA-AAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSK  318
            ER   + +AA   V+ELRE++ +GKT+SYEWR +QLK +LK+   +E  ++  + SDL K
Sbjct  3    ERTVFDGEAAERVVTELRESYNSGKTRSYEWRENQLKNMLKLVCENEDVMVQTVNSDLHK  62

Query  319  PELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAW  498
            PE E+F HEIA +K SCKLALKEL+RWM PE VKS+   +PSSA IV EP GVVL+ISAW
Sbjct  63   PEFEAFAHEIALLKGSCKLALKELRRWMAPEKVKSSITVFPSSAAIVPEPFGVVLIISAW  122

Query  499  NYPFMLSLD  525
            NYPF+LSLD
Sbjct  123  NYPFLLSLD  131



>gb|KFK30059.1| hypothetical protein AALP_AA7G211500 [Arabis alpina]
Length=560

 Score =   163 bits (412),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            +AA+ V +LR  F  G+TKSYEWR+SQL+ ++++ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  84   EAASLVGDLRSNFNTGRTKSYEWRISQLQNIVRMIDEKEKYITEALYQDLSKPELEAFLA  143

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            EI+  K+SC LA+K+LK WM PE VK++  T+PSSA+IVSEPLGVVLVISAWN+PF+LS+
Sbjct  144  EISNTKSSCTLAIKDLKTWMAPETVKTSVTTFPSSAQIVSEPLGVVLVISAWNFPFLLSV  203

Query  523  D  525
            +
Sbjct  204  E  204



>ref|XP_011002476.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Populus 
euphratica]
Length=756

 Score =   164 bits (415),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            +AA  V EL E F AGKTKSYEWRVSQLK + K+    EK I +AL+ DLSKPE E+FV 
Sbjct  76   EAAFLVKELNENFRAGKTKSYEWRVSQLKGIEKMVVEREKDICEALYKDLSKPEYEAFVS  135

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            EI+ V++SC+ ALKELK+WMKPE  K++ ATYPSSA+IVSEPLG VLVIS WNYPF LS+
Sbjct  136  EISMVRSSCEEALKELKQWMKPEKAKTSMATYPSSAEIVSEPLGAVLVISTWNYPFSLSV  195


 Score = 94.0 bits (232),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  334  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  513
             V +I+ V++SC+ ALKELK+WMKPE  K++ ATYPSSA+IVSEPLG VLVIS WNYPF 
Sbjct  338  LVIQISMVRSSCEEALKELKQWMKPEKAKTSMATYPSSAEIVSEPLGAVLVISTWNYPFS  397

Query  514  LSL  522
            LS+
Sbjct  398  LSV  400



>gb|KJB29202.1| hypothetical protein B456_005G089100 [Gossypium raimondii]
Length=490

 Score =   162 bits (409),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +1

Query  178  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  357
            V ELR +FA GKTKSYEWR++QL A++K+ E  E  I+ AL  DLSKPELES ++EIA +
Sbjct  20   VKELRASFATGKTKSYEWRLTQLNAMVKMMEEKEPQIVAALHDDLSKPELESSIYEIAML  79

Query  358  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            K SC+LA+K +K WM PE  K++  T+PSSA+IVSEPLGVVLVISAWNYPF+LSLD
Sbjct  80   KNSCRLAVKNMKHWMMPEKAKTSLVTFPSSAEIVSEPLGVVLVISAWNYPFLLSLD  135



>ref|XP_004502482.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Cicer arietinum]
Length=488

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            A++ V ELR +F++GKT+SYEWR+SQ+KA+LK+    +  I+ AL SDL+KP LE+ V+E
Sbjct  16   ASSLVKELRGSFSSGKTQSYEWRISQVKALLKMVVEQQDQIIHALRSDLAKPPLETVVYE  75

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I   K SC++ LKELK+WM PE VKS+  T+PSSA+IV EPLGVVLVISAWNYPF+LSLD
Sbjct  76   IGMFKNSCEVTLKELKQWMAPEKVKSSITTFPSSAEIVPEPLGVVLVISAWNYPFLLSLD  135



>ref|XP_010025726.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW62439.1| hypothetical protein EUGRSUZ_H05081 [Eucalyptus grandis]
Length=550

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            AA  V ELR++F +GKTKSYEWR +QL+++ K+ +  EK I+ AL  DLSKPELE+FV E
Sbjct  76   AALLVQELRKSFNSGKTKSYEWRAAQLQSISKMIDEREKEIIQALQLDLSKPELEAFVSE  135

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I+  ++SC+ ALK+LKRWM PE V ++  TYPSSA+IVSEP GVVL+IS WNYPF+LSLD
Sbjct  136  ISMTQSSCQKALKDLKRWMAPEKVSTSITTYPSSAEIVSEPFGVVLIISTWNYPFLLSLD  195



>ref|XP_010447116.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
[Camelina sativa]
Length=549

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            +AA  V ELR  F  G+TKSYEWR+SQL+ + ++ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  72   EAALLVDELRNNFNTGRTKSYEWRISQLQNISRMLDEKEKCITEALYQDLSKPELEAFLA  131

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            EI+  K SC LA+KELK WM PE V+++  T+PSSA+IVSEPLGVVLVISAWN+PF+LS+
Sbjct  132  EISNTKTSCTLAIKELKNWMTPETVETSVTTFPSSAQIVSEPLGVVLVISAWNFPFLLSV  191

Query  523  D  525
            +
Sbjct  192  E  192



>ref|XP_010025727.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW62440.1| hypothetical protein EUGRSUZ_H05081 [Eucalyptus grandis]
Length=545

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            AA  V ELR++F +GKTKSYEWR +QL+++ K+ +  EK I+ AL  DLSKPELE+FV E
Sbjct  71   AALLVQELRKSFNSGKTKSYEWRAAQLQSISKMIDEREKEIIQALQLDLSKPELEAFVSE  130

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I+  ++SC+ ALK+LKRWM PE V ++  TYPSSA+IVSEP GVVL+IS WNYPF+LSLD
Sbjct  131  ISMTQSSCQKALKDLKRWMAPEKVSTSITTYPSSAEIVSEPFGVVLIISTWNYPFLLSLD  190



>ref|XP_004142628.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
sativus]
 ref|XP_004161167.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
sativus]
Length=484

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            A   V+ELRE++ +GKT+SYEWR +QLK +LK+   +E+ ++  + SDL KPE E+F HE
Sbjct  12   AERVVTELRESYNSGKTRSYEWRENQLKNLLKLVCENEEVMVQTVNSDLHKPEFEAFAHE  71

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            IA +K SCKLA+KEL+RWM PE VKS+   +PSSA IV EP GVVL+ISAWNYPF+LSLD
Sbjct  72   IALLKGSCKLAIKELRRWMAPEKVKSSITVFPSSAAIVPEPFGVVLIISAWNYPFLLSLD  131



>emb|CDX75414.1| BnaA01g02880D [Brassica napus]
Length=556

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            +AA  V ELR  F  G+T+SYEWR+SQL+ + K+ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  80   EAALLVDELRTNFNTGRTRSYEWRISQLQNIAKMIDEKEKCITEALYQDLSKPELEAFLA  139

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            E++  K+SC LA+KELK WM PE VK++  T+PSSA+IVSEPLGVVLVISAWN+PF+LS+
Sbjct  140  ELSNTKSSCMLAIKELKNWMAPETVKTSVTTFPSSAQIVSEPLGVVLVISAWNFPFLLSV  199

Query  523  D  525
            +
Sbjct  200  E  200



>ref|XP_009115014.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X1 [Brassica rapa]
Length=556

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            +AA  V ELR  F  G+T+SYEWR+SQL+ + K+ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  80   EAALLVDELRTNFNTGRTRSYEWRISQLQNIAKMIDEKEKCITEALYQDLSKPELEAFLA  139

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            E++  K+SC LA+KELK WM PE VK++  T+PSSA+IVSEPLGVVLVISAWN+PF+LS+
Sbjct  140  ELSNTKSSCMLAIKELKNWMAPETVKTSVTTFPSSAQIVSEPLGVVLVISAWNFPFLLSV  199

Query  523  D  525
            +
Sbjct  200  E  200



>ref|XP_009115077.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X2 [Brassica rapa]
Length=554

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            +AA  V ELR  F  G+T+SYEWR+SQL+ + K+ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  78   EAALLVDELRTNFNTGRTRSYEWRISQLQNIAKMIDEKEKCITEALYQDLSKPELEAFLA  137

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            E++  K+SC LA+KELK WM PE VK++  T+PSSA+IVSEPLGVVLVISAWN+PF+LS+
Sbjct  138  ELSNTKSSCMLAIKELKNWMAPETVKTSVTTFPSSAQIVSEPLGVVLVISAWNFPFLLSV  197

Query  523  D  525
            +
Sbjct  198  E  198



>ref|NP_001288985.1| aldehyde dehydrogenase family 3 member I1, chloroplastic [Brassica 
rapa]
 gb|ABC41273.1| putative aldehyde dehydrogenase [Brassica rapa]
Length=555

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            +AA  V ELR  F  G+T+SYEWR+SQL+ + K+ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  80   EAALLVDELRTNFNTGRTRSYEWRISQLQNIAKMIDEKEKCITEALYQDLSKPELEAFLA  139

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            E++  K+SC LA+KELK WM PE VK++  T+PSSA+IVSEPLGVVLVISAWN+PF+LS+
Sbjct  140  ELSNTKSSCMLAIKELKNWMAPETVKTSVTTFPSSAQIVSEPLGVVLVISAWNFPFLLSV  199

Query  523  D  525
            +
Sbjct  200  E  200



>gb|AID60136.1| aldehyde dehydrogenase 3 [Brassica napus]
Length=554

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            +AA  V ELR  F  G+T+SYEWR+SQL+ + K+ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  78   EAALLVDELRTNFNTGRTRSYEWRISQLQNIAKMIDEKEKCITEALYQDLSKPELEAFLA  137

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            E++  K+SC LA+KELK WM PE VK++  T+PSSA+IVSEPLGVVLVISAWN+PF+LS+
Sbjct  138  ELSNTKSSCMLAIKELKNWMAPETVKTSVTTFPSSAQIVSEPLGVVLVISAWNFPFLLSV  197

Query  523  D  525
            +
Sbjct  198  E  198



>gb|KDO80593.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=300

 Score =   157 bits (396),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 94/124 (76%), Gaps = 3/124 (2%)
 Frame = +1

Query  163  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  333
            DA AA   V ELR TFA+GKTKSY WRVSQLK+++K+    E  I+DAL  DL KPELES
Sbjct  15   DAEAASLFVKELRGTFASGKTKSYGWRVSQLKSLMKMLNEREPDIVDALRQDLDKPELES  74

Query  334  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  513
             ++E+A +K S K ALKELK WM PE  K++  T+PSSA+IV EP GVVL+IS WNYPF+
Sbjct  75   SIYEVALLKTSIKSALKELKHWMTPEKAKTSITTFPSSAEIVPEPFGVVLIISPWNYPFL  134

Query  514  LSLD  525
            LSLD
Sbjct  135  LSLD  138



>ref|XP_008227606.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
[Prunus mume]
Length=368

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 99/130 (76%), Gaps = 1/130 (1%)
 Frame = +1

Query  139  EERK*LEMDAAAA-VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  315
            EE++    D A   V ELR +F +G+TKSYEWR+SQL+ + K+ E  EK I +AL+ DLS
Sbjct  66   EEKQTFNPDKAGELVKELRNSFNSGRTKSYEWRMSQLENIAKMLEEKEKEITEALYKDLS  125

Query  316  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  495
            KPE+E+F+ EI   K+SC  ALKEL++WM P+ V ++  T+PSSA+IVSEPLGVVLVIS 
Sbjct  126  KPEVEAFISEIVTAKSSCNEALKELRQWMIPQKVNTSITTFPSSAEIVSEPLGVVLVIST  185

Query  496  WNYPFMLSLD  525
            WN+PF+LSLD
Sbjct  186  WNFPFLLSLD  195



>gb|EPS67391.1| aldehyde dehydrogenase, partial [Genlisea aurea]
Length=432

 Score =   160 bits (404),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +1

Query  178  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  357
            V ELR  + +G+T+S EWR SQLKA+LKIA HHE+ I++AL SDL+KP+ E+++ EIA V
Sbjct  1    VEELRSAYHSGRTRSLEWRASQLKALLKIATHHEEEILEALMSDLNKPKHEAYLFEIASV  60

Query  358  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
             ++CKLA+KEL  WM PE VK+  AT+PSSA+IVSEPLGVVLVIS WNYPF+LS++
Sbjct  61   SSACKLAMKELPGWMMPEKVKTTMATFPSSAEIVSEPLGVVLVISTWNYPFLLSME  116



>emb|CDY36336.1| BnaC08g05150D [Brassica napus]
Length=482

 Score =   160 bits (404),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            DA+  ++ELR +F AG T+ YEWRVSQLK +L I ++HE  I+ AL  DL KPELES V+
Sbjct  9    DASNLMTELRMSFDAGVTRGYEWRVSQLKKLLVICDNHEPEIVSALHDDLGKPELESSVY  68

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            E+A ++ S KLALK+LK WM P+  K++  T+P+SA+IVSEPLGVVLVISAWNYPF+LS+
Sbjct  69   EVALLRNSIKLALKQLKNWMAPDKAKTSLTTFPASAEIVSEPLGVVLVISAWNYPFLLSI  128

Query  523  D  525
            D
Sbjct  129  D  129



>ref|XP_010539000.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Tarenaya 
hassleriana]
Length=482

 Score =   160 bits (404),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            DA   V+ LR  F AG T+ YEWRVSQLK +LK+ +HHE  I+ AL  DL KPELES ++
Sbjct  9    DATELVTGLRRGFDAGVTRGYEWRVSQLKNLLKVCDHHEPEIVAALRDDLGKPELESSIY  68

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            E+A ++ S KLALK LK WM PE  K++  T+P+SA+IVSEPLGV+LVISAWN+PF+LSL
Sbjct  69   EVALLRNSIKLALKHLKDWMTPEKAKTSLTTFPASAEIVSEPLGVILVISAWNFPFLLSL  128

Query  523  D  525
            D
Sbjct  129  D  129



>gb|KDO80592.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=372

 Score =   157 bits (398),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 94/124 (76%), Gaps = 3/124 (2%)
 Frame = +1

Query  163  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  333
            DA AA   V ELR TFA+GKTKSY WRVSQLK+++K+    E  I+DAL  DL KPELES
Sbjct  15   DAEAASLFVKELRGTFASGKTKSYGWRVSQLKSLMKMLNEREPDIVDALRQDLDKPELES  74

Query  334  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  513
             ++E+A +K S K ALKELK WM PE  K++  T+PSSA+IV EP GVVL+IS WNYPF+
Sbjct  75   SIYEVALLKTSIKSALKELKHWMTPEKAKTSITTFPSSAEIVPEPFGVVLIISPWNYPFL  134

Query  514  LSLD  525
            LSLD
Sbjct  135  LSLD  138



>ref|XP_006434228.1| hypothetical protein CICLE_v10000949mg [Citrus clementina]
 gb|ESR47468.1| hypothetical protein CICLE_v10000949mg [Citrus clementina]
Length=372

 Score =   157 bits (398),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 94/124 (76%), Gaps = 3/124 (2%)
 Frame = +1

Query  163  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  333
            DA AA   V ELR TFA+GKTKSY WRVSQLK+++K+    E  I+DAL  DL KPELES
Sbjct  15   DAEAASLFVKELRGTFASGKTKSYGWRVSQLKSLMKMLNEREPDIVDALRQDLDKPELES  74

Query  334  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  513
             ++E+A +K S K ALKELK WM PE  K++  T+PSSA+IV EP GVVL+IS WNYPF+
Sbjct  75   SIYEVALLKTSIKSALKELKHWMTPEKAKTSITTFPSSAEIVPEPFGVVLIISPWNYPFL  134

Query  514  LSLD  525
            LSLD
Sbjct  135  LSLD  138



>ref|XP_006662789.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Oryza brachyantha]
Length=482

