BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF040E12

Length=557
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAN66483.1|  hypothetical protein VITISV_015390                     147   1e-37   Vitis vinifera
ref|XP_002267833.2|  PREDICTED: vacuolar-sorting receptor 1             145   2e-37   Vitis vinifera
ref|XP_008244809.1|  PREDICTED: vacuolar-sorting receptor 1-like        142   5e-36   Prunus mume [ume]
gb|KJB71519.1|  hypothetical protein B456_011G126800                    140   1e-35   Gossypium raimondii
gb|KHG14060.1|  Vacuolar-sorting receptor 1 -like protein               140   1e-35   Gossypium arboreum [tree cotton]
gb|KJB71518.1|  hypothetical protein B456_011G126800                    140   1e-35   Gossypium raimondii
ref|XP_011002594.1|  PREDICTED: vacuolar-sorting receptor 1-like        140   1e-35   Populus euphratica
ref|XP_007207200.1|  hypothetical protein PRUPE_ppa002877mg             140   2e-35   Prunus persica
ref|XP_007033523.1|  Vacuolar sorting receptor isoform 3                139   2e-35   
ref|XP_009775401.1|  PREDICTED: vacuolar-sorting receptor 1-like        140   3e-35   Nicotiana sylvestris
ref|XP_007033521.1|  Vacuolar sorting receptor isoform 1                139   3e-35   
gb|KDP21863.1|  hypothetical protein JCGZ_00650                         139   5e-35   Jatropha curcas
emb|CDP06387.1|  unnamed protein product                                139   7e-35   Coffea canephora [robusta coffee]
ref|XP_004302536.1|  PREDICTED: vacuolar-sorting receptor 1-like        138   9e-35   Fragaria vesca subsp. vesca
ref|XP_006341299.1|  PREDICTED: vacuolar-sorting receptor 1 isofo...    136   3e-34   Solanum tuberosum [potatoes]
ref|NP_001275302.1|  vacuolar sorting receptor protein PV72-like ...    137   3e-34   Solanum tuberosum [potatoes]
ref|XP_009611473.1|  PREDICTED: vacuolar-sorting receptor 1-like        137   3e-34   Nicotiana tomentosiformis
ref|XP_006362349.1|  PREDICTED: vacuolar-sorting receptor 1-like        135   1e-33   Solanum tuberosum [potatoes]
ref|XP_008370265.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    135   1e-33   
ref|XP_009611965.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    135   1e-33   Nicotiana tomentosiformis
ref|XP_008370266.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    135   1e-33   
ref|XP_009611966.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    135   1e-33   Nicotiana tomentosiformis
ref|XP_011019003.1|  PREDICTED: vacuolar-sorting receptor 1-like        135   2e-33   Populus euphratica
gb|KDO64109.1|  hypothetical protein CISIN_1g0100101mg                  131   4e-33   Citrus sinensis [apfelsine]
gb|KHG23770.1|  Vacuolar-sorting receptor 1 -like protein               134   5e-33   Gossypium arboreum [tree cotton]
ref|XP_010327706.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    134   5e-33   Solanum lycopersicum
ref|XP_010327707.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    134   6e-33   Solanum lycopersicum
gb|KJB29887.1|  hypothetical protein B456_005G122400                    133   6e-33   Gossypium raimondii
gb|KDO64106.1|  hypothetical protein CISIN_1g0100101mg                  132   7e-33   Citrus sinensis [apfelsine]
gb|KJB29886.1|  hypothetical protein B456_005G122400                    133   7e-33   Gossypium raimondii
gb|KJB29888.1|  hypothetical protein B456_005G122400                    133   7e-33   Gossypium raimondii
gb|KDO64107.1|  hypothetical protein CISIN_1g0100101mg                  132   7e-33   Citrus sinensis [apfelsine]
ref|XP_002528694.1|  Vacuolar sorting receptor 1 precursor, putative    133   9e-33   Ricinus communis
gb|AAN60346.1|  unknown                                                 127   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010253066.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    131   2e-32   Nelumbo nucifera [Indian lotus]
ref|XP_010253065.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    131   3e-32   Nelumbo nucifera [Indian lotus]
ref|XP_006429591.1|  hypothetical protein CICLE_v10011298mg             130   6e-32   Citrus clementina [clementine]
ref|XP_002309184.1|  vacuolar sorting receptor family protein           130   7e-32   Populus trichocarpa [western balsam poplar]
ref|XP_010252051.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    129   1e-31   Nelumbo nucifera [Indian lotus]
ref|XP_009384326.1|  PREDICTED: vacuolar-sorting receptor 1-like        129   2e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004246285.1|  PREDICTED: vacuolar-sorting receptor 1-like        129   3e-31   Solanum lycopersicum
ref|XP_006398566.1|  hypothetical protein EUTSA_v10015537mg             129   3e-31   
ref|XP_008788526.1|  PREDICTED: vacuolar-sorting receptor 1-like        129   3e-31   Phoenix dactylifera
ref|XP_008792241.1|  PREDICTED: vacuolar-sorting receptor 1-like        129   4e-31   Phoenix dactylifera
ref|XP_010093546.1|  Vacuolar-sorting receptor 1                        129   4e-31   Morus notabilis
emb|CDY38157.1|  BnaA07g02260D                                          126   5e-31   Brassica napus [oilseed rape]
gb|EYU42029.1|  hypothetical protein MIMGU_mgv1a002928mg                128   5e-31   Erythranthe guttata [common monkey flower]
gb|KFK24686.1|  hypothetical protein AALP_AA8G011700                    127   8e-31   Arabis alpina [alpine rockcress]
ref|XP_010922756.1|  PREDICTED: vacuolar-sorting receptor 1-like        127   1e-30   
emb|CDY04821.1|  BnaAnng00030D                                          127   1e-30   
pdb|4TJV|A  Chain A, Crystal Structure Of Protease-associated Dom...    120   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010529937.1|  PREDICTED: vacuolar-sorting receptor 1 isofo...    127   2e-30   Tarenaya hassleriana [spider flower]
ref|XP_010529936.1|  PREDICTED: vacuolar-sorting receptor 1 isofo...    127   2e-30   Tarenaya hassleriana [spider flower]
gb|EMT24279.1|  Vacuolar-sorting receptor 1                             126   2e-30   
ref|XP_010414284.1|  PREDICTED: vacuolar-sorting receptor 2             126   2e-30   Camelina sativa [gold-of-pleasure]
ref|XP_009372030.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    126   2e-30   Pyrus x bretschneideri [bai li]
ref|XP_002881098.1|  hypothetical protein ARALYDRAFT_481940             126   2e-30   Arabidopsis lyrata subsp. lyrata
ref|XP_009372028.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    126   3e-30   Pyrus x bretschneideri [bai li]
ref|XP_009801642.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    126   3e-30   Nicotiana sylvestris
ref|XP_010931377.1|  PREDICTED: vacuolar-sorting receptor 1-like        126   3e-30   Elaeis guineensis
gb|EEE52644.1|  hypothetical protein OsJ_35003                          126   3e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009801640.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    126   3e-30   Nicotiana sylvestris
ref|XP_006290748.1|  hypothetical protein CARUB_v10016844mg             126   3e-30   Capsella rubella
ref|XP_010504032.1|  PREDICTED: vacuolar-sorting receptor 1             126   3e-30   Camelina sativa [gold-of-pleasure]
ref|XP_004977384.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    126   3e-30   
ref|XP_010426913.1|  PREDICTED: vacuolar-sorting receptor 1-like        126   3e-30   Camelina sativa [gold-of-pleasure]
gb|EEE51529.1|  hypothetical protein OsJ_32728                          126   3e-30   Oryza sativa Japonica Group [Japonica rice]
gb|EEC67546.1|  hypothetical protein OsI_34875                          126   4e-30   Oryza sativa Indica Group [Indian rice]
gb|EEC68730.1|  hypothetical protein OsI_37233                          125   4e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_006296113.1|  hypothetical protein CARUB_v10025264mg             125   5e-30   
gb|KGN58683.1|  hypothetical protein Csa_3G728010                       124   5e-30   Cucumis sativus [cucumbers]
ref|NP_001065992.1|  Os12g0116000                                       126   6e-30   
tpg|DAA39323.1|  TPA: hypothetical protein ZEAMMB73_720222              125   7e-30   
ref|XP_010543160.1|  PREDICTED: vacuolar-sorting receptor 2             125   7e-30   Tarenaya hassleriana [spider flower]
ref|XP_008669942.1|  PREDICTED: vacuolar-sorting receptor 1-like        125   7e-30   Zea mays [maize]
pir||T00044  vacuolar sorting receptor protein homolog PV72 - cuc...    125   7e-30
gb|KFK34530.1|  hypothetical protein AALP_AA5G158000                    125   9e-30   Arabis alpina [alpine rockcress]
ref|NP_190853.1|  vacuolar-sorting receptor 1                           124   1e-29   Arabidopsis thaliana [mouse-ear cress]
gb|AAB72111.1|  vacuolar sorting receptor homolog                       124   1e-29   Arabidopsis thaliana [mouse-ear cress]
gb|AAK82551.1|  AT3g52850/F8J2_20                                       124   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004137673.1|  PREDICTED: vacuolar-sorting receptor 1-like        124   1e-29   Cucumis sativus [cucumbers]
ref|XP_004978527.1|  PREDICTED: vacuolar-sorting receptor 1-like        124   1e-29   
ref|XP_008442315.1|  PREDICTED: vacuolar-sorting receptor 1             124   2e-29   Cucumis melo [Oriental melon]
dbj|BAK00302.1|  predicted protein                                      124   2e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010510382.1|  PREDICTED: vacuolar-sorting receptor 2-like        124   2e-29   Camelina sativa [gold-of-pleasure]
ref|XP_006403761.1|  hypothetical protein EUTSA_v10010181mg             124   2e-29   Eutrema salsugineum [saltwater cress]
ref|XP_010469873.1|  PREDICTED: vacuolar-sorting receptor 2-like        124   2e-29   Camelina sativa [gold-of-pleasure]
ref|XP_002876170.1|  hypothetical protein ARALYDRAFT_906663             123   3e-29   Arabidopsis lyrata subsp. lyrata
ref|XP_006403762.1|  hypothetical protein EUTSA_v10010181mg             123   4e-29   
ref|XP_002450144.1|  hypothetical protein SORBIDRAFT_05g001160          123   4e-29   Sorghum bicolor [broomcorn]
ref|XP_009410512.1|  PREDICTED: vacuolar-sorting receptor 1             123   4e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009388213.1|  PREDICTED: vacuolar-sorting receptor 1-like        122   5e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_180588.1|  vacuolar-sorting receptor 2                           122   8e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008388357.1|  PREDICTED: vacuolar-sorting receptor 1-like        122   9e-29   
ref|NP_001189637.1|  vacuolar-sorting receptor 2                        122   9e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010515761.1|  PREDICTED: vacuolar-sorting receptor 1-like        122   1e-28   
ref|XP_009125765.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-sor...    122   1e-28   Brassica rapa
emb|CDX78128.1|  BnaA09g33230D                                          121   1e-28   
tpg|DAA39320.1|  TPA: hypothetical protein ZEAMMB73_030788              114   2e-28   
ref|NP_001169650.1|  hypothetical protein precursor                     120   2e-28   
emb|CDY13344.1|  BnaC06g14130D                                          121   2e-28   Brassica napus [oilseed rape]
dbj|BAK03786.1|  predicted protein                                      121   3e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX67539.1|  BnaA07g15790D                                          120   3e-28   
ref|XP_008677615.1|  PREDICTED: uncharacterized protein LOC100383...    120   4e-28   
gb|KHF97360.1|  Vacuolar-sorting receptor 3 -like protein               120   4e-28   Gossypium arboreum [tree cotton]
ref|XP_009125234.1|  PREDICTED: vacuolar-sorting receptor 1-like        120   4e-28   Brassica rapa
gb|EMT19677.1|  Vacuolar-sorting receptor 1                             120   6e-28   
emb|CDX73599.1|  BnaC08g24040D                                          119   6e-28   
ref|XP_003626680.1|  Vacuolar sorting receptor                          119   8e-28   Medicago truncatula
ref|XP_003579018.1|  PREDICTED: vacuolar-sorting receptor 1             119   9e-28   Brachypodium distachyon [annual false brome]
ref|XP_009115984.1|  PREDICTED: vacuolar-sorting receptor 1             119   1e-27   Brassica rapa
ref|XP_004510100.1|  PREDICTED: vacuolar-sorting receptor 1-like        119   2e-27   Cicer arietinum [garbanzo]
ref|XP_011095146.1|  PREDICTED: vacuolar-sorting receptor 1-like        118   2e-27   Sesamum indicum [beniseed]
gb|KJB32253.1|  hypothetical protein B456_005G231800                    117   3e-27   Gossypium raimondii
ref|XP_003521852.1|  PREDICTED: vacuolar-sorting receptor 1-like        117   3e-27   Glycine max [soybeans]
gb|KHN42141.1|  Vacuolar-sorting receptor 2                             117   3e-27   Glycine soja [wild soybean]
ref|XP_004173121.1|  PREDICTED: vacuolar-sorting receptor 3-like        116   4e-27   
ref|XP_006842496.1|  hypothetical protein AMTR_s00077p00095230          117   4e-27   Amborella trichopoda
gb|KJB79450.1|  hypothetical protein B456_013G050300                    117   4e-27   Gossypium raimondii
ref|XP_010043186.1|  PREDICTED: vacuolar-sorting receptor 1-like        117   5e-27   Eucalyptus grandis [rose gum]
ref|XP_003529053.2|  PREDICTED: vacuolar-sorting receptor 1-like        116   9e-27   Glycine max [soybeans]
ref|XP_004152276.1|  PREDICTED: vacuolar-sorting receptor 3-like        116   9e-27   Cucumis sativus [cucumbers]
gb|KJB32254.1|  hypothetical protein B456_005G231800                    116   1e-26   Gossypium raimondii
gb|KJB32252.1|  hypothetical protein B456_005G231800                    116   1e-26   Gossypium raimondii
gb|EEC82690.1|  hypothetical protein OsI_27347                          116   1e-26   Oryza sativa Indica Group [Indian rice]
ref|NP_001060643.1|  Os07g0680000                                       116   1e-26   
gb|EYU35791.1|  hypothetical protein MIMGU_mgv1a002876mg                115   3e-26   Erythranthe guttata [common monkey flower]
ref|XP_011086922.1|  PREDICTED: vacuolar-sorting receptor 1-like        115   3e-26   Sesamum indicum [beniseed]
ref|XP_002527509.1|  zinc finger protein, putative                      114   5e-26   Ricinus communis
ref|XP_006663158.1|  PREDICTED: vacuolar-sorting receptor 1-like        114   5e-26   Oryza brachyantha
gb|KJB12290.1|  hypothetical protein B456_002G010300                    112   1e-25   Gossypium raimondii
gb|AIY30334.1|  vacuolar-sorting receptor 3 protein                     107   2e-25   Ziziphus jujuba [Chinese jujube]
ref|XP_006664280.1|  PREDICTED: vacuolar-sorting receptor 1-like        113   2e-25   Oryza brachyantha
ref|XP_010683480.1|  PREDICTED: vacuolar-sorting receptor 1-like        112   2e-25   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB12295.1|  hypothetical protein B456_002G010300                    110   3e-25   Gossypium raimondii
emb|CDY37219.1|  BnaA09g08400D                                          112   3e-25   Brassica napus [oilseed rape]
ref|XP_009123210.1|  PREDICTED: vacuolar-sorting receptor 3-like        112   3e-25   Brassica rapa
emb|CDX81459.1|  BnaC09g08700D                                          112   3e-25   
ref|XP_006409638.1|  hypothetical protein EUTSA_v10022598mg             112   3e-25   Eutrema salsugineum [saltwater cress]
ref|XP_007134557.1|  hypothetical protein PHAVU_010G057200g             111   6e-25   Phaseolus vulgaris [French bean]
ref|XP_007042634.1|  Vaculolar sorting receptor 3 isoform 2             110   6e-25   
ref|XP_010547949.1|  PREDICTED: vacuolar-sorting receptor 3-like        111   6e-25   Tarenaya hassleriana [spider flower]
gb|KJB12292.1|  hypothetical protein B456_002G010300                    111   8e-25   Gossypium raimondii
gb|KJB12291.1|  hypothetical protein B456_002G010300                    110   9e-25   Gossypium raimondii
gb|KJB12294.1|  hypothetical protein B456_002G010300                    110   1e-24   Gossypium raimondii
ref|NP_001050034.1|  Os03g0335300                                       110   1e-24   
ref|XP_010547948.1|  PREDICTED: vacuolar-sorting receptor 3             109   2e-24   Tarenaya hassleriana [spider flower]
ref|XP_007042633.1|  Vaculolar sorting receptor 3 isoform 1             109   2e-24   Theobroma cacao [chocolate]
gb|EMS62484.1|  Vacuolar-sorting receptor 1                             110   2e-24   Triticum urartu
ref|XP_006650048.1|  PREDICTED: vacuolar-sorting receptor 1-like        109   3e-24   Oryza brachyantha
ref|XP_006409641.1|  hypothetical protein EUTSA_v10022594mg             109   3e-24   Eutrema salsugineum [saltwater cress]
ref|XP_008454393.1|  PREDICTED: vacuolar-sorting receptor 4-like ...    109   4e-24   Cucumis melo [Oriental melon]
ref|XP_008454392.1|  PREDICTED: vacuolar-sorting receptor 4-like ...    109   4e-24   Cucumis melo [Oriental melon]
ref|XP_010488908.1|  PREDICTED: vacuolar-sorting receptor 4             108   4e-24   Camelina sativa [gold-of-pleasure]
gb|KDP44487.1|  hypothetical protein JCGZ_16320                         108   5e-24   Jatropha curcas
gb|KHN05603.1|  Vacuolar-sorting receptor 1                             108   5e-24   Glycine soja [wild soybean]
ref|XP_010488909.1|  PREDICTED: vacuolar-sorting receptor 3             108   5e-24   Camelina sativa [gold-of-pleasure]
ref|XP_003538018.1|  PREDICTED: vacuolar-sorting receptor 1-like        108   5e-24   Glycine max [soybeans]
ref|XP_006658133.1|  PREDICTED: vacuolar-sorting receptor 1-like        108   5e-24   Oryza brachyantha
gb|KFK39977.1|  hypothetical protein AALP_AA3G313900                    108   5e-24   Arabis alpina [alpine rockcress]
ref|XP_006411071.1|  hypothetical protein EUTSA_v10016384mg             108   5e-24   Eutrema salsugineum [saltwater cress]
gb|KFK39979.1|  hypothetical protein AALP_AA3G314200                    108   6e-24   Arabis alpina [alpine rockcress]
ref|NP_179079.1|  vacuolar-sorting receptor 4                           108   6e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006300216.1|  hypothetical protein CARUB_v10016452mg             108   6e-24   Capsella rubella
ref|NP_179081.1|  vacuolar-sorting receptor 3                           108   6e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002885935.1|  VSR-2                                              108   6e-24   
ref|XP_002883854.1|  hypothetical protein ARALYDRAFT_899691             108   7e-24   
ref|XP_009136249.1|  PREDICTED: vacuolar-sorting receptor 3             108   8e-24   Brassica rapa
emb|CDY65441.1|  BnaCnng47180D                                          108   8e-24   Brassica napus [oilseed rape]
ref|XP_006297095.1|  hypothetical protein CARUB_v10013097mg             108   8e-24   
ref|XP_011092498.1|  PREDICTED: vacuolar-sorting receptor 3-like        108   9e-24   Sesamum indicum [beniseed]
gb|KHN30433.1|  Vacuolar-sorting receptor 1                             108   9e-24   Glycine soja [wild soybean]
ref|XP_003517598.2|  PREDICTED: vacuolar-sorting receptor 1-like ...    108   9e-24   Glycine max [soybeans]
emb|CDX91478.1|  BnaC04g06720D                                          107   1e-23   
ref|XP_010517675.1|  PREDICTED: vacuolar-sorting receptor 4-like        107   1e-23   Camelina sativa [gold-of-pleasure]
gb|KEH44022.1|  vacuolar-sorting receptor-like protein                  107   1e-23   Medicago truncatula
ref|XP_010467255.1|  PREDICTED: vacuolar-sorting receptor 4-like        107   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_009143376.1|  PREDICTED: vacuolar-sorting receptor 1-like        107   2e-23   Brassica rapa
gb|ABR17683.1|  unknown                                                 107   2e-23   Picea sitchensis
ref|XP_003623631.1|  Vacuolar sorting receptor                          107   2e-23   Medicago truncatula
ref|XP_010467256.1|  PREDICTED: vacuolar-sorting receptor 3-like        107   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_009598407.1|  PREDICTED: vacuolar-sorting receptor 3-like        107   2e-23   Nicotiana tomentosiformis
ref|XP_009760191.1|  PREDICTED: vacuolar-sorting receptor 3-like        107   2e-23   Nicotiana sylvestris
ref|XP_010039169.1|  PREDICTED: vacuolar-sorting receptor 1-like        102   3e-23   
gb|AES62774.2|  vacuolar-sorting receptor-like protein                  107   3e-23   Medicago truncatula
ref|XP_010687358.1|  PREDICTED: vacuolar-sorting receptor 4-like        107   3e-23   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS73119.1|  hypothetical protein M569_01632                         106   3e-23   Genlisea aurea
emb|CDY60753.1|  BnaA05g34780D                                          106   5e-23   Brassica napus [oilseed rape]
ref|XP_010036004.1|  PREDICTED: vacuolar-sorting receptor 1-like        106   5e-23   Eucalyptus grandis [rose gum]
ref|XP_003592523.1|  Vacuolar-sorting receptor                          105   7e-23   
ref|XP_002313909.1|  vacuolar sorting receptor protein BP-80            105   7e-23   Populus trichocarpa [western balsam poplar]
ref|XP_010517715.1|  PREDICTED: vacuolar-sorting receptor 3-like ...    105   8e-23   Camelina sativa [gold-of-pleasure]
ref|XP_011030346.1|  PREDICTED: vacuolar-sorting receptor 3-like        105   8e-23   Populus euphratica
ref|XP_010517708.1|  PREDICTED: vacuolar-sorting receptor 3-like ...    105   8e-23   Camelina sativa [gold-of-pleasure]
ref|XP_004496877.1|  PREDICTED: vacuolar-sorting receptor 1-like        105   1e-22   Cicer arietinum [garbanzo]
ref|XP_011001937.1|  PREDICTED: vacuolar-sorting receptor 3             105   1e-22   Populus euphratica
gb|EMS51356.1|  Vacuolar-sorting receptor 1                             105   1e-22   Triticum urartu
gb|EPS72005.1|  hypothetical protein M569_02753                         104   1e-22   Genlisea aurea
emb|CDO97275.1|  unnamed protein product                                104   1e-22   Coffea canephora [robusta coffee]
ref|XP_002298772.1|  hypothetical protein POPTR_0001s30160g             104   2e-22   Populus trichocarpa [western balsam poplar]
ref|XP_004492565.1|  PREDICTED: vacuolar-sorting receptor 1-like        104   2e-22   Cicer arietinum [garbanzo]
ref|XP_007157213.1|  hypothetical protein PHAVU_002G052000g             104   2e-22   Phaseolus vulgaris [French bean]
ref|XP_008384516.1|  PREDICTED: vacuolar-sorting receptor 3-like        104   2e-22   
ref|XP_006346308.1|  PREDICTED: vacuolar-sorting receptor 3-like        104   2e-22   Solanum tuberosum [potatoes]
ref|XP_004959891.1|  PREDICTED: vacuolar-sorting receptor 1-like        104   2e-22   
