BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF040A18

Length=571
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011090682.1|  PREDICTED: 40S ribosomal protein S3a               270   1e-87   Sesamum indicum [beniseed]
ref|XP_011073454.1|  PREDICTED: 40S ribosomal protein S3a-like          269   4e-87   Sesamum indicum [beniseed]
gb|EPS65103.1|  hypothetical protein M569_09676                         265   7e-87   Genlisea aurea
gb|EYU23687.1|  hypothetical protein MIMGU_mgv1a012196mg                266   3e-86   Erythranthe guttata [common monkey flower]
ref|XP_004247589.1|  PREDICTED: 40S ribosomal protein S3a               266   6e-86   Solanum lycopersicum
emb|CDO99096.1|  unnamed protein product                                266   6e-86   Coffea canephora [robusta coffee]
ref|NP_001275164.1|  40S ribosomal protein S3a-like protein             266   7e-86   Solanum tuberosum [potatoes]
gb|EPS71864.1|  hypothetical protein M569_02887                         265   1e-85   Genlisea aurea
sp|P33444.4|RS3A_CATRO  RecName: Full=40S ribosomal protein S3a; ...    264   2e-85   Catharanthus roseus [chatas]
dbj|BAA05057.1|  cyc07                                                  264   2e-85   Catharanthus roseus [chatas]
ref|XP_010938988.1|  PREDICTED: 40S ribosomal protein S3a-like          264   4e-85   Elaeis guineensis
ref|XP_010553762.1|  PREDICTED: 40S ribosomal protein S3a-1-like        263   6e-85   Tarenaya hassleriana [spider flower]
dbj|BAA00860.1|  cyc07                                                  263   7e-85   Catharanthus roseus [chatas]
ref|XP_010546607.1|  PREDICTED: 40S ribosomal protein S3a-1-like        263   1e-84   Tarenaya hassleriana [spider flower]
ref|XP_010553319.1|  PREDICTED: 40S ribosomal protein S3a-1-like        262   1e-84   Tarenaya hassleriana [spider flower]
gb|KDP23643.1|  hypothetical protein JCGZ_23476                         262   1e-84   Jatropha curcas
sp|P49198.2|RS3A_HELAN  RecName: Full=40S ribosomal protein S3a         261   3e-84   Helianthus annuus
ref|XP_010550935.1|  PREDICTED: 40S ribosomal protein S3a-2-like        261   3e-84   Tarenaya hassleriana [spider flower]
ref|XP_009628663.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    261   4e-84   Nicotiana tomentosiformis
ref|XP_009591686.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    261   4e-84   Nicotiana tomentosiformis
ref|XP_009779517.1|  PREDICTED: 40S ribosomal protein S3a               261   4e-84   Nicotiana sylvestris
ref|XP_009775368.1|  PREDICTED: 40S ribosomal protein S3a-like          261   4e-84   Nicotiana sylvestris
ref|XP_009618011.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    261   5e-84   Nicotiana tomentosiformis
ref|XP_010524908.1|  PREDICTED: 40S ribosomal protein S3a-2             261   5e-84   Tarenaya hassleriana [spider flower]
gb|AFS65104.1|  40S ribosomal protein S3a-like protein                  261   5e-84   Elaeis guineensis
ref|XP_010034641.1|  PREDICTED: 40S ribosomal protein S3a               261   5e-84   Eucalyptus grandis [rose gum]
ref|XP_010942777.1|  PREDICTED: 40S ribosomal protein S3a               261   6e-84   Elaeis guineensis
ref|XP_007034836.1|  Ribosomal protein S3Ae isoform 2                   260   6e-84   
ref|XP_006284351.1|  hypothetical protein CARUB_v10005523mg             261   7e-84   Capsella rubella
ref|XP_003610736.1|  40S ribosomal protein S3a-like protein             260   8e-84   Medicago truncatula
ref|XP_002517085.1|  40S ribosomal protein S3a, putative                260   8e-84   Ricinus communis
emb|CDO98656.1|  unnamed protein product                                260   8e-84   Coffea canephora [robusta coffee]
ref|XP_011026951.1|  PREDICTED: 40S ribosomal protein S3a-2             260   9e-84   Populus euphratica
ref|XP_007034835.1|  Ribosomal protein S3Ae isoform 1                   260   1e-83   Theobroma cacao [chocolate]
ref|XP_004985319.1|  PREDICTED: 40S ribosomal protein S3a-like is...    260   1e-83   Setaria italica
ref|XP_002283142.1|  PREDICTED: 40S ribosomal protein S3a-1             260   1e-83   Vitis vinifera
ref|XP_006663973.1|  PREDICTED: 40S ribosomal protein S3a-like          260   1e-83   Oryza brachyantha
ref|XP_006649574.1|  PREDICTED: 40S ribosomal protein S3a-like          259   1e-83   Oryza brachyantha
gb|KHN02741.1|  40S ribosomal protein S3a                               259   1e-83   Glycine soja [wild soybean]
ref|XP_006663971.1|  PREDICTED: 40S ribosomal protein S3a-like          259   2e-83   Oryza brachyantha
ref|NP_001265990.1|  40S ribosomal protein S3a                          259   2e-83   Cicer arietinum [garbanzo]
ref|XP_008811659.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    259   2e-83   Phoenix dactylifera
ref|XP_006663974.1|  PREDICTED: 40S ribosomal protein S3a-like          259   2e-83   Oryza brachyantha
gb|ABK24527.1|  unknown                                                 256   2e-83   Picea sitchensis
gb|KHN30486.1|  40S ribosomal protein S3a                               258   2e-83   Glycine soja [wild soybean]
ref|XP_004958212.1|  PREDICTED: 40S ribosomal protein S3a-like          259   2e-83   Setaria italica
ref|NP_001241005.1|  uncharacterized protein LOC100805519               259   2e-83   Glycine max [soybeans]
ref|XP_004985318.1|  PREDICTED: 40S ribosomal protein S3a-like is...    260   2e-83   
gb|ACU17112.1|  unknown                                                 258   3e-83   Glycine max [soybeans]
ref|XP_004235324.1|  PREDICTED: 40S ribosomal protein S3a               259   3e-83   Solanum lycopersicum
ref|XP_002312545.2|  ribosomal protein S3a                              259   4e-83   
ref|XP_003572000.1|  PREDICTED: 40S ribosomal protein S3a               259   4e-83   Brachypodium distachyon [annual false brome]
ref|XP_010256142.1|  PREDICTED: 40S ribosomal protein S3a-1-like        258   5e-83   Nelumbo nucifera [Indian lotus]