 Score =   159 bits (403),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            + AA   ELR +F AG+T+  EWR +QL+A++++ E  E  I DAL SDL+KP +ES++H
Sbjct  4    EVAAVAGELRASFRAGRTRPAEWRAAQLRAIVRMVEEREGDISDALHSDLAKPRMESYLH  63

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            EI+  KA+CK ALK LK WMKPE V +   T+PS+A+IVSEPLGVVLVISAWNYPF+LS+
Sbjct  64   EISLAKAACKFALKGLKNWMKPEKVPAGLTTFPSTAQIVSEPLGVVLVISAWNYPFLLSI  123

Query  523  D  525
            +
Sbjct  124  E  124



>ref|XP_010432443.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
[Camelina sativa]
Length=547

 Score =   160 bits (405),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            +AA  V ELR  F  G+TKSYEWR+SQL+ + ++ +  EK I +AL+ DLSKPELE+F+ 
Sbjct  70   EAALLVDELRNNFNTGRTKSYEWRISQLQNISRMLDEKEKCITEALYQDLSKPELEAFLA  129

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            EI+  K+SC LA+KELK WM P+ V+++  T+PSSA+IVSEPLGVVLVISAWN+PF+LS+
Sbjct  130  EISNTKSSCTLAIKELKNWMAPDTVETSVTTFPSSAQIVSEPLGVVLVISAWNFPFLLSV  189

Query  523  D  525
            +
Sbjct  190  E  190



>gb|KHG28299.1| Aldehyde dehydrogenase family 3 member H1 [Gossypium arboreum]
Length=493

 Score =   159 bits (403),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            A   V ELR++F  GKTKSY WRV+QLKA+LK+ + +E  I+ AL  DLSKPE ES ++E
Sbjct  18   ANEVVKELRDSFVTGKTKSYRWRVTQLKAMLKMLDENEPQIVAALRDDLSKPEFESSLYE  77

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I  V  SC+LALKE+  WM PE  K++  T+PSSA+IVSEPLGVVLVISAWNYPF++SLD
Sbjct  78   IQMVNNSCRLALKEMNHWMMPEKAKTSLTTFPSSAEIVSEPLGVVLVISAWNYPFLVSLD  137



>ref|XP_008227591.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X2 [Prunus mume]
Length=479

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 99/130 (76%), Gaps = 1/130 (1%)
 Frame = +1

Query  139  EERK*LEMDAAAA-VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  315
            EE++    D A   V ELR +F +G+TKSYEWR+SQL+ + K+ E  EK I +AL+ DLS
Sbjct  66   EEKQTFNPDKAGELVKELRNSFNSGRTKSYEWRMSQLENIAKMLEEKEKEITEALYKDLS  125

Query  316  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  495
            KPE+E+F+ EI   K+SC  ALKEL++WM P+ V ++  T+PSSA+IVSEPLGVVLVIS 
Sbjct  126  KPEVEAFISEIVTAKSSCNEALKELRQWMIPQKVNTSITTFPSSAEIVSEPLGVVLVIST  185

Query  496  WNYPFMLSLD  525
            WN+PF+LSLD
Sbjct  186  WNFPFLLSLD  195



>gb|ACU23701.1| unknown [Glycine max]
Length=329

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 92/120 (77%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            A++ V ELR+ F  G T+SYEWRVSQ+KA+LK    +E  I+ AL SDL+KP LE+ V+E
Sbjct  16   ASSLVKELRDNFGKGTTRSYEWRVSQVKALLKAVVENEDQIVGALCSDLAKPPLETVVYE  75

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I   + SC++ LKELK WM PE VK++  T+PSSA+IV EPLGVVLVISAWNYP +LSLD
Sbjct  76   IGMFQNSCEVILKELKHWMTPEKVKTSIRTFPSSAEIVPEPLGVVLVISAWNYPILLSLD  135



>ref|XP_006393739.1| hypothetical protein EUTSA_v10011438mg [Eutrema salsugineum]
 gb|ESQ31025.1| hypothetical protein EUTSA_v10011438mg [Eutrema salsugineum]
Length=483

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 95/121 (79%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            DA+  V+ELR +F AG T  YEWRV+QLK +L I ++HE  I+ AL  DL KPELES V+
Sbjct  10   DASNLVTELRRSFDAGVTCGYEWRVTQLKKLLVICDNHEPEIVSALHDDLGKPELESSVY  69

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            E+A ++ S KLALK+LK WM P+  K++  T+P+SA+IVSEPLGVVLVISAWNYPF+LS+
Sbjct  70   EVALLRNSIKLALKQLKNWMAPDKAKTSLTTFPASAEIVSEPLGVVLVISAWNYPFLLSI  129

Query  523  D  525
            D
Sbjct  130  D  130



>ref|XP_004503900.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=534

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 91/120 (76%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            AA  V ELR  F  GKTKSYEWR+SQLKA+ K+ E  EK I+DAL  D+SKP LE+F+ E
Sbjct  61   AALLVRELRNNFDTGKTKSYEWRISQLKAIAKMLEEKEKEIVDALNKDISKPPLEAFITE  120

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I   K+SC  AL+ELK WMKPE V ++   YPSSA+IVSEPLGVVLVIS WN+P +LSLD
Sbjct  121  IFQAKSSCNEALQELKHWMKPEKVSTSITAYPSSAEIVSEPLGVVLVISTWNFPMLLSLD  180



>gb|KJB59280.1| hypothetical protein B456_009G247000 [Gossypium raimondii]
Length=493

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            A   V ELR++F  GKTKS+ WRV+QLKA+LK+ + +E  I+ AL  DLSKPE ES ++E
Sbjct  18   AKEVVKELRDSFVTGKTKSHRWRVTQLKAMLKMLDENEPQIVAALRDDLSKPEFESSLYE  77

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I  +K SC+LALKE+  WM PE  K++  T+PSSA+IVSEPLGVVLVISAWNYPF+LSLD
Sbjct  78   IQILKNSCRLALKEMNHWMMPEKAKTSLTTFPSSAEIVSEPLGVVLVISAWNYPFLLSLD  137



>emb|CDX69039.1| BnaC01g04140D [Brassica napus]
Length=549

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            +AA  V ELR  F  G+T+SYEWR+SQL+ + K+ +  EK I +AL  DLSKPELE+F+ 
Sbjct  73   EAALLVDELRTNFNTGRTRSYEWRISQLQNIAKMIDEKEKCITEALHQDLSKPELEAFLA  132

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            E++  K+SC LA+KELK WM PE VK++  T+PSSA+IVSEPLGVVL+ISAWN+PF+LS+
Sbjct  133  ELSNTKSSCMLAIKELKNWMAPETVKTSVTTFPSSAQIVSEPLGVVLIISAWNFPFLLSV  192

Query  523  D  525
            +
Sbjct  193  E  193



>gb|KDO80591.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=434

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 94/124 (76%), Gaps = 3/124 (2%)
 Frame = +1

Query  163  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  333
            DA AA   V ELR TFA+GKTKSY WRVSQLK+++K+    E  I+DAL  DL KPELES
Sbjct  15   DAEAASLFVKELRGTFASGKTKSYGWRVSQLKSLMKMLNEREPDIVDALRQDLDKPELES  74

Query  334  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  513
             ++E+A +K S K ALKELK WM PE  K++  T+PSSA+IV EP GVVL+IS WNYPF+
Sbjct  75   SIYEVALLKTSIKSALKELKHWMTPEKAKTSITTFPSSAEIVPEPFGVVLIISPWNYPFL  134

Query  514  LSLD  525
            LSLD
Sbjct  135  LSLD  138



>emb|CDY36018.1| BnaA08g04430D [Brassica napus]
Length=482

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            DA+  ++ELR +F AG T+SYEWRVSQLK +  I ++HE  I+ AL  DL KPELES V+
Sbjct  9    DASNLMTELRMSFDAGVTRSYEWRVSQLKKLQVICDNHEPEIVSALHDDLGKPELESSVY  68

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            E+A ++ S KLALK+LK WM P+  K++  T+P+SA+IVSEPLGVVLVISAWNYPF+LS+
Sbjct  69   EVALLRNSIKLALKQLKNWMAPDKAKTSLTTFPASAEIVSEPLGVVLVISAWNYPFLLSI  128

Query  523  D  525
            D
Sbjct  129  D  129



>ref|XP_004503899.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=542

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 91/120 (76%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            AA  V ELR  F  GKTKSYEWR+SQLKA+ K+ E  EK I+DAL  D+SKP LE+F+ E
Sbjct  69   AALLVRELRNNFDTGKTKSYEWRISQLKAIAKMLEEKEKEIVDALNKDISKPPLEAFITE  128

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I   K+SC  AL+ELK WMKPE V ++   YPSSA+IVSEPLGVVLVIS WN+P +LSLD
Sbjct  129  IFQAKSSCNEALQELKHWMKPEKVSTSITAYPSSAEIVSEPLGVVLVISTWNFPMLLSLD  188



>ref|XP_006412252.1| hypothetical protein EUTSA_v10024844mg [Eutrema salsugineum]
 dbj|BAJ33838.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53705.1| hypothetical protein EUTSA_v10024844mg [Eutrema salsugineum]
Length=547

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            +AA  V ELR  F  G+TKSYEWR+SQL+ + ++ +  E++I +AL  DLSKPELE+F+ 
Sbjct  71   EAALLVEELRINFNTGRTKSYEWRISQLQNISRMIDEKERSIAEALHQDLSKPELEAFLA  130

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            EI+  K+SC LA+KELK WM PE VK++  T+PSSA+IVSEPLGVVLVISAWN+PF+LS+
Sbjct  131  EISNTKSSCMLAIKELKNWMAPETVKTSVTTFPSSAQIVSEPLGVVLVISAWNFPFLLSV  190

Query  523  D  525
            +
Sbjct  191  E  191



>ref|XP_010461437.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Camelina 
sativa]
Length=485

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            +A+  V+ELR +F  G T+ Y+WR++QLK +L I ++HE  I++AL  DL KPELES V 
Sbjct  12   EASDLVNELRRSFDDGVTRGYDWRITQLKKLLVICDNHEHEIVEALRDDLGKPELESSVF  71

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            E+A ++ SCKLALK+LK WM P+  K++  T+P+SA+IVSEPLGVVLVISAWNYPF+LS+
Sbjct  72   EVALLRNSCKLALKQLKNWMAPDKAKTSLTTFPASAEIVSEPLGVVLVISAWNYPFLLSI  131

Query  523  D  525
            D
Sbjct  132  D  132



>ref|XP_010437650.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
[Camelina sativa]
Length=549

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            +AA  V ELR  F  G+TKSY+WR+SQL+ + ++ +  EK I +AL  DLSKPELE+F+ 
Sbjct  72   EAALLVDELRNNFNTGRTKSYQWRISQLQNISRMLDEKEKCITEALNQDLSKPELEAFLA  131

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            EI+  K+SC LA+KELK WM PE V+++  T+PSSA+IVSEPLGVVLVISAWN+PF+LS+
Sbjct  132  EISNTKSSCTLAIKELKNWMAPETVETSVTTFPSSAQIVSEPLGVVLVISAWNFPFLLSV  191

Query  523  D  525
            +
Sbjct  192  E  192



>ref|XP_008227590.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Prunus mume]
Length=549

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 99/130 (76%), Gaps = 1/130 (1%)
 Frame = +1

Query  139  EERK*LEMDAAAA-VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLS  315
            EE++    D A   V ELR +F +G+TKSYEWR+SQL+ + K+ E  EK I +AL+ DLS
Sbjct  66   EEKQTFNPDKAGELVKELRNSFNSGRTKSYEWRMSQLENIAKMLEEKEKEITEALYKDLS  125

Query  316  KPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISA  495
            KPE+E+F+ EI   K+SC  ALKEL++WM P+ V ++  T+PSSA+IVSEPLGVVLVIS 
Sbjct  126  KPEVEAFISEIVTAKSSCNEALKELRQWMIPQKVNTSITTFPSSAEIVSEPLGVVLVIST  185

Query  496  WNYPFMLSLD  525
            WN+PF+LSLD
Sbjct  186  WNFPFLLSLD  195



>ref|XP_010500136.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Camelina 
sativa]
Length=486

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            +A+  V+ELR +F  G T+ Y+WR++QLK +L I ++HE  I++AL  DL KPELES V 
Sbjct  13   EASDLVNELRRSFDDGVTRGYDWRITQLKKLLVICDNHEHDIVEALRDDLGKPELESSVF  72

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            E+A ++ SCKLALK+LK WM P+  K++  T+P+SA+IVSEPLGVVLVISAWNYPF+LS+
Sbjct  73   EVALLRNSCKLALKQLKNWMAPDKAKTSLTTFPASAEIVSEPLGVVLVISAWNYPFLLSI  132

Query  523  D  525
            D
Sbjct  133  D  133



>gb|ACJ85715.1| unknown [Medicago truncatula]
Length=313

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = +1

Query  178  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  357
            V ELR+ F  GKTKSYEWR+SQL+A++K+ E  EK I+DAL +DLSKP LE+++ EI   
Sbjct  73   VRELRKNFDTGKTKSYEWRISQLEAIVKMLEEKEKEIIDALHTDLSKPRLEAYITEIVQA  132

Query  358  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            K+SC  AL+ELK WMKPE V ++   +PSSA+I SEPLGVVL+IS WN+P +LSLD
Sbjct  133  KSSCDEALQELKHWMKPEKVSTSITAFPSSAEIASEPLGVVLIISTWNFPMLLSLD  188



>ref|XP_010479042.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Camelina 
sativa]
Length=485

 Score =   157 bits (398),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            +A+  V+ELR +F  G T+ Y+WR++QLK +L I ++HE  I++AL  DL KPELES V 
Sbjct  12   EASDLVNELRRSFDDGVTRGYDWRITQLKKLLVICDNHEHDIVEALRHDLGKPELESSVF  71

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            E+A ++ SCKLALK+LK WM P+  K++  T+P+SA+IVSEPLGVVLVISAWNYPF+LS+
Sbjct  72   EVALLRNSCKLALKQLKNWMAPDKAKTSLTTFPASAEIVSEPLGVVLVISAWNYPFLLSI  131

Query  523  D  525
            D
Sbjct  132  D  132



>ref|XP_006434229.1| hypothetical protein CICLE_v10000949mg [Citrus clementina]
 gb|ESR47469.1| hypothetical protein CICLE_v10000949mg [Citrus clementina]
Length=493

 Score =   157 bits (397),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 94/124 (76%), Gaps = 3/124 (2%)
 Frame = +1

Query  163  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  333
            DA AA   V ELR TFA+GKTKSY WRVSQLK+++K+    E  I+DAL  DL KPELES
Sbjct  15   DAEAASLFVKELRGTFASGKTKSYGWRVSQLKSLMKMLNEREPDIVDALRQDLDKPELES  74

Query  334  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  513
             ++E+A +K S K ALKELK WM PE  K++  T+PSSA+IV EP GVVL+IS WNYPF+
Sbjct  75   SIYEVALLKTSIKSALKELKHWMTPEKAKTSITTFPSSAEIVPEPFGVVLIISPWNYPFL  134

Query  514  LSLD  525
            LSLD
Sbjct  135  LSLD  138



>ref|XP_006472804.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Citrus 
sinensis]
 gb|KDO80585.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=493

 Score =   157 bits (397),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 94/124 (76%), Gaps = 3/124 (2%)
 Frame = +1

Query  163  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  333
            DA AA   V ELR TFA+GKTKSY WRVSQLK+++K+    E  I+DAL  DL KPELES
Sbjct  15   DAEAASLFVKELRGTFASGKTKSYGWRVSQLKSLMKMLNEREPDIVDALRQDLDKPELES  74

Query  334  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  513
             ++E+A +K S K ALKELK WM PE  K++  T+PSSA+IV EP GVVL+IS WNYPF+
Sbjct  75   SIYEVALLKTSIKSALKELKHWMTPEKAKTSITTFPSSAEIVPEPFGVVLIISPWNYPFL  134