ref|XP_004230700.1|  PREDICTED: vacuolar-sorting receptor 3             104   2e-22   Solanum lycopersicum
gb|EYU37571.1|  hypothetical protein MIMGU_mgv1a002851mg                104   2e-22   Erythranthe guttata [common monkey flower]
ref|XP_008660179.1|  PREDICTED: vacuolar-sorting receptor 1             104   2e-22   
ref|XP_010277061.1|  PREDICTED: vacuolar-sorting receptor 3-like        103   3e-22   Nelumbo nucifera [Indian lotus]
gb|AAB72112.1|  vacuolar sorting receptor homolog                       103   3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010272410.1|  PREDICTED: vacuolar-sorting receptor 3-like        103   4e-22   Nelumbo nucifera [Indian lotus]
ref|XP_007143116.1|  hypothetical protein PHAVU_007G045100g             103   4e-22   Phaseolus vulgaris [French bean]
ref|XP_002467906.1|  hypothetical protein SORBIDRAFT_01g036170          103   4e-22   Sorghum bicolor [broomcorn]
ref|XP_010111675.1|  Vacuolar-sorting receptor 3                        103   5e-22   Morus notabilis
gb|KDO57883.1|  hypothetical protein CISIN_1g006786mg                   101   5e-22   Citrus sinensis [apfelsine]
ref|XP_009375671.1|  PREDICTED: vacuolar-sorting receptor 3-like        102   6e-22   
gb|AGV54776.1|  vacuolar-sorting receptor                               102   7e-22   Phaseolus vulgaris [French bean]
ref|XP_006849341.1|  hypothetical protein AMTR_s00164p00059220          102   7e-22   
emb|CBI32834.3|  unnamed protein product                              97.8    7e-22   Vitis vinifera
ref|XP_009349164.1|  PREDICTED: vacuolar-sorting receptor 3-like        102   7e-22   Pyrus x bretschneideri [bai li]
ref|XP_008348888.1|  PREDICTED: vacuolar-sorting receptor 3-like        102   8e-22   
ref|XP_008236323.1|  PREDICTED: vacuolar-sorting receptor 3             102   1e-21   Prunus mume [ume]
ref|XP_007199755.1|  hypothetical protein PRUPE_ppa002822mg             102   1e-21   Prunus persica
ref|XP_003610620.1|  Vacuolar-sorting receptor                          102   1e-21   
gb|KCW63607.1|  hypothetical protein EUGRSUZ_G01233                     102   1e-21   Eucalyptus grandis [rose gum]
ref|XP_010065899.1|  PREDICTED: vacuolar-sorting receptor 1-like        102   1e-21   Eucalyptus grandis [rose gum]
gb|KHN42313.1|  Vacuolar-sorting receptor 1                             101   2e-21   Glycine soja [wild soybean]
ref|XP_004136938.1|  PREDICTED: vacuolar-sorting receptor 3-like        101   2e-21   Cucumis sativus [cucumbers]
ref|XP_003536576.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    101   2e-21   Glycine max [soybeans]
ref|XP_008455032.1|  PREDICTED: vacuolar-sorting receptor 3-like        101   2e-21   Cucumis melo [Oriental melon]
gb|KHN06808.1|  Vacuolar-sorting receptor 1                             101   2e-21   Glycine soja [wild soybean]
ref|XP_004159916.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-sor...    101   2e-21   
ref|XP_004984466.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    101   3e-21   Setaria italica
ref|XP_004984465.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    101   3e-21   
ref|XP_004984464.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    101   3e-21   
ref|XP_003555992.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    101   3e-21   Glycine max [soybeans]
ref|XP_004984463.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    101   3e-21   
ref|XP_011457866.1|  PREDICTED: vacuolar-sorting receptor 3             100   3e-21   Fragaria vesca subsp. vesca
gb|KDO57886.1|  hypothetical protein CISIN_1g006786mg                   100   3e-21   Citrus sinensis [apfelsine]
ref|XP_011088070.1|  PREDICTED: vacuolar-sorting receptor 3-like        100   3e-21   Sesamum indicum [beniseed]
ref|XP_006422827.1|  hypothetical protein CICLE_v10028015mg             100   5e-21   Citrus clementina [clementine]
dbj|BAK05589.1|  predicted protein                                      100   5e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006486921.1|  PREDICTED: vacuolar-sorting receptor 3-like        100   5e-21   Citrus sinensis [apfelsine]
gb|KDO57885.1|  hypothetical protein CISIN_1g006786mg                   100   5e-21   Citrus sinensis [apfelsine]
gb|KDO57884.1|  hypothetical protein CISIN_1g006786mg                   100   6e-21   Citrus sinensis [apfelsine]
emb|CAN79862.1|  hypothetical protein VITISV_021998                     100   6e-21   Vitis vinifera
ref|XP_004511312.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    100   6e-21   Cicer arietinum [garbanzo]
emb|CBI22461.3|  unnamed protein product                                100   7e-21   Vitis vinifera
ref|XP_002264769.1|  PREDICTED: vacuolar-sorting receptor 3             100   7e-21   Vitis vinifera
ref|XP_004511311.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  99.8    8e-21   
tpg|DAA45229.1|  TPA: hypothetical protein ZEAMMB73_518849            99.4    1e-20   
sp|P93484.1|VSR1_PEA  RecName: Full=Vacuolar-sorting receptor 1; ...  99.4    1e-20   Pisum sativum [garden pea]
tpg|DAA45231.1|  TPA: hypothetical protein ZEAMMB73_518849            94.0    2e-20   
ref|XP_007140077.1|  hypothetical protein PHAVU_008G082200g           98.6    2e-20   Phaseolus vulgaris [French bean]
ref|XP_010233902.1|  PREDICTED: vacuolar-sorting receptor 1-like      98.2    3e-20   Brachypodium distachyon [annual false brome]
ref|XP_003534638.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  98.2    3e-20   Glycine max [soybeans]
dbj|BAB64531.1|  vacuolar sorting receptor                            97.8    3e-20   Vigna mungo [urad dal]
ref|XP_003552313.1|  PREDICTED: vacuolar-sorting receptor 1-like      97.8    3e-20   Glycine max [soybeans]
tpg|DAA45230.1|  TPA: hypothetical protein ZEAMMB73_518849            95.9    3e-20   
gb|KHN40635.1|  Vacuolar-sorting receptor 1                           97.8    4e-20   Glycine soja [wild soybean]
ref|XP_002967764.1|  hypothetical protein SELMODRAFT_169577           96.7    9e-20   Selaginella moellendorffii
ref|XP_002992389.1|  hypothetical protein SELMODRAFT_269926           96.7    9e-20   
gb|AAF80450.1|AF161719_1  vacuolar targeting receptor bp-80           96.7    9e-20   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001169232.1|  hypothetical protein precursor                   96.3    1e-19   Zea mays [maize]
ref|XP_008655380.1|  PREDICTED: vacuolar-sorting receptor 1-like      94.7    2e-19   
ref|XP_010228654.1|  PREDICTED: vacuolar-sorting receptor 1-like      95.9    2e-19   Brachypodium distachyon [annual false brome]
gb|EMT18407.1|  Vacuolar-sorting receptor 1                           95.5    2e-19   
gb|EEC66779.1|  hypothetical protein OsI_33169                        91.7    4e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_002463394.1|  hypothetical protein SORBIDRAFT_02g043010        94.4    6e-19   Sorghum bicolor [broomcorn]
gb|KJB38063.1|  hypothetical protein B456_006G235500                  92.4    2e-18   Gossypium raimondii
gb|EPS57970.1|  hypothetical protein M569_16845                       92.0    4e-18   Genlisea aurea
gb|EMT28756.1|  hypothetical protein F775_27608                       87.0    5e-18   
ref|XP_008787225.1|  PREDICTED: vacuolar-sorting receptor 3-like      90.9    8e-18   
ref|XP_010938945.1|  PREDICTED: vacuolar-sorting receptor 3-like      90.5    1e-17   Elaeis guineensis
ref|XP_002968618.1|  hypothetical protein SELMODRAFT_440462           90.5    2e-17   Selaginella moellendorffii
ref|XP_002975863.1|  hypothetical protein SELMODRAFT_175218           90.5    2e-17   
ref|XP_010942821.1|  PREDICTED: vacuolar-sorting receptor 1-like      90.5    2e-17   Elaeis guineensis
ref|XP_006661708.1|  PREDICTED: vacuolar-sorting receptor 3-like      90.1    2e-17   Oryza brachyantha
gb|AAN05373.1|  Putative vacuolar sorting receptor protein            89.7    2e-17   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001064400.1|  Os10g0346600                                     89.7    2e-17   
ref|XP_002489190.1|  hypothetical protein SORBIDRAFT_0013s004040      86.3    3e-17   
gb|KHN42446.1|  Vacuolar-sorting receptor 4                           84.0    3e-17   
gb|ACG44286.1|  vacuolar sorting receptor 3 precursor                 88.6    6e-17   
ref|NP_001130741.1|  uncharacterized protein LOC100191845 precursor   87.8    1e-16   
gb|AFW68896.1|  hypothetical protein ZEAMMB73_054159                  87.4    1e-16   
ref|XP_003573873.1|  PREDICTED: vacuolar-sorting receptor 1-like      87.4    2e-16   
gb|AFW68894.1|  hypothetical protein ZEAMMB73_054159                  87.0    2e-16   
gb|AFW68895.1|  hypothetical protein ZEAMMB73_054159                  87.0    2e-16   
gb|ACN30885.1|  unknown                                               87.0    2e-16   
ref|XP_008805693.1|  PREDICTED: vacuolar-sorting receptor 3-like      86.7    3e-16   
gb|EMS45035.1|  hypothetical protein TRIUR3_18121                     81.6    4e-16   
gb|ABR17707.1|  unknown                                               85.5    7e-16   
gb|EMT00254.1|  hypothetical protein F775_19349                       80.1    9e-16   
ref|XP_009421105.1|  PREDICTED: vacuolar-sorting receptor 3-like      85.1    1e-15   
ref|XP_004983263.1|  PREDICTED: vacuolar-sorting receptor 3-like      83.6    3e-15   
ref|XP_009404782.1|  PREDICTED: vacuolar-sorting receptor 4-like      83.6    3e-15   
gb|EAZ37923.1|  hypothetical protein OsJ_22274                        77.8    6e-15   
gb|EMS67136.1|  hypothetical protein TRIUR3_12943                     81.6    1e-14   
ref|XP_009387954.1|  PREDICTED: vacuolar-sorting receptor 6-like ...  79.7    5e-14   
ref|XP_009387953.1|  PREDICTED: vacuolar-sorting receptor 6-like ...  79.7    6e-14   
ref|XP_002536854.1|  hypothetical protein RCOM_1789310                74.3    9e-14   
ref|XP_001751750.1|  predicted protein                                79.0    1e-13   
ref|XP_009616647.1|  PREDICTED: vacuolar-sorting receptor 6-like      78.6    1e-13   
ref|XP_006853456.1|  hypothetical protein AMTR_s00032p00189440        78.2    2e-13   
ref|XP_001759820.1|  predicted protein                                78.2    2e-13   
ref|XP_009794444.1|  PREDICTED: vacuolar-sorting receptor 6-like      77.8    3e-13   
gb|EEC81131.1|  hypothetical protein OsI_24020                        77.4    3e-13   
gb|AFW87686.1|  vacuolar sorting receptor 7                           77.4    4e-13   
ref|NP_001058298.1|  Os06g0664300                                     77.4    4e-13   
ref|XP_010684292.1|  PREDICTED: vacuolar-sorting receptor 7-like      77.4    4e-13   
gb|ACN28195.1|  unknown                                               77.4    4e-13   
ref|NP_001152485.1|  vacuolar sorting receptor 7 precursor            77.0    5e-13   
ref|XP_002437414.1|  hypothetical protein SORBIDRAFT_10g026544        77.0    5e-13   
ref|XP_006363163.1|  PREDICTED: vacuolar-sorting receptor 6-like      77.0    5e-13   
ref|XP_004965628.1|  PREDICTED: vacuolar-sorting receptor 6-like ...  77.0    6e-13   
ref|XP_004965629.1|  PREDICTED: vacuolar-sorting receptor 6-like ...  76.6    6e-13   
gb|KDO77204.1|  hypothetical protein CISIN_1g0067882mg                75.9    7e-13   
gb|AFW68893.1|  hypothetical protein ZEAMMB73_054159                  76.6    7e-13   
emb|CBI27239.3|  unnamed protein product                              77.0    8e-13   
gb|KDO77203.1|  hypothetical protein CISIN_1g0067882mg                75.1    1e-12   
ref|XP_001759928.1|  predicted protein                                75.5    1e-12   
ref|XP_001785165.1|  predicted protein                                75.5    2e-12   
gb|KDO77202.1|  hypothetical protein CISIN_1g0067882mg                74.7    2e-12   
ref|XP_001776090.1|  predicted protein                                75.1    2e-12   
gb|AES73268.2|  vacuolar sorting receptor protein, putative           69.3    3e-12   
gb|AFK35926.1|  unknown                                               71.6    3e-12   
ref|XP_006448592.1|  hypothetical protein CICLE_v10014573mg           74.3    4e-12   
ref|XP_006448589.1|  hypothetical protein CICLE_v10014573mg           74.3    4e-12   
ref|XP_011008227.1|  PREDICTED: vacuolar-sorting receptor 6-like      74.3    4e-12   
ref|XP_006448590.1|  hypothetical protein CICLE_v10014573mg           74.3    5e-12   
ref|XP_006468586.1|  PREDICTED: vacuolar-sorting receptor 6-like      74.3    5e-12   
ref|XP_004232618.1|  PREDICTED: vacuolar-sorting receptor 6-like      74.3    5e-12   
gb|KDO77200.1|  hypothetical protein CISIN_1g0067882mg                73.9    6e-12   
gb|EMT30552.1|  hypothetical protein F775_21497                       73.2    9e-12   
ref|XP_007040993.1|  Vacuolar sorting receptor 7                      72.8    1e-11   
ref|XP_003603017.1|  Vacuolar sorting receptor                        68.2    1e-11   
ref|XP_002275462.3|  PREDICTED: vacuolar-sorting receptor 6-like      72.8    1e-11   
ref|XP_001765481.1|  predicted protein                                72.4    2e-11   
dbj|BAJ91572.1|  predicted protein                                    72.4    2e-11   
emb|CDP18160.1|  unnamed protein product                              72.0    2e-11   
dbj|BAJ97179.1|  predicted protein                                    72.0    2e-11   
ref|XP_002297915.2|  hypothetical protein POPTR_0001s12220g           72.0    2e-11   
ref|XP_009408244.1|  PREDICTED: vacuolar-sorting receptor 7           72.0    3e-11   
ref|XP_010260770.1|  PREDICTED: vacuolar-sorting receptor 7           71.2    4e-11   
ref|XP_006656342.1|  PREDICTED: vacuolar-sorting receptor 6-like      70.9    5e-11   
ref|XP_001777810.1|  predicted protein                                70.9    6e-11   
ref|XP_008372129.1|  PREDICTED: vacuolar-sorting receptor 7-like      68.2    7e-11   
ref|XP_010914289.1|  PREDICTED: vacuolar-sorting receptor 6           70.5    8e-11   
emb|CDX93144.1|  BnaA03g38660D                                        70.1    1e-10   
ref|XP_009340258.1|  PREDICTED: vacuolar-sorting receptor 6-like      70.1    1e-10   
ref|XP_011096860.1|  PREDICTED: vacuolar-sorting receptor 6           69.7    1e-10   
ref|XP_009363270.1|  PREDICTED: vacuolar-sorting receptor 6-like      69.3    2e-10   
gb|KEH37345.1|  vacuolar-sorting receptor                             68.9    2e-10   
gb|KDP43132.1|  hypothetical protein JCGZ_26665                       68.9    3e-10   
ref|XP_008802338.1|  PREDICTED: vacuolar-sorting receptor 6-like      68.9    3e-10   
dbj|BAK00261.1|  predicted protein                                    68.9    3e-10   
ref|XP_002447079.1|  hypothetical protein SORBIDRAFT_06g028180        68.2    4e-10   
ref|XP_008383256.1|  PREDICTED: vacuolar-sorting receptor 6-like      68.2    5e-10   
ref|XP_010537030.1|  PREDICTED: vacuolar-sorting receptor 7           67.8    6e-10   
gb|KJB48042.1|  hypothetical protein B456_008G051500                  67.4    6e-10   
ref|XP_008225932.1|  PREDICTED: vacuolar-sorting receptor 7           67.8    7e-10   
ref|XP_004293795.1|  PREDICTED: vacuolar-sorting receptor 6           67.4    8e-10   
ref|XP_002304606.1|  vacuolar sorting receptor family protein         67.4    8e-10   
ref|XP_008371928.1|  PREDICTED: vacuolar-sorting receptor 6-like      67.4    8e-10   
ref|XP_010941716.1|  PREDICTED: vacuolar-sorting receptor 6-like ...  67.0    9e-10   
gb|KJB48040.1|  hypothetical protein B456_008G051500                  67.0    9e-10   
gb|KJB48041.1|  hypothetical protein B456_008G051500                  67.0    1e-09   
gb|EYU43627.1|  hypothetical protein MIMGU_mgv1a002747mg              67.0    1e-09   
dbj|BAJ88964.1|  predicted protein                                    67.0    1e-09   
ref|XP_010941715.1|  PREDICTED: vacuolar-sorting receptor 6-like ...  66.6    1e-09   
gb|KHG13712.1|  Vacuolar-sorting receptor 6 -like protein             66.6    1e-09   
ref|XP_008805925.1|  PREDICTED: vacuolar-sorting receptor 6-like ...  66.2    2e-09   
ref|XP_004487890.1|  PREDICTED: vacuolar-sorting receptor 6-like      66.2    2e-09   
gb|AEW09228.1|  hypothetical protein UMN_755_01                       61.2    2e-09   
gb|EEE61664.1|  hypothetical protein OsJ_16123                        66.2    2e-09   
ref|XP_003563336.1|  PREDICTED: vacuolar-sorting receptor 6           66.2    2e-09   
emb|CAE03573.2|  OSJNBa0085I10.18                                     65.9    2e-09   
ref|XP_007212810.1|  hypothetical protein PRUPE_ppa002849mg           65.9    3e-09   
ref|XP_009368555.1|  PREDICTED: vacuolar-sorting receptor 7-like      65.9    3e-09   
ref|NP_001053838.1|  Os04g0611400                                     65.9    3e-09   
gb|KFK41675.1|  hypothetical protein AALP_AA2G158300                  65.5    3e-09   
ref|XP_009393260.1|  PREDICTED: vacuolar-sorting receptor 6           65.1    5e-09   
ref|XP_007138862.1|  hypothetical protein PHAVU_009G243800g           64.7    5e-09   
ref|XP_005848603.1|  hypothetical protein CHLNCDRAFT_144100           64.7    6e-09   
emb|CDY43178.1|  BnaCnng11060D                                        64.7    6e-09   
gb|AFG69854.1|  hypothetical protein UMN_755_01                       59.7    7e-09   
ref|XP_011022310.1|  PREDICTED: vacuolar-sorting receptor 6           64.3    7e-09   
gb|KCW75576.1|  hypothetical protein EUGRSUZ_E04321                   63.9    8e-09   
emb|CDY02347.1|  BnaA09g25550D                                        63.9    9e-09   
ref|XP_009115026.1|  PREDICTED: vacuolar-sorting receptor 6           63.9    1e-08   
gb|EYU23258.1|  hypothetical protein MIMGU_mgv1a0227552mg             62.0    1e-08   
gb|AAF98196.1|AC000107_19  F17F8.23                                   63.9    1e-08   
ref|XP_003546387.1|  PREDICTED: vacuolar-sorting receptor 6-like      63.5    1e-08   
ref|XP_002890913.1|  hypothetical protein ARALYDRAFT_313733           63.5    1e-08   
ref|NP_174375.1|  vacuolar sorting receptor 6                         63.5    1e-08   
gb|KCW75573.1|  hypothetical protein EUGRSUZ_E04321                   63.5    1e-08   
ref|XP_010058066.1|  PREDICTED: vacuolar-sorting receptor 6           63.2    2e-08   
ref|XP_004976775.1|  PREDICTED: vacuolar-sorting receptor 6-like      62.8    2e-08   
ref|XP_009133482.1|  PREDICTED: vacuolar-sorting receptor 7           62.8    3e-08   
ref|XP_006306993.1|  hypothetical protein CARUB_v10008569mg           62.8    3e-08   
emb|CDX78975.1|  BnaA01g10420D                                        62.8    3e-08   
emb|CDY50060.1|  BnaCnng18670D                                        62.8    3e-08   
ref|NP_001190777.1|  vacuolar-sorting receptor 7                      62.0    4e-08   
gb|AAM96969.1|  vacuolar sorting receptor-like protein                62.0    4e-08   
ref|XP_010100622.1|  Vacuolar-sorting receptor 6                      62.0    5e-08   
emb|CAA16619.1|  vacuolar sorting receptor-like protein               62.0    5e-08   
ref|NP_193744.1|  vacuolar-sorting receptor 7                         62.0    5e-08   
ref|XP_006415395.1|  hypothetical protein EUTSA_v10007059mg           61.6    5e-08   
ref|XP_010499644.1|  PREDICTED: vacuolar-sorting receptor 6-like      61.6    6e-08   
ref|XP_010460907.1|  PREDICTED: vacuolar-sorting receptor 6-like      61.6    6e-08   
ref|XP_010478532.1|  PREDICTED: vacuolar-sorting receptor 6           61.2    7e-08   
ref|XP_003534862.1|  PREDICTED: vacuolar-sorting receptor 6-like      61.2    8e-08   
ref|XP_003581645.1|  PREDICTED: vacuolar-sorting receptor 7-like      60.8    9e-08   
ref|XP_008439432.1|  PREDICTED: vacuolar-sorting receptor 6-like ...  60.8    1e-07   
ref|XP_008439431.1|  PREDICTED: vacuolar-sorting receptor 6-like ...  60.8    1e-07   
ref|XP_004134519.1|  PREDICTED: vacuolar-sorting receptor 6-like      60.5    1e-07   
ref|XP_006413899.1|  hypothetical protein EUTSA_v10024676mg           60.5    1e-07   
ref|XP_002869948.1|  hypothetical protein ARALYDRAFT_492857           60.5    1e-07   
gb|KFK28654.1|  hypothetical protein AALP_AA7G027800                  60.5    1e-07   
ref|XP_003064631.1|  predicted protein                                60.5    2e-07   
ref|XP_010439615.1|  PREDICTED: vacuolar-sorting receptor 7-like      60.1    2e-07   
ref|XP_010434318.1|  PREDICTED: vacuolar-sorting receptor 7           60.1    2e-07   
ref|XP_010449220.1|  PREDICTED: vacuolar-sorting receptor 7-like      60.1    2e-07   
ref|XP_005643138.1|  hypothetical protein COCSUDRAFT_26335            59.7    3e-07   
ref|XP_007513418.1|  predicted protein                                58.5    6e-07   
ref|XP_003057973.1|  predicted protein                                57.4    2e-06   
gb|EMT02959.1|  Vacuolar-sorting receptor 4                           55.1    7e-06   
ref|XP_010509684.1|  PREDICTED: vacuolar-sorting receptor 5           55.1    7e-06   
ref|XP_011401748.1|  Vacuolar-sorting receptor 1                      55.1    8e-06   
ref|XP_006653756.1|  PREDICTED: vacuolar-sorting receptor 6-like      54.7    9e-06   
ref|XP_010516663.1|  PREDICTED: vacuolar-sorting receptor 5-like      54.7    1e-05   
ref|NP_181040.1|  vacuolar-sorting receptor 5                         54.7    1e-05   
ref|XP_002501193.1|  predicted protein                                54.3    1e-05   
ref|XP_010504984.1|  PREDICTED: vacuolar-sorting receptor 5-like ...  53.9    2e-05   
ref|XP_010504983.1|  PREDICTED: vacuolar-sorting receptor 5-like ...  53.9    2e-05   
ref|XP_010519023.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-sor...  53.9    2e-05   
gb|EMS63262.1|  Vacuolar-sorting receptor 1                           53.9    2e-05   
ref|XP_006295863.1|  hypothetical protein CARUB_v10024993mg           52.0    7e-05   
ref|XP_006283299.1|  hypothetical protein CARUB_v10004337mg           52.0    8e-05   
ref|XP_002879526.1|  hypothetical protein ARALYDRAFT_321210           52.0    8e-05   
ref|XP_009141412.1|  PREDICTED: vacuolar-sorting receptor 5           51.2    1e-04   
emb|CDY64650.1|  BnaAnng19540D                                        50.4    2e-04   
ref|XP_002323673.2|  hypothetical protein POPTR_0016s14450g           47.4    2e-04   
ref|XP_006387140.1|  hypothetical protein POPTR_1723s00200g           47.4    3e-04   
gb|ACS91931.1|  vacuolar sorting receptor protein                     50.1    3e-04   
ref|XP_005848848.1|  hypothetical protein CHLNCDRAFT_144184           49.3    6e-04   
emb|CDY43647.1|  BnaA04g20440D                                        49.3    6e-04   