gb|ABK22319.1|  unknown                                                 258   5e-83   Picea sitchensis
ref|XP_006379849.1|  hypothetical protein POPTR_0008s15610g             258   5e-83   Populus trichocarpa [western balsam poplar]
ref|NP_001241430.1|  uncharacterized protein LOC100813273               258   5e-83   Glycine max [soybeans]
ref|XP_010259119.1|  PREDICTED: 40S ribosomal protein S3a-1             258   5e-83   Nelumbo nucifera [Indian lotus]
ref|XP_002463138.1|  hypothetical protein SORBIDRAFT_02g038370          258   6e-83   Sorghum bicolor [broomcorn]
gb|KDP40219.1|  hypothetical protein JCGZ_02217                         258   7e-83   Jatropha curcas
gb|AFK33413.1|  unknown                                                 258   7e-83   Lotus japonicus
gb|KJB34507.1|  hypothetical protein B456_006G069600                    258   7e-83   Gossypium raimondii
gb|ABK56834.1|  RPS3                                                    258   8e-83   Cymbidium hybrid cultivar
ref|NP_001275123.1|  cyc07-like protein                                 258   8e-83   Solanum tuberosum [potatoes]
ref|XP_004241461.1|  PREDICTED: 40S ribosomal protein S3a               258   8e-83   Solanum lycopersicum
ref|NP_001046578.1|  Os02g0287000                                       258   8e-83   
gb|KHG05975.1|  40S ribosomal S3a                                       258   8e-83   Gossypium arboreum [tree cotton]
ref|XP_008804511.1|  PREDICTED: 40S ribosomal protein S3a               258   9e-83   Phoenix dactylifera
ref|XP_007030615.1|  Ribosomal protein S3Ae                             257   1e-82   
ref|XP_010229024.1|  PREDICTED: 40S ribosomal protein S3a-like          258   1e-82   Brachypodium distachyon [annual false brome]
sp|A7Q5X9.1|RS3A2_VITVI  RecName: Full=40S ribosomal protein S3a-2      256   1e-82   Vitis vinifera
ref|XP_002277791.1|  PREDICTED: 40S ribosomal protein S3a-2-like        257   1e-82   Vitis vinifera
ref|XP_006408143.1|  hypothetical protein EUTSA_v10021341mg             257   1e-82   Eutrema salsugineum [saltwater cress]
ref|NP_001239858.1|  uncharacterized protein LOC100808747               257   2e-82   Glycine max [soybeans]
ref|NP_001066631.1|  Os12g0406200                                       257   2e-82   
ref|XP_003559021.1|  PREDICTED: 40S ribosomal protein S3a-like          257   2e-82   Brachypodium distachyon [annual false brome]
ref|XP_002512232.1|  40S ribosomal protein S3a, putative                257   2e-82   Ricinus communis
ref|NP_001274913.1|  40S ribosomal protein S3a-like                     257   2e-82   Solanum tuberosum [potatoes]
dbj|BAJ93929.1|  predicted protein                                      257   2e-82   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB28386.1|  hypothetical protein B456_005G045000                    256   2e-82   Gossypium raimondii
ref|XP_008449325.1|  PREDICTED: 40S ribosomal protein S3a-like          257   2e-82   Cucumis melo [Oriental melon]
ref|XP_004145387.1|  PREDICTED: 40S ribosomal protein S3a-like          256   2e-82   
ref|XP_008438626.1|  PREDICTED: 40S ribosomal protein S3a               257   2e-82   Cucumis melo [Oriental melon]
gb|KFK37895.1|  hypothetical protein AALP_AA3G043200                    256   2e-82   Arabis alpina [alpine rockcress]
ref|XP_004134125.1|  PREDICTED: 40S ribosomal protein S3a-like          256   2e-82   Cucumis sativus [cucumbers]
ref|NP_001276152.1|  40S ribosomal protein S3a-like                     256   2e-82   
ref|NP_195193.1|  40S ribosomal protein S3a-2                           256   2e-82   Arabidopsis thaliana [mouse-ear cress]
gb|KHG19560.1|  40S ribosomal S3a                                       256   3e-82   Gossypium arboreum [tree cotton]
ref|XP_007143300.1|  hypothetical protein PHAVU_007G060700g             256   3e-82   Phaseolus vulgaris [French bean]
emb|CDY17474.1|  BnaC03g65890D                                          256   3e-82   Brassica napus [oilseed rape]
ref|XP_002463137.1|  hypothetical protein SORBIDRAFT_02g038365          256   3e-82   Sorghum bicolor [broomcorn]
gb|ABB55362.1|  cyc07-like                                              256   4e-82   Solanum tuberosum [potatoes]
ref|XP_008218237.1|  PREDICTED: 40S ribosomal protein S3a-2             256   4e-82   Prunus mume [ume]
gb|KJB28382.1|  hypothetical protein B456_005G045000                    255   4e-82   Gossypium raimondii
gb|KHG11221.1|  40S ribosomal S3a                                       256   4e-82   Gossypium arboreum [tree cotton]
ref|XP_007205738.1|  hypothetical protein PRUPE_ppa010179mg             256   4e-82   Prunus persica
gb|ABB72808.1|  cyc07-like protein                                      256   4e-82   Solanum tuberosum [potatoes]
ref|XP_007157117.1|  hypothetical protein PHAVU_002G044200g             256   4e-82   Phaseolus vulgaris [French bean]
ref|XP_010274385.1|  PREDICTED: 40S ribosomal protein S3a-like          256   5e-82   Nelumbo nucifera [Indian lotus]
ref|XP_004496691.1|  PREDICTED: 40S ribosomal protein S3a-like          256   5e-82   Cicer arietinum [garbanzo]
gb|EEE56753.1|  hypothetical protein OsJ_06287                          260   5e-82   Oryza sativa Japonica Group [Japonica rice]
gb|KJB72261.1|  hypothetical protein B456_011G167500                    256   5e-82   Gossypium raimondii
ref|NP_001049289.1|  Os03g0200500                                       256   5e-82   
ref|XP_011030646.1|  PREDICTED: 40S ribosomal protein S3a-2-like        256   5e-82   Populus euphratica
gb|KFK30101.1|  hypothetical protein AALP_AA7G217000                    256   6e-82   Arabis alpina [alpine rockcress]
ref|NP_001152574.1|  40S ribosomal protein S3a                          255   6e-82   Zea mays [maize]
gb|ACR37738.1|  unknown                                                 252   7e-82   Zea mays [maize]