Query  514  LSLD  525
            LSLD
Sbjct  135  LSLD  138



>gb|KHG30273.1| Aldehyde dehydrogenase family 3 member H1 [Gossypium arboreum]
Length=490

 Score =   157 bits (396),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = +1

Query  178  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  357
            V ELR +FA GKTKSYEWR++QL A++K+ E  E  I+ AL  DLSKPELES ++EIA +
Sbjct  20   VKELRASFATGKTKSYEWRLTQLNAMVKMMEEKEPQIVAALHDDLSKPELESSIYEIAML  79

Query  358  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            K S +LA+K +K WM PE  K++  T+PSSA+IVSEPLGVVLVISAWNYPF+LSLD
Sbjct  80   KNSFRLAVKNMKHWMMPEKAKTSLVTFPSSAEIVSEPLGVVLVISAWNYPFLLSLD  135



>ref|XP_008444182.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Cucumis melo]
Length=488

 Score =   157 bits (396),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 99/124 (80%), Gaps = 3/124 (2%)
 Frame = +1

Query  163  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  333
            DAAAA   V +LR +F  G T+SYEWRVSQL+++LK++  HE+ + +AL SDLSKP LES
Sbjct  12   DAAAATELVKKLRRSFTTGTTRSYEWRVSQLQSLLKLSLEHEEDLCNALHSDLSKPVLES  71

Query  334  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  513
             VHEIA +K SCKLALKEL+RWM PE VKS+   +PSSA IV EP GVVL+ISAWNYPF+
Sbjct  72   IVHEIALLKGSCKLALKELRRWMAPEKVKSSITVFPSSAAIVPEPFGVVLIISAWNYPFL  131

Query  514  LSLD  525
            LSLD
Sbjct  132  LSLD  135



>ref|XP_003602042.1| Aldehyde dehydrogenase family 3 member H1 [Medicago truncatula]
Length=495

 Score =   157 bits (396),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 98/125 (78%), Gaps = 5/125 (4%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            A++ V ELR +F++GKT+SYEWR+SQ+KA+LK+ +  +  I+DAL SDL+KP LE+ V+E
Sbjct  18   ASSLVKELRVSFSSGKTRSYEWRISQVKALLKMVDEQQDQIIDALRSDLAKPPLETVVYE  77

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYP-----F  510
            I   K SC++ LKELK+WM PE  K++  T+PSSA+IV EPLGVVLVISAWNYP     F
Sbjct  78   IGMFKNSCEVTLKELKQWMAPEKAKTSVTTFPSSAEIVPEPLGVVLVISAWNYPFRKSTF  137

Query  511  MLSLD  525
            +LSLD
Sbjct  138  VLSLD  142



>ref|XP_009107480.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Brassica 
rapa]
Length=482

 Score =   156 bits (395),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 95/121 (79%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            DA+  ++ELR +F AG T+SYEWRVSQLK +  I ++HE  I+ AL  DL  PELES V+
Sbjct  9    DASNLMTELRMSFDAGVTRSYEWRVSQLKKLQVICDNHEPEIVSALHDDLGTPELESSVY  68

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            E+A ++ S KLALK+LK WM P+  K++  T+P+SA+IVSEPLGVVLVISAWNYPF+LS+
Sbjct  69   EVALLRNSIKLALKQLKNWMAPDKAKTSLTTFPASAEIVSEPLGVVLVISAWNYPFLLSI  128

Query  523  D  525
            D
Sbjct  129  D  129



>ref|XP_002888606.1| ALDH3H1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64865.1| ALDH3H1 [Arabidopsis lyrata subsp. lyrata]
Length=484

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 95/121 (79%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            DA+  V++LR +F  G T+ YEWRV+QLK +L I ++HE  I+ AL  DL KPELES V+
Sbjct  11   DASILVTDLRRSFDDGVTRGYEWRVTQLKKLLIICDNHEPEIVAALRDDLGKPELESSVY  70

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            E++ ++ S KLALK+LK WM PE  K++  T+P+SA+IVSEPLGVVLVISAWNYPF+LS+
Sbjct  71   EVSLLRNSIKLALKQLKNWMAPEKAKTSLTTFPASAEIVSEPLGVVLVISAWNYPFLLSI  130

Query  523  D  525
            D
Sbjct  131  D  131



>ref|XP_003630349.1| Aldehyde dehydrogenase family 3 member H1 [Medicago truncatula]
Length=550

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = +1

Query  178  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  357
            V ELR+ F  GKTKSYEWR+SQL+A++K+ E  EK I+DAL +DLSKP LE+++ EI   
Sbjct  73   VRELRKNFDTGKTKSYEWRISQLEAIVKMLEEKEKEIIDALHTDLSKPRLEAYITEIVQA  132

Query  358  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            K+SC  AL+ELK WMKPE V ++   +PSSA+IVSEPLGVVL+IS WN+P +LSLD
Sbjct  133  KSSCDEALQELKHWMKPEKVSTSITAFPSSAEIVSEPLGVVLIISTWNFPMLLSLD  188



>gb|AET04825.2| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=543

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = +1

Query  178  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  357
            V ELR+ F  GKTKSYEWR+SQL+A++K+ E  EK I+DAL +DLSKP LE+++ EI   
Sbjct  73   VRELRKNFDTGKTKSYEWRISQLEAIVKMLEEKEKEIIDALHTDLSKPRLEAYITEIVQA  132

Query  358  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            K+SC  AL+ELK WMKPE V ++   +PSSA+IVSEPLGVVL+IS WN+P +LSLD
Sbjct  133  KSSCDEALQELKHWMKPEKVSTSITAFPSSAEIVSEPLGVVLIISTWNFPMLLSLD  188



>gb|KFK24209.1| hypothetical protein AALP_AAs42301U000200 [Arabis alpina]
Length=483

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            DA   ++ELR +F +G T+ YEWRVSQLK +L I ++HE  I+ AL  DL KPELES V+
Sbjct  10   DATNLMTELRRSFDSGVTRGYEWRVSQLKKLLIICDNHEPEIVSALHDDLGKPELESSVY  69

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            E+A ++ S KLAL +LK WM P+  K++  T+P+SA+I+S+PLGVVLVISAWNYPF+LSL
Sbjct  70   EVALLRNSIKLALSQLKYWMAPDKAKTSLTTFPASAEIISDPLGVVLVISAWNYPFLLSL  129

Query  523  D  525
            D
Sbjct  130  D  130



>ref|XP_003523436.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Glycine max]
 ref|XP_006578967.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X2 [Glycine max]
 ref|XP_006578968.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X3 [Glycine max]
Length=488

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 92/120 (77%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            A++ V ELR+ F  G T+SYEWRVSQ+KA+LK    +E  I+ AL SDL+KP LE+ V+E
Sbjct  16   ASSLVKELRDNFGKGTTRSYEWRVSQVKALLKAVVENEDQIVGALCSDLAKPPLETVVYE  75

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I   + SC++ LKELK WM PE VK++  T+PSSA+IV EPLGVVLVISAWNYP +LSLD
Sbjct  76   IGMFQNSCEVILKELKHWMTPEKVKTSIRTFPSSAEIVPEPLGVVLVISAWNYPILLSLD  135



>ref|XP_011468213.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Fragaria 
vesca subsp. vesca]
Length=545

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            A   V ELR++F +G+TKSYEWR+ QL  + ++ +  EK I++AL+ DLSKPELE+F+ E
Sbjct  74   AGLLVKELRKSFNSGRTKSYEWRMLQLSNIARMLDEKEKDIVEALYKDLSKPELETFISE  133

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I+  K+SCK AL+ LK+WM P+ VK++ AT+PSSA+IVSEPLGVVLVIS WN+PF+LS+D
Sbjct  134  ISTAKSSCKEALEGLKQWMIPQKVKTSIATFPSSAEIVSEPLGVVLVISTWNFPFLLSID  193



>ref|XP_008387507.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Malus domestica]
Length=550

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 92/120 (77%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            A   V ELR++F +G+TKSYEWR  QL+ + K+ E  EK I +AL+ DLSKPE+E+F+ E
Sbjct  77   AGLLVKELRKSFNSGRTKSYEWRRXQLENIAKMLEEKEKEITEALYKDLSKPEIEAFISE  136

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I   ++SC  ALKELK WM P+ V ++  TYPSSA+IVSEPLGVVLVIS WN+PF+LSLD
Sbjct  137  IVQXRSSCNEALKELKHWMVPQKVXTSITTYPSSAEIVSEPLGVVLVISTWNFPFLLSLD  196



>gb|ACG29168.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=478

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 91/120 (76%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            A   V ELR +FAAG+T+  EWR +QLK ++++ +  E  I  AL  DL+KP +ESF+HE
Sbjct  2    AEETVRELRASFAAGRTRPAEWRAAQLKGLIRMIDEKEAEISAALHEDLAKPHMESFLHE  61

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I+  K+SCK ALK LK WMKPE V +A  T+PSSA+IV EPLGVVL+ISAWNYPF+LS+D
Sbjct  62   ISLTKSSCKFALKGLKNWMKPEKVPAAITTFPSSAQIVPEPLGVVLIISAWNYPFILSID  121



>emb|CAE51203.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
Length=480

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 95/121 (79%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            +A+  V+ELR +F  G T+ YEWRV+QLK ++ I ++HE  I+ AL  DL KPELES V+
Sbjct  7    EASNLVTELRRSFDDGVTRGYEWRVTQLKKLMIICDNHEPEIVAALRDDLGKPELESSVY  66

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            E++ ++ S KLALK+LK WM PE  K++  T+P+SA+IVSEPLGVVLVISAWNYPF+LS+
Sbjct  67   EVSLLRNSIKLALKQLKNWMAPEKAKTSLTTFPASAEIVSEPLGVVLVISAWNYPFLLSI  126

Query  523  D  525
            D
Sbjct  127  D  127



>ref|NP_001148092.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
 gb|ACG29697.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=481

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 91/120 (76%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            A   V ELR +FAAG+T+  EWR +QLK ++++ +  E  I  AL  DL+KP +ESF+HE
Sbjct  5    AEETVRELRASFAAGRTRPAEWRAAQLKGLIRMIDEKEAEISAALHEDLAKPHMESFLHE  64

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I+  K+SCK ALK LK WMKPE V +A  T+PSSA+IV EPLGVVL+ISAWNYPF+LS+D
Sbjct  65   ISLTKSSCKFALKGLKNWMKPEKVPAAITTFPSSAQIVPEPLGVVLIISAWNYPFILSID  124



>ref|XP_008367720.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Malus 
domestica]
Length=560

 Score =   155 bits (392),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 92/120 (77%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            A   V ELR++F +G+TKSYEWR  QL+ + K+ E  EK I +AL+ DLSKPE+E+F+ E
Sbjct  87   AGLLVKELRKSFNSGRTKSYEWRRXQLENIAKMLEEKEKEITEALYKDLSKPEIEAFISE  146

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I   ++SC  ALKELK WM P+ V ++  TYPSSA+IVSEPLGVVLVIS WN+PF+LSLD
Sbjct  147  IVQXRSSCNEALKELKHWMVPQKVXTSITTYPSSAEIVSEPLGVVLVISTWNFPFLLSLD  206



>gb|AAM61211.1| aldehyde dehydrogenase, putative [Arabidopsis thaliana]
Length=484

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 95/121 (79%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            +A+  V+ELR +F  G T+ YEWRV+QLK ++ I ++HE  I+ AL  DL KPELES V+
Sbjct  11   EASNLVTELRRSFDDGVTRGYEWRVTQLKKLMIICDNHEPEIVAALRDDLGKPELESSVY  70

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            E++ ++ S KLALK+LK WM PE  K++  T+P+SA+IVSEPLGVVLVISAWNYPF+LS+
Sbjct  71   EVSLLRNSIKLALKQLKNWMAPEKAKTSLTTFPASAEIVSEPLGVVLVISAWNYPFLLSI  130

Query  523  D  525
            D
Sbjct  131  D  131



>ref|NP_175081.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
 ref|NP_849770.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
 sp|Q70DU8.2|AL3H1_ARATH RecName: Full=Aldehyde dehydrogenase family 3 member H1; Short=AtALDH4; 
Short=Ath-ALDH4 [Arabidopsis thaliana]
 gb|AAG50550.1|AC074228_5 aldehyde dehydrogenase, putative [Arabidopsis thaliana]
 gb|AAL59944.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AEE32025.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
 gb|AEE32026.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
Length=484

 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 95/121 (79%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            +A+  V+ELR +F  G T+ YEWRV+QLK ++ I ++HE  I+ AL  DL KPELES V+
Sbjct  11   EASNLVTELRRSFDDGVTRGYEWRVTQLKKLMIICDNHEPEIVAALRDDLGKPELESSVY  70

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            E++ ++ S KLALK+LK WM PE  K++  T+P+SA+IVSEPLGVVLVISAWNYPF+LS+
Sbjct  71   EVSLLRNSIKLALKQLKNWMAPEKAKTSLTTFPASAEIVSEPLGVVLVISAWNYPFLLSI  130

Query  523  D  525
            D
Sbjct  131  D  131



>ref|XP_004502483.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Cicer arietinum]
Length=493

 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 97/125 (78%), Gaps = 5/125 (4%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            A++ V ELR +F++GKT+SYEWR+SQ+KA+LK+    +  I+ AL SDL+KP LE+ V+E
Sbjct  16   ASSLVKELRGSFSSGKTQSYEWRISQVKALLKMVVEQQDQIIHALRSDLAKPPLETVVYE  75

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYP-----F  510
            I   K SC++ LKELK+WM PE VKS+  T+PSSA+IV EPLGVVLVISAWNYP     F
Sbjct  76   IGMFKNSCEVTLKELKQWMAPEKVKSSITTFPSSAEIVPEPLGVVLVISAWNYPFCKLTF  135

Query  511  MLSLD  525
            +LSLD
Sbjct  136  VLSLD  140



>gb|ACF85700.1| unknown [Zea mays]
 gb|AFW65462.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=478

 Score =   154 bits (389),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 91/120 (76%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            A   V ELR +FAAG+T+  EWR +QLK ++++ +  E  I  AL  DL+KP +ESF+HE
Sbjct  2    AEETVRELRASFAAGQTRPAEWRAAQLKGLIRMIDEKEAEISAALHEDLAKPHMESFLHE  61

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I+  K+SCK ALK LK WMKPE V +A  T+PSSA+IV EPLGVVL+ISAWNYPF+LS+D
Sbjct  62   ISLTKSSCKFALKGLKNWMKPEKVPAAITTFPSSAQIVPEPLGVVLIISAWNYPFILSID  121



>ref|XP_010930724.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Elaeis 
guineensis]
Length=495

 Score =   154 bits (390),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            AA   +E+RE F +GKT+S EWR +QLK ++++ E  E  IM AL +DL+KP  ES++HE
Sbjct  20   AAEMEAEMREIFRSGKTRSLEWRAAQLKGLVRMIEEKEADIMAALDADLAKPPFESYLHE  79

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            ++ VK+SC  ALKELK WMKPE V ++  T+PS+A+IVSEPLGVVL+ISAWNYPF+LSL
Sbjct  80   VSLVKSSCTFALKELKHWMKPEKVPASITTFPSTAEIVSEPLGVVLIISAWNYPFLLSL  138



>ref|XP_003532071.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
[Glycine max]
 gb|KHN16935.1| Aldehyde dehydrogenase family 3 member I1, chloroplastic [Glycine 
soja]
Length=541

 Score =   154 bits (390),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = +1

Query  178  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  357
            V +LR++F +G TKSY WRVSQL+A+ K+ E  EK I +AL+ DL KP LE+F+ EI+  
Sbjct  73   VKDLRKSFDSGMTKSYGWRVSQLEAIAKMLEEKEKEITEALYKDLGKPRLEAFITEISQA  132

Query  358  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            K+SC  ALKELK WMKPE V ++  TYPSSA+IV EPLGVVLVIS WN+PF+LS+D
Sbjct  133  KSSCSEALKELKEWMKPEKVNTSITTYPSSAEIVPEPLGVVLVISTWNFPFLLSMD  188