>emb|CAN66483.1| hypothetical protein VITISV_015390 [Vitis vinifera]
Length=625

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 80/83 (96%), Gaps = 1/83 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            LGL+VC+ WF+L GSC+GRFVVEKNSL+VTSPES+KD+YECAIGNFG+PQYGG+MVGTVV
Sbjct  5    LGLLVCV-WFVLWGSCVGRFVVEKNSLRVTSPESLKDVYECAIGNFGVPQYGGTMVGTVV  63

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPKANQKACKSF+D ++SFKSKP
Sbjct  64   YPKANQKACKSFEDVEISFKSKP  86



>ref|XP_002267833.2| PREDICTED: vacuolar-sorting receptor 1 [Vitis vinifera]
 emb|CBI18031.3| unnamed protein product [Vitis vinifera]
Length=624

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 80/83 (96%), Gaps = 1/83 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            LGL+VC+ WF+L GSC+GRFVVEKNSL+VTSPES+KD+YECAIGNFG+PQYGG+MVGTVV
Sbjct  5    LGLLVCV-WFVLWGSCVGRFVVEKNSLRVTSPESLKDVYECAIGNFGVPQYGGTMVGTVV  63

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPKANQKACKSF+D ++SFKSKP
Sbjct  64   YPKANQKACKSFEDVEISFKSKP  86



>ref|XP_008244809.1| PREDICTED: vacuolar-sorting receptor 1-like [Prunus mume]
Length=622

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 76/83 (92%), Gaps = 1/83 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            LG +V  +WFLLCG C+GRFVVEKNSLKVTSP S+K +YECAIGNFG+PQYGG++VGTV 
Sbjct  5    LGFLV-GVWFLLCGVCVGRFVVEKNSLKVTSPSSLKSVYECAIGNFGVPQYGGTLVGTVY  63

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPKANQKACKSFDDFDVSFKSKP
Sbjct  64   YPKANQKACKSFDDFDVSFKSKP  86



>gb|KJB71519.1| hypothetical protein B456_011G126800 [Gossypium raimondii]
 gb|KJB71520.1| hypothetical protein B456_011G126800 [Gossypium raimondii]
Length=621

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 75/81 (93%), Gaps = 1/81 (1%)
 Frame = +1

Query  313  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  492
             ++C+ W LL G+CLGRFVVEKNSLKVTSPESIK +YECAIGNFG+PQYGG++VGTVVYP
Sbjct  7    FLICM-WVLLVGNCLGRFVVEKNSLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYP  65

Query  493  KANQKACKSFDDFDVSFKSKP  555
            KANQ ACKSFDDFD+SFKSKP
Sbjct  66   KANQGACKSFDDFDISFKSKP  86



>gb|KHG14060.1| Vacuolar-sorting receptor 1 -like protein [Gossypium arboreum]
Length=621

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 75/81 (93%), Gaps = 1/81 (1%)
 Frame = +1

Query  313  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  492
             ++C+ W LL G+CLGRFVVEKNSLKVTSPESIK +YECAIGNFG+PQYGG++VGTVVYP
Sbjct  7    FLICM-WVLLVGNCLGRFVVEKNSLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYP  65

Query  493  KANQKACKSFDDFDVSFKSKP  555
            KANQ ACKSFDDFD+SFKSKP
Sbjct  66   KANQGACKSFDDFDISFKSKP  86



>gb|KJB71518.1| hypothetical protein B456_011G126800 [Gossypium raimondii]
Length=569

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 75/81 (93%), Gaps = 1/81 (1%)
 Frame = +1

Query  313  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  492
             ++C+ W LL G+CLGRFVVEKNSLKVTSPESIK +YECAIGNFG+PQYGG++VGTVVYP
Sbjct  7    FLICM-WVLLVGNCLGRFVVEKNSLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYP  65

Query  493  KANQKACKSFDDFDVSFKSKP  555
            KANQ ACKSFDDFD+SFKSKP
Sbjct  66   KANQGACKSFDDFDISFKSKP  86



>ref|XP_011002594.1| PREDICTED: vacuolar-sorting receptor 1-like [Populus euphratica]
Length=625

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 76/83 (92%), Gaps = 1/83 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            LG +VC+ WFLLCG C GRFVVEKNSLK+TSPES+K +YECAIGNFG+PQYGG++VGTVV
Sbjct  5    LGFLVCV-WFLLCGFCFGRFVVEKNSLKLTSPESLKGVYECAIGNFGVPQYGGTLVGTVV  63

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPKANQKACK FD+ D+SFKS+P
Sbjct  64   YPKANQKACKGFDEVDISFKSRP  86



>ref|XP_007207200.1| hypothetical protein PRUPE_ppa002877mg [Prunus persica]
 gb|EMJ08399.1| hypothetical protein PRUPE_ppa002877mg [Prunus persica]
Length=625

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 75/83 (90%), Gaps = 1/83 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            LG +V  +WFLLCG C+GRFVVEKNSLKVTSP S+K +YECAIGNFG+PQYGG++VGTV 
Sbjct  5    LGFLV-GVWFLLCGVCVGRFVVEKNSLKVTSPSSLKSVYECAIGNFGVPQYGGTLVGTVY  63

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPKANQKACK FDDFDVSFKSKP
Sbjct  64   YPKANQKACKGFDDFDVSFKSKP  86



>ref|XP_007033523.1| Vacuolar sorting receptor isoform 3 [Theobroma cacao]
 gb|EOY04449.1| Vacuolar sorting receptor isoform 3 [Theobroma cacao]
Length=515

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 75/83 (90%), Gaps = 1/83 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
             G ++C+ W LL G+CLGRFVVEKNSLKVTSPESIK +YECAIGNFG+PQYGG++VGTVV
Sbjct  5    FGFLICV-WILLWGNCLGRFVVEKNSLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVV  63

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPKANQ ACK FDDFD+SFKSKP
Sbjct  64   YPKANQGACKIFDDFDISFKSKP  86



>ref|XP_009775401.1| PREDICTED: vacuolar-sorting receptor 1-like [Nicotiana sylvestris]
Length=623

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 77/83 (93%), Gaps = 1/83 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            LG +VC+L  +LCGSCLGRFVVEKNSL+VTSP SIKD+YECAIGNFG+PQYGG+MVG V+
Sbjct  5    LGFLVCIL-CVLCGSCLGRFVVEKNSLRVTSPSSIKDVYECAIGNFGVPQYGGTMVGIVM  63

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPKANQK+CK+F DFD+SFKSKP
Sbjct  64   YPKANQKSCKNFADFDISFKSKP  86



>ref|XP_007033521.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
 ref|XP_007033522.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
 gb|EOY04447.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
 gb|EOY04448.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
Length=621

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 75/83 (90%), Gaps = 1/83 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
             G ++C+ W LL G+CLGRFVVEKNSLKVTSPESIK +YECAIGNFG+PQYGG++VGTVV
Sbjct  5    FGFLICV-WILLWGNCLGRFVVEKNSLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVV  63

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPKANQ ACK FDDFD+SFKSKP
Sbjct  64   YPKANQGACKIFDDFDISFKSKP  86



>gb|KDP21863.1| hypothetical protein JCGZ_00650 [Jatropha curcas]
Length=622

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 75/83 (90%), Gaps = 1/83 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            LG +V  +WFLLCGSC GRFVVEKNSLKVTSP+S++ +YECAIGNFG+PQYGG++VGTVV
Sbjct  5    LGFLV-FVWFLLCGSCFGRFVVEKNSLKVTSPDSVRGIYECAIGNFGVPQYGGTLVGTVV  63

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPKANQKACK FD+ D SFKSKP
Sbjct  64   YPKANQKACKEFDEADGSFKSKP  86



>emb|CDP06387.1| unnamed protein product [Coffea canephora]
Length=628

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 76/82 (93%), Gaps = 1/82 (1%)
 Frame = +1

Query  313  LIVCLLWFL-LCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVY  489
            L+V LLWFL L GSC GRFVVEKNSLK+TSP+S+K +YECAIGNFG+PQYGG+M+GTVVY
Sbjct  9    LVVYLLWFLFLLGSCSGRFVVEKNSLKITSPDSLKRVYECAIGNFGVPQYGGTMIGTVVY  68

Query  490  PKANQKACKSFDDFDVSFKSKP  555
            PKA+QKACKSFDD D+SFKSKP
Sbjct  69   PKADQKACKSFDDVDISFKSKP  90



>ref|XP_004302536.1| PREDICTED: vacuolar-sorting receptor 1-like [Fragaria vesca subsp. 
vesca]
Length=625

 Score =   138 bits (348),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 76/83 (92%), Gaps = 1/83 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            +G +V + WFLLCG C+GRFVVEKNSLKVTSP S+K++YECAIGNFG+PQYGG++VGTV 
Sbjct  5    IGFLVSV-WFLLCGFCVGRFVVEKNSLKVTSPNSLKNVYECAIGNFGVPQYGGTLVGTVF  63

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPKANQKACK F+DFD+SFKSKP
Sbjct  64   YPKANQKACKGFEDFDISFKSKP  86



>ref|XP_006341299.1| PREDICTED: vacuolar-sorting receptor 1 isoform X2 [Solanum tuberosum]
Length=578

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 76/83 (92%), Gaps = 1/83 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            +G +VC+ WF+LCG C+GRFVVEKNSL+VTSP+SIK++YECAIGNFG+PQYGG+MVG V+
Sbjct  3    VGFLVCI-WFVLCGCCMGRFVVEKNSLRVTSPDSIKEVYECAIGNFGVPQYGGTMVGNVM  61

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPK NQK+CK+F DFD+ +KSKP
Sbjct  62   YPKTNQKSCKNFSDFDIFYKSKP  84



>ref|NP_001275302.1| vacuolar sorting receptor protein PV72-like protein precursor 
[Solanum tuberosum]
 gb|ABC01915.1| vacuolar sorting receptor protein PV72-like protein [Solanum 
tuberosum]
Length=621

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 76/83 (92%), Gaps = 1/83 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            +G +VC+ WF+LCG C+GRFVVEKNSL+VTSP+SIK++YECAIGNFG+PQYGG+MVG V+
Sbjct  3    VGFLVCI-WFVLCGCCMGRFVVEKNSLRVTSPDSIKEVYECAIGNFGVPQYGGTMVGNVM  61

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPK NQK+CK+F DFD+ +KSKP
Sbjct  62   YPKTNQKSCKNFSDFDIFYKSKP  84



>ref|XP_009611473.1| PREDICTED: vacuolar-sorting receptor 1-like [Nicotiana tomentosiformis]
Length=623

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 76/83 (92%), Gaps = 1/83 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            LG +VC+L  +L GSCLGRFVVEKNSL+VTSP SIKD+YECAIGNFG+PQYGG+MVG V+
Sbjct  5    LGFLVCIL-CVLSGSCLGRFVVEKNSLRVTSPSSIKDVYECAIGNFGVPQYGGTMVGIVM  63

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPKANQK+CK+F DFD+SFKSKP
Sbjct  64   YPKANQKSCKNFTDFDISFKSKP  86



>ref|XP_006362349.1| PREDICTED: vacuolar-sorting receptor 1-like [Solanum tuberosum]
Length=624

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 75/82 (91%), Gaps = 1/82 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            LG +VC+ WF++ GSCLGRFVVEKNSL+VTSP+SIKD+YECAIGNFG+PQYGG+MVG VV
Sbjct  5    LGFLVCV-WFIVIGSCLGRFVVEKNSLRVTSPDSIKDVYECAIGNFGVPQYGGTMVGIVV  63

Query  487  YPKANQKACKSFDDFDVSFKSK  552
            YPKANQK+CK F D D+SFK+K
Sbjct  64   YPKANQKSCKDFADSDISFKTK  85



>ref|XP_008370265.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Malus 
domestica]
Length=626

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 73/83 (88%), Gaps = 1/83 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            LGL+V  +WFLLCG C+GRFVVEKNSLKVTSP S+K LYECAIGNFG+PQYGG++VGTV 
Sbjct  5    LGLLV-GVWFLLCGVCVGRFVVEKNSLKVTSPSSMKGLYECAIGNFGVPQYGGTLVGTVY  63

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPK NQKACK F+DFD SFK KP
Sbjct  64   YPKTNQKACKGFEDFDESFKPKP  86



>ref|XP_009611965.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=626

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 74/82 (90%), Gaps = 1/82 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            LG +VC+ WFL+ GSC GRFVVEKNSL+VTSPESIKD+YECAIGNFG+PQYGG++VG V 
Sbjct  5    LGFLVCI-WFLVIGSCYGRFVVEKNSLRVTSPESIKDVYECAIGNFGVPQYGGTLVGNVA  63

Query  487  YPKANQKACKSFDDFDVSFKSK  552
            YPKANQK+CKSF+  D+SFKSK
Sbjct  64   YPKANQKSCKSFESADISFKSK  85



>ref|XP_008370266.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Malus 
domestica]
Length=625

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 73/83 (88%), Gaps = 1/83 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            LGL+V  +WFLLCG C+GRFVVEKNSLKVTSP S+K LYECAIGNFG+PQYGG++VGTV 
Sbjct  5    LGLLV-GVWFLLCGVCVGRFVVEKNSLKVTSPSSMKGLYECAIGNFGVPQYGGTLVGTVY  63

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPK NQKACK F+DFD SFK KP
Sbjct  64   YPKTNQKACKGFEDFDESFKPKP  86



>ref|XP_009611966.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=624

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 74/82 (90%), Gaps = 1/82 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            LG +VC+ WFL+ GSC GRFVVEKNSL+VTSPESIKD+YECAIGNFG+PQYGG++VG V 
Sbjct  5    LGFLVCI-WFLVIGSCYGRFVVEKNSLRVTSPESIKDVYECAIGNFGVPQYGGTLVGNVA  63

Query  487  YPKANQKACKSFDDFDVSFKSK  552
            YPKANQK+CKSF+  D+SFKSK
Sbjct  64   YPKANQKSCKSFESADISFKSK  85



>ref|XP_011019003.1| PREDICTED: vacuolar-sorting receptor 1-like [Populus euphratica]
Length=625

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 75/83 (90%), Gaps = 1/83 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            LG +V  +W LLCG CLGRFVVEKNSLK+TSP+S+K +YECAIGNFG+PQYGG++VGTVV
Sbjct  5    LGFLV-GVWLLLCGFCLGRFVVEKNSLKLTSPDSLKGVYECAIGNFGVPQYGGTLVGTVV  63

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPKANQKACK FD+ D+SFKS+P
Sbjct  64   YPKANQKACKGFDEVDISFKSRP  86



>gb|KDO64109.1| hypothetical protein CISIN_1g0100101mg [Citrus sinensis]
Length=362

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 73/83 (88%), Gaps = 1/83 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            LG +V +L FLLCG   GRFVVEKNSLKVTSPE IK +YECAIGNFG+PQYGG+++GTVV
Sbjct  5    LGFLVGIL-FLLCGLSFGRFVVEKNSLKVTSPEKIKGVYECAIGNFGVPQYGGTLIGTVV  63

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPKANQKACK FD+ D+SFKS+P
Sbjct  64   YPKANQKACKGFDEVDLSFKSRP  86



>gb|KHG23770.1| Vacuolar-sorting receptor 1 -like protein [Gossypium arboreum]
Length=621

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 75/83 (90%), Gaps = 1/83 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
             G+++C+ W +L G+CLGRFVVE+NSLKVTSP SIK +YECAIGNFG+PQYGG++VGTVV
Sbjct  5    FGVLICV-WIMLLGNCLGRFVVEENSLKVTSPGSIKGVYECAIGNFGVPQYGGTLVGTVV  63

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPKANQ ACK FD+FD+SFKSKP
Sbjct  64   YPKANQGACKIFDEFDISFKSKP  86



>ref|XP_010327706.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Solanum 
lycopersicum]
Length=626

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 75/82 (91%), Gaps = 1/82 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            LG +VC+ WFL+ GSCLGRFVVEKNSL+VTSP+SIK++YECAIGNFG+PQYGG+MVG V+
Sbjct  5    LGFLVCV-WFLVIGSCLGRFVVEKNSLRVTSPDSIKNVYECAIGNFGVPQYGGTMVGIVM  63

Query  487  YPKANQKACKSFDDFDVSFKSK  552
            YPKANQK+CK F D D+SFK+K
Sbjct  64   YPKANQKSCKDFADSDISFKTK  85



>ref|XP_010327707.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Solanum 
lycopersicum]
Length=624

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 75/82 (91%), Gaps = 1/82 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            LG +VC+ WFL+ GSCLGRFVVEKNSL+VTSP+SIK++YECAIGNFG+PQYGG+MVG V+
Sbjct  5    LGFLVCV-WFLVIGSCLGRFVVEKNSLRVTSPDSIKNVYECAIGNFGVPQYGGTMVGIVM  63

Query  487  YPKANQKACKSFDDFDVSFKSK  552
            YPKANQK+CK F D D+SFK+K
Sbjct  64   YPKANQKSCKDFADSDISFKTK  85



>gb|KJB29887.1| hypothetical protein B456_005G122400 [Gossypium raimondii]
Length=621

 Score =   133 bits (335),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 75/83 (90%), Gaps = 1/83 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
             G+++C+ W +L G+CLGRFVVE+NSLKVTSP SIK +YECAIGNFG+PQYGG++VGTVV
Sbjct  5    FGVLICV-WIMLLGNCLGRFVVEENSLKVTSPGSIKGVYECAIGNFGVPQYGGTLVGTVV  63

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPKANQ ACK FD+FD+SFKSKP
Sbjct  64   YPKANQGACKIFDEFDISFKSKP  86



>gb|KDO64106.1| hypothetical protein CISIN_1g0100101mg [Citrus sinensis]
Length=411

 Score =   132 bits (331),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 73/83 (88%), Gaps = 1/83 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            LG +V +L FLLCG   GRFVVEKNSLKVTSPE IK +YECAIGNFG+PQYGG+++GTVV
Sbjct  5    LGFLVGIL-FLLCGLSFGRFVVEKNSLKVTSPEKIKGVYECAIGNFGVPQYGGTLIGTVV  63

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPKANQKACK FD+ D+SFKS+P
Sbjct  64   YPKANQKACKGFDEVDLSFKSRP  86



>gb|KJB29886.1| hypothetical protein B456_005G122400 [Gossypium raimondii]
Length=623

 Score =   133 bits (335),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 75/83 (90%), Gaps = 1/83 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
             G+++C+ W +L G+CLGRFVVE+NSLKVTSP SIK +YECAIGNFG+PQYGG++VGTVV
Sbjct  5    FGVLICV-WIMLLGNCLGRFVVEENSLKVTSPGSIKGVYECAIGNFGVPQYGGTLVGTVV  63

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPKANQ ACK FD+FD+SFKSKP
Sbjct  64   YPKANQGACKIFDEFDISFKSKP  86



>gb|KJB29888.1| hypothetical protein B456_005G122400 [Gossypium raimondii]
Length=621

 Score =   133 bits (335),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 75/83 (90%), Gaps = 1/83 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
             G+++C+ W +L G+CLGRFVVE+NSLKVTSP SIK +YECAIGNFG+PQYGG++VGTVV
Sbjct  5    FGVLICV-WIMLLGNCLGRFVVEENSLKVTSPGSIKGVYECAIGNFGVPQYGGTLVGTVV  63

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPKANQ ACK FD+FD+SFKSKP
Sbjct  64   YPKANQGACKIFDEFDISFKSKP  86



>gb|KDO64107.1| hypothetical protein CISIN_1g0100101mg, partial [Citrus sinensis]
 gb|KDO64108.1| hypothetical protein CISIN_1g0100101mg, partial [Citrus sinensis]
Length=410

 Score =   132 bits (331),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 73/83 (88%), Gaps = 1/83 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            LG +V +L FLLCG   GRFVVEKNSLKVTSPE IK +YECAIGNFG+PQYGG+++GTVV
Sbjct  5    LGFLVGIL-FLLCGLSFGRFVVEKNSLKVTSPEKIKGVYECAIGNFGVPQYGGTLIGTVV  63

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPKANQKACK FD+ D+SFKS+P
Sbjct  64   YPKANQKACKGFDEVDLSFKSRP  86



>ref|XP_002528694.1| Vacuolar sorting receptor 1 precursor, putative [Ricinus communis]
 gb|EEF33683.1| Vacuolar sorting receptor 1 precursor, putative [Ricinus communis]
Length=625

 Score =   133 bits (334),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  334  FLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKAC  513
             +LCGSCLGRFVVEKNSL+VTSP+S+K ++ECAIGNFG+PQYGG++VGTVVYPKANQKAC
Sbjct  13   LMLCGSCLGRFVVEKNSLRVTSPDSVKGIHECAIGNFGVPQYGGTLVGTVVYPKANQKAC  72

Query  514  KSFDDFDVSFKSKP  555
            K FD+ D+SFKSKP
Sbjct  73   KGFDEVDISFKSKP  86



>gb|AAN60346.1| unknown [Arabidopsis thaliana]
Length=216

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 72/83 (87%), Gaps = 1/83 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            LGL   L + L+    +GRFVVEKN+LKVTSP+SIK +YECAIGNFG+PQYGG++VGTVV
Sbjct  3    LGLFT-LSFLLILNLAMGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVV  61

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPK+NQKACKS+ DFD+SFKSKP
Sbjct  62   YPKSNQKACKSYSDFDISFKSKP  84



>ref|XP_010253066.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Nelumbo 
nucifera]
Length=580

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 1/78 (1%)
 Frame = +1

Query  325  LLWFL-LCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKAN  501
             +W L LCGSCLGRFVVEKNSL+VTSP+S+K +YECAIGNFG+PQYGG+MVGTVVYPK N
Sbjct  8    FIWALFLCGSCLGRFVVEKNSLRVTSPQSLKGVYECAIGNFGVPQYGGTMVGTVVYPKVN  67

Query  502  QKACKSFDDFDVSFKSKP  555
            QKAC  FD+ D+SFKSKP
Sbjct  68   QKACNDFDEVDLSFKSKP  85



>ref|XP_010253065.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nelumbo 
nucifera]
Length=623

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 70/78 (90%), Gaps = 1/78 (1%)
 Frame = +1

Query  325  LLWFL-LCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKAN  501
             +W L LCGSCLGRFVVEKNSL+VTSP+S+K +YECAIGNFG+PQYGG+MVGTVVYPK N
Sbjct  8    FIWALFLCGSCLGRFVVEKNSLRVTSPQSLKGVYECAIGNFGVPQYGGTMVGTVVYPKVN  67

Query  502  QKACKSFDDFDVSFKSKP  555
            QKAC  FD+ D+SFKSKP
Sbjct  68   QKACNDFDEVDLSFKSKP  85



>ref|XP_006429591.1| hypothetical protein CICLE_v10011298mg [Citrus clementina]
 ref|XP_006481200.1| PREDICTED: vacuolar-sorting receptor 1-like [Citrus sinensis]
 gb|ESR42831.1| hypothetical protein CICLE_v10011298mg [Citrus clementina]
Length=623

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 73/83 (88%), Gaps = 1/83 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            LG +V +L FLLCG   GRFVVEKNSLKVTSPE IK +YECAIGNFG+PQYGG+++GTVV
Sbjct  5    LGFLVGIL-FLLCGLSFGRFVVEKNSLKVTSPEKIKGVYECAIGNFGVPQYGGTLIGTVV  63

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPKANQKACK FD+ D+SFKS+P
Sbjct  64   YPKANQKACKGFDEVDLSFKSRP  86



>ref|XP_002309184.1| vacuolar sorting receptor family protein [Populus trichocarpa]
 gb|EEE92707.1| vacuolar sorting receptor family protein [Populus trichocarpa]
Length=625

 Score =   130 bits (328),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 1/83 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            LG +V  +W LLCG C GRFVVEKN+LK+TSP+S+K +YECAIGNFG+PQYGG++VGTV+
Sbjct  5    LGFLV-GVWLLLCGFCFGRFVVEKNNLKLTSPDSLKGVYECAIGNFGVPQYGGTLVGTVI  63

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPKANQKACK FD  D+SFKS+P
Sbjct  64   YPKANQKACKGFDGVDISFKSRP  86



>ref|XP_010252051.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nelumbo 
nucifera]
Length=624

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 71/82 (87%), Gaps = 1/82 (1%)
 Frame = +1

Query  313  LIVCLLWFLL-CGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVY  489
            L+   +W L   GSCLGRFVVEKNSLKVTSPE +K +YECAIGNFG+PQYGG+M+GTV+Y
Sbjct  5    LLPIFIWALFFWGSCLGRFVVEKNSLKVTSPEDLKGVYECAIGNFGVPQYGGTMIGTVIY  64

Query  490  PKANQKACKSFDDFDVSFKSKP  555
            PKANQKACK FD+ D+SFKSKP
Sbjct  65   PKANQKACKDFDEVDLSFKSKP  86



>ref|XP_009384326.1| PREDICTED: vacuolar-sorting receptor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009384327.1| PREDICTED: vacuolar-sorting receptor 1-like [Musa acuminata subsp. 
malaccensis]
Length=621

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 70/83 (84%), Gaps = 6/83 (7%)
 Frame = +1

Query  325  LLW------FLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            +LW      FLL GSC GRFVVEKNSLKVTSP+S+K +YECAIGNFG+PQYGG+MVG V 
Sbjct  5    MLWISVWVLFLLWGSCWGRFVVEKNSLKVTSPDSLKGIYECAIGNFGVPQYGGTMVGIVA  64

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPK NQKACKSF DFD+S+KSKP
Sbjct  65   YPKDNQKACKSFRDFDISYKSKP  87



>ref|XP_004246285.1| PREDICTED: vacuolar-sorting receptor 1-like [Solanum lycopersicum]
Length=621

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 76/83 (92%), Gaps = 1/83 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            +G +VC+L F++CG C+GRFVVEKNSL+VTSP+SIK++YECAIGNFG+PQYGG++VG V+
Sbjct  3    VGFLVCIL-FVMCGCCMGRFVVEKNSLRVTSPDSIKEVYECAIGNFGVPQYGGTLVGNVM  61

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPK+N+K+C +F DFD+ +KSKP
Sbjct  62   YPKSNKKSCNNFSDFDIFYKSKP  84