ref|NP_001141038.1|  hypothetical protein                               255   7e-82   Zea mays [maize]
sp|Q9MBB3.1|RS3A_DAUCA  RecName: Full=40S ribosomal protein S3a; ...    255   7e-82   Daucus carota [carrots]
gb|EYU41450.1|  hypothetical protein MIMGU_mgv1a002668mg                267   7e-82   Erythranthe guttata [common monkey flower]
gb|KJB28385.1|  hypothetical protein B456_005G045000                    254   1e-81   Gossypium raimondii
gb|AFW89330.1|  40S ribosomal protein S3a                               257   1e-81   
gb|ACU18272.1|  unknown                                                 254   1e-81   Glycine max [soybeans]
gb|AFW89335.1|  40S ribosomal protein S3a                               257   1e-81   
ref|XP_002463139.1|  hypothetical protein SORBIDRAFT_02g038380          253   1e-81   
ref|XP_002314671.2|  ribosomal protein S3a                              254   2e-81   Populus trichocarpa [western balsam poplar]
ref|XP_010272784.1|  PREDICTED: 40S ribosomal protein S3a-like          254   2e-81   Nelumbo nucifera [Indian lotus]
ref|XP_003638196.1|  40S ribosomal protein S3a                          254   2e-81   
ref|XP_006848758.1|  hypothetical protein AMTR_s00026p00042160          254   2e-81   Amborella trichopoda
ref|XP_010090259.1|  40S ribosomal protein S3a                          254   2e-81   Morus notabilis
gb|ACJ85751.1|  unknown                                                 254   2e-81   Medicago truncatula
ref|XP_007137418.1|  hypothetical protein PHAVU_009G125400g             254   2e-81   Phaseolus vulgaris [French bean]
gb|KCW60693.1|  hypothetical protein EUGRSUZ_H03423                     253   2e-81   Eucalyptus grandis [rose gum]
ref|XP_010419205.1|  PREDICTED: 40S ribosomal protein S3a-1-like        254   2e-81   Camelina sativa [gold-of-pleasure]
ref|XP_010485869.1|  PREDICTED: 40S ribosomal protein S3a-1             254   2e-81   Camelina sativa [gold-of-pleasure]
ref|XP_010675082.1|  PREDICTED: 40S ribosomal protein S3a               254   3e-81   Beta vulgaris subsp. vulgaris [field beet]
gb|AGT16352.1|  40S ribosomal protein S3a                               254   3e-81   Saccharum hybrid cultivar R570
ref|XP_008224264.1|  PREDICTED: 40S ribosomal protein S3a               254   3e-81   Prunus mume [ume]
ref|XP_010024230.1|  PREDICTED: 40S ribosomal protein S3a-like          254   3e-81   Eucalyptus grandis [rose gum]
tpg|DAA43947.1|  TPA: hypothetical protein ZEAMMB73_528269              251   3e-81   
ref|NP_001149096.1|  40S ribosomal protein S3a                          254   3e-81   Zea mays [maize]
gb|AFW89333.1|  hypothetical protein ZEAMMB73_166147                    255   4e-81   
ref|XP_010092425.1|  40S ribosomal protein S3a                          254   4e-81   
ref|NP_187135.1|  40S ribosomal protein S3a-1                           253   4e-81   Arabidopsis thaliana [mouse-ear cress]
emb|CDY40680.1|  BnaC03g33960D                                          253   5e-81   Brassica napus [oilseed rape]
emb|CDX76296.1|  BnaA08g11040D                                          253   5e-81   
ref|XP_009124201.1|  PREDICTED: 40S ribosomal protein S3a-2             253   5e-81   Brassica rapa
ref|XP_009108713.1|  PREDICTED: 40S ribosomal protein S3a-2-like        253   5e-81   Brassica rapa
emb|CDY50760.1|  BnaAnng10670D                                          253   6e-81   Brassica napus [oilseed rape]
ref|XP_009138316.1|  PREDICTED: 40S ribosomal protein S3a-2-like        253   7e-81   Brassica rapa
ref|XP_010432386.1|  PREDICTED: 40S ribosomal protein S3a-2-like        253   7e-81   Camelina sativa [gold-of-pleasure]
ref|XP_009110285.1|  PREDICTED: 40S ribosomal protein S3a-2             253   8e-81   Brassica rapa
emb|CDX75453.1|  BnaA01g02490D                                          253   8e-81   
emb|CDX69078.1|  BnaC01g03750D                                          253   8e-81   
ref|XP_009134791.1|  PREDICTED: 40S ribosomal protein S3a-2-like        253   9e-81   Brassica rapa
emb|CDX74165.1|  BnaA03g28820D                                          253   1e-80   
ref|XP_002869131.1|  40S ribosomal protein S3A                          253   1e-80   Arabidopsis lyrata subsp. lyrata
ref|XP_006298355.1|  hypothetical protein CARUB_v10014425mg             252   1e-80   Capsella rubella
ref|XP_006412198.1|  hypothetical protein EUTSA_v10026006mg             252   1e-80   Eutrema salsugineum [saltwater cress]
ref|XP_010463973.1|  PREDICTED: 40S ribosomal protein S3a-1-like        252   1e-80   Camelina sativa [gold-of-pleasure]
ref|XP_010437575.1|  PREDICTED: 40S ribosomal protein S3a-2             252   2e-80   Camelina sativa [gold-of-pleasure]
ref|XP_002882377.1|  40S ribosomal protein S3A                          252   2e-80   
ref|XP_003526635.1|  PREDICTED: 40S ribosomal protein S3a-like          252   2e-80   Glycine max [soybeans]
gb|AAC98779.1|  S-phase-specific ribosomal protein                      252   2e-80   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010447045.1|  PREDICTED: 40S ribosomal protein S3a-2-like        251   2e-80   Camelina sativa [gold-of-pleasure]
gb|KJB38201.1|  hypothetical protein B456_006G241700                    251   3e-80   Gossypium raimondii
ref|XP_009394355.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    251   3e-80   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACN40078.1|  unknown                                                 251   3e-80   Picea sitchensis
ref|XP_011032434.1|  PREDICTED: 40S ribosomal protein S3a               251   3e-80   Populus euphratica
ref|XP_006382773.1|  40S ribosomal protein S3A                          251   3e-80   Populus trichocarpa [western balsam poplar]
gb|KJB38202.1|  hypothetical protein B456_006G241700                    251   3e-80   Gossypium raimondii
gb|ACG33267.1|  40S ribosomal protein S3a                               251   4e-80   Zea mays [maize]