>ref|XP_007137428.1| hypothetical protein PHAVU_009G126400g [Phaseolus vulgaris]
 gb|ESW09422.1| hypothetical protein PHAVU_009G126400g [Phaseolus vulgaris]
Length=490

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            A++ V ELR+ F +G+T+SYEWRVSQ+KA+LK    +E  I+DAL SDL+KP LE+ V+E
Sbjct  18   ASSLVKELRKNFGSGRTRSYEWRVSQVKALLKAMVDNEDQIVDALRSDLAKPSLETLVYE  77

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I  +K+S ++ LKELK WM PE VK++  T+PSSA+IV EPLGVVLVIS WNYP +L+L+
Sbjct  78   IGLLKSSSEVILKELKHWMTPEKVKTSIKTFPSSAEIVPEPLGVVLVISPWNYPILLTLE  137



>gb|AAX96338.1| aldehyde dehydrogenase, putative [Oryza sativa Japonica Group]
Length=494

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 96/135 (71%), Gaps = 12/135 (9%)
 Frame = +1

Query  157  EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  336
            E + AA V ELR +F +G+T++ EWR +QL+ ++++ E  E  I DAL SDL+KP +ES+
Sbjct  3    EEEVAAVVGELRGSFRSGRTRAAEWRAAQLRGIVRMVEEREGDISDALHSDLAKPRMESY  62

Query  337  VHEIAFVKASCKLALKELKRWMKPE------------NVKSAFATYPSSAKIVSEPLGVV  480
            +HEI+  KA+C  ALK LK WMKPE             V +A  T+PS+A+IVSEPLGVV
Sbjct  63   LHEISLAKAACTFALKGLKNWMKPEKMLIMLTLINDDQVPAALTTFPSTAQIVSEPLGVV  122

Query  481  LVISAWNYPFMLSLD  525
            LVISAWNYPF+LS+D
Sbjct  123  LVISAWNYPFLLSID  137



>emb|CDY25655.1| BnaC05g25340D [Brassica napus]
Length=389

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 92/121 (76%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            DA   V+ELR +F  G T+ YEWRV+QLK +L I ++HE  I+ AL  DL KPELES V+
Sbjct  9    DATDLVTELRRSFDDGVTRGYEWRVTQLKKLLLICDNHEPEIVSALHDDLGKPELESSVY  68

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            E+A ++ S  LA+++LK WM P+  K++  T+P+SA+IV EPLGVVLVISAWNYPF+LS+
Sbjct  69   EVALLRNSINLAVQQLKDWMAPDKAKTSLTTFPASAEIVYEPLGVVLVISAWNYPFLLSI  128

Query  523  D  525
            D
Sbjct  129  D  129



>gb|ABR16899.1| unknown [Picea sitchensis]
Length=556

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 93/124 (75%), Gaps = 1/124 (1%)
 Frame = +1

Query  157  EMDAAAAV-SELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  333
            EM  A A+ ++LRETF  G T+SYEWR+SQL+ +LK+ + ++  I +AL  D+ KP  ES
Sbjct  79   EMPIADAIATQLRETFTCGSTRSYEWRMSQLEQILKLTDENQTQITEALHQDMGKPVFES  138

Query  334  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  513
            F+ EI+  K+SCK+A+KELK WM P+ V +    +PSSA+IV EPLG VL+ISAWNYPF+
Sbjct  139  FISEISLTKSSCKVAIKELKSWMTPQKVSTTITVFPSSAEIVPEPLGAVLIISAWNYPFL  198

Query  514  LSLD  525
            LS+D
Sbjct  199  LSMD  202



>ref|XP_009145048.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Brassica 
rapa]
Length=482

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 92/121 (76%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            DA   V+ELR +F  G T+ YEWRV+QLK +L I ++HE  I+ AL  DL KPELES V+
Sbjct  9    DATDLVTELRRSFDDGVTRGYEWRVTQLKKLLLICDNHEPEIVSALHDDLGKPELESSVY  68

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            E+A ++ S  LA+K+LK WM P+  K++  T+P+SA+IV EPLGVVLVISAWNYPF+LS+
Sbjct  69   EVALLRNSINLAVKQLKDWMAPDKAKTSLTTFPASAEIVYEPLGVVLVISAWNYPFLLSI  128

Query  523  D  525
            D
Sbjct  129  D  129



>ref|XP_009404859.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
Length=487

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 92/120 (77%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            AA  V+ELRETF +G+T+S  WR +QLKA+ ++ + +E  I  AL+ DL+KP  ESF+HE
Sbjct  10   AAEVVAELRETFRSGRTRSLRWRAAQLKALARMIDENEADIAAALYHDLAKPPTESFLHE  69

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I+  K +C  ALK+LKRWMKP  V ++  T+PSSAKIV EP GVVLVISAWN+PF+LS+D
Sbjct  70   ISLAKEACLFALKKLKRWMKPRKVPTSITTFPSSAKIVPEPFGVVLVISAWNFPFLLSID  129



>gb|ABA96616.1| aldehyde dehydrogenase family protein, expressed [Oryza sativa 
Japonica Group]
Length=484

 Score =   152 bits (383),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 90/118 (76%), Gaps = 0/118 (0%)
 Frame = +1

Query  172  AAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIA  351
            A V+ LR  FAAG T+  EWR +QL+ +L++A   E  +  AL +DL+KP  ES+VHEIA
Sbjct  11   AEVAALRGRFAAGGTRGAEWRAAQLRGILRMAAEAEAEVCRALHADLAKPYTESYVHEIA  70

Query  352  FVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
             VK+SCK ALK LK+WMKP+ V +   T+PS+A++ +EPLGVVLVISAWNYPF+LS+D
Sbjct  71   LVKSSCKFALKNLKKWMKPQKVTAPLMTFPSTARVAAEPLGVVLVISAWNYPFLLSID  128



>tpg|DAA38940.1| TPA: hypothetical protein ZEAMMB73_547503 [Zea mays]
Length=317

 Score =   149 bits (375),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 89/120 (74%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            A   V ELR +FA+G+T+  EWR  QLK ++++ +  E  I  AL  DL+KP +ES++HE
Sbjct  2    AEETVQELRASFASGRTRRAEWRAEQLKGLIRMIDEKEAEISAALHEDLAKPHMESYLHE  61

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I+  ++SCK AL  LK WMKPE + +A  T+PSSA+IV EPLGVVL+ISAWNYPF+LS+D
Sbjct  62   ISITRSSCKFALDGLKSWMKPEKIPAALTTFPSSAQIVPEPLGVVLIISAWNYPFILSID  121



>ref|XP_006663868.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like, partial 
[Oryza brachyantha]
Length=479

 Score =   151 bits (382),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = +1

Query  178  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  357
            V+ LR  FAAG+T+  EWR +QL+ +L++A   E  +  AL +DL+KP  ES+VHEIA V
Sbjct  8    VAALRGRFAAGRTRGAEWRAAQLRGLLRMAAEAEAEVCRALHADLAKPSTESYVHEIALV  67

Query  358  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            K+SC+ ALK LK+WMKP+ V ++  T+PS+A++ +EPLGVVLVISAWNYPF+LS+D
Sbjct  68   KSSCEFALKNLKKWMKPQKVHASLMTFPSTARVTAEPLGVVLVISAWNYPFLLSID  123



>gb|EMS67814.1| Aldehyde dehydrogenase family 3 member I1, chloroplastic [Triticum 
urartu]
Length=160

 Score =   143 bits (361),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 85/114 (75%), Gaps = 0/114 (0%)
 Frame = +1

Query  169  AAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEI  348
            AAAV ELRE FAAG+T+  EWR +QL+ VL++A   E  I DAL +DL KP+ E+ VHE+
Sbjct  6    AAAVQELRERFAAGQTRPAEWRAAQLRGVLRMATEMEAEICDALHADLGKPKTEAHVHEL  65

Query  349  AFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPF  510
            + +K+SC  ALK LK+WMKP+ V +    +PS+A+I  EPLG+VLVISAWNYP 
Sbjct  66   SLIKSSCLFALKNLKKWMKPQKVPAKLMNFPSTARITPEPLGLVLVISAWNYPL  119



>ref|XP_006304446.1| hypothetical protein CARUB_v10011079mg [Capsella rubella]
 gb|EOA37344.1| hypothetical protein CARUB_v10011079mg [Capsella rubella]
Length=484

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 94/122 (77%), Gaps = 0/122 (0%)
 Frame = +1

Query  160  MDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFV  339
            ++A+  V ELR +F  G T+ YEWRV+QLK +L + ++HE  I+ AL  DL KPELES V
Sbjct  10   VEASDLVKELRRSFDDGVTRGYEWRVTQLKKLLVVFDNHEPEIVAALRDDLGKPELESSV  69

Query  340  HEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLS  519
            +E++ ++ S KLALK+LK WM P+  K +  T+P+SA+IVSEPLGVVLVISAWNYPF+LS
Sbjct  70   YEVSLLRNSVKLALKQLKNWMAPDKAKISLTTFPASAEIVSEPLGVVLVISAWNYPFLLS  129

Query  520  LD  525
            +D
Sbjct  130  ID  131



>ref|XP_007159875.1| hypothetical protein PHAVU_002G275200g [Phaseolus vulgaris]
 gb|ESW31869.1| hypothetical protein PHAVU_002G275200g [Phaseolus vulgaris]
Length=566

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = +1

Query  178  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  357
            V +LR+ F +G+TKSYEWRVSQL+A+ K+ E  EK I +AL+ DL+KP  E+F+ E+   
Sbjct  98   VRDLRKCFDSGRTKSYEWRVSQLEAISKMLEEKEKEITEALYKDLAKPPFEAFITEVTQA  157

Query  358  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            K+SC  AL ELK WMKPE V ++  T+PSSA+IV EPLGVVLVIS WN+PF+LS+D
Sbjct  158  KSSCNEALTELKHWMKPERVSTSITTFPSSAEIVPEPLGVVLVISTWNFPFLLSMD  213



>dbj|BAK01937.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=489

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = +1

Query  154  LEMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  333
            +E  AAA ++ELR +F  G+T+  EWR +QL++++++ E  E  I DAL +DL+KP +E+
Sbjct  9    MEPTAAALMAELRGSFREGRTRPAEWRTAQLRSLVRMIEEKEDDISDALHADLAKPRMEA  68

Query  334  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  513
            ++HEI+  K +C  ALK LK WMKP+ V SA  T+PS+A+IV EP+GVVLVISAWNYPF+
Sbjct  69   YLHEISLAKGACMFALKGLKNWMKPDKVPSAITTFPSTAQIVPEPMGVVLVISAWNYPFL  128

Query  514  LSLD  525
            LS++
Sbjct  129  LSIE  132



>gb|KDO80584.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=487

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 90/122 (74%), Gaps = 3/122 (2%)
 Frame = +1

Query  163  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  333
            DA AA   V ELR TFA+GKTKSY WRVSQLK+++K+    E  I+DAL  DL KPELES
Sbjct  15   DAEAASLFVKELRGTFASGKTKSYGWRVSQLKSLMKMLNEREPDIVDALRQDLDKPELES  74

Query  334  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  513
             ++E+A +K S K ALKELK WM PE  K++  T+PSSA+IV EP GVVL+IS WNYPF 
Sbjct  75   SIYEVALLKTSIKSALKELKHWMTPEKAKTSITTFPSSAEIVPEPFGVVLIISPWNYPFF  134

Query  514  LS  519
            + 
Sbjct  135  VG  136



>ref|NP_001168661.1| hypothetical protein [Zea mays]
 gb|ACN29088.1| unknown [Zea mays]
 tpg|DAA38941.1| TPA: hypothetical protein ZEAMMB73_547503 [Zea mays]
Length=478

 Score =   149 bits (375),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 89/120 (74%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            A   V ELR +FA+G+T+  EWR  QLK ++++ +  E  I  AL  DL+KP +ES++HE
Sbjct  2    AEETVQELRASFASGRTRRAEWRAEQLKGLIRMIDEKEAEISAALHEDLAKPHMESYLHE  61

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I+  ++SCK AL  LK WMKPE + +A  T+PSSA+IV EPLGVVL+ISAWNYPF+LS+D
Sbjct  62   ISITRSSCKFALDGLKSWMKPEKIPAALTTFPSSAQIVPEPLGVVLIISAWNYPFILSID  121



>ref|XP_008668343.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=541

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 89/120 (74%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            A   V ELR +FA+G+T+  EWR  QLK ++++ +  E  I  AL  DL+KP +ES++HE
Sbjct  2    AEETVQELRASFASGRTRRAEWRAEQLKGLIRMIDEKEAEISAALHEDLAKPHMESYLHE  61

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I+  ++SCK AL  LK WMKPE + +A  T+PSSA+IV EPLGVVL+ISAWNYPF+LS+D
Sbjct  62   ISITRSSCKFALDGLKSWMKPEKIPAALTTFPSSAQIVPEPLGVVLIISAWNYPFILSID  121



>ref|XP_003577758.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Brachypodium 
distachyon]
Length=481

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 87/114 (76%), Gaps = 0/114 (0%)
 Frame = +1

Query  184  ELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFVKA  363
            ELR  F +G+T+  EWR +QLKA++++ E  E  I DAL +DL+KP +ES++HEI+  K 
Sbjct  11   ELRGCFRSGRTRPAEWRAAQLKALVRMIEDKENDISDALHADLAKPRMESYLHEISLAKG  70

Query  364  SCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            +C  ALK +K WMKPE V +A  T+PS+A IV EPLGVVL+ISAWNYPF+LS+D
Sbjct  71   ACIFALKGMKNWMKPEKVPAAITTFPSTATIVPEPLGVVLIISAWNYPFLLSID  124



>gb|KDO52217.1| hypothetical protein CISIN_1g009109mg [Citrus sinensis]
 gb|KDO52218.1| hypothetical protein CISIN_1g009109mg [Citrus sinensis]
 gb|KDO52219.1| hypothetical protein CISIN_1g009109mg [Citrus sinensis]
 gb|KDO52220.1| hypothetical protein CISIN_1g009109mg [Citrus sinensis]
Length=429

 Score =   145 bits (365),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            AA+ + ELR  + + KTKSYEWR+SQ++++  + E  E+ I++A+  DLSKP  E+F+ E
Sbjct  69   AASLMKELRNNYNSRKTKSYEWRMSQIQSIANMIEEKEEEIIEAIHKDLSKPPFETFISE  128

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I+  K+SCKLALKELK W KPE  K++  TYPSSA+I+SEPLGVVLVIS WNYPF+LSLD
Sbjct  129  ISMTKSSCKLALKELKYWTKPEKAKTSLTTYPSSAEIISEPLGVVLVISTWNYPFLLSLD  188



>ref|XP_006432085.1| hypothetical protein CICLE_v10000776mg [Citrus clementina]
 ref|XP_006432087.1| hypothetical protein CICLE_v10000776mg [Citrus clementina]
 ref|XP_006464931.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
isoform X2 [Citrus sinensis]
 gb|ESR45325.1| hypothetical protein CICLE_v10000776mg [Citrus clementina]
 gb|ESR45327.1| hypothetical protein CICLE_v10000776mg [Citrus clementina]
Length=429

 Score =   145 bits (365),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            AA+ + ELR  + + KTKSYEWR+SQ++++  + E  E+ I++A+  DLSKP  E+F+ E
Sbjct  69   AASLMKELRNNYNSRKTKSYEWRMSQIQSIANMIEEKEEEIIEAIHKDLSKPPFETFISE  128

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I+  K+SCKLALKELK W KPE  K++  TYPSSA+I+SEPLGVVLVIS WNYPF+LSLD
Sbjct  129  ISMTKSSCKLALKELKYWTKPEKAKTSLTTYPSSAEIISEPLGVVLVISTWNYPFLLSLD  188



>gb|KDO52216.1| hypothetical protein CISIN_1g009109mg [Citrus sinensis]
Length=507