>ref|XP_006398566.1| hypothetical protein EUTSA_v10015537mg [Eutrema salsugineum]
 gb|ESQ40019.1| hypothetical protein EUTSA_v10015537mg [Eutrema salsugineum]
Length=627

 Score =   129 bits (324),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 56/76 (74%), Positives = 68/76 (89%), Gaps = 2/76 (3%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
            +LWF   GSC GRFVVEKN+L+VTSPESI+ +YECA+GNFG+PQYGGSM G VVYPKAN 
Sbjct  16   MLWF--TGSCTGRFVVEKNNLRVTSPESIRGIYECALGNFGVPQYGGSMSGAVVYPKANH  73

Query  505  KACKSFDDFDVSFKSK  552
            K+CK+FDDFD+SF+S+
Sbjct  74   KSCKNFDDFDISFRSR  89



>ref|XP_008788526.1| PREDICTED: vacuolar-sorting receptor 1-like [Phoenix dactylifera]
Length=624

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 69/81 (85%), Gaps = 5/81 (6%)
 Frame = +1

Query  328  LWF-----LLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  492
            LWF      L GS LGRFVVEKNSLKVTSPES+K +YECAIGNFG+PQYGG+MVG VVYP
Sbjct  9    LWFSVWVLFLWGSSLGRFVVEKNSLKVTSPESLKGIYECAIGNFGVPQYGGTMVGIVVYP  68

Query  493  KANQKACKSFDDFDVSFKSKP  555
            KAN+KAC  FDDFD+SFKSKP
Sbjct  69   KANRKACSKFDDFDISFKSKP  89



>ref|XP_008792241.1| PREDICTED: vacuolar-sorting receptor 1-like [Phoenix dactylifera]
Length=620

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 70/77 (91%), Gaps = 1/77 (1%)
 Frame = +1

Query  328  LWFL-LCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
            +W L L GS LGRFVVEKNSLKVTSPES+K +YECAIGNFG+PQYGG+MVG VVYPKAN+
Sbjct  9    VWVLFLWGSSLGRFVVEKNSLKVTSPESLKGIYECAIGNFGVPQYGGTMVGIVVYPKANR  68

Query  505  KACKSFDDFDVSFKSKP  555
            KAC+SFDDFD+SFK KP
Sbjct  69   KACQSFDDFDISFKPKP  85



>ref|XP_010093546.1| Vacuolar-sorting receptor 1 [Morus notabilis]
 gb|EXB54253.1| Vacuolar-sorting receptor 1 [Morus notabilis]
Length=628

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 75/84 (89%), Gaps = 1/84 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCL-GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTV  483
            LG++VC+L F+   SC+ GRFVVEKNSLKVTSP  +K +YECAIGNFG+PQYGG++VGTV
Sbjct  5    LGILVCVLVFVSWSSCVVGRFVVEKNSLKVTSPNPLKGVYECAIGNFGVPQYGGTLVGTV  64

Query  484  VYPKANQKACKSFDDFDVSFKSKP  555
            VYP+ANQKACK+F+DF VSFKSKP
Sbjct  65   VYPQANQKACKNFEDFSVSFKSKP  88



>emb|CDY38157.1| BnaA07g02260D [Brassica napus]
Length=370

 Score =   126 bits (316),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +1

Query  331  WFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKA  510
            W +  GSC+G FVVEKNSL+VTSPESI+ +YECA+GNFG+PQYGGSM G+VVYPKANQKA
Sbjct  39   WVMWWGSCMGMFVVEKNSLRVTSPESIRGIYECALGNFGVPQYGGSMSGSVVYPKANQKA  98

Query  511  CKSFDDFDVSFKSK  552
            CK+F+DFD+SF S+
Sbjct  99   CKNFEDFDISFISR  112



>gb|EYU42029.1| hypothetical protein MIMGU_mgv1a002928mg [Erythranthe guttata]
Length=624

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 72/83 (87%), Gaps = 1/83 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
             G+  C+ WF+L  SCLGRFVVEKNSLKVTSP+S+KD+YECAIGNFG+P YGGSM G+V 
Sbjct  5    FGIWACV-WFVLVVSCLGRFVVEKNSLKVTSPDSLKDVYECAIGNFGVPDYGGSMAGSVF  63

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPK+N+KACK+F DFD++ K+KP
Sbjct  64   YPKSNEKACKNFQDFDIALKTKP  86



>gb|KFK24686.1| hypothetical protein AALP_AA8G011700 [Arabis alpina]
Length=627

 Score =   127 bits (320),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            +GL+V  L  +  G C GRFVVEKN+L+VTSPE+I+ +YECA+GNFG+PQYGGSM G VV
Sbjct  7    VGLVVMGLVMVWLGPCTGRFVVEKNNLRVTSPEAIRGVYECALGNFGVPQYGGSMAGAVV  66

Query  487  YPKANQKACKSFDDFDVSFKSK  552
            YPKANQKACK+F+DFD+SF+S+
Sbjct  67   YPKANQKACKNFNDFDISFRSR  88



>ref|XP_010922756.1| PREDICTED: vacuolar-sorting receptor 1-like [Elaeis guineensis]
Length=620

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 70/81 (86%), Gaps = 5/81 (6%)
 Frame = +1

Query  328  LWF-----LLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  492
            LWF      L GS LGRFVVEKNSLKVTSPES+K +YECAIGNFG+PQYGG+MVG VVYP
Sbjct  5    LWFSVWVLFLWGSSLGRFVVEKNSLKVTSPESLKGIYECAIGNFGVPQYGGTMVGIVVYP  64

Query  493  KANQKACKSFDDFDVSFKSKP  555
            KAN+KAC++F DFD+SFKSKP
Sbjct  65   KANKKACRNFADFDISFKSKP  85



>emb|CDY04821.1| BnaAnng00030D [Brassica napus]
Length=635

 Score =   127 bits (320),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 54/68 (79%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +1

Query  349  SCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDD  528
            SC+GRFVVEKNSL+VTSPESI+ +YECA+GNFG+PQYGGSM G+VVYPKANQKACK+F+D
Sbjct  29   SCMGRFVVEKNSLRVTSPESIRGIYECALGNFGVPQYGGSMSGSVVYPKANQKACKNFED  88

Query  529  FDVSFKSK  552
            FD+SF+S+
Sbjct  89   FDISFRSR  96



>pdb|4TJV|A Chain A, Crystal Structure Of Protease-associated Domain Of Arabidopsis 
Vacuolar Sorting Receptor 1
 pdb|4TJX|A Chain A, Crystal Structure Of Protease-associated Domain Of Arabidopsis 
Vsr1 In Complex With Aleurain Peptide
Length=165

 Score =   120 bits (302),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +1

Query  361  RFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDVS  540
            RFVVEKN+LKVTSP+SIK +YECAIGNFG+PQYGG++VGTVVYPK+NQKACKS+ DFD+S
Sbjct  3    RFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYSDFDIS  62

Query  541  FKSKP  555
            FKSKP
Sbjct  63   FKSKP  67



>ref|XP_010529937.1| PREDICTED: vacuolar-sorting receptor 1 isoform X2 [Tarenaya hassleriana]
Length=624

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
            L + L+ G+ LGRFVVEKN+LKVTSP+SI+ +YECAIGNFG+PQYGG++VGTVVYP +NQ
Sbjct  10   LSFVLILGTALGRFVVEKNNLKVTSPDSIRGIYECAIGNFGVPQYGGTLVGTVVYPSSNQ  69

Query  505  KACKSFDDFDVSFKSKP  555
            KACK+F+DFDVSFKSKP
Sbjct  70   KACKNFEDFDVSFKSKP  86



>ref|XP_010529936.1| PREDICTED: vacuolar-sorting receptor 1 isoform X1 [Tarenaya hassleriana]
Length=626

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
            L + L+ G+ LGRFVVEKN+LKVTSP+SI+ +YECAIGNFG+PQYGG++VGTVVYP +NQ
Sbjct  10   LSFVLILGTALGRFVVEKNNLKVTSPDSIRGIYECAIGNFGVPQYGGTLVGTVVYPSSNQ  69

Query  505  KACKSFDDFDVSFKSKP  555
            KACK+F+DFDVSFKSKP
Sbjct  70   KACKNFEDFDVSFKSKP  86



>gb|EMT24279.1| Vacuolar-sorting receptor 1 [Aegilops tauschii]
Length=625

 Score =   126 bits (317),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 57/77 (74%), Positives = 66/77 (86%), Gaps = 3/77 (4%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
            LLW   CG C  RFVVEKNSL+VT+PE++K  YECAIGNFG+PQYGG+MVG V YPKAN+
Sbjct  18   LLW---CGGCDARFVVEKNSLRVTAPEALKGAYECAIGNFGVPQYGGTMVGVVAYPKANR  74

Query  505  KACKSFDDFDVSFKSKP  555
            KACK FDDFDVSFK++P
Sbjct  75   KACKGFDDFDVSFKARP  91



>ref|XP_010414284.1| PREDICTED: vacuolar-sorting receptor 2 [Camelina sativa]
Length=625

 Score =   126 bits (317),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 54/80 (68%), Positives = 72/80 (90%), Gaps = 1/80 (1%)
 Frame = +1

Query  316  IVCLLWFLL-CGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  492
            ++ ++W ++   SC+GRFVVEKN+L+VTSPESI+ +YECA+GNFG+PQYGGSM G V+YP
Sbjct  8    LIVMVWIIVGWSSCMGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVLYP  67

Query  493  KANQKACKSFDDFDVSFKSK  552
            KANQKACK+FDDFD+SF+S+
Sbjct  68   KANQKACKNFDDFDISFRSR  87



>ref|XP_009372030.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=625

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 69/83 (83%), Gaps = 1/83 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            LG +VC+ WFLLCG C+ RFVVEK+SLKVTSP S+K  YECAIGNFG+PQYGG++VGTV 
Sbjct  5    LGFLVCV-WFLLCGVCVARFVVEKSSLKVTSPSSMKGEYECAIGNFGVPQYGGTLVGTVY  63

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPK NQ ACK F+D D SFK KP
Sbjct  64   YPKTNQMACKGFEDTDESFKPKP  86



>ref|XP_002881098.1| hypothetical protein ARALYDRAFT_481940 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57357.1| hypothetical protein ARALYDRAFT_481940 [Arabidopsis lyrata subsp. 
lyrata]
Length=623

 Score =   126 bits (317),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 54/79 (68%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +1

Query  316  IVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPK  495
            +V ++W +   SC GRFVVEKN+L+VTSPESI+ +YECA+GNFG+PQYGGSM G VVYPK
Sbjct  8    LVVIVWVMGWSSCTGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVVYPK  67

Query  496  ANQKACKSFDDFDVSFKSK  552
            ANQK CK+FDDF++SF+S+
Sbjct  68   ANQKGCKNFDDFEISFRSR  86



>ref|XP_009372028.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=626

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 69/83 (83%), Gaps = 1/83 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            LG +VC+ WFLLCG C+ RFVVEK+SLKVTSP S+K  YECAIGNFG+PQYGG++VGTV 
Sbjct  5    LGFLVCV-WFLLCGVCVARFVVEKSSLKVTSPSSMKGEYECAIGNFGVPQYGGTLVGTVY  63

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPK NQ ACK F+D D SFK KP
Sbjct  64   YPKTNQMACKGFEDTDESFKPKP  86



>ref|XP_009801642.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Nicotiana 
sylvestris]
Length=624

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 72/82 (88%), Gaps = 1/82 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            LG +VC+ W L+ G   GRFVVEKNSL+VTSP+SIKD+YECAIGNFG+PQYGG++VG VV
Sbjct  5    LGFLVCV-WCLVIGCSYGRFVVEKNSLRVTSPDSIKDVYECAIGNFGVPQYGGTLVGNVV  63

Query  487  YPKANQKACKSFDDFDVSFKSK  552
            YPKANQK+CKSF+  D+SFKSK
Sbjct  64   YPKANQKSCKSFESADISFKSK  85



>ref|XP_010931377.1| PREDICTED: vacuolar-sorting receptor 1-like [Elaeis guineensis]
Length=620

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 68/81 (84%), Gaps = 5/81 (6%)
 Frame = +1

Query  328  LWF-----LLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  492
            LWF      L GS  GRFVVEKNSLKVTSPES+K  +ECAIGNFG+PQYGG+MVG V YP
Sbjct  5    LWFSVWVLFLWGSSFGRFVVEKNSLKVTSPESLKGTHECAIGNFGVPQYGGTMVGIVSYP  64

Query  493  KANQKACKSFDDFDVSFKSKP  555
            KAN+KACKSFDDFD+SFKSKP
Sbjct  65   KANRKACKSFDDFDISFKSKP  85



>gb|EEE52644.1| hypothetical protein OsJ_35003 [Oryza sativa Japonica Group]
Length=591

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +1

Query  343  CGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSF  522
            CGSC GRFVVEKNSLKVTSP  +K  YECAIGNFG+PQYGG+MVG V YPKAN+KACKSF
Sbjct  22   CGSCHGRFVVEKNSLKVTSPSDMKGTYECAIGNFGVPQYGGTMVGVVAYPKANKKACKSF  81

Query  523  DDFDVSFKSKP  555
            DDFD+S+K+KP
Sbjct  82   DDFDISYKAKP  92



>ref|XP_009801640.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nicotiana 
sylvestris]
Length=626

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 72/82 (88%), Gaps = 1/82 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            LG +VC+ W L+ G   GRFVVEKNSL+VTSP+SIKD+YECAIGNFG+PQYGG++VG VV
Sbjct  5    LGFLVCV-WCLVIGCSYGRFVVEKNSLRVTSPDSIKDVYECAIGNFGVPQYGGTLVGNVV  63

Query  487  YPKANQKACKSFDDFDVSFKSK  552
            YPKANQK+CKSF+  D+SFKSK
Sbjct  64   YPKANQKSCKSFESADISFKSK  85



>ref|XP_006290748.1| hypothetical protein CARUB_v10016844mg [Capsella rubella]
 gb|EOA23646.1| hypothetical protein CARUB_v10016844mg [Capsella rubella]
Length=626

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
            L + L+    LGRFVVEKN+LKVTSPESIK +YECAIGNFG+PQYGG++VGTVVYPK+NQ
Sbjct  11   LSFLLILNLALGRFVVEKNNLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYPKSNQ  70

Query  505  KACKSFDDFDVSFKSKP  555
            KACKS++DFD+SFKSKP
Sbjct  71   KACKSYNDFDISFKSKP  87



>ref|XP_010504032.1| PREDICTED: vacuolar-sorting receptor 1 [Camelina sativa]
Length=626

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +1

Query  316  IVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPK  495
            I  L + L+    LGRFVVEKN+LKVTSPESIK +YECAIGNFG+PQYGG++VGTVVYPK
Sbjct  8    IFTLSFLLILNLALGRFVVEKNNLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYPK  67

Query  496  ANQKACKSFDDFDVSFKSKP  555
            +NQKACKS+ DFD+SFKSKP
Sbjct  68   SNQKACKSYTDFDISFKSKP  87



>ref|XP_004977384.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Setaria 
italica]
Length=624

 Score =   126 bits (316),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 58/83 (70%), Positives = 70/83 (84%), Gaps = 1/83 (1%)
 Frame = +1

Query  310  GLIVCLLWF-LLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
             ++  L+W  LL G C GRFVVEKNSLKVT+P+ +K  YECAIGNFG+PQYGG+MVG V 
Sbjct  8    AMLQLLVWAALLLGCCHGRFVVEKNSLKVTAPDDLKGTYECAIGNFGVPQYGGTMVGFVA  67

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPKAN+KACKSFDDFD+S+K+KP
Sbjct  68   YPKANKKACKSFDDFDISYKAKP  90



>ref|XP_010426913.1| PREDICTED: vacuolar-sorting receptor 1-like [Camelina sativa]
Length=626

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 72/83 (87%), Gaps = 1/83 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            LGL   L + L+    LGRFVVEKN+LKVTSPESIK +YECAIGNFG+PQYGG++VGTVV
Sbjct  6    LGLFT-LSFLLILNLALGRFVVEKNNLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVV  64

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPK+NQKACKS+ DFD+SFKSKP
Sbjct  65   YPKSNQKACKSYTDFDISFKSKP  87



>gb|EEE51529.1| hypothetical protein OsJ_32728 [Oryza sativa Japonica Group]
Length=626

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +1

Query  343  CGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSF  522
            CGSC GRFVVEKNSLKVTSP  +K  YECAIGNFG+PQYGG+MVG V YPKAN+KACKSF
Sbjct  22   CGSCHGRFVVEKNSLKVTSPSDMKGTYECAIGNFGVPQYGGTMVGVVAYPKANKKACKSF  81

Query  523  DDFDVSFKSKP  555
            DDFD+S+K+KP
Sbjct  82   DDFDISYKAKP  92



>gb|EEC67546.1| hypothetical protein OsI_34875 [Oryza sativa Indica Group]
Length=626

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +1

Query  343  CGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSF  522
            CGSC GRFVVEKNSLKVTSP  +K  YECAIGNFG+PQYGG+MVG V YPKAN+KACKSF
Sbjct  22   CGSCHGRFVVEKNSLKVTSPSDMKGTYECAIGNFGVPQYGGTMVGVVAYPKANKKACKSF  81

Query  523  DDFDVSFKSKP  555
            DDFD+S+K+KP
Sbjct  82   DDFDISYKAKP  92



>gb|EEC68730.1| hypothetical protein OsI_37233 [Oryza sativa Indica Group]
Length=626

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +1

Query  343  CGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSF  522
            CGSC GRFVVEKNSLKVTSP  +K  YECAIGNFG+PQYGG+MVG V YPKAN+KACKSF
Sbjct  22   CGSCHGRFVVEKNSLKVTSPSDMKGTYECAIGNFGVPQYGGTMVGVVAYPKANKKACKSF  81

Query  523  DDFDVSFKSKP  555
            DDFD+S+K+KP
Sbjct  82   DDFDISYKAKP  92



>ref|XP_006296113.1| hypothetical protein CARUB_v10025264mg [Capsella rubella]
 gb|EOA29011.1| hypothetical protein CARUB_v10025264mg [Capsella rubella]
Length=623

 Score =   125 bits (315),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            +GL+V +   +   SC+GRFVVEKN+L+VTSPESI+ +YECA+GNFGIPQYGGSM G V+
Sbjct  4    VGLVVIVWIIVGWSSCMGRFVVEKNNLRVTSPESIRGVYECALGNFGIPQYGGSMSGAVL  63

Query  487  YPKANQKACKSFDDFDVSFKSK  552
            YPKANQKACK+F DFD+SF+S+
Sbjct  64   YPKANQKACKNFADFDISFRSR  85



>gb|KGN58683.1| hypothetical protein Csa_3G728010 [Cucumis sativus]
Length=522

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 69/81 (85%), Gaps = 3/81 (4%)
 Frame = +1

Query  313  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  492
            L VC   F+L  SCLGRFVVEKNSLK+TSP+SIK +YECAIGNFG+P+YGG+M G V YP
Sbjct  9    LFVC---FILSVSCLGRFVVEKNSLKITSPDSIKGVYECAIGNFGVPEYGGTMTGIVHYP  65

Query  493  KANQKACKSFDDFDVSFKSKP  555
            KANQKACKSFDD  +SFKSKP
Sbjct  66   KANQKACKSFDDAGISFKSKP  86



>ref|NP_001065992.1| Os12g0116000 [Oryza sativa Japonica Group]
 gb|ABA96293.2| Vacuolar sorting receptor 1 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29011.1| Os12g0116000 [Oryza sativa Japonica Group]
 dbj|BAG90054.1| unnamed protein product [Oryza sativa Japonica Group]
Length=728

 Score =   126 bits (316),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +1

Query  343  CGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSF  522
            CGSC GRFVVEKNSLKVTSP  +K  YECAIGNFG+PQYGG+MVG V YPKAN+KACKSF
Sbjct  124  CGSCHGRFVVEKNSLKVTSPSDMKGTYECAIGNFGVPQYGGTMVGVVAYPKANKKACKSF  183

Query  523  DDFDVSFKSKP  555
            DDFD+S+K+KP
Sbjct  184  DDFDISYKAKP  194



>tpg|DAA39323.1| TPA: hypothetical protein ZEAMMB73_720222, partial [Zea mays]
Length=620

 Score =   125 bits (313),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 70/83 (84%), Gaps = 2/83 (2%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            L L+VC    LL G C GRFVVEKNSLKVT+P+ +K  YECAIGNFG+PQYGG+MVG V 
Sbjct  10   LRLLVCAA--LLLGCCHGRFVVEKNSLKVTAPDDLKGTYECAIGNFGVPQYGGTMVGFVA  67

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPKAN+KACKSFDDFD+S+K+KP
Sbjct  68   YPKANRKACKSFDDFDISYKAKP  90



>ref|XP_010543160.1| PREDICTED: vacuolar-sorting receptor 2 [Tarenaya hassleriana]
Length=628

 Score =   125 bits (314),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 57/84 (68%), Positives = 69/84 (82%), Gaps = 1/84 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGS-CLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTV  483
            +G  V + W ++ G  C GRFVVEKN+L+VTSPESI+ +YECAIGNFG+PQYGGSM G V
Sbjct  5    IGYGVMMSWVMVMGWWCEGRFVVEKNNLRVTSPESIRGIYECAIGNFGVPQYGGSMTGEV  64

Query  484  VYPKANQKACKSFDDFDVSFKSKP  555
            V+PKANQK C+SFD FD+SF SKP
Sbjct  65   VFPKANQKGCQSFDQFDISFSSKP  88



>ref|XP_008669942.1| PREDICTED: vacuolar-sorting receptor 1-like [Zea mays]
Length=624

 Score =   125 bits (313),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 70/83 (84%), Gaps = 2/83 (2%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            L L+VC    LL G C GRFVVEKNSLKVT+P+ +K  YECAIGNFG+PQYGG+MVG V 
Sbjct  10   LRLLVCAA--LLLGCCHGRFVVEKNSLKVTAPDDLKGTYECAIGNFGVPQYGGTMVGFVA  67

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPKAN+KACKSFDDFD+S+K+KP
Sbjct  68   YPKANRKACKSFDDFDISYKAKP  90



>pir||T00044 vacuolar sorting receptor protein homolog PV72 - cucurbit
 dbj|BAA25079.1| PV72 [Cucurbita cv. Kurokawa Amakuri]
Length=624

 Score =   125 bits (313),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +1

Query  334  FLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKAC  513
            FLLC SC GRFVVEKNSLKVT P+SIK +YECAIGNFG+P+YGG+M G V YPKANQKAC
Sbjct  13   FLLCVSCFGRFVVEKNSLKVTYPDSIKGVYECAIGNFGVPEYGGTMTGIVHYPKANQKAC  72

Query  514  KSFDDFDVSFKSKP  555
            KSFDD  +SFKSKP
Sbjct  73   KSFDDVGISFKSKP  86



>gb|KFK34530.1| hypothetical protein AALP_AA5G158000 [Arabis alpina]
Length=625

 Score =   125 bits (313),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
            L + ++    LGRFVVEKN+LKVTSP+SIK +YECAIGNFG+PQYGG++VGTVVYPK+NQ
Sbjct  11   LFFLVILSLALGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQ  70

Query  505  KACKSFDDFDVSFKSKP  555
            KACKS++DFD+SFKSKP
Sbjct  71   KACKSYNDFDISFKSKP  87



>ref|NP_190853.1| vacuolar-sorting receptor 1 [Arabidopsis thaliana]
 sp|P93026.2|VSR1_ARATH RecName: Full=Vacuolar-sorting receptor 1; Short=AtVSR1; AltName: 
Full=BP80-like protein b; Short=AtBP80b; AltName: Full=Epidermal 
growth factor receptor-like protein 1; Short=AtELP; 
Short=AtELP1; AltName: Full=Spot 3 protein; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAA69222.1| Spot 3 protein [Arabidopsis thaliana]
 gb|AAB46988.1| EGF receptor like protein [Arabidopsis thaliana]
 gb|AEE79000.1| vacuolar-sorting receptor 1 [Arabidopsis thaliana]
Length=623

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 72/83 (87%), Gaps = 1/83 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            LGL   L + L+    +GRFVVEKN+LKVTSP+SIK +YECAIGNFG+PQYGG++VGTVV
Sbjct  3    LGLFT-LSFLLILNLAMGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVV  61

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPK+NQKACKS+ DFD+SFKSKP
Sbjct  62   YPKSNQKACKSYSDFDISFKSKP  84



>gb|AAB72111.1| vacuolar sorting receptor homolog [Arabidopsis thaliana]
Length=623

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 72/83 (87%), Gaps = 1/83 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            LGL   L + L+    +GRFVVEKN+LKVTSP+SIK +YECAIGNFG+PQYGG++VGTVV
Sbjct  3    LGLFT-LSFLLILNLAMGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVV  61

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPK+NQKACKS+ DFD+SFKSKP
Sbjct  62   YPKSNQKACKSYSDFDISFKSKP  84