ref|XP_006838990.1|  hypothetical protein AMTR_s00002p00271660          251   4e-80   
ref|NP_001288829.1|  40S ribosomal protein S3a                          251   5e-80   Brassica rapa
ref|XP_009406016.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    251   5e-80   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH32959.1|  40S ribosomal protein S3a-1                             251   5e-80   Medicago truncatula
emb|CDY21109.1|  BnaA01g33400D                                          250   6e-80   Brassica napus [oilseed rape]
gb|ACG34058.1|  40S ribosomal protein S3a                               250   6e-80   Zea mays [maize]
ref|XP_006382772.1|  hypothetical protein POPTR_0005s05280g             250   7e-80   
emb|CDY30019.1|  BnaC01g39890D                                          251   8e-80   Brassica napus [oilseed rape]
ref|XP_004296667.1|  PREDICTED: 40S ribosomal protein S3a               250   8e-80   Fragaria vesca subsp. vesca
ref|XP_009408135.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    250   9e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002987274.1|  hypothetical protein SELMODRAFT_271906             249   1e-79   Selaginella moellendorffii
ref|XP_008391001.1|  PREDICTED: 40S ribosomal protein S3a-2-like        249   1e-79   Malus domestica [apple tree]
ref|XP_009400022.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    249   2e-79   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008390932.1|  PREDICTED: 40S ribosomal protein S3a-2-like        249   3e-79   Malus domestica [apple tree]
ref|XP_009335287.1|  PREDICTED: 40S ribosomal protein S3a-2-like        249   3e-79   Pyrus x bretschneideri [bai li]
gb|KHN21710.1|  40S ribosomal protein S3a                               251   3e-79   Glycine soja [wild soybean]
ref|XP_004302028.1|  PREDICTED: 40S ribosomal protein S3a-2             248   6e-79   Fragaria vesca subsp. vesca
gb|ABK93399.1|  unknown                                                 248   9e-79   Populus trichocarpa [western balsam poplar]
gb|AAP80855.1|  cyc07                                                   246   1e-78   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006420004.1|  hypothetical protein CICLE_v10005663mg             247   1e-78   Citrus clementina [clementine]
gb|KDO74488.1|  hypothetical protein CISIN_1g024879mg                   246   2e-78   Citrus sinensis [apfelsine]
ref|XP_001761018.1|  predicted protein                                  244   1e-77   
ref|XP_007226551.1|  hypothetical protein PRUPE_ppa024854mg             253   6e-77   
ref|XP_001767326.1|  predicted protein                                  242   1e-76   
gb|EEE53089.1|  hypothetical protein OsJ_35850                          254   3e-76   Oryza sativa Japonica Group [Japonica rice]
gb|KDO37446.1|  hypothetical protein CISIN_1g045491mg                   240   3e-76   Citrus sinensis [apfelsine]
ref|XP_001755439.1|  predicted protein                                  241   3e-76   
gb|EEC69140.1|  hypothetical protein OsI_38068                          255   3e-76   Oryza sativa Indica Group [Indian rice]
ref|XP_006428321.1|  hypothetical protein CICLE_v10012508mg             241   4e-76   Citrus clementina [clementine]
gb|KDO43437.1|  hypothetical protein CISIN_1g040060mg                   240   4e-76   Citrus sinensis [apfelsine]
ref|XP_001774632.1|  predicted protein                                  241   5e-76   
ref|XP_001765908.1|  predicted protein                                  240   5e-76   
ref|XP_001765967.1|  predicted protein                                  240   6e-76   
ref|XP_002949135.1|  component of cytosolic 80S ribosome and 40S ...    239   1e-75   Volvox carteri f. nagariensis
gb|AAX55706.1|  cyc07                                                   238   1e-75   Vitis vinifera
ref|XP_001693710.1|  ribosomal protein S3a, component of cytosoli...    238   3e-75   Chlamydomonas reinhardtii
ref|XP_001777314.1|  predicted protein                                  236   3e-74   
emb|CBX25071.1|  40S ribosomal protein S3a                              234   1e-73   Polytomella sp. Pringsheim 198.80
gb|EMT30223.1|  40S ribosomal protein S3a                               231   2e-72   
emb|CEG00819.1|  Ribosomal protein S3Ae                                 230   5e-72   Ostreococcus tauri
ref|XP_001422366.1|  Ribosomal protein S3a, component of cytosoli...    230   6e-72   Ostreococcus lucimarinus CCE9901
ref|XP_005650618.1|  ribosomal protein S3Ae                             229   1e-71   Coccomyxa subellipsoidea C-169
ref|XP_008671813.1|  PREDICTED: 40S ribosomal protein S3a-like          224   9e-70   Zea mays [maize]
gb|AFW89329.1|  hypothetical protein ZEAMMB73_166147                    222   3e-69   
gb|KFM56731.1|  40S ribosomal protein S3a                               219   7e-69   Stegodyphus mimosarum
ref|XP_002428136.1|  40S ribosomal protein S3A, putative                222   1e-68   Pediculus humanus corporis [human body lice]
gb|ACD65096.1|  putative 40S ribosomal protein RPS3A                    219   1e-68   Novocrania anomala
ref|XP_007508881.1|  predicted protein                                  221   1e-68   Bathycoccus prasinos
gb|ABX75452.1|  40S ribosomal protein S3a                               218   6e-68   Lycosa singoriensis
gb|ABW23199.1|  ribosomal protein rps3a                                 218   2e-67   Eurythoe complanata
gb|KDR16079.1|  40S ribosomal protein S3a                               218   3e-67   Zootermopsis nevadensis
gb|ACD61705.1|  ribosomal protein S3                                    218   4e-67   Chironomus riparius
sp|Q5G5C4.1|RS3A_PERAM  RecName: Full=40S ribosomal protein S3a         218   4e-67   Periplaneta americana
gb|AGM32131.1|  40S ribosomal protein S3a                               218   5e-67   Coptotermes formosanus
sp|Q6EV04.1|RS3A_BIPLU  RecName: Full=40S ribosomal protein S3a         217   1e-66   Biphyllus lunatus