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 102/144 (71%), Gaps = 3/144 (2%)
 Frame = +1

Query  103  FHIYKYIYCLGREERK*LEMD---AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEH  273
            F  +     +  EE++    D   AA+ + ELR  + + KTKSYEWR+SQ++++  + E 
Sbjct  9    FQDFSCSATMAAEEKQMQRFDVEKAASLMKELRNNYNSRKTKSYEWRMSQIQSIANMIEE  68

Query  274  HEKAIMDALFSDLSKPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAK  453
             E+ I++A+  DLSKP  E+F+ EI+  K+SCKLALKELK W KPE  K++  TYPSSA+
Sbjct  69   KEEEIIEAIHKDLSKPPFETFISEISMTKSSCKLALKELKYWTKPEKAKTSLTTYPSSAE  128

Query  454  IVSEPLGVVLVISAWNYPFMLSLD  525
            I+SEPLGVVLVIS WNYPF+LSLD
Sbjct  129  IISEPLGVVLVISTWNYPFLLSLD  152



>gb|KDO52215.1| hypothetical protein CISIN_1g009109mg [Citrus sinensis]
Length=543

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            AA+ + ELR  + + KTKSYEWR+SQ++++  + E  E+ I++A+  DLSKP  E+F+ E
Sbjct  69   AASLMKELRNNYNSRKTKSYEWRMSQIQSIANMIEEKEEEIIEAIHKDLSKPPFETFISE  128

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I+  K+SCKLALKELK W KPE  K++  TYPSSA+I+SEPLGVVLVIS WNYPF+LSLD
Sbjct  129  ISMTKSSCKLALKELKYWTKPEKAKTSLTTYPSSAEIISEPLGVVLVISTWNYPFLLSLD  188



>ref|XP_006432086.1| hypothetical protein CICLE_v10000776mg [Citrus clementina]
 ref|XP_006464930.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
isoform X1 [Citrus sinensis]
 gb|ESR45326.1| hypothetical protein CICLE_v10000776mg [Citrus clementina]
Length=543

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            AA+ + ELR  + + KTKSYEWR+SQ++++  + E  E+ I++A+  DLSKP  E+F+ E
Sbjct  69   AASLMKELRNNYNSRKTKSYEWRMSQIQSIANMIEEKEEEIIEAIHKDLSKPPFETFISE  128

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I+  K+SCKLALKELK W KPE  K++  TYPSSA+I+SEPLGVVLVIS WNYPF+LSLD
Sbjct  129  ISMTKSSCKLALKELKYWTKPEKAKTSLTTYPSSAEIISEPLGVVLVISTWNYPFLLSLD  188



>ref|XP_009355864.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=534

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +1

Query  184  ELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFVKA  363
            ELR++F +G+TKSYEWR SQL+ + K+ E  EK I +AL+ DLSKPE+E+F+ EI   K+
Sbjct  93   ELRKSFNSGRTKSYEWRRSQLENIAKMLEEKEKEIAEALYKDLSKPEIEAFISEIVQAKS  152

Query  364  SCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            SC  ALKELK WM P+ V +   TYPSSA+IVSEPLGVVLVIS WN+PF+LSLD
Sbjct  153  SCNEALKELKHWMVPQKVSTPITTYPSSAEIVSEPLGVVLVISTWNFPFLLSLD  206



>gb|ABK24239.1| unknown [Picea sitchensis]
Length=478

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 87/121 (72%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            DA   V +LR TF++G+T+SYEWR++QLK V K+ + +E  I++AL  D+ KP  ESF  
Sbjct  3    DAVRVVRKLRYTFSSGRTRSYEWRIAQLKQVWKLVDENEDQIIEALSEDIGKPPFESFFA  62

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            EI+  K SCK+A+K+LK WM PE V +    +PS A+I+ EPLG  L+ISAWNYP +LS+
Sbjct  63   EISLTKDSCKVAIKQLKSWMAPEKVSTTLTVFPSKAEILPEPLGAALIISAWNYPLLLSM  122

Query  523  D  525
            D
Sbjct  123  D  123



>ref|XP_004977224.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Setaria italica]
Length=482

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 90/120 (75%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            AA A   LR +FA+G+T+   WR +QL+ +L++A   E  I  AL +DL+KP  ES+VHE
Sbjct  7    AAQARERLRASFASGRTRPAAWRAAQLRGLLRMAVEMEAEICAALRADLAKPRTESYVHE  66

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I+ V +SCK ALK L++WMKP+ V +   T+PS+A++ +EPLGVVLVISAWNYPF+L++D
Sbjct  67   ISLVTSSCKFALKNLQKWMKPKKVPAGLLTFPSTARVTAEPLGVVLVISAWNYPFLLAID  126



>ref|XP_004977223.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Setaria italica]
Length=520

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 90/120 (75%), Gaps = 0/120 (0%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            AA A   LR +FA+G+T+   WR +QL+ +L++A   E  I  AL +DL+KP  ES+VHE
Sbjct  7    AAQARERLRASFASGRTRPAAWRAAQLRGLLRMAVEMEAEICAALRADLAKPRTESYVHE  66

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            I+ V +SCK ALK L++WMKP+ V +   T+PS+A++ +EPLGVVLVISAWNYPF+L++D
Sbjct  67   ISLVTSSCKFALKNLQKWMKPKKVPAGLLTFPSTARVTAEPLGVVLVISAWNYPFLLAID  126



>ref|XP_009355863.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Pyrus x bretschneideri]
Length=560

 Score =   144 bits (362),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +1

Query  184  ELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFVKA  363
            ELR++F +G+TKSYEWR SQL+ + K+ E  EK I +AL+ DLSKPE+E+F+ EI   K+
Sbjct  93   ELRKSFNSGRTKSYEWRRSQLENIAKMLEEKEKEIAEALYKDLSKPEIEAFISEIVQAKS  152

Query  364  SCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            SC  ALKELK WM P+ V +   TYPSSA+IVSEPLGVVLVIS WN+PF+LSLD
Sbjct  153  SCNEALKELKHWMVPQKVSTPITTYPSSAEIVSEPLGVVLVISTWNFPFLLSLD  206



>ref|XP_010238657.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Brachypodium 
distachyon]
Length=479

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 90/121 (74%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            DA +  +ELR  F  G T++ EWR +QL+ +L++A   E  + DAL +DL+KP  E+ +H
Sbjct  3    DARSWAAELRGRFEEGLTRAAEWRAAQLRGLLRMATEMEAEMCDALHADLAKPRTEACLH  62

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            EI+ +K+SC  ALK LK+WMKP+ V++   T+PS+A+I +EPLGVVL+ISAWNYP +LSL
Sbjct  63   EISLIKSSCLFALKNLKKWMKPQKVQAKLMTFPSAARITAEPLGVVLIISAWNYPLLLSL  122

Query  523  D  525
            D
Sbjct  123  D  123



>ref|XP_002449124.1| hypothetical protein SORBIDRAFT_05g005470 [Sorghum bicolor]
 gb|EES08112.1| hypothetical protein SORBIDRAFT_05g005470 [Sorghum bicolor]
Length=478

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 85/116 (73%), Gaps = 0/116 (0%)
 Frame = +1

Query  178  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  357
            V EL   F AG+ +S +WR  QL+ ++++ +  E  I  AL  DL+KP +ES++HEI+  
Sbjct  6    VRELPPNFPAGRKRSPQWRAEQLRGLIRMIDEKEAEISAALHEDLAKPHMESYLHEISLT  65

Query  358  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            K+SCK A+  LK WMKPE V ++  T+PSSA+IV EPLGVVL+ISAWNYPF+LS+D
Sbjct  66   KSSCKFAINGLKNWMKPEKVPASITTFPSSAQIVPEPLGVVLIISAWNYPFILSID  121



>ref|XP_002441918.1| hypothetical protein SORBIDRAFT_08g004840 [Sorghum bicolor]
 gb|EES15756.1| hypothetical protein SORBIDRAFT_08g004840 [Sorghum bicolor]
Length=487

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = +1

Query  196  TFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFVKASCKL  375
            +FA G+T++  WR +QL+ +L++A   E  +  AL +DL+KP+ ES+VHEI+ V  SCK 
Sbjct  18   SFATGRTRAAAWREAQLRGLLRMAAEMEDDVCAALRADLAKPQTESYVHEISLVTTSCKF  77

Query  376  ALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            ALK LK+WMKP+ V     T+PS+A++ +EPLGVVLVISAWNYPF+L++D
Sbjct  78   ALKNLKKWMKPQKVPGGVLTFPSAARVTAEPLGVVLVISAWNYPFLLAID  127



>gb|ACL53721.1| unknown [Zea mays]
 gb|AFW56224.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=491

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 83/114 (73%), Gaps = 0/114 (0%)
 Frame = +1

Query  184  ELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFVKA  363
             LR +FA+G+T+   WR +QL+ +L++A   E  I  AL +DL+KP  E +VHEI+ V +
Sbjct  19   RLRRSFASGRTRPAAWREAQLRGLLRMATEREDDICAALHADLAKPLTECYVHEISLVIS  78

Query  364  SCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            SCK ALK LK+WMKP  V     T+PS+A + +EPLGVVLVISAWNYPF+L++D
Sbjct  79   SCKFALKNLKKWMKPRKVPGGLLTFPSAASVAAEPLGVVLVISAWNYPFLLAID  132



>ref|NP_001152171.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
 gb|ACG46203.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=491

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 83/114 (73%), Gaps = 0/114 (0%)
 Frame = +1

Query  184  ELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFVKA  363
             LR +FA+G+T+   WR +QL+ +L++A   E  I  AL +DL+KP  E +VHEI+ V +
Sbjct  19   RLRRSFASGRTRPAAWREAQLRGLLRMAAEREDDICAALHADLAKPLTECYVHEISLVIS  78

Query  364  SCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            SCK ALK LK+WMKP  V     T+PS+A + +EPLGVVLVISAWNYPF+L++D
Sbjct  79   SCKFALKNLKKWMKPRKVPGGLLTFPSAASVAAEPLGVVLVISAWNYPFLLAID  132



>ref|XP_010547357.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010547358.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=540

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +1

Query  157  EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  336
            E   A+ V ELR+ F  GKTKSYEWR++QL+ + ++ +   K I  AL  DL+KPELE+F
Sbjct  68   EETVASLVEELRDNFKTGKTKSYEWRITQLEGIARMIDEKSKYIAQALREDLNKPELEAF  127

Query  337  VHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFML  516
            + EI+  K+SC LA+KELK WM PE V ++  T PSSA+IVSEPLGVVL+ISAWN+PF+L
Sbjct  128  LAEISNTKSSCMLAIKELKNWMTPEPVTTSVTTSPSSAEIVSEPLGVVLIISAWNFPFLL  187

Query  517  SLD  525
            ++D
Sbjct  188  AID  190



>gb|EMT33845.1| Aldehyde dehydrogenase family 3 member H1 [Aegilops tauschii]
Length=517

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 92/145 (63%), Gaps = 25/145 (17%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            AAA + ELR +F  G+T+  EWR +QL+A++++ E  E  I DAL +DL+KP +E+++HE
Sbjct  5    AAAVMEELRGSFREGRTRPAEWRTAQLRALVRMIEEKEDDISDALHADLAKPRMEAYLHE  64

Query  346  -------------------------IAFVKASCKLALKELKRWMKPENVKSAFATYPSSA  450
                                     I+  K +C  ALK LK WMKP+ V SA  T+PS+A
Sbjct  65   VCSTSISISNLQVDSNRIYRRILGLISLAKGACMFALKGLKNWMKPDKVPSAITTFPSTA  124

Query  451  KIVSEPLGVVLVISAWNYPFMLSLD  525
            +IV EPLGVVLVISAWNYPF+LS++
Sbjct  125  QIVPEPLGVVLVISAWNYPFLLSIE  149



>ref|XP_001780129.1| variable substrate [Physcomitrella patens]
 gb|EDQ55048.1| variable substrate [Physcomitrella patens]
Length=500

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 89/128 (70%), Gaps = 12/128 (9%)
 Frame = +1

Query  178  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  357
            V+E+RE +   +TK  EWRV QLK +L++    E  I++AL++DL KP  ES++ EI+ V
Sbjct  19   VAEVREAYMTMRTKPAEWRVQQLKGLLRMVIESESEIVEALYADLGKPAHESYMSEISLV  78

Query  358  KASCKLALKELKRWMKPEN------------VKSAFATYPSSAKIVSEPLGVVLVISAWN  501
            K+SCKLA+KELK+WM P+             V  +  T+PSSA IV+EPLGV LVISAWN
Sbjct  79   KSSCKLAIKELKKWMAPQRLCIMHVMFGALMVSGSMITFPSSASIVAEPLGVTLVISAWN  138

Query  502  YPFMLSLD  525
            +PF+LS+D
Sbjct  139  FPFLLSVD  146



>ref|XP_001764841.1| variable substrate [Physcomitrella patens]
 gb|EDQ70283.1| variable substrate [Physcomitrella patens]
Length=492

 Score =   132 bits (332),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 83/116 (72%), Gaps = 0/116 (0%)
 Frame = +1

Query  178  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  357
            V+E+RE +  G+T+   WRV QL  ++++    E  I+  L++DL KP  ES+V E++ V
Sbjct  23   VTEVREAYRNGRTRPAAWRVQQLNGIIRMISERESEIVQTLYTDLGKPSHESYVTEVSLV  82

Query  358  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            +++CKLA+KELK+WM P  V  +  T+PS   IV+EPLGV LVISAWN+PF+LS++
Sbjct  83   RSACKLAIKELKKWMAPLKVSGSITTFPSWGAIVAEPLGVALVISAWNFPFLLSVE  138



>ref|XP_002978037.1| hypothetical protein SELMODRAFT_268146 [Selaginella moellendorffii]
 gb|EFJ20694.1| hypothetical protein SELMODRAFT_268146 [Selaginella moellendorffii]
Length=480

 Score =   132 bits (332),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 85/116 (73%), Gaps = 0/116 (0%)
 Frame = +1

Query  178  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  357
            V+ELR+ F +G+T+  EWR +QL+A+L++ +  E  I++AL  D+ KP  E++V E++ +
Sbjct  10   VAELRDAFRSGRTRPMEWRAAQLRAMLRMIDEREGEIIEALDRDIGKPAYETYVAELSTI  69

Query  358  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
              SC  ALK L+ WM P+ V ++  ++PSS +IV EPLGV LVISAWN+PF+LSLD
Sbjct  70   ANSCTNALKHLRSWMAPDKVSTSMISFPSSGEIVPEPLGVALVISAWNFPFLLSLD  125



>ref|XP_002966702.1| hypothetical protein SELMODRAFT_168397 [Selaginella moellendorffii]
 gb|EFJ32729.1| hypothetical protein SELMODRAFT_168397 [Selaginella moellendorffii]
Length=480

 Score =   131 bits (330),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 85/116 (73%), Gaps = 0/116 (0%)
 Frame = +1

Query  178  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  357
            V+ELR+ F +G+T+  +WR +QL+A+L++ +  E  I++AL  D+ KP  E++V E++ +
Sbjct  10   VAELRDEFRSGRTRPMDWRAAQLRAMLRMIDEREGEIIEALDRDIGKPAYETYVAELSTI  69

Query  358  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
              SC  ALK L+ WM PE V ++  ++PSS +IV EPLGV LVISAWN+PF+LSLD
Sbjct  70   ANSCTNALKHLRSWMAPEKVSTSMISFPSSGEIVPEPLGVALVISAWNFPFLLSLD  125



>ref|XP_002966639.1| hypothetical protein SELMODRAFT_227647 [Selaginella moellendorffii]
 gb|EFJ32666.1| hypothetical protein SELMODRAFT_227647 [Selaginella moellendorffii]
Length=479

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 82/119 (69%), Gaps = 0/119 (0%)
 Frame = +1