>gb|AAK82551.1| AT3g52850/F8J2_20 [Arabidopsis thaliana]
Length=623

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 72/83 (87%), Gaps = 1/83 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            LGL   L + L+    +GRFVVEKN+LKVTSP+SIK +YECAIGNFG+PQYGG++VGTVV
Sbjct  3    LGLFT-LSFLLILNLAMGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVV  61

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPK+NQKACKS+ DFD+SFKSKP
Sbjct  62   YPKSNQKACKSYSDFDISFKSKP  84



>ref|XP_004137673.1| PREDICTED: vacuolar-sorting receptor 1-like [Cucumis sativus]
 ref|XP_004160331.1| PREDICTED: vacuolar-sorting receptor 1-like [Cucumis sativus]
Length=624

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +1

Query  316  IVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPK  495
            I+  + F+L  SCLGRFVVEKNSLK+TSP+SIK +YECAIGNFG+P+YGG+M G V YPK
Sbjct  7    ILLFVCFILSVSCLGRFVVEKNSLKITSPDSIKGVYECAIGNFGVPEYGGTMTGIVHYPK  66

Query  496  ANQKACKSFDDFDVSFKSKP  555
            ANQKACKSFDD  +SFKSKP
Sbjct  67   ANQKACKSFDDAGISFKSKP  86



>ref|XP_004978527.1| PREDICTED: vacuolar-sorting receptor 1-like [Setaria italica]
Length=624

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 70/83 (84%), Gaps = 1/83 (1%)
 Frame = +1

Query  310  GLIVCLLWF-LLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
             ++  L+W  LL G C GRFVVEKNSLKVT+P+ +K  YECAIGNFG+PQYGG+MVG V 
Sbjct  8    AMLRLLVWAALLLGCCHGRFVVEKNSLKVTAPDDLKGTYECAIGNFGVPQYGGTMVGFVA  67

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPKAN+KACKSFDDFD+S+K+KP
Sbjct  68   YPKANKKACKSFDDFDISYKAKP  90



>ref|XP_008442315.1| PREDICTED: vacuolar-sorting receptor 1 [Cucumis melo]
Length=622

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 69/81 (85%), Gaps = 3/81 (4%)
 Frame = +1

Query  313  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  492
            L VC   F+L  SCLGRFVVEKNSLK+TSP+SIK +YECAIGNFG+P+YGG+M G V YP
Sbjct  9    LYVC---FILSVSCLGRFVVEKNSLKITSPDSIKGVYECAIGNFGVPEYGGTMTGIVHYP  65

Query  493  KANQKACKSFDDFDVSFKSKP  555
            KANQKACKSFDD  +SFKSKP
Sbjct  66   KANQKACKSFDDAGISFKSKP  86



>dbj|BAK00302.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=642

 Score =   124 bits (311),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 56/77 (73%), Positives = 65/77 (84%), Gaps = 3/77 (4%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
            LLW   CG C  RFVVEKNSL+VT+P ++K  YECAIGNFG+PQYGG+MVG V YPKAN+
Sbjct  35   LLW---CGGCDARFVVEKNSLRVTAPVALKGAYECAIGNFGVPQYGGTMVGVVAYPKANR  91

Query  505  KACKSFDDFDVSFKSKP  555
            KACK FDDFDVSFK++P
Sbjct  92   KACKGFDDFDVSFKARP  108



>ref|XP_010510382.1| PREDICTED: vacuolar-sorting receptor 2-like [Camelina sativa]
Length=625

 Score =   124 bits (310),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 53/80 (66%), Positives = 71/80 (89%), Gaps = 1/80 (1%)
 Frame = +1

Query  316  IVCLLWFLL-CGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  492
            ++ ++W ++   SC+GRFVVEKN+L+VTSPESI+ +YECA+GNFG+PQYGGSM G V+YP
Sbjct  8    LIVMVWIIVGWSSCMGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVLYP  67

Query  493  KANQKACKSFDDFDVSFKSK  552
            KANQKACK+FD FD+SF+S+
Sbjct  68   KANQKACKNFDGFDISFRSR  87



>ref|XP_006403761.1| hypothetical protein EUTSA_v10010181mg [Eutrema salsugineum]
 gb|ESQ45214.1| hypothetical protein EUTSA_v10010181mg [Eutrema salsugineum]
Length=626

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
            L + L+    LGRFVVEKN+LKVTSP+SIK +YECAIGNFG+PQYGG++VGTVVYPK+NQ
Sbjct  11   LSFLLILSLALGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQ  70

Query  505  KACKSFDDFDVSFKSKP  555
            KACKS+ DFD+SFKS+P
Sbjct  71   KACKSYSDFDISFKSRP  87



>ref|XP_010469873.1| PREDICTED: vacuolar-sorting receptor 2-like [Camelina sativa]
Length=625

 Score =   124 bits (310),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 53/80 (66%), Positives = 71/80 (89%), Gaps = 1/80 (1%)
 Frame = +1

Query  316  IVCLLWFLL-CGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  492
            ++ ++W ++   SC+GRFVVEKN+L+VTSPESI+ +YECA+GNFG+PQYGGSM G V+YP
Sbjct  8    LIVMVWIIVGWSSCMGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVLYP  67

Query  493  KANQKACKSFDDFDVSFKSK  552
            KANQKACK+FD FD+SF+S+
Sbjct  68   KANQKACKNFDGFDISFRSR  87



>ref|XP_002876170.1| hypothetical protein ARALYDRAFT_906663 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52429.1| hypothetical protein ARALYDRAFT_906663 [Arabidopsis lyrata subsp. 
lyrata]
Length=623

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
            L + L+    +GRFVVEKN+LKVTSP+SIK +YECAIGNFG+PQYGG++VGTVVYPK+NQ
Sbjct  8    LSFLLILNLSMGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQ  67

Query  505  KACKSFDDFDVSFKSKP  555
            KACKS+ DFD+SFKSKP
Sbjct  68   KACKSYSDFDISFKSKP  84



>ref|XP_006403762.1| hypothetical protein EUTSA_v10010181mg [Eutrema salsugineum]
 gb|ESQ45215.1| hypothetical protein EUTSA_v10010181mg [Eutrema salsugineum]
Length=654

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
            L + L+    LGRFVVEKN+LKVTSP+SIK +YECAIGNFG+PQYGG++VGTVVYPK+NQ
Sbjct  11   LSFLLILSLALGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQ  70

Query  505  KACKSFDDFDVSFKSKP  555
            KACKS+ DFD+SFKS+P
Sbjct  71   KACKSYSDFDISFKSRP  87



>ref|XP_002450144.1| hypothetical protein SORBIDRAFT_05g001160 [Sorghum bicolor]
 gb|EES09132.1| hypothetical protein SORBIDRAFT_05g001160 [Sorghum bicolor]
Length=627

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +1

Query  337  LLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACK  516
            LL G C GRFVVEKNSLKVT+P+ +K  YECAIGNFG+PQYGG+MVG V YPKAN+KACK
Sbjct  21   LLLGCCQGRFVVEKNSLKVTAPDDLKGTYECAIGNFGVPQYGGTMVGFVAYPKANRKACK  80

Query  517  SFDDFDVSFKSKP  555
            SFDDFD+S+K+KP
Sbjct  81   SFDDFDISYKAKP  93



>ref|XP_009410512.1| PREDICTED: vacuolar-sorting receptor 1 [Musa acuminata subsp. 
malaccensis]
Length=622

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +1

Query  313  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  492
            L V  +  LL GSC G+FVVEKNSLKVTSP+S+K +YECAIGNFG+PQYGG+MVG V YP
Sbjct  8    LRVVWVSVLLWGSCWGKFVVEKNSLKVTSPDSLKGIYECAIGNFGVPQYGGTMVGIVAYP  67

Query  493  KANQKACKSFDDFDVSFKSKP  555
            KAN+K C+ FD+FD+S+KSKP
Sbjct  68   KANRKGCQGFDNFDISYKSKP  88



>ref|XP_009388213.1| PREDICTED: vacuolar-sorting receptor 1-like [Musa acuminata subsp. 
malaccensis]
Length=529

 Score =   122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 66/82 (80%), Gaps = 5/82 (6%)
 Frame = +1

Query  325  LLWFL-----LCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVY  489
            +LW L     LCG+C GRFVVEKNSLKVTSP S+K +YE AIGNFG+PQYGG+MVG V Y
Sbjct  5    MLWLLVPVLFLCGTCWGRFVVEKNSLKVTSPNSLKGIYESAIGNFGVPQYGGTMVGIVAY  64

Query  490  PKANQKACKSFDDFDVSFKSKP  555
            PK N KAC +F DFD+S+KSKP
Sbjct  65   PKVNWKACHNFKDFDISYKSKP  86



>ref|NP_180588.1| vacuolar-sorting receptor 2 [Arabidopsis thaliana]
 sp|O22925.1|VSR2_ARATH RecName: Full=Vacuolar-sorting receptor 2; Short=AtVSR2; AltName: 
Full=BP80-like protein c; Short=AtBP80c; AltName: Full=Epidermal 
growth factor receptor-like protein 4; Short=AtELP4; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC16948.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|ABE65874.1| vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AEC08366.1| vacuolar-sorting receptor 2 [Arabidopsis thaliana]
Length=625

 Score =   122 bits (306),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 54/80 (68%), Positives = 69/80 (86%), Gaps = 1/80 (1%)
 Frame = +1

Query  316  IVCLLWFLL-CGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  492
            +V ++W  +   SC GRFVVEKN+L+VTSPESI+ +YECA+GNFG+PQYGGSM G VVYP
Sbjct  8    LVVIVWVTVGWSSCTGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVVYP  67

Query  493  KANQKACKSFDDFDVSFKSK  552
            K NQKACK+FDDF++SF+S+
Sbjct  68   KTNQKACKNFDDFEISFRSR  87



>ref|XP_008388357.1| PREDICTED: vacuolar-sorting receptor 1-like [Malus domestica]
Length=626

 Score =   122 bits (306),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 67/83 (81%), Gaps = 1/83 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            LG +VC+ WFLLC  C+GRFVVEKN LKVTSP S+K  YECAIGNFG+P YGG++VGTV 
Sbjct  5    LGFLVCV-WFLLCRVCVGRFVVEKNRLKVTSPSSMKGDYECAIGNFGVPPYGGTLVGTVY  63

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPK NQ ACK F+D D +FK KP
Sbjct  64   YPKTNQMACKGFEDTDETFKPKP  86



>ref|NP_001189637.1| vacuolar-sorting receptor 2 [Arabidopsis thaliana]
 gb|AEC08367.1| vacuolar-sorting receptor 2 [Arabidopsis thaliana]
Length=641

 Score =   122 bits (306),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 54/80 (68%), Positives = 69/80 (86%), Gaps = 1/80 (1%)
 Frame = +1

Query  316  IVCLLWFLL-CGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  492
            +V ++W  +   SC GRFVVEKN+L+VTSPESI+ +YECA+GNFG+PQYGGSM G VVYP
Sbjct  8    LVVIVWVTVGWSSCTGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVVYP  67

Query  493  KANQKACKSFDDFDVSFKSK  552
            K NQKACK+FDDF++SF+S+
Sbjct  68   KTNQKACKNFDDFEISFRSR  87



>ref|XP_010515761.1| PREDICTED: vacuolar-sorting receptor 1-like [Camelina sativa]
Length=626

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
            L + L+    L RFVVEKN+LKVTSPESIK +YECAIGNFG+PQYGG++VGTVVYPK+NQ
Sbjct  11   LSFLLILNLALCRFVVEKNNLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYPKSNQ  70

Query  505  KACKSFDDFDVSFKSKP  555
            KACKS+ DFD+SFKSKP
Sbjct  71   KACKSYTDFDISFKSKP  87



>ref|XP_009125765.1| PREDICTED: LOW QUALITY PROTEIN: vacuolar-sorting receptor 2 [Brassica 
rapa]
Length=643

 Score =   122 bits (305),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  349  SCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDD  528
            SC+GRFVVEKNSL+VTS E I+ +YECA+GNFG+PQYGGSM G+VVYPKANQKACK+F+D
Sbjct  30   SCMGRFVVEKNSLRVTSAEFIRGIYECALGNFGVPQYGGSMSGSVVYPKANQKACKNFED  89

Query  529  FDVSFKSK  552
            FD+SF+S+
Sbjct  90   FDISFRSR  97



>emb|CDX78128.1| BnaA09g33230D [Brassica napus]
Length=625

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +1

Query  334  FLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKAC  513
             L+ G  +GRFVVEKN+LKVTSP+SIK +YECAIGNFG+PQYGG++VGTVVYPK+NQKAC
Sbjct  14   LLILGLAMGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKAC  73

Query  514  KSFDDFDVSFKSK  552
            KS+ DFD++FKSK
Sbjct  74   KSYSDFDITFKSK  86



>tpg|DAA39320.1| TPA: hypothetical protein ZEAMMB73_030788 [Zea mays]
Length=143

 Score =   114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 68/83 (82%), Gaps = 2/83 (2%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            L L+VC    LL G C GRFVV+KN+LKVT+P+ +K  YECAIGNF +PQYG +MVG V 
Sbjct  10   LQLLVCAT--LLLGCCHGRFVVDKNNLKVTAPDDLKGTYECAIGNFEVPQYGDTMVGFVA  67

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPKAN+KACKSF+DFD+++K+KP
Sbjct  68   YPKANRKACKSFEDFDINYKAKP  90



>ref|NP_001169650.1| hypothetical protein precursor [Zea mays]
 gb|ACN34397.1| unknown [Zea mays]
Length=521

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +1

Query  346  GSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFD  525
            G C GRFVVEKNSLKVT+P+ +K  YECAIGNFG+PQYGG+MVG V YPKAN+KACKSFD
Sbjct  20   GCCQGRFVVEKNSLKVTAPDGLKGTYECAIGNFGVPQYGGTMVGFVAYPKANRKACKSFD  79

Query  526  DFDVSFKSKP  555
            DFD+S+K+KP
Sbjct  80   DFDISYKAKP  89



>emb|CDY13344.1| BnaC06g14130D [Brassica napus]
Length=625

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
            L + L+    L RFVVEKN+LKVTSP+SIK +YECAIGNFG+PQYGG++VGTV YPK+NQ
Sbjct  11   LSFLLILSPALCRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVAYPKSNQ  70

Query  505  KACKSFDDFDVSFKSKP  555
            KACKS++DFD+SFKSKP
Sbjct  71   KACKSYNDFDISFKSKP  87



>dbj|BAK03786.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=695

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +1

Query  340  LCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKS  519
             C  C GRFVVEKNSLKVT+P+S+K  YECAIGNFG+PQYGG+MVG V YPKAN+KACKS
Sbjct  90   FCCCCEGRFVVEKNSLKVTAPDSLKGSYECAIGNFGVPQYGGTMVGVVAYPKANRKACKS  149

Query  520  FDDFDVSFKSKP  555
            FDDFD+S+K+KP
Sbjct  150  FDDFDISYKAKP  161



>emb|CDX67539.1| BnaA07g15790D [Brassica napus]
Length=625

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
            L + L+    L RFVVEKN+LKVTSP+SIK +YECAIGNFG+PQYGG++VGTV YP++NQ
Sbjct  11   LSFLLISSPALCRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVAYPRSNQ  70

Query  505  KACKSFDDFDVSFKSKP  555
            KACKS++DFD+SFKSKP
Sbjct  71   KACKSYNDFDISFKSKP  87



>ref|XP_008677615.1| PREDICTED: uncharacterized protein LOC100383531 isoform X1 [Zea 
mays]
 gb|AFW64625.1| hypothetical protein ZEAMMB73_291086 [Zea mays]
Length=623

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +1

Query  346  GSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFD  525
            G C GRFVVEKNSLKVT+P+ +K  YECAIGNFG+PQYGG+MVG V YPKAN+KACKSFD
Sbjct  20   GCCQGRFVVEKNSLKVTAPDGLKGTYECAIGNFGVPQYGGTMVGFVAYPKANRKACKSFD  79

Query  526  DFDVSFKSKP  555
            DFD+S+K+KP
Sbjct  80   DFDISYKAKP  89



>gb|KHF97360.1| Vacuolar-sorting receptor 3 -like protein [Gossypium arboreum]
Length=628

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 65/81 (80%), Gaps = 1/81 (1%)
 Frame = +1

Query  316  IVCLLWFLLCGSCL-GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  492
            +V   W LLC  C  GRFVVEKNSL VTSPE IK  Y+ AIGNFGIPQYGGSM GTVVYP
Sbjct  9    VVLSFWLLLCIGCSDGRFVVEKNSLTVTSPEKIKGTYDSAIGNFGIPQYGGSMAGTVVYP  68

Query  493  KANQKACKSFDDFDVSFKSKP  555
            K NQKACK+FD+F +SF+SKP
Sbjct  69   KDNQKACKAFDEFSISFQSKP  89



>ref|XP_009125234.1| PREDICTED: vacuolar-sorting receptor 1-like [Brassica rapa]
Length=625

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
            L + L+    L RFVVEKN+LKVTSP+SIK +YECAIGNFG+PQYGG++VGTV YP++NQ
Sbjct  11   LSFLLILSPALCRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVAYPRSNQ  70

Query  505  KACKSFDDFDVSFKSKP  555
            KACKS++DFD+SFKSKP
Sbjct  71   KACKSYNDFDISFKSKP  87



>gb|EMT19677.1| Vacuolar-sorting receptor 1 [Aegilops tauschii]
Length=618

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +1

Query  340  LCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKS  519
             C  C GRFVVEKNSLKVT+P+S+K  YECAIGNFG+PQYGG+MVG V YPK+N+KACKS
Sbjct  15   FCCCCEGRFVVEKNSLKVTAPDSLKGSYECAIGNFGVPQYGGTMVGVVAYPKSNRKACKS  74

Query  520  FDDFDVSFKSKP  555
            FDDFD+S+K+KP
Sbjct  75   FDDFDISYKAKP  86



>emb|CDX73599.1| BnaC08g24040D [Brassica napus]
Length=625

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +1

Query  334  FLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKAC  513
             L+    +GRFVVEKN+LKVTSP+SIK +YECAIGNFG+PQYGG++VGTVVYPK+NQKAC
Sbjct  14   LLILSLAVGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKAC  73

Query  514  KSFDDFDVSFKSK  552
            KS+ DFD+SFKSK
Sbjct  74   KSYSDFDISFKSK  86



>ref|XP_003626680.1| Vacuolar sorting receptor [Medicago truncatula]
 gb|AET01156.1| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=625

 Score =   119 bits (299),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +1

Query  328  LWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQK  507
            +W  LCGSC+GRFVVEKN+LK+TSP+S++ +YECAIGNFG+P+YGG+M+GTVVYPK N+ 
Sbjct  11   VWIYLCGSCMGRFVVEKNNLKITSPKSLRGIYECAIGNFGVPKYGGTMIGTVVYPKLNKN  70

Query  508  ACKSFDDFDVSFKSKP  555
             C  F+D D S  SKP
Sbjct  71   GCTKFNDADTSLNSKP  86



>ref|XP_003579018.1| PREDICTED: vacuolar-sorting receptor 1 [Brachypodium distachyon]
Length=623

 Score =   119 bits (298),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  352  CLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDF  531
            C GRFVVEKNSLKVT+P++++  YECAIGNFG+PQYGG+MVG V YPKAN+KACKSFDDF
Sbjct  23   CEGRFVVEKNSLKVTAPDALRGTYECAIGNFGVPQYGGTMVGVVAYPKANRKACKSFDDF  82

Query  532  DVSFKSKP  555
            D+S+K+KP
Sbjct  83   DISYKAKP  90



>ref|XP_009115984.1| PREDICTED: vacuolar-sorting receptor 1 [Brassica rapa]
Length=625

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +1

Query  334  FLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKAC  513
             L+    +GRFVVEKN+LKVTSP+SIK +YECAIGNFG+PQYGG++VGTVVYPK+NQKAC
Sbjct  14   LLILSVAVGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKAC  73

Query  514  KSFDDFDVSFKSK  552
            KS+ DFD++FKSK
Sbjct  74   KSYSDFDITFKSK  86



>ref|XP_004510100.1| PREDICTED: vacuolar-sorting receptor 1-like [Cicer arietinum]
Length=629

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 68/83 (82%), Gaps = 1/83 (1%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            L  ++C+ W  LCGSC+GRFVVEKN+LK+TSP+S++ +YECAIGNFG+P+YGG+M+GTVV
Sbjct  7    LTFLLCV-WIFLCGSCVGRFVVEKNNLKITSPKSLRGIYECAIGNFGVPKYGGTMIGTVV  65

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPK N+  C  F+D D S  SKP
Sbjct  66   YPKFNRNGCNKFNDGDTSLTSKP  88



>ref|XP_011095146.1| PREDICTED: vacuolar-sorting receptor 1-like [Sesamum indicum]
Length=624

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +1

Query  334  FLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKAC  513
            FLL  SC GRFVVEKNSLKV SP+S+K L+ECAIGNFG+PQYGG++VG+V YPK+NQKAC
Sbjct  13   FLLLASCFGRFVVEKNSLKVASPDSLKGLHECAIGNFGVPQYGGTLVGSVFYPKSNQKAC  72

Query  514  KSFDDFDVSFKSKP  555
             +F D D+SF++KP
Sbjct  73   TNFQDVDLSFQTKP  86



>gb|KJB32253.1| hypothetical protein B456_005G231800 [Gossypium raimondii]
Length=559

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +1

Query  346  GSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFD  525
            G+C  RFVVEKNSL++TSPE IK  Y+ AIGNFGIPQYGGSM G VVYPK NQK CKSFD
Sbjct  22   GNCYARFVVEKNSLRLTSPEKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKENQKGCKSFD  81

Query  526  DFDVSFKSKP  555
            DF +SFKSKP
Sbjct  82   DFGISFKSKP  91



>ref|XP_003521852.1| PREDICTED: vacuolar-sorting receptor 1-like [Glycine max]
Length=624

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 66/76 (87%), Gaps = 3/76 (4%)
 Frame = +1

Query  328  LWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQK  507
            LW LLCGSC+GRFVVEKN+LK+TSP+S++ +YECAIGNFG+P+YGG+M+G+VVYPK+NQ 
Sbjct  13   LWILLCGSCVGRFVVEKNNLKITSPKSLRGIYECAIGNFGVPKYGGTMIGSVVYPKSNQN  72

Query  508  ACKSFDDFDVSFKSKP  555
             C+   +FD S  SKP
Sbjct  73   GCR---NFDASLSSKP  85



>gb|KHN42141.1| Vacuolar-sorting receptor 2 [Glycine soja]
Length=622

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 66/76 (87%), Gaps = 3/76 (4%)
 Frame = +1

Query  328  LWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQK  507
            LW LLCGSC+GRFVVEKN+LK+TSP+S++ +YECAIGNFG+P+YGG+M+G+VVYPK+NQ 
Sbjct  11   LWILLCGSCVGRFVVEKNNLKITSPKSLRGIYECAIGNFGVPKYGGTMIGSVVYPKSNQN  70

Query  508  ACKSFDDFDVSFKSKP  555
             C+   +FD S  SKP
Sbjct  71   GCR---NFDASLSSKP  83



>ref|XP_004173121.1| PREDICTED: vacuolar-sorting receptor 3-like, partial [Cucumis 
sativus]
Length=517

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
            LLW  L   C+GRFVVEKNSL+VTSPE I+  Y+ AIGNFGIPQYGGS+ G VVYPK NQ
Sbjct  14   LLWLSLVPLCMGRFVVEKNSLRVTSPEKIRGTYDSAIGNFGIPQYGGSLAGVVVYPKENQ  73

Query  505  KACKSFDDFDVSFKSKP  555
            K CK F DF +SF+SKP
Sbjct  74   KGCKDFGDFHISFQSKP  90



>ref|XP_006842496.1| hypothetical protein AMTR_s00077p00095230 [Amborella trichopoda]
 gb|ERN04171.1| hypothetical protein AMTR_s00077p00095230 [Amborella trichopoda]
Length=622

 Score =   117 bits (294),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 54/82 (66%), Positives = 68/82 (83%), Gaps = 1/82 (1%)
 Frame = +1

Query  313  LIVCLLWF-LLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVY  489
            L+  L+W  L+     GRFVVEKNSL+VTSP+S+KD YECAIGNFG+PQYGG+MVGTV Y
Sbjct  4    LLCLLVWASLIWVPVYGRFVVEKNSLRVTSPDSLKDTYECAIGNFGVPQYGGTMVGTVTY  63

Query  490  PKANQKACKSFDDFDVSFKSKP  555
            PK+NQKAC+ + + ++SFKSKP
Sbjct  64   PKSNQKACREYKEVEISFKSKP  85



>gb|KJB79450.1| hypothetical protein B456_013G050300 [Gossypium raimondii]
Length=628

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 63/81 (78%), Gaps = 1/81 (1%)
 Frame = +1