gb|ABI52667.1|  40S ribosomal protein S3a                               216   1e-66   Argas monolakensis
gb|ABS44871.1|  ribosomal protein S3Ae                                  216   1e-66   Pteromalus puparum
gb|ABE66401.1|  S phase protein                                         214   1e-66   Striga asiatica [witchweed]
ref|XP_001601315.1|  PREDICTED: 40S ribosomal protein S3a               216   2e-66   Nasonia vitripennis
gb|KDD76342.1|  ribosomal protein S3Ae                                  216   2e-66   Helicosporidium sp. ATCC 50920
gb|AAV84249.1|  ribosomal protein S3                                    214   3e-66   Culicoides sonorensis
gb|ACD65136.1|  putative 40S ribosomal protein RPS3A                    212   7e-66   Phoronis muelleri
tpg|DAA34106.1|  TPA: 40S ribosomal protein S3a                         213   7e-66   Amblyomma variegatum
dbj|BAN20332.1|  ribosomal protein S3A                                  214   7e-66   Riptortus pedestris
ref|XP_002505259.1|  predicted protein                                  214   8e-66   Micromonas commoda
gb|AAU06483.1|  ribosomal protein subunit 3                             214   8e-66   Culicoides sonorensis
gb|ABZ04255.1|  ribosomal protein rps3a                                 213   8e-66   Lineus viridis
ref|XP_002465526.1|  hypothetical protein SORBIDRAFT_01g040570          214   9e-66   
ref|XP_008555289.1|  PREDICTED: 40S ribosomal protein S3a               214   1e-65   Microplitis demolitor
ref|XP_011421732.1|  PREDICTED: 40S ribosomal protein S3a-like          214   1e-65   
ref|XP_011495909.1|  PREDICTED: 40S ribosomal protein S3a               214   2e-65   Ceratosolen solmsi marchali
gb|EKC30815.1|  40S ribosomal protein S3a                               214   2e-65   Crassostrea gigas
sp|Q4PM31.1|RS3A_IXOSC  RecName: Full=40S ribosomal protein S3a         213   3e-65   Ixodes scapularis [blacklegged tick]
emb|CAJ17219.1|  ribosomal protein S3Ae                                 213   3e-65   Timarcha balearica
ref|XP_009024124.1|  hypothetical protein HELRODRAFT_185887             213   3e-65   Helobdella robusta
ref|XP_968064.1|  PREDICTED: 40S ribosomal protein S3a                  213   3e-65   Tribolium castaneum [rust-red flour beetle]
gb|EYU26004.1|  hypothetical protein MIMGU_mgv1a019927mg                211   4e-65   Erythranthe guttata [common monkey flower]
sp|Q4KTD9.1|RS3A_SUBDO  RecName: Full=40S ribosomal protein S3a         212   5e-65   Suberites domuncula
gb|ERZ98268.1|  hypothetical protein GLOINDRAFT_339726                  211   7e-65   
ref|XP_011421723.1|  PREDICTED: 40S ribosomal protein S3a-like          212   8e-65   Crassostrea gigas
gb|ACY71306.1|  ribosomal protein S3A                                   212   9e-65   Chrysomela tremula
sp|A6YPJ8.1|RS3A_TRIIF  RecName: Full=40S ribosomal protein S3a         211   2e-64   Triatoma infestans
emb|CAD91420.1|  ribosomal protein S3a                                  211   2e-64   Crassostrea gigas
gb|EYU30365.1|  hypothetical protein MIMGU_mgv1a021183mg                209   3e-64   Erythranthe guttata [common monkey flower]
ref|XP_011155135.1|  PREDICTED: 40S ribosomal protein S3a               211   3e-64   Harpegnathos saltator
ref|XP_011142878.1|  PREDICTED: 40S ribosomal protein S3a               210   3e-64   Harpegnathos saltator
ref|XP_011159168.1|  PREDICTED: 40S ribosomal protein S3a               210   3e-64   Solenopsis invicta [imported red fire ant]
ref|XP_008478156.1|  PREDICTED: 40S ribosomal protein S3a               208   3e-64   
ref|XP_003060358.1|  predicted protein                                  210   4e-64   Micromonas pusilla CCMP1545
ref|XP_011352079.1|  PREDICTED: 40S ribosomal protein S3a               210   4e-64   Ooceraea biroi
dbj|BAH12261.1|  unnamed protein product                                207   4e-64   Homo sapiens [man]
ref|XP_011060675.1|  PREDICTED: 40S ribosomal protein S3a               210   4e-64   Acromyrmex echinatior
ref|XP_011259689.1|  PREDICTED: 40S ribosomal protein S3a               210   4e-64   Camponotus floridanus
gb|KHG19561.1|  40S ribosomal S3a                                       209   5e-64   Gossypium arboreum [tree cotton]
ref|XP_005954900.1|  PREDICTED: 40S ribosomal protein S3a-like          209   6e-64   Pantholops hodgsonii [Tibetan antelope]
gb|KGL84225.1|  hypothetical protein N309_14824                         206   7e-64   Tinamus guttatus
gb|EDL42086.1|  mCG2066                                                 206   7e-64   Mus musculus [mouse]
ref|XP_001774288.1|  predicted protein                                  209   7e-64   
ref|XP_003399883.1|  PREDICTED: 40S ribosomal protein S3a-like          209   7e-64   Bombus terrestris [large earth bumblebee]
ref|XP_003221796.1|  PREDICTED: 40S ribosomal protein S3a               209   7e-64   Anolis carolinensis [Carolina anole]
ref|XP_003704988.1|  PREDICTED: 40S ribosomal protein S3a-like          209   8e-64   Megachile rotundata
emb|CAB46830.1|  Ribosomal protein                                      206   8e-64   Canis lupus familiaris [dogs]
ref|XP_007437219.1|  PREDICTED: 40S ribosomal protein S3a-like          209   9e-64   Python bivittatus
ref|XP_002598366.1|  hypothetical protein BRAFLDRAFT_69722              209   9e-64   Branchiostoma floridae
ref|XP_004337280.1|  40S ribosomal protein S3a, putative                209   1e-63   Acanthamoeba castellanii str. Neff
ref|XP_009075160.1|  PREDICTED: 40S ribosomal protein S3a               208   1e-63   Acanthisitta chloris
ref|XP_005149013.1|  PREDICTED: 40S ribosomal protein S3a isoform X4    207   1e-63   Melopsittacus undulatus
gb|AAT76631.1|  ribosomal protein S3a                                   208   1e-63   Felis catus [cat]
gb|KFO84143.1|  40S ribosomal protein S3a                               208   1e-63   Buceros rhinoceros silvestris