Query  169  AAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEI  348
            AA   E+R  F +G+T+S +WR++QLK+++ + + HE+ I +A+  D+ KP  E F  EI
Sbjct  7    AAVCGEVRGDFKSGRTRSLDWRLAQLKSIVDLIKKHEEDITEAVAVDMGKPSYECFASEI  66

Query  349  AFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
              VK++C+LA+K LK W    NV    AT P+SA +  EP GVVL+ISAWN+PF+LSLD
Sbjct  67   FPVKSACQLAIKNLKNWTAAVNVPPLLATLPASASMKPEPFGVVLIISAWNFPFLLSLD  125



>ref|XP_002978104.1| hypothetical protein SELMODRAFT_271300 [Selaginella moellendorffii]
 gb|EFJ20761.1| hypothetical protein SELMODRAFT_271300 [Selaginella moellendorffii]
Length=479

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 82/119 (69%), Gaps = 0/119 (0%)
 Frame = +1

Query  169  AAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEI  348
            AA   E+R  F +G+T+S +WR++QLK+++ + + HE+ I +A+  D+ KP  E F  EI
Sbjct  7    AAVCGEVRGDFKSGRTRSLDWRLAQLKSIVDLIKKHEEDITEAVAVDMGKPSYECFASEI  66

Query  349  AFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
              VK++C+LA+K LK W    NV    AT P+SA +  EP GVVL+ISAWN+PF+LSLD
Sbjct  67   FPVKSACQLAIKNLKNWTAAVNVPPLLATLPASASMKPEPFGVVLIISAWNFPFLLSLD  125



>ref|XP_007213817.1| hypothetical protein PRUPE_ppa005609mg [Prunus persica]
 gb|EMJ15016.1| hypothetical protein PRUPE_ppa005609mg [Prunus persica]
Length=451

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +1

Query  235  VSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFVKASCKLALKELKRWMKPEN  414
            +SQL+ + K+ E  EK I +AL+ DLSKPE+E+F+ EI   K+SC  ALKEL++WM P+ 
Sbjct  1    MSQLENIAKMLEEKEKEITEALYKDLSKPEVEAFISEIVTAKSSCNEALKELRQWMIPQK  60

Query  415  VKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            V ++  T+PSSA+IVSEPLGVVLVI+ WN+PF+LS+D
Sbjct  61   VNTSITTFPSSAEIVSEPLGVVLVIATWNFPFLLSVD  97



>gb|KJB75337.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=443

 Score =   123 bits (308),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +1

Query  268  EHHEKAIMDALFSDLSKPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSS  447
            +  EK I++AL  DLSKPELE+F+ EI   ++SCKLALKELK+WM P+ V+++ ATYPSS
Sbjct  3    DEKEKEIVEALRKDLSKPELEAFLSEILMARSSCKLALKELKQWMMPQKVETSLATYPSS  62

Query  448  AKIVSEPLGVVLVISAWNYPFMLSLD  525
            A+IV+EPLGVVLVIS WN+PF LSLD
Sbjct  63   AEIVAEPLGVVLVISTWNFPFSLSLD  88



>ref|XP_010679827.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Beta 
vulgaris subsp. vulgaris]
Length=487

 Score =   120 bits (301),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 81/121 (67%), Gaps = 0/121 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            D  + +SELRETF +GKTKS EWR +QL+A+  + EH EK    ALF D+ K +LE++  
Sbjct  5    DTMSLLSELRETFKSGKTKSLEWRKTQLQALSNMVEHQEKLCFQALFDDVGKGKLEAYKD  64

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            E+   K + + AL  LK+WM P+    +    PS A+I+ EP G+VL++++WNYPF L+L
Sbjct  65   EVGPTKKTIEYALSNLKKWMAPKKAGMSLLLLPSKAEIIPEPYGLVLILTSWNYPFDLAL  124

Query  523  D  525
            +
Sbjct  125  E  125



>ref|XP_001757163.1| variable substrate [Physcomitrella patens]
 gb|EDQ78022.1| variable substrate [Physcomitrella patens]
Length=479

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 79/122 (65%), Gaps = 0/122 (0%)
 Frame = +1

Query  160  MDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFV  339
            +DA   VSELR T    +T+  +WR+ Q++AVLK+   +E  I  AL SDL K   ESF+
Sbjct  4    IDAPQIVSELRATLRTARTRPAQWRLDQIRAVLKLVNENEDDIYAALHSDLHKSNYESFL  63

Query  340  HEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLS  519
             E+  + ++CK  +K L +WM PE      A +P++A ++SEPLGV LVIS WN+P +L+
Sbjct  64   TEVNVLVSACKSTMKNLHKWMAPEKKPIPLAVWPANASVISEPLGVALVISPWNFPLLLA  123

Query  520  LD  525
            LD
Sbjct  124  LD  125



>ref|XP_001197038.2| PREDICTED: aldehyde dehydrogenase-like [Strongylocentrotus purpuratus]
Length=218

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 72/121 (60%), Gaps = 0/121 (0%)
 Frame = +1

Query  160  MDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFV  339
             DA   V   R  F A +T+SYE R++ L  + ++   +++A +DAL+ DL KPE E+  
Sbjct  5    FDAGMVVESCRSAFDASQTRSYEARITHLHNLRRMISENKQAFVDALYKDLRKPEFEAVT  64

Query  340  HEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLS  519
             E+ F    C LA+ ELK+WMKPE V   FA       I  +PLGVVL+I AWNYPF L 
Sbjct  65   FEVDFCHNDCVLAINELKQWMKPEKVAIPFAGVGKQCYIQRDPLGVVLIIGAWNYPFQLP  124

Query  520  L  522
            +
Sbjct  125  I  125



>ref|WP_002673810.1| hypothetical protein [Treponema denticola]
 gb|EMB43951.1| hypothetical protein HMPREF9730_01891 [Treponema denticola AL-2]
Length=457

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 80/123 (65%), Gaps = 0/123 (0%)
 Frame = +1

Query  154  LEMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  333
            +  D    V   R+ F   KTKSYE+R+SQL  + ++   ++K +++AL+SDL K E+E 
Sbjct  1    MNQDIETIVKNCRDFFGTNKTKSYEFRISQLLKLQEVLNQNKKELLNALYSDLHKTEMEG  60

Query  334  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  513
            F  E A V+   K A+K LK+W+KP+ V ++ A + SS+KI+ EP G VL++S WNYP  
Sbjct  61   FFSEFAIVRGELKFAIKHLKKWIKPKRVPTSIAHFKSSSKIMYEPFGTVLIMSPWNYPLN  120

Query  514  LSL  522
            L+L
Sbjct  121  LTL  123



>ref|WP_002688230.1| hypothetical protein [Treponema denticola]
 gb|EMB30984.1| hypothetical protein HMPREF9727_00669 [Treponema denticola MYR-T]
 gb|EMB31912.1| hypothetical protein HMPREF9725_01034 [Treponema denticola H1-T]
Length=457

 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 80/123 (65%), Gaps = 0/123 (0%)
 Frame = +1

Query  154  LEMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  333
            +  D    V   R+ F   KTKSYE+R+SQL  + ++   ++K +++AL+SDL K E+E 
Sbjct  1    MNQDIETIVKNCRDFFGINKTKSYEFRISQLLKLQEVLNQNKKELLNALYSDLHKTEMEG  60

Query  334  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  513
            F  E A V+   K A+K LK+W+KP+ V ++ A + SS+KI+ EP G VL++S WNYP  
Sbjct  61   FFSEFAIVRGELKFAIKHLKKWIKPKRVPTSIAHFKSSSKIMYEPFGTVLIMSPWNYPLN  120

Query  514  LSL  522
            L+L
Sbjct  121  LTL  123



>ref|WP_009627619.1| Aldehyde Dehydrogenase [Pseudanabaena biceps]
 gb|ELS32285.1| Aldehyde Dehydrogenase [Pseudanabaena biceps PCC 7429]
Length=463

 Score =   118 bits (295),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 81/122 (66%), Gaps = 0/122 (0%)
 Frame = +1

Query  157  EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  336
             +D  A +++ R  F   KTK YE+RVSQLK + ++ + +EK I+DA+++DL KP +E F
Sbjct  8    NLDIPATIAKQRIFFDGNKTKDYEFRVSQLKKLAQLIKENEKLILDAVYADLRKPTIEIF  67

Query  337  VHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFML  516
              EI    +  +  +K LK WMKP+ V +    +PSS+ I +EPLGVVL+++ WNYPF L
Sbjct  68   GSEILIALSEIRYVIKHLKAWMKPQKVGTPLNLFPSSSYIYTEPLGVVLIVAPWNYPFSL  127

Query  517  SL  522
            ++
Sbjct  128  NI  129



>ref|WP_010698015.1| hypothetical protein [Treponema denticola]
 gb|EMB26466.1| hypothetical protein HMPREF9724_00443 [Treponema denticola SP37]
 gb|EPF33798.1| hypothetical protein HMPREF9734_01362 [Treponema denticola SP44]
 gb|EPF39492.1| hypothetical protein HMPREF9731_01295 [Treponema denticola SP23]
Length=457

 Score =   117 bits (294),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 80/123 (65%), Gaps = 0/123 (0%)
 Frame = +1

Query  154  LEMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  333
            +  D    V   R+ F   KTKSYE+R+SQL  + ++   ++K +++AL+SDL K E+E 
Sbjct  1    MNQDIETIVKNCRDFFETNKTKSYEFRISQLLKLQEVLNQNKKELLNALYSDLHKTEMEG  60

Query  334  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  513
            F  E A V+   K A+K LK+W+KP+ V ++ A + SS+KI+ EP G VL++S WNYP  
Sbjct  61   FFSEFAIVRGELKFAIKHLKKWIKPKRVPTSIAHFKSSSKIMYEPFGTVLIMSPWNYPLN  120

Query  514  LSL  522
            L+L
Sbjct  121  LTL  123



>ref|WP_006011635.1| aldehyde dehydrogenase [Glaciecola pallidula]
 dbj|GAC29092.1| aldehyde dehydrogenase [Glaciecola pallidula DSM 14239 = ACAM 
615]
Length=468

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 73/113 (65%), Gaps = 0/113 (0%)
 Frame = +1

Query  178  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  357
            + EL+ TFA G+TK Y+WRV QL A+ ++ + +  AI+ AL +DL K E ES++ EI + 
Sbjct  21   IDELKRTFATGRTKPYQWRVEQLTALKQLIQENSNAIILALHTDLGKSETESWLTEIGYS  80

Query  358  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFML  516
             A  K  LK LK WMKP  + +   T P  +  +SEPLGV L+I AWNYPF L
Sbjct  81   IADIKGNLKRLKSWMKPTKISTPMITQPGKSYTISEPLGVALIIGAWNYPFQL  133



>gb|EMS62407.1| Aldehyde dehydrogenase family 3 member H1 [Triticum urartu]
Length=450

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +1

Query  268  EHHEKAIMDALFSDLSKPELESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSS  447
            E  E  I DAL +DL+KP +E+++HEI+  K +C  ALK LK WMKP+ V SA  T+PS+
Sbjct  3    EEKEDDISDALHADLAKPRMEAYLHEISLAKGACMFALKGLKNWMKPDKVPSAITTFPST  62

Query  448  AKIVSEPLGVVLVISAWNYPFMLSLD  525
            A+IV EPLGVVLVISAWNYPF+LS++
Sbjct  63   AQIVPEPLGVVLVISAWNYPFLLSIE  88



>ref|WP_002691376.1| hypothetical protein [Treponema denticola]
 gb|EMB23771.1| hypothetical protein HMPREF9723_00909 [Treponema denticola OTK]
Length=457

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 79/123 (64%), Gaps = 0/123 (0%)
 Frame = +1

Query  154  LEMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  333
            +  D    V   R  F   KTKSYE+R+SQL  + ++   ++K +++AL+SDL K E+E 
Sbjct  1    MNQDIETIVKNCRIFFETNKTKSYEFRISQLVKLQEVLNQNKKELLNALYSDLHKTEMEG  60

Query  334  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  513
            F  E A V+   K A+K LK+W+KP+ V ++ A + SS+KI+ EP G VL++S WNYP  
Sbjct  61   FFSEFAIVRGELKFAIKHLKKWIKPKRVPTSIAHFKSSSKIMYEPFGTVLIMSPWNYPLN  120

Query  514  LSL  522
            L+L
Sbjct  121  LTL  123



>ref|WP_002675966.1| aldehyde dehydrogenase [Treponema denticola]
 ref|NP_973110.1| alcohol dehydrogenase [Treponema denticola ATCC 35405]
 gb|AAS13029.1| aldehyde dehydrogenase (NADP) family protein [Treponema denticola 
ATCC 35405]
 gb|EMB37926.1| hypothetical protein HMPREF9721_01175 [Treponema denticola ATCC 
35404]
 gb|EMB39991.1| hypothetical protein HMPREF9735_00655 [Treponema denticola ATCC 
33521]
 gb|EMB47669.1| hypothetical protein HMPREF9729_00609 [Treponema denticola ASLM]
 gb|EMD55872.1| hypothetical protein HMPREF9728_02381 [Treponema denticola US-Trep]
Length=457

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 79/123 (64%), Gaps = 0/123 (0%)
 Frame = +1

Query  154  LEMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  333
            +  D    V   R  F   KTKSYE+R+SQL  + ++   ++K +++AL+SDL K E+E 
Sbjct  1    MNQDIETIVKNCRIFFETNKTKSYEFRISQLLKLQEVLNQNKKELLNALYSDLHKTEMEG  60

Query  334  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  513
            F  E A V+   K A+K LK+W+KP+ V ++ A + SS+KI+ EP G VL++S WNYP  
Sbjct  61   FFSEFAIVRGELKFAIKHLKKWIKPKRVPTSIAHFKSSSKIMYEPFGTVLIMSPWNYPLN  120

Query  514  LSL  522
            L+L
Sbjct  121  LTL  123



>ref|WP_002667397.1| aldehyde dehydrogenase [Treponema denticola]
 gb|EGC77954.1| aldehyde dehydrogenase family protein [Treponema denticola F0402]
Length=457

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 79/123 (64%), Gaps = 0/123 (0%)
 Frame = +1

Query  154  LEMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  333
            +  D    V   R  F   KTKSYE+R+SQL  + ++   ++K +++AL+SDL K E+E 
Sbjct  1    MNQDIETIVKNCRIFFETNKTKSYEFRISQLLKLQEVLNQNKKELLNALYSDLHKTEMEG  60

Query  334  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  513
            F  E A V+   K A+K LK+W+KP+ V ++ A + SS+KI+ EP G VL++S WNYP  
Sbjct  61   FFSEFAIVRGELKFAIKHLKKWIKPKRVPTSIAHFKSSSKIMYEPFGTVLIMSPWNYPLN  120

Query  514  LSL  522
            L+L
Sbjct  121  LTL  123



>gb|AIN92873.1| aldehyde dehydrogenase [Treponema putidum]
Length=457

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 79/123 (64%), Gaps = 0/123 (0%)
 Frame = +1

Query  154  LEMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  333
            +  D    V   R  F   KTKSYE+R+SQL  + ++   ++K +++AL+SDL K E+E 
Sbjct  1    MNQDIETIVKNCRIFFETNKTKSYEFRISQLLKLQEVLNQNKKELLNALYSDLHKTEMEG  60

Query  334  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  513
            F  E A V+   K A+K LK+W+KP+ V ++ A + SS+KI+ EP G VL++S WNYP  
Sbjct  61   FFSEFAIVRGELKFAIKHLKKWIKPKRVPTSIAHFKSSSKIMYEPFGTVLIMSPWNYPLN  120

Query  514  LSL  522
            L+L
Sbjct  121  LTL  123



>ref|WP_010694958.1| hypothetical protein [Treponema denticola]
 gb|EMB25152.1| hypothetical protein HMPREF9733_01214 [Treponema denticola SP33]
 gb|EPF36659.1| hypothetical protein HMPREF9732_00684 [Treponema denticola SP32]
Length=457

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 79/123 (64%), Gaps = 0/123 (0%)
 Frame = +1