Query  316  IVCLLWFLLCGSCL-GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  492
            +V   W LLC  C  GRFVVEKNSL VTSPE IK  Y+ AIGNFGIPQYGGSM GTVVYP
Sbjct  9    VVLSFWLLLCIGCSDGRFVVEKNSLTVTSPEKIKGTYDSAIGNFGIPQYGGSMAGTVVYP  68

Query  493  KANQKACKSFDDFDVSFKSKP  555
            K NQK CK+FD+F +SF SKP
Sbjct  69   KDNQKGCKAFDEFSISFPSKP  89



>ref|XP_010043186.1| PREDICTED: vacuolar-sorting receptor 1-like [Eucalyptus grandis]
 gb|KCW88338.1| hypothetical protein EUGRSUZ_A00725 [Eucalyptus grandis]
Length=632

 Score =   117 bits (293),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 52/70 (74%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +1

Query  346  GSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFD  525
            G C GRFVV+KNSLKVTSP S+K  +ECAIGNFG+PQYGG++VGTVVYP ANQ ACK F 
Sbjct  23   GGCEGRFVVQKNSLKVTSPNSMKGAHECAIGNFGVPQYGGTLVGTVVYPSANQHACKEFR  82

Query  526  DFDVSFKSKP  555
            +FD+SFK+KP
Sbjct  83   EFDLSFKTKP  92



>ref|XP_003529053.2| PREDICTED: vacuolar-sorting receptor 1-like [Glycine max]
 gb|KHN25078.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=624

 Score =   116 bits (291),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 66/76 (87%), Gaps = 3/76 (4%)
 Frame = +1

Query  328  LWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQK  507
            +W LLCGSC+GRFVVEKN+LK+TSP+S++ +YECAIGNFG+P+YGG+M+G+VVYPK+NQ 
Sbjct  13   VWILLCGSCVGRFVVEKNNLKITSPKSLRGIYECAIGNFGVPKYGGTMIGSVVYPKSNQN  72

Query  508  ACKSFDDFDVSFKSKP  555
             C+   +FD S  SKP
Sbjct  73   GCR---NFDASLSSKP  85



>ref|XP_004152276.1| PREDICTED: vacuolar-sorting receptor 3-like [Cucumis sativus]
 gb|KGN52769.1| hypothetical protein Csa_4G000880 [Cucumis sativus]
Length=632

 Score =   116 bits (291),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
            LLW  L   C+GRFVVEKNSL+VTSPE I+  Y+ AIGNFGIPQYGGS+ G VVYPK NQ
Sbjct  14   LLWLSLVPLCMGRFVVEKNSLRVTSPEKIRGTYDSAIGNFGIPQYGGSLAGVVVYPKENQ  73

Query  505  KACKSFDDFDVSFKSKP  555
            K CK F DF +SF+SKP
Sbjct  74   KGCKDFGDFHISFQSKP  90



>gb|KJB32254.1| hypothetical protein B456_005G231800 [Gossypium raimondii]
Length=600

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +1

Query  346  GSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFD  525
            G+C  RFVVEKNSL++TSPE IK  Y+ AIGNFGIPQYGGSM G VVYPK NQK CKSFD
Sbjct  22   GNCYARFVVEKNSLRLTSPEKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKENQKGCKSFD  81

Query  526  DFDVSFKSKP  555
            DF +SFKSKP
Sbjct  82   DFGISFKSKP  91



>gb|KJB32252.1| hypothetical protein B456_005G231800 [Gossypium raimondii]
Length=630

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +1

Query  346  GSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFD  525
            G+C  RFVVEKNSL++TSPE IK  Y+ AIGNFGIPQYGGSM G VVYPK NQK CKSFD
Sbjct  22   GNCYARFVVEKNSLRLTSPEKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKENQKGCKSFD  81

Query  526  DFDVSFKSKP  555
            DF +SFKSKP
Sbjct  82   DFGISFKSKP  91



>gb|EEC82690.1| hypothetical protein OsI_27347 [Oryza sativa Indica Group]
Length=626

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +1

Query  340  LCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKS  519
            + G   GRFVVEKNSL+VTSP  ++ +YECAIGNFG+PQYGG+M G VVYPKAN+KAC+S
Sbjct  16   MAGEAAGRFVVEKNSLRVTSPAGLRGVYECAIGNFGMPQYGGTMHGVVVYPKANKKACRS  75

Query  520  FDDFDVSFKSKP  555
            FDDFD+SFK KP
Sbjct  76   FDDFDLSFKPKP  87



>ref|NP_001060643.1| Os07g0680000 [Oryza sativa Japonica Group]
 dbj|BAC80001.1| putative vacuolar targeting receptor [Oryza sativa Japonica Group]
 dbj|BAD31218.1| putative vacuolar targeting receptor [Oryza sativa Japonica Group]
 dbj|BAF22557.1| Os07g0680000 [Oryza sativa Japonica Group]
 gb|EAZ41102.1| hypothetical protein OsJ_25594 [Oryza sativa Japonica Group]
 dbj|BAG93090.1| unnamed protein product [Oryza sativa Japonica Group]
Length=626

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +1

Query  340  LCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKS  519
            + G   GRFVVEKNSL+VTSP  ++ +YECAIGNFG+PQYGG+M G VVYPKAN+KAC+S
Sbjct  16   MAGEAAGRFVVEKNSLRVTSPAGLRGVYECAIGNFGMPQYGGTMHGVVVYPKANKKACRS  75

Query  520  FDDFDVSFKSKP  555
            FDDFD+SFK KP
Sbjct  76   FDDFDLSFKPKP  87



>gb|EYU35791.1| hypothetical protein MIMGU_mgv1a002876mg [Erythranthe guttata]
Length=628

 Score =   115 bits (288),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 50/68 (74%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  352  CLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDF  531
            CLGRFVVEKN+LKVTSPES++ +YECAIGNFG+PQYGG MVG+V YPK NQK C +F D 
Sbjct  22   CLGRFVVEKNNLKVTSPESVRGVYECAIGNFGVPQYGGVMVGSVFYPKTNQKGCNTFQDS  81

Query  532  DVSFKSKP  555
            D+S K+KP
Sbjct  82   DLSSKTKP  89



>ref|XP_011086922.1| PREDICTED: vacuolar-sorting receptor 1-like [Sesamum indicum]
Length=631

 Score =   115 bits (287),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 53/85 (62%), Positives = 70/85 (82%), Gaps = 4/85 (5%)
 Frame = +1

Query  310  GLIVCLLWFLLCGS---CLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGT  480
            G++ C+   LL GS   C GRFVVEKN+L+VTSP S++ +YECAIGNFG+PQYGG+M+G+
Sbjct  10   GVLACICLILL-GSLPCCWGRFVVEKNNLRVTSPGSVRGIYECAIGNFGVPQYGGTMLGS  68

Query  481  VVYPKANQKACKSFDDFDVSFKSKP  555
            V YPKANQKAC +F D D+++K+KP
Sbjct  69   VFYPKANQKACNTFQDSDITWKNKP  93



>ref|XP_002527509.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF34907.1| zinc finger protein, putative [Ricinus communis]
Length=633

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
            L+  L+  SC+GRFVVEKNSL+VTSP+ IK  Y+ AIGNFGIPQYGGSM G V YPK N+
Sbjct  18   LVACLMVSSCVGRFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVTYPKDNK  77

Query  505  KACKSFDDFDVSFKSKP  555
            K CK FDDF VSFKS+P
Sbjct  78   KGCKEFDDFGVSFKSRP  94



>ref|XP_006663158.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=653

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = +1

Query  349  SCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDD  528
            +C G FVVEKNSL+VT+P  +K  YECAIGNFG+PQYGG+MVG V YPKAN+KACKSFDD
Sbjct  51   ACRGGFVVEKNSLRVTAPSDLKGTYECAIGNFGVPQYGGTMVGVVAYPKANKKACKSFDD  110

Query  529  FDVSFKSKP  555
            FD+S+K KP
Sbjct  111  FDISYKPKP  119



>gb|KJB12290.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=532

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 61/77 (79%), Gaps = 2/77 (3%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
            LL F+   +C  RFVVEKNSL VTSPE IK  ++ AIGNFGIPQYGGSM G VVYPK NQ
Sbjct  16   LLSFI--SNCCARFVVEKNSLTVTSPEKIKGTHDSAIGNFGIPQYGGSMAGVVVYPKENQ  73

Query  505  KACKSFDDFDVSFKSKP  555
            KACKSF DF +SFKSKP
Sbjct  74   KACKSFGDFGISFKSKP  90



>gb|AIY30334.1| vacuolar-sorting receptor 3 protein, partial [Ziziphus jujuba]
Length=155

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  361  RFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDVS  540
            RFVVEKN+L+VTSPE I+  ++ AIGNFGIPQYGGSM G VVYPK NQK CK F DF +S
Sbjct  29   RFVVEKNNLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGAVVYPKENQKGCKEFTDFGIS  88

Query  541  FKSKP  555
            FKSKP
Sbjct  89   FKSKP  93



>ref|XP_006664280.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=698

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  352  CLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDF  531
            C G F+VEKNSL+VT+P  +K  YECAIGNFG+PQYGG+MVG V YPKAN+KACKSFDDF
Sbjct  97   CHGGFLVEKNSLRVTAPSDLKGTYECAIGNFGVPQYGGTMVGVVTYPKANKKACKSFDDF  156

Query  532  DVSFKSKP  555
            D+S+K KP
Sbjct  157  DISYKPKP  164



>ref|XP_010683480.1| PREDICTED: vacuolar-sorting receptor 1-like [Beta vulgaris subsp. 
vulgaris]
Length=626

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 65/81 (80%), Gaps = 1/81 (1%)
 Frame = +1

Query  313  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  492
            +IV LL  ++   CLGRFVVEKNSLKVTSP S++ +YECAIGNFG+PQYGG+M G V +P
Sbjct  11   VIVSLL-MMMISLCLGRFVVEKNSLKVTSPSSLRGVYECAIGNFGVPQYGGAMGGIVAFP  69

Query  493  KANQKACKSFDDFDVSFKSKP  555
            K+NQK CK F D D+SFK KP
Sbjct  70   KSNQKGCKPFSDDDISFKPKP  90



>gb|KJB12295.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=477

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 61/77 (79%), Gaps = 2/77 (3%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
            LL F+   +C  RFVVEKNSL VTSPE IK  ++ AIGNFGIPQYGGSM G VVYPK NQ
Sbjct  16   LLSFI--SNCCARFVVEKNSLTVTSPEKIKGTHDSAIGNFGIPQYGGSMAGVVVYPKENQ  73

Query  505  KACKSFDDFDVSFKSKP  555
            KACKSF DF +SFKSKP
Sbjct  74   KACKSFGDFGISFKSKP  90



>emb|CDY37219.1| BnaA09g08400D [Brassica napus]
Length=624

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  352  CLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDF  531
            C  RFVVEKNSL VTSP+SIK  ++CAIGNFGIPQYGGSM GTVVYPK NQK+CK F DF
Sbjct  18   CESRFVVEKNSLSVTSPDSIKGAHDCAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDF  77

Query  532  DVSFKSKP  555
             +SFKS+P
Sbjct  78   SISFKSQP  85



>ref|XP_009123210.1| PREDICTED: vacuolar-sorting receptor 3-like [Brassica rapa]
Length=624

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  352  CLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDF  531
            C  RFVVEKNSL VTSP+SIK  ++CAIGNFGIPQYGGSM GTVVYPK NQK+CK F DF
Sbjct  18   CESRFVVEKNSLSVTSPDSIKGAHDCAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDF  77

Query  532  DVSFKSKP  555
             +SFKS+P
Sbjct  78   SISFKSQP  85



>emb|CDX81459.1| BnaC09g08700D [Brassica napus]
Length=624

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  352  CLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDF  531
            C  RFVVEKNSL VTSP+SIK  ++CAIGNFGIPQYGGSM GTVVYPK NQK+CK F DF
Sbjct  18   CESRFVVEKNSLSVTSPDSIKGAHDCAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDF  77

Query  532  DVSFKSKP  555
             +SFKS+P
Sbjct  78   SISFKSQP  85



>ref|XP_006409638.1| hypothetical protein EUTSA_v10022598mg [Eutrema salsugineum]
 gb|ESQ51091.1| hypothetical protein EUTSA_v10022598mg [Eutrema salsugineum]
Length=626

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = +1

Query  349  SCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDD  528
            SC  RFVVEKNSL VTSPESIK  ++ AIGNFGIPQYGGSM GTVVYPK NQK+CK F D
Sbjct  19   SCEARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSD  78

Query  529  FDVSFKSKP  555
            F +SFKS+P
Sbjct  79   FSISFKSQP  87



>ref|XP_007134557.1| hypothetical protein PHAVU_010G057200g [Phaseolus vulgaris]
 gb|ESW06551.1| hypothetical protein PHAVU_010G057200g [Phaseolus vulgaris]
Length=625

 Score =   111 bits (278),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 62/76 (82%), Gaps = 3/76 (4%)
 Frame = +1

Query  328  LWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQK  507
            +W LLCGSC+G FVVEKN+LK+TSP S+K +YECAIGNFG+P+YGG+M+G+VVYPK +Q 
Sbjct  14   VWILLCGSCVGTFVVEKNNLKITSPNSLKGIYECAIGNFGVPKYGGTMIGSVVYPKTDQN  73

Query  508  ACKSFDDFDVSFKSKP  555
             CK FD    S  SKP
Sbjct  74   GCKPFDS---SLSSKP  86



>ref|XP_007042634.1| Vaculolar sorting receptor 3 isoform 2, partial [Theobroma cacao]
 gb|EOX98465.1| Vaculolar sorting receptor 3 isoform 2, partial [Theobroma cacao]
Length=501

 Score =   110 bits (275),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = +1

Query  313  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  492
            L+V  +   + G+C  RFVVEKNSL VTSPE IK  ++ AIGNFGIPQYGGSM G V+YP
Sbjct  7    LLVGFVLLSVIGNCYARFVVEKNSLMVTSPEKIKGTHDSAIGNFGIPQYGGSMAGAVIYP  66

Query  493  KANQKACKSFDDFDVSFKSKP  555
            K N+K CK FD+F +SF+SKP
Sbjct  67   KENRKGCKGFDEFGISFQSKP  87



>ref|XP_010547949.1| PREDICTED: vacuolar-sorting receptor 3-like [Tarenaya hassleriana]
Length=635

 Score =   111 bits (278),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  352  CLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDF  531
            C  RFVVEKNSL VTSPESIK  ++ AIGNFG+PQYGGSM GTVVYPK NQKACK F DF
Sbjct  29   CDARFVVEKNSLSVTSPESIKGTHDSAIGNFGVPQYGGSMAGTVVYPKENQKACKEFSDF  88

Query  532  DVSFKSKP  555
             +SFKS+P
Sbjct  89   SISFKSQP  96



>gb|KJB12292.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
 gb|KJB12293.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=629

 Score =   111 bits (277),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 61/77 (79%), Gaps = 2/77 (3%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
            LL F+   +C  RFVVEKNSL VTSPE IK  ++ AIGNFGIPQYGGSM G VVYPK NQ
Sbjct  16   LLSFI--SNCCARFVVEKNSLTVTSPEKIKGTHDSAIGNFGIPQYGGSMAGVVVYPKENQ  73

Query  505  KACKSFDDFDVSFKSKP  555
            KACKSF DF +SFKSKP
Sbjct  74   KACKSFGDFGISFKSKP  90



>gb|KJB12291.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=624

 Score =   110 bits (276),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 61/77 (79%), Gaps = 2/77 (3%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
            LL F+   +C  RFVVEKNSL VTSPE IK  ++ AIGNFGIPQYGGSM G VVYPK NQ
Sbjct  16   LLSFI--SNCCARFVVEKNSLTVTSPEKIKGTHDSAIGNFGIPQYGGSMAGVVVYPKENQ  73

Query  505  KACKSFDDFDVSFKSKP  555
            KACKSF DF +SFKSKP
Sbjct  74   KACKSFGDFGISFKSKP  90



>gb|KJB12294.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=604

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 61/77 (79%), Gaps = 2/77 (3%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
            LL F+   +C  RFVVEKNSL VTSPE IK  ++ AIGNFGIPQYGGSM G VVYPK NQ
Sbjct  16   LLSFI--SNCCARFVVEKNSLTVTSPEKIKGTHDSAIGNFGIPQYGGSMAGVVVYPKENQ  73

Query  505  KACKSFDDFDVSFKSKP  555
            KACKSF DF +SFKSKP
Sbjct  74   KACKSFGDFGISFKSKP  90



>ref|NP_001050034.1| Os03g0335300 [Oryza sativa Japonica Group]
 gb|ABF95810.1| Vacuolar sorting receptor 1 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11948.1| Os03g0335300 [Oryza sativa Japonica Group]
 dbj|BAG93773.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00476.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC75202.1| hypothetical protein OsI_11454 [Oryza sativa Indica Group]
 gb|EEE59012.1| hypothetical protein OsJ_10747 [Oryza sativa Japonica Group]
Length=628

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
            GRFVVEKNSL+VTSPE IK  YECAIGNFG+PQYGG++ G V YPK+NQKACKSF+DFD+
Sbjct  22   GRFVVEKNSLRVTSPEGIKGKYECAIGNFGVPQYGGTLHGWVEYPKSNQKACKSFEDFDI  81

Query  538  SFKS  549
            SFKS
Sbjct  82   SFKS  85



>ref|XP_010547948.1| PREDICTED: vacuolar-sorting receptor 3 [Tarenaya hassleriana]
Length=635

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  352  CLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDF  531
            C  RFVVEKNSL VTSPESIK  ++ AIGNFG+PQYGGSM GTVVYPK N KACK F DF
Sbjct  29   CDARFVVEKNSLSVTSPESIKGTHDSAIGNFGVPQYGGSMAGTVVYPKENHKACKEFSDF  88

Query  532  DVSFKSKP  555
             +SFKS+P
Sbjct  89   SISFKSQP  96



>ref|XP_007042633.1| Vaculolar sorting receptor 3 isoform 1 [Theobroma cacao]
 gb|EOX98464.1| Vaculolar sorting receptor 3 isoform 1 [Theobroma cacao]
Length=626

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = +1

Query  313  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  492
            L+V  +   + G+C  RFVVEKNSL VTSPE IK  ++ AIGNFGIPQYGGSM G V+YP
Sbjct  7    LLVGFVLLSVIGNCYARFVVEKNSLMVTSPEKIKGTHDSAIGNFGIPQYGGSMAGAVIYP  66

Query  493  KANQKACKSFDDFDVSFKSKP  555
            K N+K CK FD+F +SF+SKP
Sbjct  67   KENRKGCKGFDEFGISFQSKP  87



>gb|EMS62484.1| Vacuolar-sorting receptor 1 [Triticum urartu]
Length=925

 Score =   110 bits (276),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 46/62 (74%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +1

Query  370  VEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDVSFKS  549
            +EKNSL+VT+PE++K  YECAIGNFG+PQYGG+MVG V YPKAN+KACK FD+FDVSFK+
Sbjct  330  LEKNSLRVTAPEALKGAYECAIGNFGVPQYGGTMVGVVAYPKANRKACKGFDEFDVSFKA  389

Query  550  KP  555
            +P
Sbjct  390  RP  391



>ref|XP_006650048.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=630

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +1

Query  349  SCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDD  528
            +  GRFVVEKNSL+VTSP+SIK  YECAIGNFG+PQYGG++ G V YPK+N+KACKSF+D
Sbjct  21   TAAGRFVVEKNSLRVTSPDSIKGKYECAIGNFGVPQYGGTLHGWVEYPKSNRKACKSFED  80

Query  529  FDVSFKS  549
            FD+SFKS
Sbjct  81   FDISFKS  87



>ref|XP_006409641.1| hypothetical protein EUTSA_v10022594mg [Eutrema salsugineum]
 gb|ESQ51094.1| hypothetical protein EUTSA_v10022594mg [Eutrema salsugineum]
Length=631

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  352  CLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDF  531
            C  RFVVEKNSL VTSP+SIK  ++ AIGNFGIPQYGGSM GTVVYPK NQK+CK F DF
Sbjct  25   CKARFVVEKNSLSVTSPDSIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDF  84

Query  532  DVSFKSKP  555
             +SFKS+P
Sbjct  85   SISFKSQP  92



>ref|XP_008454393.1| PREDICTED: vacuolar-sorting receptor 4-like isoform X2 [Cucumis 
melo]
Length=632

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  352  CLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDF  531
            C+ RFVVEKNSL+VTSPE I+  Y+ AIGNFGIPQYGGS+ G VVYPK NQK CK F DF
Sbjct  23   CMARFVVEKNSLRVTSPEKIRGTYDSAIGNFGIPQYGGSLAGVVVYPKENQKGCKDFSDF  82

Query  532  DVSFKSKP  555
             +SF+SKP
Sbjct  83   HISFQSKP  90



>ref|XP_008454392.1| PREDICTED: vacuolar-sorting receptor 4-like isoform X1 [Cucumis 
melo]
Length=633

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  352  CLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDF  531
            C+ RFVVEKNSL+VTSPE I+  Y+ AIGNFGIPQYGGS+ G VVYPK NQK CK F DF
Sbjct  23   CMARFVVEKNSLRVTSPEKIRGTYDSAIGNFGIPQYGGSLAGVVVYPKENQKGCKDFSDF  82

Query  532  DVSFKSKP  555
             +SF+SKP
Sbjct  83   HISFQSKP  90



>ref|XP_010488908.1| PREDICTED: vacuolar-sorting receptor 4 [Camelina sativa]
Length=626

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
             RFVVEKNSL VTSPESIK  ++ AIGNFGIPQYGGSM GTVVYPK NQK+CK F DF +
Sbjct  22   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  81

Query  538  SFKSKP  555
            SFKS+P
Sbjct  82   SFKSQP  87



>gb|KDP44487.1| hypothetical protein JCGZ_16320 [Jatropha curcas]
Length=630

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 63/85 (74%), Gaps = 3/85 (4%)
 Frame = +1

Query  310  GLIVCL---LWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGT  480
            G  VCL   L +L+    + RFVVEKNSL+VTSP+ IK  Y+ AIGNFGIPQYGGSM G 
Sbjct  7    GFTVCLGFLLMYLMVTGSVARFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGA  66

Query  481  VVYPKANQKACKSFDDFDVSFKSKP  555
            V YPK N+K CK F+DF +SFKS+P
Sbjct  67   VTYPKDNRKGCKDFNDFGLSFKSQP  91



>gb|KHN05603.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=628

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 62/80 (78%), Gaps = 4/80 (5%)
 Frame = +1

Query  328  LWF----LLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPK  495
            LWF    L+  S +GRFVVEKNSL+VTSPE I+  ++ AIGNFGIPQYGGSM G V+YPK
Sbjct  10   LWFVGLVLVPVSIMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGNVLYPK  69

Query  496  ANQKACKSFDDFDVSFKSKP  555
             N+K CK FDDF +SFKS P
Sbjct  70   DNKKGCKEFDDFGISFKSSP  89



>ref|XP_010488909.1| PREDICTED: vacuolar-sorting receptor 3 [Camelina sativa]
Length=626

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
             RFVVEKNSL VTSPESIK  ++ AIGNFGIPQYGGSM GTVVYPK NQK+CK F DF +
Sbjct  22   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  81

Query  538  SFKSKP  555
            SFKS+P
Sbjct  82   SFKSQP  87



>ref|XP_003538018.1| PREDICTED: vacuolar-sorting receptor 1-like [Glycine max]
Length=628

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 62/80 (78%), Gaps = 4/80 (5%)
 Frame = +1

Query  328  LWF----LLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPK  495
            LWF    L+  S +GRFVVEKNSL+VTSPE I+  ++ AIGNFGIPQYGGSM G V+YPK
Sbjct  10   LWFVGLVLVPVSIMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGNVLYPK  69

Query  496  ANQKACKSFDDFDVSFKSKP  555
             N+K CK FDDF +SFKS P
Sbjct  70   DNKKGCKEFDDFGISFKSSP  89



>ref|XP_006658133.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=630

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +1

Query  340  LCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKS  519
            + G   GRFV EKNSL+VTSP  ++ +YECAIGNFG+PQYGG+M G VVYPKAN+KACK+
Sbjct  20   MAGEAAGRFVGEKNSLRVTSPAGLRGVYECAIGNFGMPQYGGTMHGVVVYPKANRKACKA  79

Query  520  FDDFDVSFKSK  552
            FD+FD+SFK K
Sbjct  80   FDEFDLSFKPK  90



>gb|KFK39977.1| hypothetical protein AALP_AA3G313900 [Arabis alpina]
Length=626

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
             RFVVEKNSL VTSPESIK  ++ AIGNFGIPQYGGSM GTVVYPK NQK+CK F DF +
Sbjct  23   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  82

Query  538  SFKSKP  555
            SFKS+P
Sbjct  83   SFKSQP  88



>ref|XP_006411071.1| hypothetical protein EUTSA_v10016384mg [Eutrema salsugineum]
 gb|ESQ52524.1| hypothetical protein EUTSA_v10016384mg [Eutrema salsugineum]
Length=622