ref|XP_005014766.1|  PREDICTED: 40S ribosomal protein S3a               208   1e-63   
ref|XP_011297729.1|  PREDICTED: 40S ribosomal protein S3a               209   1e-63   Fopius arisanus
ref|XP_005415772.1|  PREDICTED: 40S ribosomal protein S3a               208   1e-63   
ref|XP_007055759.1|  PREDICTED: 40S ribosomal protein S3a-A isofo...    207   1e-63   
ref|XP_005517609.1|  PREDICTED: 40S ribosomal protein S3a isoform X3    207   1e-63   
gb|EFX89527.1|  hypothetical protein DAPPUDRAFT_303071                  209   1e-63   Daphnia pulex
gb|EFB26537.1|  hypothetical protein PANDA_001716                       208   1e-63   Ailuropoda melanoleuca
ref|NP_001279332.1|  ribosomal protein S3A                              209   1e-63   Callorhinchus milii [Australian ghost shark]
ref|XP_009977023.1|  PREDICTED: 40S ribosomal protein S3a               208   1e-63   Tauraco erythrolophus
ref|XP_010203978.1|  PREDICTED: 40S ribosomal protein S3a               208   1e-63   
gb|EOB04964.1|  40S ribosomal protein S3a                               208   1e-63   
gb|EMC77645.1|  40S ribosomal protein S3a                               208   1e-63   
ref|XP_006735747.1|  PREDICTED: 40S ribosomal protein S3a-like is...    208   1e-63   
gb|ETE70827.1|  40S ribosomal protein S3a                               209   1e-63   
gb|KFM10230.1|  40S ribosomal protein S3a                               208   1e-63   
gb|KFP91786.1|  40S ribosomal protein S3a                               208   1e-63   
ref|XP_007902210.1|  PREDICTED: 40S ribosomal protein S3a               209   1e-63   
ref|XP_005955989.1|  PREDICTED: 40S ribosomal protein S3a-like is...    209   1e-63   
gb|EAX04989.1|  ribosomal protein S3A, isoform CRA_b                    208   1e-63   
gb|KFR12636.1|  40S ribosomal protein S3a                               208   1e-63   
gb|KFW97162.1|  40S ribosomal protein S3a                               208   2e-63   
gb|EAW77577.1|  hCG33299, isoform CRA_a                                 209   2e-63   
ref|XP_010311392.1|  PREDICTED: 40S ribosomal protein S3a               208   2e-63   
gb|KFP00832.1|  40S ribosomal protein S3a                               208   2e-63   
ref|XP_004088582.1|  PREDICTED: 40S ribosomal protein S3a               207   2e-63   
ref|XP_005330207.1|  PREDICTED: 40S ribosomal protein S3a-like          208   2e-63   
gb|EAW77579.1|  hCG33299, isoform CRA_c                                 208   2e-63   
ref|XP_005967889.1|  PREDICTED: 40S ribosomal protein S3a-like          208   2e-63   
emb|CBI34197.3|  unnamed protein product                                207   2e-63   
ref|XP_007230303.1|  PREDICTED: 40S ribosomal protein S3a               208   2e-63   
gb|ELW69964.1|  40S ribosomal protein S3a                               208   2e-63   
ref|XP_003205487.1|  PREDICTED: 40S ribosomal protein S3a isoform X1    208   2e-63   
ref|XP_009281624.1|  PREDICTED: 40S ribosomal protein S3a               208   2e-63   
ref|XP_008933878.1|  PREDICTED: 40S ribosomal protein S3a               207   2e-63   
ref|XP_003923833.1|  PREDICTED: 40S ribosomal protein S3a               208   2e-63   
ref|XP_005436755.1|  PREDICTED: 40S ribosomal protein S3a               208   2e-63   
dbj|BAE88391.1|  unnamed protein product                                208   2e-63   
ref|XP_006629554.1|  PREDICTED: 40S ribosomal protein S3a-like          208   2e-63   
gb|AAA35682.1|  ribosmal protein small subunit                          208   2e-63   
gb|AAH66926.1|  Ribosomal protein S3A                                   208   2e-63   
ref|XP_008492080.1|  PREDICTED: 40S ribosomal protein S3a               207   2e-63   
ref|XP_005149010.1|  PREDICTED: 40S ribosomal protein S3a isoform X1    208   2e-63   
sp|O43999.3|RS3A_EIMTE  RecName: Full=40S ribosomal protein S3a; ...    208   2e-63   
ref|NP_001075886.1|  ribosomal protein S3A                              208   2e-63   
ref|XP_009969079.1|  PREDICTED: 40S ribosomal protein S3a               208   2e-63   
ref|XP_008047613.1|  PREDICTED: 40S ribosomal protein S3a               208   2e-63   
ref|XP_008852472.1|  PREDICTED: 40S ribosomal protein S3a               208   2e-63   
ref|NP_000997.1|  40S ribosomal protein S3a isoform 1                   208   2e-63   
ref|NP_001185510.1|  40S ribosomal protein S3a                          208   2e-63   
ref|NP_058655.3|  40S ribosomal protein S3a                             208   2e-63   
ref|XP_008633930.1|  PREDICTED: 40S ribosomal protein S3a               208   2e-63   
ref|XP_010016125.1|  PREDICTED: 40S ribosomal protein S3a               208   2e-63   
ref|XP_005045047.1|  PREDICTED: 40S ribosomal protein S3a               208   2e-63   
ref|XP_005307414.1|  PREDICTED: 40S ribosomal protein S3a               208   2e-63   
dbj|BAF83764.1|  unnamed protein product                                208   2e-63   
sp|Q6DV02.3|RS3A_GECJA  RecName: Full=40S ribosomal protein S3a         208   2e-63   
sp|P61246.1|RS3A_FELCA  RecName: Full=40S ribosomal protein S3a         208   2e-63   
ref|XP_004088583.1|  PREDICTED: 40S ribosomal protein S3a               206   2e-63   
ref|XP_006985395.1|  PREDICTED: 40S ribosomal protein S3a-like          208   2e-63   
ref|XP_009873775.1|  PREDICTED: 40S ribosomal protein S3a               208   2e-63   
ref|XP_004655919.1|  PREDICTED: 40S ribosomal protein S3a               208   2e-63   
ref|XP_004323125.1|  PREDICTED: 40S ribosomal protein S3a-like          208   2e-63   
ref|XP_004017251.1|  PREDICTED: 40S ribosomal protein S3a               208   2e-63   
dbj|BAE87927.1|  unnamed protein product                                208   2e-63   
ref|XP_006040183.1|  PREDICTED: 40S ribosomal protein S3a-like          208   2e-63   
ref|XP_006884543.1|  PREDICTED: 40S ribosomal protein S3a-like          208   2e-63   
ref|XP_009896517.1|  PREDICTED: 40S ribosomal protein S3a               208   2e-63   