Query  154  LEMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  333
            +  D    V   R  F   KTKSYE+R+SQL  + ++   ++K +++AL+SDL K E+E 
Sbjct  1    MNQDIETIVKNCRIFFETNKTKSYEFRISQLLKLQEVLNQNKKELLNALYSDLHKTEMEG  60

Query  334  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  513
            F  E A V+   K A+K LK+W+KP+ V ++ A + SS+KI+ EP G VL++S WNYP  
Sbjct  61   FFSEFAIVRGELKFAIKHLKKWIKPKRVPTSIAHFKSSSKIMYEPFGTVLIMSPWNYPLN  120

Query  514  LSL  522
            L+L
Sbjct  121  LTL  123



>ref|WP_010689581.1| hypothetical protein [Treponema denticola]
 gb|EMB42007.1| hypothetical protein HMPREF9722_00839 [Treponema denticola ATCC 
33520]
Length=457

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 79/123 (64%), Gaps = 0/123 (0%)
 Frame = +1

Query  154  LEMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  333
            +  D    V   R  F   KTKSYE+R+SQL  + ++   ++K +++AL+SDL K E+E 
Sbjct  1    MNQDIETIVKNCRIFFETNKTKSYEFRISQLLKLQEVLNQNKKELLNALYSDLHKTEMEG  60

Query  334  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  513
            F  E A V+   K A+K LK+W+KP+ V ++ A + SS+KI+ EP G VL++S WNYP  
Sbjct  61   FFSEFAIVRGELKFAIKHLKKWIKPKRVPTSIAHFKSSSKIMYEPFGTVLIMSPWNYPLN  120

Query  514  LSL  522
            L+L
Sbjct  121  LTL  123



>emb|CDX72584.1| BnaC07g46060D [Brassica napus]
Length=484

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 78/117 (67%), Gaps = 0/117 (0%)
 Frame = +1

Query  175  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  354
            ++ E+RETFA+G+T+S +WR +QLKA++++ + +E+ + D LF DL K   E+F  E+ F
Sbjct  11   SLREMRETFASGRTRSVKWRKTQLKAIIEMVKDNEEKMCDVLFQDLGKHSTEAFRDELGF  70

Query  355  VKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            V  S   AL  L +W+ P         YP++ K++SEP G VLV+S+WN+P  LSLD
Sbjct  71   VMRSAATALNSLDKWVVPRKSNLPLLFYPATGKVISEPYGTVLVLSSWNFPISLSLD  127



>ref|XP_004142629.1| PREDICTED: LOW QUALITY PROTEIN: aldehyde dehydrogenase family 
3 member H1-like [Cucumis sativus]
Length=462

 Score =   115 bits (288),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 67/88 (76%), Gaps = 3/88 (3%)
 Frame = +1

Query  163  DAAAA---VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  333
            DAAAA   V+ELR  F +G T+SYEWRVSQL+++LK+   HE+ I DAL SDLSKP LES
Sbjct  8    DAAAATDLVNELRAIFNSGNTRSYEWRVSQLESLLKLCVDHEEDICDALRSDLSKPALES  67

Query  334  FVHEIAFVKASCKLALKELKRWMKPENV  417
             +HEI  VK SCKLA+KE+  WMKPE V
Sbjct  68   IIHEIGMVKGSCKLAIKEIGNWMKPEKV  95



>ref|WP_002684196.1| hypothetical protein [Treponema denticola]
 gb|EMB33813.1| hypothetical protein HMPREF9726_01193 [Treponema denticola H-22]
Length=457

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 79/123 (64%), Gaps = 0/123 (0%)
 Frame = +1

Query  154  LEMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELES  333
            +  D    V   R  F   KTKSYE+R+SQL  + ++   ++K +++AL+SDL K E+E 
Sbjct  1    MNKDIETIVKNCRIFFETNKTKSYEFRISQLLKLQEVLNQNKKELLNALYSDLHKTEMEG  60

Query  334  FVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFM  513
            F  E A V+   K A+K LK+W+KP+ V ++ A + SS+KI+ EP G VL++S WNYP  
Sbjct  61   FFSEFAIVRGELKFAIKHLKKWIKPKRVPTSIAHFKSSSKIMYEPFGTVLIMSPWNYPLN  120

Query  514  LSL  522
            L+L
Sbjct  121  LTL  123



>ref|XP_001767194.1| variable substrate [Physcomitrella patens]
 gb|EDQ68115.1| variable substrate [Physcomitrella patens]
Length=485

 Score =   115 bits (287),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 78/122 (64%), Gaps = 0/122 (0%)
 Frame = +1

Query  160  MDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFV  339
            +DAA   S LRETF  G+T+   WR+ QL A++K+ E +E  I  ALF+DL KP  E+  
Sbjct  10   LDAAKVASCLRETFRTGRTRPSNWRLEQLHAIVKLIEENEDEICRALFADLHKPRHEALT  69

Query  340  HEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLS  519
             E   V AS K A+K L +W  P   ++ +  +P+SA I+ EPLGV  VI+ WN+PF+L+
Sbjct  70   MESLVVTASAKHAIKNLNKWRAPVKKETPYIVWPASAFILPEPLGVAFVIAPWNFPFLLA  129

Query  520  LD  525
            +D
Sbjct  130  VD  131



>emb|CDP01945.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   115 bits (287),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 83/119 (70%), Gaps = 0/119 (0%)
 Frame = +1

Query  169  AAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEI  348
            A  ++ELR+TF +GKT+  EWR +QL+A+LK+ + +E +I DAL  DL K  +ES+  E+
Sbjct  8    ARNLAELRQTFRSGKTRGLEWRKAQLRAILKLLDENEDSIFDALQQDLGKHPVESYRDEV  67

Query  349  AFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
              +K S K AL  +++WM P+  +     +P+ A+++ EPLG+VLV+++WN+P  L+LD
Sbjct  68   GVLKKSAKYALASVEKWMAPKKGQMPLLFFPARAEVLPEPLGLVLVLASWNFPISLALD  126



>ref|WP_028953736.1| aldehyde dehydrogenase [Synechococcus sp. CC9616]
Length=459

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 77/119 (65%), Gaps = 1/119 (1%)
 Frame = +1

Query  166  AAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHE  345
            +A+ + ++R+    G+T+S+ WRV QLK + ++ E HE+ +++AL SDL KP  E+F   
Sbjct  4    SASHLEQMRDLVGRGQTRSHAWRVEQLKRLRELVESHEQDVLEALASDLGKPSTEAFFEV  63

Query  346  IAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            +A ++   KL  K L+RWM+P +V    A  P  A +V EPLG VL+I  WNYPF L+L
Sbjct  64   VALLQ-ELKLTDKNLRRWMRPTSVPVPLAQRPGQASVVPEPLGCVLIIGPWNYPFSLTL  121



>ref|XP_009138416.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like isoform 
X2 [Brassica rapa]
Length=472

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 78/117 (67%), Gaps = 0/117 (0%)
 Frame = +1

Query  175  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  354
            ++ E+R+TFA+G+T+S +WR +QL+A++++ + +E  + D LF DL K  +E+F  E+ F
Sbjct  11   SLREMRDTFASGRTRSVKWRKTQLEAIIEMVKDNEDKMCDVLFQDLGKHSIEAFRDELGF  70

Query  355  VKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            V  S   AL  L +W+ P         YP++ K++SEP G VLV+S+WN+P  LSLD
Sbjct  71   VMRSATTALNSLDKWVVPRKSNLPLLFYPATGKVISEPYGTVLVLSSWNFPISLSLD  127



>emb|CDX77447.1| BnaA07g05850D [Brassica napus]
Length=481

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 78/117 (67%), Gaps = 0/117 (0%)
 Frame = +1

Query  175  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  354
            ++ E+RETFA+G+T+S +WR +QL+A++++ + +E  + D LF DL K   E+F  E+ F
Sbjct  8    SLREMRETFASGRTRSVKWRKTQLEAIIEMVKDNEDKMCDVLFQDLGKHSTEAFRDELGF  67

Query  355  VKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            V  S   AL  L +W+ P+        YPS+ K++SEP G VLV+S+WN+P  LSLD
Sbjct  68   VMRSATTALNCLDKWVVPKKSNLPLLFYPSTGKVISEPYGTVLVLSSWNFPISLSLD  124



>ref|XP_009138415.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like isoform 
X1 [Brassica rapa]
Length=484

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 78/117 (67%), Gaps = 0/117 (0%)
 Frame = +1

Query  175  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  354
            ++ E+R+TFA+G+T+S +WR +QL+A++++ + +E  + D LF DL K  +E+F  E+ F
Sbjct  11   SLREMRDTFASGRTRSVKWRKTQLEAIIEMVKDNEDKMCDVLFQDLGKHSIEAFRDELGF  70

Query  355  VKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            V  S   AL  L +W+ P         YP++ K++SEP G VLV+S+WN+P  LSLD
Sbjct  71   VMRSATTALNSLDKWVVPRKSNLPLLFYPATGKVISEPYGTVLVLSSWNFPISLSLD  127



>emb|CDX69216.1| BnaC01g02370D [Brassica napus]
Length=481

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 78/117 (67%), Gaps = 0/117 (0%)
 Frame = +1

Query  175  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  354
            ++ E+RETFA+G+T+S +WR +QL+A++++ + +E  + D LF DL K   E+F  E+ F
Sbjct  8    SLREMRETFASGRTRSVKWRKTQLEAIIEMVKDNEDKMCDVLFQDLGKHSTEAFRDELGF  67

Query  355  VKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            V  S   AL  L +W+ P+        YPS+ K++SEP G VLV+S+WN+P  LSLD
Sbjct  68   VMRSATTALNCLDKWVVPKKSDLPLLFYPSTGKVISEPYGTVLVLSSWNFPISLSLD  124



>ref|XP_001770374.1| variable substrate [Physcomitrella patens]
 gb|EDQ64864.1| variable substrate [Physcomitrella patens]
Length=466

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 79/123 (64%), Gaps = 0/123 (0%)
 Frame = +1

Query  157  EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  336
             +D +   S LR  F  G+T+S +WR+ QL A++K+ E +E+ I  AL +DL KP  E+F
Sbjct  9    RLDTSQVASSLRAAFRTGRTRSVKWRLEQLHAIVKLLEENEEDIYWALDADLRKPRHEAF  68

Query  337  VHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFML  516
            + EI  + AS + ++K L +WM P         +P+SA IV EPLGVV ++S WN+PFML
Sbjct  69   LSEIYTITASARYSIKNLHKWMAPAKKGVPLLAWPASASIVPEPLGVVFIMSPWNFPFML  128

Query  517  SLD  525
            ++D
Sbjct  129  AVD  131



>ref|XP_009109317.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Brassica 
rapa]
Length=494

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 78/117 (67%), Gaps = 0/117 (0%)
 Frame = +1

Query  175  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  354
            ++ E+R+TFA+G+T+S +WR +QL A++++ + +E+ + D LF DL K   E+F  E+ F
Sbjct  17   SLREMRDTFASGRTRSVKWRKAQLGAIIEMVKDNEEKMSDVLFQDLGKHSTEAFRDELGF  76

Query  355  VKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            V  S   AL  L +W+ P N       YP++ K++SEP G VLV+S+WN+P  LSLD
Sbjct  77   VMRSATTALNCLDKWVVPRNSNLPLLFYPATGKVISEPYGTVLVLSSWNFPISLSLD  133



>ref|WP_041246595.1| aldehyde dehydrogenase [Glaciecola nitratireducens]
Length=457

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 73/113 (65%), Gaps = 0/113 (0%)
 Frame = +1

Query  178  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  357
            + EL+ TFA+G+TKSYEWRV QL A+  + E +   I++AL +DL K + E+++ EI + 
Sbjct  9    IDELKRTFASGRTKSYEWRVEQLNALTLLIEENSSDIIEALHADLGKCKTEAWLTEIGYS  68

Query  358  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFML  516
             AS    +K LK WMKP  + +     P  +  ++EPLGV L+I AWNYPF L
Sbjct  69   TASITDTVKRLKSWMKPNKISTPMIAQPGKSYTINEPLGVALIIGAWNYPFQL  121



>gb|AEP28780.1| NAD-dependent aldehyde dehydrogenase [Glaciecola nitratireducens 
FR1064]
Length=469

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 73/113 (65%), Gaps = 0/113 (0%)
 Frame = +1

Query  178  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  357
            + EL+ TFA+G+TKSYEWRV QL A+  + E +   I++AL +DL K + E+++ EI + 
Sbjct  21   IDELKRTFASGRTKSYEWRVEQLNALTLLIEENSSDIIEALHADLGKCKTEAWLTEIGYS  80

Query  358  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFML  516
             AS    +K LK WMKP  + +     P  +  ++EPLGV L+I AWNYPF L
Sbjct  81   TASITDTVKRLKSWMKPNKISTPMIAQPGKSYTINEPLGVALIIGAWNYPFQL  133



>ref|XP_009145598.1| PREDICTED: aldehyde dehydrogenase family 3 member F1 [Brassica 
rapa]
Length=481

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 78/117 (67%), Gaps = 0/117 (0%)
 Frame = +1

Query  175  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  354
            ++ E+R+TFA+G+T+S +WR +QL+A++++ + +E  + D LF DL K   E+F  E+ F
Sbjct  8    SLREMRDTFASGRTRSVKWRKTQLEAIIEMVKDNEDKMCDVLFQDLGKHSTEAFRDELGF  67

Query  355  VKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            V  S   AL  L +W+ P+        YPS+ K++SEP G VLV+S+WN+P  LSLD
Sbjct  68   VMRSATTALNCLDKWVVPKKSNLPLLFYPSTGKVISEPYGTVLVLSSWNFPISLSLD  124



>emb|CDY59717.1| BnaA03g59170D [Brassica napus]
Length=484

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 77/117 (66%), Gaps = 0/117 (0%)
 Frame = +1

Query  175  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  354
            ++ E+R+TFA+G+T+S +WR +QL+A++++ + +E  + D LF DL K   E+F  E+ F
Sbjct  11   SLREMRDTFASGRTRSVKWRKTQLEAIIEMVKDNEDKMCDVLFQDLGKHSTEAFRDELGF  70

Query  355  VKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            V  S   AL  L +W+ P         YP++ K++SEP G VLV+S+WN+P  LSLD
Sbjct  71   VMRSATTALNSLDKWVVPRKSNLPLLFYPATGKVISEPYGTVLVLSSWNFPISLSLD  127



>emb|CDY35463.1| BnaC03g61970D [Brassica napus]
Length=488

 Score =   112 bits (281),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 78/117 (67%), Gaps = 0/117 (0%)
 Frame = +1

Query  175  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  354
            ++ E+RETFA+G+T+S +WR +QL A++++ + +E+ + D LF DL K   E+F  E+ F
Sbjct  11   SLREMRETFASGRTRSVKWRKAQLGAIIEMVKDNEEKMSDVLFQDLGKHSTEAFRDELGF  70

Query  355  VKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            V  S   AL  L +W+ P+        YP++ K++SEP G VLV+S+WN+P  LSLD
Sbjct  71   VMRSATTALNCLDKWVVPKKSNLPLLFYPATGKVISEPYGTVLVLSSWNFPISLSLD  127



>emb|CDY24790.1| BnaA08g15200D [Brassica napus]
Length=488

 Score =   112 bits (281),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 77/117 (66%), Gaps = 0/117 (0%)
 Frame = +1

Query  175  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  354
            ++ E+RETFA+G+T+S +WR +QL A++++ + +E+ + D LF DL K   E+F  E+ F
Sbjct  11   SLREMRETFASGRTRSVKWRKAQLGAIIEMVKDNEEKMSDVLFQDLGKHSTEAFRDELGF  70

Query  355  VKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            V  S   AL  L +W+ P         YP++ K++SEP G VLV+S+WN+P  LSLD
Sbjct  71   VMRSATTALNCLDKWVVPRKSNLPLLFYPATGKVISEPYGTVLVLSSWNFPISLSLD  127