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +1

Query  316  IVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPK  495
            ++ L + L+    LG+F+VEKN+LKVTSPE+IK +YECAIGNFGIP+YGG++VG VV+P 
Sbjct  7    VITLSFVLILQLALGKFLVEKNNLKVTSPETIKGVYECAIGNFGIPKYGGTLVGAVVHPV  66

Query  496  ANQKACKSFDDFDVSFKSKP  555
            +N KACKSF +F VSFKS P
Sbjct  67   SNHKACKSFSEFGVSFKSTP  86



>gb|KFK39979.1| hypothetical protein AALP_AA3G314200 [Arabis alpina]
Length=627

 Score =   108 bits (271),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
             RFVVEKNSL VTSPESIK  ++ AIGNFGIPQYGGSM GTVVYPK NQK+CK F DF +
Sbjct  23   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  82

Query  538  SFKSKP  555
            SFKS+P
Sbjct  83   SFKSQP  88



>ref|NP_179079.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
 ref|NP_849954.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
 sp|Q56ZQ3.2|VSR4_ARATH RecName: Full=Vacuolar-sorting receptor 4; Short=AtVSR4; AltName: 
Full=BP80-like protein a; Short=AtBP80a; AltName: Full=Epidermal 
growth factor receptor-like protein 2b; Short=AtELP2b; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC24185.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAL32822.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAM15052.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAP37749.1| At2g14720 [Arabidopsis thaliana]
 gb|AEC06326.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
 gb|AEC06327.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
Length=628

 Score =   108 bits (271),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
             RFVVEKNSL VTSPESIK  ++ AIGNFGIPQYGGSM GTVVYPK NQK+CK F DF +
Sbjct  24   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  83

Query  538  SFKSKP  555
            SFKS+P
Sbjct  84   SFKSQP  89



>ref|XP_006300216.1| hypothetical protein CARUB_v10016452mg [Capsella rubella]
 gb|EOA33114.1| hypothetical protein CARUB_v10016452mg [Capsella rubella]
Length=629

 Score =   108 bits (271),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
             RFVVEKNSL VTSPESIK  ++ AIGNFGIPQYGGSM GTVVYPK NQK+CK F DF +
Sbjct  25   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  84

Query  538  SFKSKP  555
            SFKS+P
Sbjct  85   SFKSQP  90



>ref|NP_179081.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
 ref|NP_849955.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
 sp|O80977.1|VSR3_ARATH RecName: Full=Vacuolar-sorting receptor 3; Short=AtVSR3; AltName: 
Full=BP80-like protein a'; Short=AtBP80a'; AltName: Full=Epidermal 
growth factor receptor-like protein 2a; Short=AtELP2a; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC24183.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAM15053.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AEC06328.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
 gb|AEC06329.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
Length=628

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
             RFVVEKNSL VTSPESIK  ++ AIGNFGIPQYGGSM GTVVYPK NQK+CK F DF +
Sbjct  24   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  83

Query  538  SFKSKP  555
            SFKS+P
Sbjct  84   SFKSQP  89



>ref|XP_002885935.1| VSR-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62194.1| VSR-2 [Arabidopsis lyrata subsp. lyrata]
Length=627

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
             RFVVEKNSL VTSPESIK  ++ AIGNFGIPQYGGSM GTVVYPK NQK+CK F DF +
Sbjct  23   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  82

Query  538  SFKSKP  555
            SFKS+P
Sbjct  83   SFKSQP  88



>ref|XP_002883854.1| hypothetical protein ARALYDRAFT_899691 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60113.1| hypothetical protein ARALYDRAFT_899691 [Arabidopsis lyrata subsp. 
lyrata]
Length=627

 Score =   108 bits (270),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
             RFVVEKNSL VTSPESIK  ++ AIGNFGIPQYGGSM GTVVYPK NQK+CK F DF +
Sbjct  23   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  82

Query  538  SFKSKP  555
            SFKS+P
Sbjct  83   SFKSQP  88



>ref|XP_009136249.1| PREDICTED: vacuolar-sorting receptor 3 [Brassica rapa]
Length=631

 Score =   108 bits (270),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
             RFVVEKNSL VTSPESIK  ++ AIGNFGIPQYGGSM GTV+YPK NQK+CK F DF +
Sbjct  27   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVIYPKENQKSCKEFSDFSI  86

Query  538  SFKSKP  555
            SFKS+P
Sbjct  87   SFKSQP  92



>emb|CDY65441.1| BnaCnng47180D [Brassica napus]
Length=631

 Score =   108 bits (270),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
             RFVVEKNSL VTSPESIK  ++ AIGNFGIPQYGGSM GTV+YPK NQK+CK F DF +
Sbjct  27   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVIYPKENQKSCKEFSDFSI  86

Query  538  SFKSKP  555
            SFKS+P
Sbjct  87   SFKSQP  92



>ref|XP_006297095.1| hypothetical protein CARUB_v10013097mg, partial [Capsella rubella]
 gb|EOA29993.1| hypothetical protein CARUB_v10013097mg, partial [Capsella rubella]
Length=698

 Score =   108 bits (270),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
             RFVVEKNSL VTSPESIK  ++ AIGNFGIPQYGGSM GTVVYPK NQK+CK F DF +
Sbjct  94   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  153

Query  538  SFKSKP  555
            SFKS+P
Sbjct  154  SFKSQP  159



>ref|XP_011092498.1| PREDICTED: vacuolar-sorting receptor 3-like [Sesamum indicum]
Length=630

 Score =   108 bits (269),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 62/76 (82%), Gaps = 1/76 (1%)
 Frame = +1

Query  328  LWFLL-CGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
             W L+   + +GRFVVEKNSL+VTSPESIK  ++ AIGNFGIPQYGGSM G VVYPK N+
Sbjct  15   FWVLIFTQAVVGRFVVEKNSLRVTSPESIKGTHDSAIGNFGIPQYGGSMAGIVVYPKDNR  74

Query  505  KACKSFDDFDVSFKSK  552
            K CK+FDDF +SFK+K
Sbjct  75   KGCKNFDDFGISFKAK  90



>gb|KHN30433.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=643

 Score =   108 bits (269),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 63/81 (78%), Gaps = 0/81 (0%)
 Frame = +1

Query  313  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  492
            ++  +L  LL  S +GRFVVEKNSL+VTSPE I+  ++ AIGNFGIPQYGGSM G V+YP
Sbjct  24   VVSLMLVGLLPVSTMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGNVIYP  83

Query  493  KANQKACKSFDDFDVSFKSKP  555
            K N+K CK FD+F +SFKS P
Sbjct  84   KDNKKGCKEFDEFGISFKSTP  104



>ref|XP_003517598.2| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine 
max]
Length=643

 Score =   108 bits (269),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 63/81 (78%), Gaps = 0/81 (0%)
 Frame = +1

Query  313  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  492
            ++  +L  LL  S +GRFVVEKNSL+VTSPE I+  ++ AIGNFGIPQYGGSM G V+YP
Sbjct  24   VVSLMLVGLLPVSTMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGNVIYP  83

Query  493  KANQKACKSFDDFDVSFKSKP  555
            K N+K CK FD+F +SFKS P
Sbjct  84   KDNKKGCKEFDEFGISFKSTP  104



>emb|CDX91478.1| BnaC04g06720D [Brassica napus]
Length=620

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +1

Query  316  IVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPK  495
            ++ L + L+     G F+VEKN+LKVTSP+SIK +YECAIGNFGIP+YGG++VGTVVYP 
Sbjct  5    VLALSFILILELAFGTFLVEKNNLKVTSPDSIKGVYECAIGNFGIPKYGGTLVGTVVYPM  64

Query  496  ANQKACKSFDDFDVSFKSKP  555
            +N K CKSF +F VSFKS P
Sbjct  65   SNHKGCKSFSEFGVSFKSSP  84



>ref|XP_010517675.1| PREDICTED: vacuolar-sorting receptor 4-like [Camelina sativa]
Length=626

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
             RFVVEKNSL VTSPESIK  ++ AIGNFGIPQYGGSM GTVVYPK NQK+CK F DF +
Sbjct  22   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  81

Query  538  SFKSKP  555
            S+KS+P
Sbjct  82   SYKSQP  87



>gb|KEH44022.1| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=529

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = +1

Query  349  SCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDD  528
            S + +FVVEKNSL+VTSP+SIK  Y+ AIGNFGIPQYGGSM G VVYPK NQK CK FD+
Sbjct  23   SSMAKFVVEKNSLRVTSPDSIKGTYDSAIGNFGIPQYGGSMAGNVVYPKDNQKGCKEFDE  82

Query  529  FDVSFKSKP  555
              +SFKSKP
Sbjct  83   SGISFKSKP  91



>ref|XP_010467255.1| PREDICTED: vacuolar-sorting receptor 4-like [Camelina sativa]
Length=626

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
             RFVVEKNSL VTSPESIK  ++ AIGNFGIPQYGGSM GTVVYPK NQK+CK F DF +
Sbjct  22   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  81

Query  538  SFKSKP  555
            S+KS+P
Sbjct  82   SYKSQP  87



>ref|XP_009143376.1| PREDICTED: vacuolar-sorting receptor 1-like [Brassica rapa]
Length=620

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +1

Query  316  IVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPK  495
            ++ L + L+     G F+VEKN+LKVTSP+SIK +YECAIGNFGIP+YGG++VGTVVYP 
Sbjct  5    VLTLSFVLILELAFGTFLVEKNNLKVTSPDSIKGVYECAIGNFGIPKYGGTLVGTVVYPM  64

Query  496  ANQKACKSFDDFDVSFKSKP  555
            +N K CKSF +F VSFKS P
Sbjct  65   SNHKGCKSFSEFGVSFKSSP  84



>gb|ABR17683.1| unknown [Picea sitchensis]
Length=635

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 64/83 (77%), Gaps = 1/83 (1%)
 Frame = +1

Query  310  GLIVCLLWFL-LCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            GL+  LL  + L    + +FVVEKNSL+V SPE+IK  Y+ AIGNFGIPQYGG+MVGT V
Sbjct  14   GLVAVLLVIIYLKTMAMAKFVVEKNSLRVLSPENIKGNYDSAIGNFGIPQYGGTMVGTAV  73

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPK NQ  CK+FD F++SFKSKP
Sbjct  74   YPKENQNGCKTFDTFEISFKSKP  96



>ref|XP_003623631.1| Vacuolar sorting receptor [Medicago truncatula]
 gb|AES79849.1| vacuolar sorting receptor [Medicago truncatula]
Length=625

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  352  CLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDF  531
            C GRF+VEKNSL++TSP+S+K  YECAIGNFG+PQYGG++VG+VVYP  NQK CK+F DF
Sbjct  20   CFGRFLVEKNSLRITSPKSLKGSYECAIGNFGVPQYGGTLVGSVVYPNVNQKGCKNFTDF  79

Query  532  DVSFKSKP  555
              SF S P
Sbjct  80   SASFHSMP  87



>ref|XP_010467256.1| PREDICTED: vacuolar-sorting receptor 3-like [Camelina sativa]
Length=629

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
             RFVVEKNSL VTSPESIK  ++ AIGNFGIPQYGGSM GTVVYPK N K+CK F DF +
Sbjct  25   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENHKSCKEFSDFSI  84

Query  538  SFKSKP  555
            SFKS+P
Sbjct  85   SFKSQP  90



>ref|XP_009598407.1| PREDICTED: vacuolar-sorting receptor 3-like [Nicotiana tomentosiformis]
Length=631

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = +1

Query  325  LLWF-LLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKAN  501
             LW  LL  S +GRFVVEKNSL+V SP+ IK  Y+ AIGNFGIPQYGGS+ GTVVYPK N
Sbjct  15   FLWLNLLFQSVVGRFVVEKNSLRVVSPDDIKGTYDSAIGNFGIPQYGGSLPGTVVYPKGN  74

Query  502  QKACKSFDDFDVSFKSK  552
            QK C++FDD  +SFKSK
Sbjct  75   QKGCRNFDDSGISFKSK  91



>ref|XP_009760191.1| PREDICTED: vacuolar-sorting receptor 3-like [Nicotiana sylvestris]
Length=631

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = +1

Query  325  LLWF-LLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKAN  501
             LW  LL  S +GRFVVEKNSL+V SP+ IK  Y+ AIGNFGIPQYGGS+ GTVVYPK N
Sbjct  15   FLWLNLLFQSVVGRFVVEKNSLRVVSPDDIKGTYDSAIGNFGIPQYGGSLPGTVVYPKGN  74

Query  502  QKACKSFDDFDVSFKSK  552
            QK C++FDD  +SFKSK
Sbjct  75   QKGCRNFDDSGISFKSK  91



>ref|XP_010039169.1| PREDICTED: vacuolar-sorting receptor 1-like [Eucalyptus grandis]
Length=195

 Score =   102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +1

Query  313  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  492
            +I   +W +   SC GRF V KNSL+VTSPES+K  Y+ +IG+FG+P+ GG+M GT+VYP
Sbjct  6    MISVWVWCIFFESCSGRFTVAKNSLEVTSPESMKGFYDSSIGSFGVPKRGGTMAGTIVYP  65

Query  493  KANQKACKSFDDFDVSFKSK  552
            K+N+KACKSF DF +SF S 
Sbjct  66   KSNRKACKSFGDFGLSFNSN  85



>gb|AES62774.2| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=632

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = +1

Query  349  SCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDD  528
            S + +FVVEKNSL+VTSP+SIK  Y+ AIGNFGIPQYGGSM G VVYPK NQK CK FD+
Sbjct  23   SSMAKFVVEKNSLRVTSPDSIKGTYDSAIGNFGIPQYGGSMAGNVVYPKDNQKGCKEFDE  82

Query  529  FDVSFKSKP  555
              +SFKSKP
Sbjct  83   SGISFKSKP  91



>ref|XP_010687358.1| PREDICTED: vacuolar-sorting receptor 4-like [Beta vulgaris subsp. 
vulgaris]
Length=633

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 63/83 (76%), Gaps = 2/83 (2%)
 Frame = +1

Query  313  LIVCLLWFLLC--GSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            +I+ L +FLL    S   RFVVEKNSL+VTSP+ +K  Y+ AIGNFGIPQYGGSM GTV+
Sbjct  14   VILLLGFFLLTWVSSIESRFVVEKNSLRVTSPDDVKGTYDTAIGNFGIPQYGGSMAGTVI  73

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPK N+K CK F DF +SFK KP
Sbjct  74   YPKDNKKGCKDFSDFSISFKKKP  96



>gb|EPS73119.1| hypothetical protein M569_01632, partial [Genlisea aurea]
Length=636

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 63/81 (78%), Gaps = 1/81 (1%)
 Frame = +1

Query  313  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  492
            L+ C+ WF + G+C GRFVVEKN L VTSP S+  +YE AIGNFG+P+YGG+M+G+V YP
Sbjct  1    LLTCV-WFAVFGACFGRFVVEKNRLTVTSPGSLSGVYETAIGNFGVPKYGGTMLGSVFYP  59

Query  493  KANQKACKSFDDFDVSFKSKP  555
             +NQKAC++F D   S K+KP
Sbjct  60   SSNQKACQNFQDIATSMKTKP  80



>emb|CDY60753.1| BnaA05g34780D [Brassica napus]
Length=620

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +1

Query  355  LGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFD  534
             G F+VEKN+LKVTSP+SIK +YECAIGNFGIP+YGG++VGTVVYP +N K CKSF +F 
Sbjct  18   FGTFLVEKNNLKVTSPDSIKGVYECAIGNFGIPKYGGTLVGTVVYPMSNHKGCKSFSEFG  77

Query  535  VSFKSKP  555
            VSFKS P
Sbjct  78   VSFKSSP  84



>ref|XP_010036004.1| PREDICTED: vacuolar-sorting receptor 1-like [Eucalyptus grandis]
 gb|KCW47526.1| hypothetical protein EUGRSUZ_K01287 [Eucalyptus grandis]
Length=628

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +1

Query  316  IVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPK  495
            ++  +W +LCGSC+GRFVVEK+SLKV++P+S+K  YE ++GNFG+P YGGSM+GTVVYP 
Sbjct  10   LLIWVWCVLCGSCVGRFVVEKSSLKVSAPKSLKGSYESSMGNFGVPLYGGSMLGTVVYPD  69

Query  496  ANQKACKSFDDFDVSFKSKP  555
             N+ ACKSF+ F+ S  + P
Sbjct  70   DNRDACKSFEGFNASLATAP  89



>ref|XP_003592523.1| Vacuolar-sorting receptor [Medicago truncatula]
Length=601

 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +1

Query  355  LGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFD  534
            + +FVVEKNSL+VTSP+SIK  Y+ AIGNFGIPQYGGSM G VVYPK NQK CK FD+  
Sbjct  1    MAKFVVEKNSLRVTSPDSIKGTYDSAIGNFGIPQYGGSMAGNVVYPKDNQKGCKEFDESG  60

Query  535  VSFKSKP  555
            +SFKSKP
Sbjct  61   ISFKSKP  67



>ref|XP_002313909.1| vacuolar sorting receptor protein BP-80 [Populus trichocarpa]
 gb|EEE87864.1| vacuolar sorting receptor protein BP-80 [Populus trichocarpa]
Length=630

 Score =   105 bits (263),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +1

Query  337  LLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACK  516
            L+  S + RFVVEKNSL+VTSP+ IK  Y+ AIGNFGIPQYGGSM G VVYPK N+K CK
Sbjct  19   LIVPSSIARFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKDNKKGCK  78

Query  517  SFDDFDVSFKSKP  555
             F++F +SF+SKP
Sbjct  79   EFEEFRISFQSKP  91



>ref|XP_010517715.1| PREDICTED: vacuolar-sorting receptor 3-like isoform X2 [Camelina 
sativa]
Length=626

 Score =   105 bits (262),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
             RFVVEKNSL VTSPE+IK  ++ AIGNFGIPQYGGSM GTVVYP+ N K+CK F DF +
Sbjct  22   ARFVVEKNSLSVTSPETIKGTHDSAIGNFGIPQYGGSMAGTVVYPRENHKSCKEFSDFSI  81

Query  538  SFKSKP  555
            SFKS+P
Sbjct  82   SFKSQP  87



>ref|XP_011030346.1| PREDICTED: vacuolar-sorting receptor 3-like [Populus euphratica]
Length=630

 Score =   105 bits (262),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
            LL  L+    + RFVVEKNSL++TSP+ IK  Y+ AIGNFGIPQYGGSM G VVYPK N+
Sbjct  15   LLISLIAPRSIARFVVEKNSLRITSPDKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKDNK  74

Query  505  KACKSFDDFDVSFKSKP  555
            K CK FD F +SF+SKP
Sbjct  75   KGCKEFDGFGISFQSKP  91



>ref|XP_010517708.1| PREDICTED: vacuolar-sorting receptor 3-like isoform X1 [Camelina 
sativa]
Length=626

 Score =   105 bits (262),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
             RFVVEKNSL VTSPE+IK  ++ AIGNFGIPQYGGSM GTVVYP+ N K+CK F DF +
Sbjct  22   ARFVVEKNSLSVTSPETIKGTHDSAIGNFGIPQYGGSMAGTVVYPRENHKSCKEFSDFSI  81

Query  538  SFKSKP  555
            SFKS+P
Sbjct  82   SFKSQP  87



>ref|XP_004496877.1| PREDICTED: vacuolar-sorting receptor 1-like [Cicer arietinum]
Length=630

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = +1

Query  349  SCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDD  528
            S + +FVVEKNSL+VTSP+SIK  Y+ AIGNFGIPQYGGSM G V+YPK N+K CK FDD
Sbjct  22   SSIAKFVVEKNSLRVTSPDSIKGTYDSAIGNFGIPQYGGSMAGNVLYPKDNRKGCKEFDD  81

Query  529  FDVSFKSKP  555
              +SFKSKP
Sbjct  82   SGISFKSKP  90



>ref|XP_011001937.1| PREDICTED: vacuolar-sorting receptor 3 [Populus euphratica]
Length=630

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  337  LLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACK  516
            L+  S + RFVVEKNSL++TSP+ IK  Y+ AIGNFGIPQYGGSM G VVYPK N+K CK
Sbjct  19   LIVPSSIARFVVEKNSLRITSPDKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKDNKKGCK  78

Query  517  SFDDFDVSFKSKP  555
             FD F +SF+SKP
Sbjct  79   EFDGFGISFQSKP  91



>gb|EMS51356.1| Vacuolar-sorting receptor 1 [Triticum urartu]
Length=640

 Score =   105 bits (261),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/65 (72%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
            GRFVVEKNSL+VTSP +++ +YECAIGNFG+PQYGG+M G VVYPKAN KACK F DF +
Sbjct  36   GRFVVEKNSLRVTSPAALRGVYECAIGNFGMPQYGGTMHGVVVYPKANTKACKPFADFGL  95

Query  538  SFKSK  552
            SF  K
Sbjct  96   SFNPK  100



>gb|EPS72005.1| hypothetical protein M569_02753, partial [Genlisea aurea]
Length=557

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = +1

Query  349  SCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDD  528
            SC  RFVVEKN+LKVTSPES+K LYECAIGNFG+PQYGG+M G+V YPK+N+ AC  F  
Sbjct  15   SCTARFVVEKNNLKVTSPESLKGLYECAIGNFGVPQYGGTMPGSVYYPKSNRHACSDFRG  74

Query  529  FDVSFKSKP  555
             D+++++KP
Sbjct  75   SDITWRNKP  83



>emb|CDO97275.1| unnamed protein product [Coffea canephora]
Length=630

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 63/82 (77%), Gaps = 4/82 (5%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            LG +V  L  L+    +GRFVVEKNSL+VTSP+SIK  ++ AIGNFGIPQYGGSM GTVV
Sbjct  13   LGFLVLNLTQLV----MGRFVVEKNSLRVTSPDSIKGTHDSAIGNFGIPQYGGSMSGTVV  68

Query  487  YPKANQKACKSFDDFDVSFKSK  552
            +PK NQK CK+F DF  SFK K
Sbjct  69   FPKENQKGCKTFSDFGSSFKPK  90



>ref|XP_002298772.1| hypothetical protein POPTR_0001s30160g [Populus trichocarpa]
 gb|EEE83577.1| hypothetical protein POPTR_0001s30160g [Populus trichocarpa]
Length=630

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
            L+  L+    + RFVVEKNSL+VTSP+ IK  Y+ AIGNFGIPQYGGSM G VVYPK N+
Sbjct  15   LVISLIAPRSIARFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKDNK  74

Query  505  KACKSFDDFDVSFKSKP  555
            K CK FD F +SF+SKP
Sbjct  75   KGCKEFDGFGISFQSKP  91



>ref|XP_004492565.1| PREDICTED: vacuolar-sorting receptor 1-like [Cicer arietinum]
Length=621

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
            GRF+VEKNSLK+TSP+S+K  YECAIGNFG+PQYGG++VG+VVYP  NQK C +F D + 
Sbjct  21   GRFLVEKNSLKITSPKSLKGTYECAIGNFGVPQYGGTLVGSVVYPNVNQKGCDNFTDVNA  80

Query  538  SFKSKP  555
            SF+SKP
Sbjct  81   SFQSKP  86



>ref|XP_007157213.1| hypothetical protein PHAVU_002G052000g [Phaseolus vulgaris]
 gb|ESW29207.1| hypothetical protein PHAVU_002G052000g [Phaseolus vulgaris]
Length=626

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = +1

Query  313  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  492
            L+   +  +L  S +GRFVVEKNSL+VTSPE I+  ++ AIGNFGIPQYGGSM G VVYP
Sbjct  7    LVSLFVGLVLPVSIMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGNVVYP  66

Query  493  KANQKACKSFDDFDVSFKSKP  555
            K N+K CK F+D  +SFKS P
Sbjct  67   KDNKKGCKEFEDSGISFKSTP  87



>ref|XP_008384516.1| PREDICTED: vacuolar-sorting receptor 3-like [Malus domestica]
Length=629

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
            GRFVVEKNSL+VTSP+ IK  Y+ AIGNFGIPQYGGSM G VVYPK NQK CK F +F +
Sbjct  24   GRFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKENQKGCKEFSEFGI  83

Query  538  SFKSKP  555
            +FKS P
Sbjct  84   TFKSSP  89



>ref|XP_006346308.1| PREDICTED: vacuolar-sorting receptor 3-like [Solanum tuberosum]
Length=630

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
             LW  L  S +GRFVVEKNSL+V SP+ IK  Y+ AIGNFGIPQYGGS+ GTVVYPK N+
Sbjct  15   FLWLNLFQSVVGRFVVEKNSLRVVSPDDIKGTYDSAIGNFGIPQYGGSIPGTVVYPKENR  74