dbj|BAE32029.1|  unnamed protein product                                208   2e-63   
ref|XP_007635341.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    208   2e-63   
ref|NP_058849.1|  40S ribosomal protein S3a                             208   2e-63   
ref|XP_001366653.1|  PREDICTED: 40S ribosomal protein S3a               208   2e-63   
ref|XP_005809444.1|  PREDICTED: 40S ribosomal protein S3a-like          208   2e-63   
gb|EAX04994.1|  ribosomal protein S3A, isoform CRA_g                    208   3e-63   
ref|XP_008931489.1|  PREDICTED: 40S ribosomal protein S3a               208   3e-63   
ref|XP_006262711.1|  PREDICTED: 40S ribosomal protein S3a               208   3e-63   
ref|XP_003797009.1|  PREDICTED: 40S ribosomal protein S3a-like is...    208   3e-63   
ref|XP_010773841.1|  PREDICTED: 40S ribosomal protein S3a               208   3e-63   
ref|XP_005710608.1|  40S ribosomal protein S3A                          207   3e-63   
ref|XP_004055608.1|  PREDICTED: 40S ribosomal protein S3a-like          207   3e-63   
dbj|BAC56507.1|  similar to ribosomal protein S3a                       204   4e-63   
ref|XP_008314924.1|  PREDICTED: 40S ribosomal protein S3a               207   4e-63   
ref|XP_009099772.1|  PREDICTED: 40S ribosomal protein S3a               207   4e-63   
ref|XP_010223052.1|  PREDICTED: 40S ribosomal protein S3a               208   4e-63   
dbj|BAB22611.1|  unnamed protein product                                207   4e-63   
gb|ABY28374.1|  ribosomal protein S3a                                   207   4e-63   
ref|XP_006174472.1|  PREDICTED: 40S ribosomal protein S3a               207   4e-63   
ref|NP_001291168.1|  ribosomal protein S3A                              207   4e-63   
ref|XP_007528141.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    207   4e-63   
ref|XP_001514859.1|  PREDICTED: 40S ribosomal protein S3a               207   4e-63   
ref|NP_001134789.1|  40S ribosomal protein S3a                          207   4e-63   
ref|XP_006779434.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    207   4e-63   
ref|XP_009509149.1|  PREDICTED: 40S ribosomal protein S3a               207   4e-63   
gb|AGQ03805.1|  ribosomal protein S3A                                   207   4e-63   
ref|XP_004411050.1|  PREDICTED: 40S ribosomal protein S3a-like          208   4e-63   
ref|NP_956353.1|  40S ribosomal protein S3a                             207   4e-63   
ref|XP_001633847.1|  predicted protein                                  207   5e-63   
ref|NP_001104210.1|  40S ribosomal protein S3a-B                        207   5e-63   
gb|AAT44427.1|  V-Fos transformation effector-like protein              207   5e-63   
ref|XP_003797010.1|  PREDICTED: 40S ribosomal protein S3a-like is...    207   5e-63   
ref|NP_001008075.1|  40S ribosomal protein S3a                          207   6e-63   
gb|AFM88910.1|  40S ribosomal protein S3a                               207   6e-63   
dbj|BAE30393.1|  unnamed protein product                                207   6e-63   
gb|ADO29317.1|  40S ribosomal protein s3a                               207   6e-63   
ref|XP_003417586.1|  PREDICTED: 40S ribosomal protein S3a               207   6e-63   
gb|ACQ58827.1|  40S ribosomal protein S3a                               207   6e-63   
ref|XP_008285008.1|  PREDICTED: 40S ribosomal protein S3a               207   6e-63   
ref|NP_001098311.1|  40S ribosomal protein S3a                          207   6e-63   
sp|A2Q0R8.1|RS3A_SOLSE  RecName: Full=40S ribosomal protein S3a         207   7e-63   
ref|XP_003449725.1|  PREDICTED: 40S ribosomal protein S3a-like          207   7e-63   
ref|NP_001080325.1|  40S ribosomal protein S3a-A                        207   7e-63   
gb|AFM85626.1|  40S ribosomal protein S3a                               207   7e-63   
ref|XP_009480002.1|  PREDICTED: 40S ribosomal protein S3a               207   8e-63   
sp|Q98TX2.3|RS3A_OPHHA  RecName: Full=40S ribosomal protein S3a         207   8e-63   
gb|EAX04993.1|  ribosomal protein S3A, isoform CRA_f                    207   8e-63   
ref|XP_009565584.1|  PREDICTED: 40S ribosomal protein S3a isoform X2    206   9e-63   
ref|XP_010727857.1|  PREDICTED: 40S ribosomal protein S3a isoform X1    207   9e-63   
gb|AFM88988.1|  ribosomal protein S3a                                   207   9e-63   
ref|XP_005954137.1|  PREDICTED: 40S ribosomal protein S3a-like is...    206   1e-62   
ref|XP_003267670.1|  PREDICTED: 40S ribosomal protein S3a-like          206   1e-62   
ref|NP_001270826.1|  40S ribosomal protein S3a                          206   1e-62   
ref|XP_004049753.1|  PREDICTED: 40S ribosomal protein S3a-like          203   1e-62   
gb|AFM88390.1|  ribosomal protein S3a                                   206   1e-62   
ref|XP_005500910.1|  PREDICTED: 40S ribosomal protein S3a               207   1e-62   
ref|XP_009827334.1|  hypothetical protein H257_04494                    206   1e-62   
dbj|BAE27060.1|  unnamed protein product                                206   1e-62   
gb|ELW50426.1|  40S ribosomal protein S3a                               208   1e-62   
gb|AFM90263.1|  40S ribosomal protein S3a                               206   1e-62   
gb|KIY97031.1|  small subunit ribosomal protein S3Ae                    204   1e-62   
ref|XP_010559325.1|  PREDICTED: 40S ribosomal protein S3a               208   2e-62   
ref|XP_005996413.1|  PREDICTED: 40S ribosomal protein S3a               206   2e-62   
ref|XP_006879080.1|  PREDICTED: 40S ribosomal protein S3a-like          206   2e-62   
ref|XP_007469965.1|  PREDICTED: 40S ribosomal protein S3a               206   2e-62   
ref|XP_001501524.2|  PREDICTED: 40S ribosomal protein S3a               209   2e-62   
gb|EXX58553.1|  ribosomal 40S subunit protein S1A                       206   2e-62   
ref|XP_003972467.1|  PREDICTED: 40S ribosomal protein S3a-like is...    206   2e-62   