>ref|WP_008182868.1| aldehyde dehydrogenase [Moorea producens]
 gb|EGJ33158.1| NAD-dependent aldehyde dehydrogenase [Moorea producens 3L]
Length=461

 Score =   112 bits (280),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 72/113 (64%), Gaps = 0/113 (0%)
 Frame = +1

Query  178  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  357
            VS LR T+A GKT+S +WR+ QL+ V K+   +E  I +AL +DL K +LE++  EI+++
Sbjct  13   VSRLRNTYATGKTRSLQWRIQQLQQVKKMTLDNEDKIREALLADLGKCQLEAWSAEISYI  72

Query  358  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFML  516
                   +K LK+WMKP  VK+     P  + I  EPLGV L+I AWNYP+ L
Sbjct  73   ATEVDHTIKHLKKWMKPRKVKTPLVAMPGKSYIQPEPLGVALIIGAWNYPWQL  125



>ref|WP_010353711.1| aldehyde dehydrogenase [Streptomyces acidiscabies]
Length=464

 Score =   112 bits (279),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 72/121 (60%), Gaps = 0/121 (0%)
 Frame = +1

Query  160  MDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFV  339
            +DAAA VS L  TFA G+T+   WR  QL+A+  +    +  + DAL +DL K  LES++
Sbjct  9    LDAAATVSRLNATFATGRTRPASWRKEQLRALRALLIDRQTELSDALHADLGKSPLESYL  68

Query  340  HEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLS  519
             E+ FV       L+ L RWM+P  V    +  P+ A+ V EPLG VL++S WNYP  L+
Sbjct  69   TELGFVVNEIDHTLRHLNRWMRPRRVGVPISLAPARARTVREPLGTVLIVSPWNYPLQLA  128

Query  520  L  522
            L
Sbjct  129  L  129



>ref|XP_009610375.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Nicotiana 
tomentosiformis]
Length=152

 Score =   107 bits (267),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 74/118 (63%), Gaps = 0/118 (0%)
 Frame = +1

Query  157  EMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESF  336
            E D  A +  LRETF +GKT+   WR +QLK +L+  E  E  I  AL  DL K ++E++
Sbjct  5    EKDLEAELEVLRETFKSGKTREESWRRTQLKNLLRFLEEKEDDIFKALKQDLGKHQVEAY  64

Query  337  VHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPF  510
              EI  +  S   AL  LK+WM  +  K   A +PSSA++V EPLG+VL+IS+WN+PF
Sbjct  65   RDEIGTLIKSVNYALDGLKQWMCGKKAKLPIAAFPSSAELVPEPLGLVLIISSWNFPF  122



>gb|KFK30260.1| hypothetical protein AALP_AA7G238000 [Arabis alpina]
Length=485

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 76/117 (65%), Gaps = 0/117 (0%)
 Frame = +1

Query  175  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  354
            ++ E+RETFA+G+T+S +WR +QL A++++ + +E  + D LF DL K   E+F  E+ F
Sbjct  11   SLREMRETFASGRTRSVKWRKTQLGAIIEMVKDNEDKLCDVLFQDLGKHSTEAFRDELGF  70

Query  355  VKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            V  S   AL  L +W+ P+        YP+  K++SEP G VLV+S+WN+P  LSLD
Sbjct  71   VIRSATTALNCLDKWVVPKKTSLPLLFYPAKGKVLSEPYGTVLVLSSWNFPISLSLD  127



>ref|WP_038001567.1| aldehyde dehydrogenase [Synechococcus sp. RS9917]
Length=459

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 70/115 (61%), Gaps = 1/115 (1%)
 Frame = +1

Query  178  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  357
            ++ LR+    G T+   WR  QL+A+  + E HE+ I+ AL  DL KPELE  V EI  +
Sbjct  8    LTTLRQAVDRGDTRPEAWRRQQLEAIANLIETHEQEILQALADDLGKPELEGMV-EILAL  66

Query  358  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            +   KL  ++L+RWM+P  V    A  P  A+++ EPLG VL+I  WNYPF L+L
Sbjct  67   RQELKLCRRQLRRWMRPRRVAVPLAQQPGRAEVIREPLGCVLIIGPWNYPFHLTL  121



>ref|XP_004170348.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like, partial 
[Cucumis sativus]
Length=321

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 73/116 (63%), Gaps = 0/116 (0%)
 Frame = +1

Query  178  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  357
            + E RE F +GKTK   WR SQLK + K    +++ I +ALF DL K  +E+F  EI  +
Sbjct  8    LEETREYFKSGKTKEASWRFSQLKGLHKFLNQNQQQIYNALFQDLGKHHVEAFRDEIGNL  67

Query  358  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            + S   AL+ LK WM P   K       +SA++V EPLGVVLVIS+WN+PF LSL+
Sbjct  68   QMSLNFALENLKHWMSPRKAKLPAIAVLNSAEVVPEPLGVVLVISSWNFPFGLSLE  123



>gb|EAQ68197.1| Putative aldehyde dehydrogenase [Synechococcus sp. RS9917]
Length=466

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 70/115 (61%), Gaps = 1/115 (1%)
 Frame = +1

Query  178  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  357
            ++ LR+    G T+   WR  QL+A+  + E HE+ I+ AL  DL KPELE  V EI  +
Sbjct  15   LTTLRQAVDRGDTRPEAWRRQQLEAIANLIETHEQEILQALADDLGKPELEGMV-EILAL  73

Query  358  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            +   KL  ++L+RWM+P  V    A  P  A+++ EPLG VL+I  WNYPF L+L
Sbjct  74   RQELKLCRRQLRRWMRPRRVAVPLAQQPGRAEVIREPLGCVLIIGPWNYPFHLTL  128



>ref|XP_010651247.1| PREDICTED: aldehyde dehydrogenase family 3 member F1 isoform 
X4 [Vitis vinifera]
Length=409

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 74/116 (64%), Gaps = 0/116 (0%)
 Frame = +1

Query  178  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  357
            + ELRE++ +GKTK   WR SQLK +L + +  EK I  AL  DL K   ES+  E+  +
Sbjct  11   LEELRESYRSGKTKEASWRKSQLKGLLTLLKEQEKDIFKALEQDLGKHYAESYRDEVGTL  70

Query  358  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
              S  LAL  LK WM     K   AT+PS+A++  EPLG+VL+IS+WN+PF LSL+
Sbjct  71   TKSVNLALSSLKDWMSSRKAKLPIATFPSTAEVFPEPLGLVLIISSWNFPFGLSLE  126



>ref|WP_012954453.1| aldehyde dehydrogenase [Candidatus Atelocyanobacterium thalassa]
 gb|ADB95766.1| NAD-dependent aldehyde dehydrogenase [Candidatus Atelocyanobacterium 
thalassa isolate ALOHA]
Length=462

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 86/125 (69%), Gaps = 2/125 (2%)
 Frame = +1

Query  148  K*LEMDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPEL  327
            K L++ A   V++ RE F +G+T+S ++R+SQLK + K    H++ I+DA  SDL +P  
Sbjct  4    KTLQVSAKKLVNQQREFFQSGETQSIDFRLSQLKLLRKAILEHQELIIDATKSDLGRPSF  63

Query  328  ESFVHEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYP  507
            E++  EIA + +  KLA+K+LK WM+P  V++    +PS+A I  EPLGVVL+I +WNYP
Sbjct  64   EAYF-EIATL-SEIKLAIKKLKNWMRPHRVQTPLEQFPSTAWIQPEPLGVVLIIGSWNYP  121

Query  508  FMLSL  522
            F L++
Sbjct  122  FQLTI  126



>ref|XP_010651245.1| PREDICTED: aldehyde dehydrogenase family 3 member F1 isoform 
X2 [Vitis vinifera]
Length=425

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 74/116 (64%), Gaps = 0/116 (0%)
 Frame = +1

Query  178  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  357
            + ELRE++ +GKTK   WR SQLK +L + +  EK I  AL  DL K   ES+  E+  +
Sbjct  11   LEELRESYRSGKTKEASWRKSQLKGLLTLLKEQEKDIFKALEQDLGKHYAESYRDEVGTL  70

Query  358  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
              S  LAL  LK WM     K   AT+PS+A++  EPLG+VL+IS+WN+PF LSL+
Sbjct  71   TKSVNLALSSLKDWMSSRKAKLPIATFPSTAEVFPEPLGLVLIISSWNFPFGLSLE  126



>gb|KJB17707.1| hypothetical protein B456_003G011600 [Gossypium raimondii]
Length=327

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 77/117 (66%), Gaps = 0/117 (0%)
 Frame = +1

Query  175  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  354
            +++ELRETF  G TKS  WR SQLKA+L++   +E +I  AL  DL K  +ES+  E+  
Sbjct  4    SIAELRETFKTGGTKSISWRKSQLKALLQLINQNEDSIFKALDQDLGKSPVESYRDEVGV  63

Query  355  VKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            +K S    L  L++W+ P+  +     +P+ A+++ +PLGVVL+ S+WN+PF L+LD
Sbjct  64   LKKSVTYTLSCLEKWVAPKKAEVPLLFFPAKAEVMPQPLGVVLIFSSWNFPFTLALD  120



>ref|XP_010651246.1| PREDICTED: aldehyde dehydrogenase family 3 member F1 isoform 
X3 [Vitis vinifera]
Length=417

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 74/116 (64%), Gaps = 0/116 (0%)
 Frame = +1

Query  178  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  357
            + ELRE++ +GKTK   WR SQLK +L + +  EK I  AL  DL K   ES+  E+  +
Sbjct  11   LEELRESYRSGKTKEASWRKSQLKGLLTLLKEQEKDIFKALEQDLGKHYAESYRDEVGTL  70

Query  358  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
              S  LAL  LK WM     K   AT+PS+A++  EPLG+VL+IS+WN+PF LSL+
Sbjct  71   TKSVNLALSSLKDWMSSRKAKLPIATFPSTAEVFPEPLGLVLIISSWNFPFGLSLE  126



>gb|KJB17709.1| hypothetical protein B456_003G011600 [Gossypium raimondii]
Length=405

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 77/117 (66%), Gaps = 0/117 (0%)
 Frame = +1

Query  175  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  354
            +++ELRETF  G TKS  WR SQLKA+L++   +E +I  AL  DL K  +ES+  E+  
Sbjct  4    SIAELRETFKTGGTKSISWRKSQLKALLQLINQNEDSIFKALDQDLGKSPVESYRDEVGV  63

Query  355  VKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            +K S    L  L++W+ P+  +     +P+ A+++ +PLGVVL+ S+WN+PF L+LD
Sbjct  64   LKKSVTYTLSCLEKWVAPKKAEVPLLFFPAKAEVMPQPLGVVLIFSSWNFPFTLALD  120



>gb|KJB17708.1| hypothetical protein B456_003G011600 [Gossypium raimondii]
Length=406

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 77/117 (66%), Gaps = 0/117 (0%)
 Frame = +1

Query  175  AVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAF  354
            +++ELRETF  G TKS  WR SQLKA+L++   +E +I  AL  DL K  +ES+  E+  
Sbjct  4    SIAELRETFKTGGTKSISWRKSQLKALLQLINQNEDSIFKALDQDLGKSPVESYRDEVGV  63

Query  355  VKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            +K S    L  L++W+ P+  +     +P+ A+++ +PLGVVL+ S+WN+PF L+LD
Sbjct  64   LKKSVTYTLSCLEKWVAPKKAEVPLLFFPAKAEVMPQPLGVVLIFSSWNFPFTLALD  120



>gb|EAZ19830.1| hypothetical protein OsJ_35414 [Oryza sativa Japonica Group]
Length=464

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 75/118 (64%), Gaps = 20/118 (17%)
 Frame = +1

Query  172  AAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIA  351
            A V+ LR  FAAG T+  EWR +QL+ +L++A   E  I                    A
Sbjct  11   AEVAALRGRFAAGGTRGAEWRAAQLRGILRMAAEAEAEI--------------------A  50

Query  352  FVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
             VK+SCK ALK LK+WMKP+ V +   T+PS+A++ +EPLGVVLVISAWNYPF+LS+D
Sbjct  51   LVKSSCKFALKNLKKWMKPQKVTAPLMTFPSTARVAAEPLGVVLVISAWNYPFLLSID  108



>ref|XP_002285466.1| PREDICTED: aldehyde dehydrogenase family 3 member F1 isoform 
X1 [Vitis vinifera]
 emb|CBI16385.3| unnamed protein product [Vitis vinifera]
Length=485

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 74/116 (64%), Gaps = 0/116 (0%)
 Frame = +1

Query  178  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  357
            + ELRE++ +GKTK   WR SQLK +L + +  EK I  AL  DL K   ES+  E+  +
Sbjct  11   LEELRESYRSGKTKEASWRKSQLKGLLTLLKEQEKDIFKALEQDLGKHYAESYRDEVGTL  70

Query  358  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
              S  LAL  LK WM     K   AT+PS+A++  EPLG+VL+IS+WN+PF LSL+
Sbjct  71   TKSVNLALSSLKDWMSSRKAKLPIATFPSTAEVFPEPLGLVLIISSWNFPFGLSLE  126



>ref|WP_015772232.1| aldehyde dehydrogenase [Jonesia denitrificans]
 gb|ACV09604.1| Aldehyde Dehydrogenase [Jonesia denitrificans DSM 20603]
Length=468

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 74/120 (62%), Gaps = 0/120 (0%)
 Frame = +1

Query  163  DAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVH  342
            D A  V  LR+TF AG TK   WR+ QL A+ ++   HEK I +AL SDL KPE E+++ 
Sbjct  8    DIAGTVHGLRDTFRAGTTKPLAWRLRQLDALEQLVSSHEKEIAEALASDLGKPEAEAYLT  67

Query  343  EIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSL  522
            E +F+    +   + L+RW K  +V    A  P++  +++EPLGVVLV++ WNYP  L L
Sbjct  68   ETSFLLTEIRHTRRHLRRWAKARHVAPPAALLPATTSVIAEPLGVVLVMAPWNYPIQLLL  127



>ref|WP_029949165.1| aldehyde dehydrogenase [Parvimonas micra]
Length=453

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 76/121 (63%), Gaps = 0/121 (0%)
 Frame = +1

Query  160  MDAAAAVSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFV  339
            M+  + V + +E F    TKS E+R+S L+ +  + + +EK I+  L +DLSK E E ++
Sbjct  1    MELKSVVEKQKEFFNTDATKSVEYRISMLRKLENVIKENEKQILSTLNNDLSKSEAEGYL  60

Query  340  HEIAFVKASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLS  519
             EI  V    + ALK +K+W KP  V+ +  T+P+ + + SEP GVVL+IS WNYPF LS
Sbjct  61   TEIGIVYGEIREALKNVKKWSKPRRVRGSLGTFPAKSYVYSEPYGVVLIISPWNYPFNLS  120

Query  520  L  522
            L
Sbjct  121  L  121



>ref|XP_002452841.1| hypothetical protein SORBIDRAFT_04g033420 [Sorghum bicolor]
 gb|EES05817.1| hypothetical protein SORBIDRAFT_04g033420 [Sorghum bicolor]
Length=486

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 75/116 (65%), Gaps = 0/116 (0%)
 Frame = +1

Query  178  VSELRETFAAGKTKSYEWRVSQLKAVLKIAEHHEKAIMDALFSDLSKPELESFVHEIAFV  357
            VS+LRE + +G+T+  EWR SQL+ ++++ E  E+AI DAL  DL K  +E+F  E+  +
Sbjct  18   VSDLREVYESGRTQDMEWRQSQLRGLVRLLEDEEEAIFDALHEDLGKHRVEAFRDEVGVL  77

Query  358  KASCKLALKELKRWMKPENVKSAFATYPSSAKIVSEPLGVVLVISAWNYPFMLSLD  525
            K S    L+ LK+W  PE   +    +P++A +V EPLGVVL+ S WN P  L+L+
Sbjct  78   KKSVVDKLQNLKKWAAPEKAHTPLVAFPATALVVPEPLGVVLIFSCWNLPIGLALE  133



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561572122600