Query  505  KACKSFDDFDVSFKSK  552
            K C++F+D   SFKSK
Sbjct  75   KGCRNFEDSGTSFKSK  90



>ref|XP_004959891.1| PREDICTED: vacuolar-sorting receptor 1-like [Setaria italica]
Length=636

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
             RFVVEKNSL+VTSP +++ +YECAIGNFG+PQYGG+M G VVYPKAN KACK F DF +
Sbjct  32   ARFVVEKNSLRVTSPAALRGVYECAIGNFGMPQYGGTMHGVVVYPKANGKACKPFADFGL  91

Query  538  SFKSKP  555
            SFK KP
Sbjct  92   SFKPKP  97



>ref|XP_004230700.1| PREDICTED: vacuolar-sorting receptor 3 [Solanum lycopersicum]
Length=630

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
             LW  L  S +GRFVVEKNSL+V SP+ IK  Y+ AIGNFGIPQYGGS+ GTVVYPK N+
Sbjct  15   FLWLNLFQSVVGRFVVEKNSLRVVSPDDIKGTYDSAIGNFGIPQYGGSIPGTVVYPKENR  74

Query  505  KACKSFDDFDVSFKSK  552
            K C++F+D   SFKSK
Sbjct  75   KGCRNFEDSGTSFKSK  90



>gb|EYU37571.1| hypothetical protein MIMGU_mgv1a002851mg [Erythranthe guttata]
Length=631

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
            GRFVVEKNSL+V SPESIK  ++ AIGNFGIPQYGGSM GTV+YPK N+K CK+FDDF +
Sbjct  26   GRFVVEKNSLRVISPESIKGNHDSAIGNFGIPQYGGSMSGTVLYPKDNKKGCKNFDDFGI  85

Query  538  SFKSK  552
            SFK+K
Sbjct  86   SFKAK  90



>ref|XP_008660179.1| PREDICTED: vacuolar-sorting receptor 1 [Zea mays]
 gb|ACG42879.1| vacuolar sorting receptor 1 precursor [Zea mays]
 gb|ACL53481.1| unknown [Zea mays]
 gb|ACN34401.1| unknown [Zea mays]
 gb|AFW88458.1| vacuolar sorting receptor-like protein [Zea mays]
Length=629

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
            GRFVVEKNSL+VTSP+ +K  YECAIGNFG+PQYGG++ G V YPK+N+KAC+SFD FD+
Sbjct  24   GRFVVEKNSLEVTSPDELKGKYECAIGNFGVPQYGGTLHGWVEYPKSNRKACQSFDQFDI  83

Query  538  SFKSK  552
            SFK K
Sbjct  84   SFKPK  88



>ref|XP_010277061.1| PREDICTED: vacuolar-sorting receptor 3-like [Nelumbo nucifera]
Length=634

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
             RFVVEKNSL VTSP+SIK  ++ AIGNFGIPQYGGSM GTVVYPK N KACK F++F  
Sbjct  30   ARFVVEKNSLTVTSPDSIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENMKACKDFNEFGT  89

Query  538  SFKSKP  555
            SFK+KP
Sbjct  90   SFKAKP  95



>gb|AAB72112.1| vacuolar sorting receptor homolog [Arabidopsis thaliana]
Length=630

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 56/68 (82%), Gaps = 2/68 (3%)
 Frame = +1

Query  358  GRFVV--EKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDF  531
             RFVV  EKNSL VTSPESIK  ++ AIGNFGIPQYGGSM GTVVYPK NQK+CK F DF
Sbjct  24   ARFVVSNEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDF  83

Query  532  DVSFKSKP  555
             +SFKS+P
Sbjct  84   SISFKSQP  91



>ref|XP_010272410.1| PREDICTED: vacuolar-sorting receptor 3-like [Nelumbo nucifera]
Length=635

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
             RFVVEKNSL VTSP+SIK  ++ AIGNFGIPQYGGSM GTV+YPK N K CK FDDF +
Sbjct  31   ARFVVEKNSLTVTSPDSIKGTHDSAIGNFGIPQYGGSMAGTVIYPKENMKGCKDFDDFGI  90

Query  538  SFKSK  552
            SFK+K
Sbjct  91   SFKTK  95



>ref|XP_007143116.1| hypothetical protein PHAVU_007G045100g [Phaseolus vulgaris]
 gb|ESW15110.1| hypothetical protein PHAVU_007G045100g [Phaseolus vulgaris]
Length=630

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +1

Query  355  LGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFD  534
            + +FVVEKNSL VTSP++IK  ++ AIGNFGIPQYGGSM G VVYPK NQK CK FDD  
Sbjct  24   MAKFVVEKNSLTVTSPDNIKGTHDSAIGNFGIPQYGGSMAGNVVYPKENQKGCKEFDDSG  83

Query  535  VSFKSKP  555
            +SFKSKP
Sbjct  84   ISFKSKP  90



>ref|XP_002467906.1| hypothetical protein SORBIDRAFT_01g036170 [Sorghum bicolor]
 gb|EER94904.1| hypothetical protein SORBIDRAFT_01g036170 [Sorghum bicolor]
Length=629

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
            GRFVVEKNS++VTSP+ +K  YECAIGNFG+PQYGG++ G V YPK+N+KAC+SFD FD+
Sbjct  24   GRFVVEKNSIQVTSPDELKGKYECAIGNFGVPQYGGTLHGWVEYPKSNRKACQSFDQFDI  83

Query  538  SFKSK  552
            SFK K
Sbjct  84   SFKPK  88



>ref|XP_010111675.1| Vacuolar-sorting receptor 3 [Morus notabilis]
 gb|EXC31466.1| Vacuolar-sorting receptor 3 [Morus notabilis]
Length=631

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 61/83 (73%), Gaps = 3/83 (4%)
 Frame = +1

Query  307  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  486
            LG +V  L  L   S   RFVVEKNSL+VTSP+ I+  ++ AIGNFGIPQYGGSM G VV
Sbjct  14   LGFLVLSLAPL---SLHARFVVEKNSLRVTSPDRIRGTHDSAIGNFGIPQYGGSMAGNVV  70

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YPK NQK CK F D+ +SF+SKP
Sbjct  71   YPKDNQKGCKEFSDYGISFQSKP  93



>gb|KDO57883.1| hypothetical protein CISIN_1g006786mg [Citrus sinensis]
Length=410

 Score =   101 bits (251),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
            L+  L   + + RFVVEKNSL VTSPE IK  ++ AIGNFGIPQYGGSM G V YPK N+
Sbjct  16   LILSLNVHTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENR  75

Query  505  KACKSFDDFDVSFKSKP  555
            K C+ F DF +SFK+KP
Sbjct  76   KGCREFGDFGISFKAKP  92



>ref|XP_009375671.1| PREDICTED: vacuolar-sorting receptor 3-like [Pyrus x bretschneideri]
Length=628

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
            GRFVVEKNSL+VTSP+ IK  Y+ AIGNFGIPQYGGSM G V+YPK NQK CK F +F +
Sbjct  24   GRFVVEKNSLRVTSPDKIKGTYDTAIGNFGIPQYGGSMAGAVLYPKQNQKGCKEFSEFGI  83

Query  538  SFKSKP  555
             F+S+P
Sbjct  84   KFESRP  89



>gb|AGV54776.1| vacuolar-sorting receptor [Phaseolus vulgaris]
Length=625

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = +1

Query  313  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  492
            L+   +  +L  S +GRFVVEKNSL+VTSPE I+  ++ AIGNFGIPQYGGSM G VVYP
Sbjct  7    LVSLFVGLVLPVSIMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGNVVYP  66

Query  493  KANQKACKSFDDFDVSFKSKP  555
            K ++K CK F+D  +SFKS P
Sbjct  67   KDDKKGCKEFEDSGISFKSTP  87



>ref|XP_006849341.1| hypothetical protein AMTR_s00164p00059220 [Amborella trichopoda]
 gb|ERN10922.1| hypothetical protein AMTR_s00164p00059220 [Amborella trichopoda]
Length=611

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
            GRFVVEKNSL VTSP+SI+ +++ AIGNFG+PQYGGSM G VVYPK N+K CK FD+F +
Sbjct  7    GRFVVEKNSLTVTSPDSIRGMHDSAIGNFGVPQYGGSMAGAVVYPKDNKKGCKGFDEFGL  66

Query  538  SFKSK  552
            SFKSK
Sbjct  67   SFKSK  71



>emb|CBI32834.3| unnamed protein product [Vitis vinifera]
Length=166

 Score = 97.8 bits (242),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 63/83 (76%), Gaps = 7/83 (8%)
 Frame = +1

Query  325  LLW--FLLCGSCLGR--FVVEKNSLKVTSPESIKDLYECAIGNFGIPQ--YGGSMVGTVV  486
            L+W  F  C + LG   FVV KNSL+VT PES+KD YECA GNFGIPQ  +GG++VGTVV
Sbjct  25   LIWVGFFTCVTYLGSCGFVV-KNSLRVTYPESLKDAYECATGNFGIPQNEHGGTVVGTVV  83

Query  487  YPKANQKACKSFDDFDVSFKSKP  555
            YP+ANQK+C     FDVSFKS+P
Sbjct  84   YPQANQKSCSRSHHFDVSFKSQP  106



>ref|XP_009349164.1| PREDICTED: vacuolar-sorting receptor 3-like [Pyrus x bretschneideri]
Length=628

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
            GRFVVEKNSL+VTSP+ IK  Y+ AIGNFGIPQYGGSM G V+YPK NQK CK F +F +
Sbjct  24   GRFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVLYPKQNQKGCKEFSEFGI  83

Query  538  SFKSKP  555
             F+S+P
Sbjct  84   KFESRP  89



>ref|XP_008348888.1| PREDICTED: vacuolar-sorting receptor 3-like [Malus domestica]
Length=628

 Score =   102 bits (255),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
            GRFVVEKNSL+VTSP+ IK  Y+ AIGNFGIPQYGGSM G V+YPK NQK CK F +F +
Sbjct  24   GRFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVLYPKQNQKGCKEFSEFGI  83

Query  538  SFKSKP  555
             F+S+P
Sbjct  84   KFESRP  89



>ref|XP_008236323.1| PREDICTED: vacuolar-sorting receptor 3 [Prunus mume]
Length=629

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
             RFVVEKNSL+VTSP+ IK  Y+ AIGNFGIPQYGGSM G V+YPK NQK CK F +F +
Sbjct  25   ARFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVLYPKENQKGCKEFSEFGI  84

Query  538  SFKSKP  555
            SFKS P
Sbjct  85   SFKSTP  90



>ref|XP_007199755.1| hypothetical protein PRUPE_ppa002822mg [Prunus persica]
 gb|EMJ00954.1| hypothetical protein PRUPE_ppa002822mg [Prunus persica]
Length=629

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
             RFVVEKNSL+VTSP+ IK  Y+ AIGNFGIPQYGGSM G V+YPK NQK CK F +F +
Sbjct  25   ARFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVLYPKENQKGCKEFSEFGI  84

Query  538  SFKSKP  555
            SFKS P
Sbjct  85   SFKSTP  90



>ref|XP_003610620.1| Vacuolar-sorting receptor [Medicago truncatula]
 gb|AES93578.1| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=622

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 57/77 (74%), Gaps = 1/77 (1%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
            L+ F+L G    RFVVEKNSL VTSP+ IK  ++ AIGNFGIPQYGGSM G VVYPK N 
Sbjct  12   LVGFMLTGMSTARFVVEKNSLSVTSPDKIKGKHDSAIGNFGIPQYGGSMAGNVVYPKDNN  71

Query  505  KACKSFDDFDVSFKSKP  555
            K CK FDD   SFKSKP
Sbjct  72   KGCKDFDD-SSSFKSKP  87



>gb|KCW63607.1| hypothetical protein EUGRSUZ_G01233 [Eucalyptus grandis]
Length=578

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
             RFVVEKNSL VTSP+ IK  Y+ AIGNFGIPQYGGSM G V YP+ N+K CK F +FD+
Sbjct  38   ARFVVEKNSLAVTSPDKIKGNYDSAIGNFGIPQYGGSMAGAVTYPEKNRKGCKEFSEFDI  97

Query  538  SFKSKP  555
            SFKSKP
Sbjct  98   SFKSKP  103



>ref|XP_010065899.1| PREDICTED: vacuolar-sorting receptor 1-like [Eucalyptus grandis]
 gb|KCW63606.1| hypothetical protein EUGRSUZ_G01233 [Eucalyptus grandis]
Length=644

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
             RFVVEKNSL VTSP+ IK  Y+ AIGNFGIPQYGGSM G V YP+ N+K CK F +FD+
Sbjct  38   ARFVVEKNSLAVTSPDKIKGNYDSAIGNFGIPQYGGSMAGAVTYPEKNRKGCKEFSEFDI  97

Query  538  SFKSKP  555
            SFKSKP
Sbjct  98   SFKSKP  103



>gb|KHN42313.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=631

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
            L+ FL     + +FVVEKNSL VTSP++IK  ++ AIGNFGIPQYGGSM G V+YPK N+
Sbjct  15   LVLFLSPPPSMAKFVVEKNSLTVTSPDNIKGTHDSAIGNFGIPQYGGSMAGNVLYPKDNK  74

Query  505  KACKSFDDFDVSFKSKP  555
            K CK FD++ +SFKSKP
Sbjct  75   KGCKEFDEYGISFKSKP  91



>ref|XP_004136938.1| PREDICTED: vacuolar-sorting receptor 3-like [Cucumis sativus]
 gb|KGN43851.1| hypothetical protein Csa_7G071400 [Cucumis sativus]
Length=631

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +1

Query  355  LGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFD  534
            + RFVVEKNSL+VTSP+ +K  Y+ AIGNFGIPQYGGSM GTVV+PK NQK C+ F D  
Sbjct  27   VARFVVEKNSLRVTSPDGLKGTYDSAIGNFGIPQYGGSMSGTVVFPKENQKGCREFSDAG  86

Query  535  VSFKSKP  555
            +SF+SKP
Sbjct  87   ISFQSKP  93



>ref|XP_003536576.1| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine 
max]
Length=631

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
            L+ FL     + +FVVEKNSL VTSP+ IK  ++ AIGNFGIPQYGGSM G V+YPK N+
Sbjct  15   LVLFLSPPPSMAKFVVEKNSLTVTSPDDIKGTHDSAIGNFGIPQYGGSMAGNVLYPKDNK  74

Query  505  KACKSFDDFDVSFKSKP  555
            K CK FD++ +SFKSKP
Sbjct  75   KGCKEFDEYGISFKSKP  91



>ref|XP_008455032.1| PREDICTED: vacuolar-sorting receptor 3-like [Cucumis melo]
Length=630

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +1

Query  355  LGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFD  534
            + RFVVEKNSL+VTSP+ +K  Y+ AIGNFGIPQYGGSM GTVV+PK NQK C+ F D  
Sbjct  26   VARFVVEKNSLRVTSPDGLKGTYDSAIGNFGIPQYGGSMSGTVVFPKENQKGCREFSDAG  85

Query  535  VSFKSKP  555
            +SF+SKP
Sbjct  86   ISFQSKP  92



>gb|KHN06808.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=631

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
            L+ FL     + +FVVEKNSL VTSP+ IK  ++ AIGNFGIPQYGGSM G V+YPK N+
Sbjct  15   LVLFLSPPPSMAKFVVEKNSLTVTSPDDIKGTHDSAIGNFGIPQYGGSMAGNVLYPKDNK  74

Query  505  KACKSFDDFDVSFKSKP  555
            K CK FD++ +SFKSKP
Sbjct  75   KGCKEFDEYGISFKSKP  91



>ref|XP_004159916.1| PREDICTED: LOW QUALITY PROTEIN: vacuolar-sorting receptor 3-like 
[Cucumis sativus]
Length=631

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +1

Query  355  LGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFD  534
            + RFVVEKNSL+VTSP+ +K  Y+ AIGNFGIPQYGGSM GTVV+PK NQK C+ F D  
Sbjct  27   VARFVVEKNSLRVTSPDGLKGTYDSAIGNFGIPQYGGSMSGTVVFPKENQKGCREFSDAG  86

Query  535  VSFKSKP  555
            +SF+SKP
Sbjct  87   ISFQSKP  93



>ref|XP_004984466.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X4 [Setaria 
italica]
Length=629

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
            GRFVVEKNS++VTSP+ +K  YECAIGNFG+PQYGG++ G V YP++N+K C+SFD FD+
Sbjct  23   GRFVVEKNSIQVTSPDELKGKYECAIGNFGVPQYGGTLHGWVEYPRSNRKGCQSFDQFDI  82

Query  538  SFKSK  552
            SFK K
Sbjct  83   SFKPK  87



>ref|XP_004984465.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X3 [Setaria 
italica]
Length=655

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
            GRFVVEKNS++VTSP+ +K  YECAIGNFG+PQYGG++ G V YP++N+K C+SFD FD+
Sbjct  23   GRFVVEKNSIQVTSPDELKGKYECAIGNFGVPQYGGTLHGWVEYPRSNRKGCQSFDQFDI  82

Query  538  SFKSK  552
            SFK K
Sbjct  83   SFKPK  87



>ref|XP_004984464.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Setaria 
italica]
Length=656

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
            GRFVVEKNS++VTSP+ +K  YECAIGNFG+PQYGG++ G V YP++N+K C+SFD FD+
Sbjct  23   GRFVVEKNSIQVTSPDELKGKYECAIGNFGVPQYGGTLHGWVEYPRSNRKGCQSFDQFDI  82

Query  538  SFKSK  552
            SFK K
Sbjct  83   SFKPK  87



>ref|XP_003555992.1| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine 
max]
Length=631

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
            L  FL     + +FVVEKNSL VTSP++IK  ++ AIGNFGIPQYGGSM G V+YPK N+
Sbjct  15   LALFLSPPPSMAKFVVEKNSLTVTSPDNIKGTHDSAIGNFGIPQYGGSMAGNVLYPKDNK  74

Query  505  KACKSFDDFDVSFKSKP  555
            K CK FD++ +SFKSKP
Sbjct  75   KGCKEFDEYGISFKSKP  91



>ref|XP_004984463.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Setaria 
italica]
Length=682

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
            GRFVVEKNS++VTSP+ +K  YECAIGNFG+PQYGG++ G V YP++N+K C+SFD FD+
Sbjct  23   GRFVVEKNSIQVTSPDELKGKYECAIGNFGVPQYGGTLHGWVEYPRSNRKGCQSFDQFDI  82

Query  538  SFKSK  552
            SFK K
Sbjct  83   SFKPK  87



>ref|XP_011457866.1| PREDICTED: vacuolar-sorting receptor 3 [Fragaria vesca subsp. 
vesca]
Length=630

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
             RFVVEKNSL+VTSP+ IK  Y+ AIGNFG+PQYGGSM G V+YPK NQK CK F DF +
Sbjct  25   ARFVVEKNSLRVTSPDKIKGKYDSAIGNFGLPQYGGSMSGAVIYPKENQKGCKEFSDFGL  84

Query  538  SFKSKP  555
            S+KS P
Sbjct  85   SYKSTP  90



>gb|KDO57886.1| hypothetical protein CISIN_1g006786mg [Citrus sinensis]
Length=560

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
            L+  L   + + RFVVEKNSL VTSPE IK  ++ AIGNFGIPQYGGSM G V YPK N+
Sbjct  16   LILSLNVHTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENR  75

Query  505  KACKSFDDFDVSFKSKP  555
            K C+ F DF +SFK+KP
Sbjct  76   KGCREFGDFGISFKAKP  92



>ref|XP_011088070.1| PREDICTED: vacuolar-sorting receptor 3-like [Sesamum indicum]
Length=629

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  355  LGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFD  534
            +GRFVVEKNSL+V SP+SIK  ++ AIGNFGIPQYGG M GTVVYP+ N+K CKSFDD  
Sbjct  25   VGRFVVEKNSLRVLSPDSIKGTHDSAIGNFGIPQYGGRMGGTVVYPRDNRKGCKSFDDSG  84

Query  535  VSFKSK  552
            +SFK+K
Sbjct  85   ISFKAK  90



>ref|XP_006422827.1| hypothetical protein CICLE_v10028015mg [Citrus clementina]
 gb|ESR36067.1| hypothetical protein CICLE_v10028015mg [Citrus clementina]
Length=631

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
            L+  L   + + RFVVEKNSL VTSPE IK  ++ AIGNFGIPQYGGSM G V YPK N+
Sbjct  16   LILSLNVHTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENR  75

Query  505  KACKSFDDFDVSFKSKP  555
            K C+ F DF +SFK+KP
Sbjct  76   KGCREFGDFGISFKAKP  92



>dbj|BAK05589.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=802

 Score =   100 bits (250),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 45/65 (69%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
            GRFVVEKNSL+VTSP S++ +YECAIGNFG+PQYGG+M G VVYPKAN +AC  F D  +
Sbjct  198  GRFVVEKNSLRVTSPASLRGVYECAIGNFGMPQYGGTMHGVVVYPKANARACNPFADSGL  257

Query  538  SFKSK  552
            SF  K
Sbjct  258  SFNPK  262



>ref|XP_006486921.1| PREDICTED: vacuolar-sorting receptor 3-like [Citrus sinensis]
Length=631

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
            L+  L   + + RFVVEKNSL VTSPE IK  ++ AIGNFGIPQYGGSM G V YPK N+
Sbjct  16   LILSLNVHTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENR  75

Query  505  KACKSFDDFDVSFKSKP  555
            K C+ F DF +SFK+KP
Sbjct  76   KGCREFGDFGISFKAKP  92



>gb|KDO57885.1| hypothetical protein CISIN_1g006786mg [Citrus sinensis]
Length=631

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
            L+  L   + + RFVVEKNSL VTSPE IK  ++ AIGNFGIPQYGGSM G V YPK N+
Sbjct  16   LILSLNVHTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENR  75

Query  505  KACKSFDDFDVSFKSKP  555
            K C+ F DF +SFK+KP
Sbjct  76   KGCREFGDFGISFKAKP  92



>gb|KDO57884.1| hypothetical protein CISIN_1g006786mg [Citrus sinensis]
Length=629

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +1

Query  325  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  504
            L+  L   + + RFVVEKNSL VTSPE IK  ++ AIGNFGIPQYGGSM G V YPK N+
Sbjct  16   LILSLNVHTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENR  75

Query  505  KACKSFDDFDVSFKSKP  555
            K C+ F DF +SFK+KP
Sbjct  76   KGCREFGDFGISFKAKP  92



>emb|CAN79862.1| hypothetical protein VITISV_021998 [Vitis vinifera]
Length=599

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  361  RFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDVS  540
            +FVVEKNSL V SPESIK  ++ AIGNFGIPQYGGSM GTVVYPK N K CK FD++ +S
Sbjct  28   KFVVEKNSLTVVSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENTKGCKGFDEYGIS  87

Query  541  FKSK  552
            FKSK
Sbjct  88   FKSK  91



>ref|XP_004511312.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Cicer 
arietinum]
Length=623

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 56/74 (76%), Gaps = 3/74 (4%)
 Frame = +1

Query  334  FLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKAC  513
            FLL    + RFVVEKNSL VTSP+ IK  ++ AIGNFGIPQYGGSM GTVVYPK N K C
Sbjct  14   FLLLTLSMARFVVEKNSLSVTSPDKIKGRHDSAIGNFGIPQYGGSMAGTVVYPKDNNKGC  73

Query  514  KSFDDFDVSFKSKP  555
            K   DFD SFKS+P
Sbjct  74   K---DFDQSFKSRP  84



>emb|CBI22461.3| unnamed protein product [Vitis vinifera]
Length=631

 Score =   100 bits (248),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
             +FVVEKNSL V SPESIK  ++ AIGNFGIPQYGGSM GTVVYPK N K CK FD++ +
Sbjct  27   AKFVVEKNSLTVVSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENTKGCKGFDEYGI  86

Query  538  SFKSK  552
            SFKSK
Sbjct  87   SFKSK  91



>ref|XP_002264769.1| PREDICTED: vacuolar-sorting receptor 3 [Vitis vinifera]
Length=636

 Score =   100 bits (248),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +1

Query  358  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  537
             +FVVEKNSL V SPESIK  ++ AIGNFGIPQYGGSM GTVVYPK N K CK FD++ +
Sbjct  32   AKFVVEKNSLTVVSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENTKGCKGFDEYGI  91

Query  538  SFKSK  552
            SFKSK
Sbjct  92   SFKSK  96



>ref|XP_004511311.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Cicer 
arietinum]
Length=654

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 56/74 (76%), Gaps = 3/74 (4%)
 Frame = +1

Query  334  FLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKAC  513
            FLL    + RFVVEKNSL VTSP+ IK  ++ AIGNFGIPQYGGSM GTVVYPK N K C
Sbjct  14   FLLLTLSMARFVVEKNSLSVTSPDKIKGRHDSAIGNFGIPQYGGSMAGTVVYPKDNNKGC  73

Query  514  KSFDDFDVSFKSKP  555
            K   DFD SFKS+P
Sbjct  74   K---DFDQSFKSRP  84



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 617525281800