ref|NP_001129593.1|  ribosomal protein S3A                              206   2e-62   
ref|XP_011395666.1|  40S ribosomal protein S3a                          206   2e-62   
ref|XP_004168031.1|  PREDICTED: 40S ribosomal protein S3a-like          204   2e-62   
ref|XP_010410434.1|  PREDICTED: 40S ribosomal protein S3a               206   2e-62   
ref|XP_008619762.1|  40S ribosomal protein S3a-2                        205   3e-62   
gb|AEE62515.1|  unknown                                                 206   3e-62   
ref|XP_008588996.1|  PREDICTED: 40S ribosomal protein S3a-like          207   3e-62   
gb|KDO28449.1|  40S ribosomal protein S3a-2                             205   3e-62   
ref|XP_005871471.1|  PREDICTED: 40S ribosomal protein S3a               208   3e-62   
ref|XP_009328112.1|  PREDICTED: 40S ribosomal protein S3a               207   3e-62   
ref|XP_009494472.1|  30S ribosomal protein S3Ae                         205   4e-62   
ref|XP_003385841.1|  PREDICTED: 40S ribosomal protein S3a-like          205   4e-62   
sp|B0WN96.2|RS3A_CULQU  RecName: Full=40S ribosomal protein S3a         205   4e-62   
ref|XP_005149012.1|  PREDICTED: 40S ribosomal protein S3a isoform X3    204   4e-62   
gb|AAK95185.1|  40S ribosomal protein S3a                               205   4e-62   
ref|XP_003945196.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    205   4e-62   
ref|XP_003773191.1|  PREDICTED: 40S ribosomal protein S3a               210   5e-62   
ref|XP_008872125.1|  hypothetical protein H310_08228                    204   5e-62   
ref|NP_001131091.1|  40S ribosomal protein S3a                          204   6e-62   
emb|CCD22031.1|  40S ribosomal protein S3A                              201   7e-62   
ref|XP_002744350.1|  PREDICTED: 40S ribosomal protein S3a               204   7e-62   
ref|XP_005096171.1|  PREDICTED: 40S ribosomal protein S3a-like          204   8e-62   
ref|XP_005542823.1|  PREDICTED: 40S ribosomal protein S3a-like          204   8e-62   
gb|AGH70187.1|  40S ribosomal protein S3a                               204   9e-62   
ref|XP_001651595.1|  AAEL005901-PA                                      202   1e-61   
ref|XP_009210953.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    204   1e-61   
ref|XP_009406018.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    203   1e-61   
ref|XP_003191240.1|  40s ribosomal protein s3ae-a (s1-a)                204   1e-61   
gb|AEP43788.1|  40S ribosomal protein S3a                               204   1e-61   
sp|Q4T8S6.3|RS3A_TETNG  RecName: Full=40S ribosomal protein S3a         204   1e-61   
gb|KGB79628.1|  40S ribosomal protein S3ae-a                            203   1e-61   
gb|AHH81805.1|  ribosomal protein s3a                                   202   1e-61   
ref|XP_001099771.1|  PREDICTED: 40S ribosomal protein S3a-like          203   1e-61   
ref|XP_003740510.1|  PREDICTED: 40S ribosomal protein S3a-like          203   2e-61   
ref|XP_001850180.1|  40S ribosomal protein S3a                          207   2e-61   
ref|XP_001837102.1|  40S ribosomal protein S1                           203   2e-61   
gb|ELR56309.1|  hypothetical protein M91_13443                          200   2e-61   
gb|KIK30608.1|  hypothetical protein PISMIDRAFT_670675                  203   2e-61   
emb|CAJ17199.1|  ribosomal protein S3Ae                                 203   2e-61   
tpg|DAA12651.1|  TPA: ribosomal protein S3a-like                        203   2e-61   
ref|XP_003473456.1|  PREDICTED: 40S ribosomal protein S3a-like          203   2e-61   
ref|XP_004045861.1|  PREDICTED: 40S ribosomal protein S3a-like is...    203   2e-61   
gb|KIY51600.1|  ribosomal protein S3Ae                                  203   2e-61   
ref|XP_005692628.1|  PREDICTED: 40S ribosomal protein S3a-like          202   2e-61   
ref|XP_001651594.1|  AAEL005901-PB                                      203   2e-61   
ref|XP_568980.1|  40s ribosomal protein s3ae-a (s1-a)                   203   2e-61   
gb|KIK48635.1|  hypothetical protein CY34DRAFT_797777                   202   3e-61   
ref|XP_006994622.1|  PREDICTED: 40S ribosomal protein S3a-like          203   3e-61   
gb|EJT50838.1|  40s ribosomal protein s3ae-a (s1-a)                     202   3e-61   
sp|A5JSW9.1|RS3A_BOMMA  RecName: Full=40S ribosomal protein S3a         202   3e-61   
ref|XP_003786993.1|  PREDICTED: 40S ribosomal protein S3a-like          202   3e-61   
pdb|4KZX|B  Chain B, Rabbit 40s Ribosomal Subunit In Complex With...    202   3e-61   
ref|XP_007392195.1|  hypothetical protein PHACADRAFT_250267             202   3e-61   
sp|P49395.2|RS3A_APLCA  RecName: Full=40S ribosomal protein S3a; ...    202   4e-61   
gb|ACT21541.1|  s3a protein                                             202   4e-61   
gb|KIM46265.1|  hypothetical protein M413DRAFT_441346                   202   5e-61   
gb|ADI50268.1|  S3a protein                                             202   5e-61   
ref|XP_005978767.1|  PREDICTED: 40S ribosomal protein S3a-like          202   5e-61   
gb|KIM68608.1|  hypothetical protein SCLCIDRAFT_1208801                 202   5e-61   
gb|EMD41078.1|  hypothetical protein CERSUDRAFT_80722                   202   5e-61   
gb|ELW51946.1|  40S ribosomal protein S3a                               200   5e-61   
ref|XP_007315533.1|  hypothetical protein SERLADRAFT_382295             202   6e-61   
gb|KDQ14611.1|  hypothetical protein BOTBODRAFT_65919                   202   6e-61   
ref|XP_004420966.1|  PREDICTED: 40S ribosomal protein S3a isoform 1     202   6e-61   
dbj|BAQ21252.1|  hypothetical protein                                   199   7e-61   
ref|XP_002901276.1|  40S ribosomal protein S3a                          201   8e-61   
ref|XP_006821611.1|  PREDICTED: 40S ribosomal protein S3a-like          202   8e-61   
sp|Q56FG9.1|RS3A_LYSTE  RecName: Full=40S ribosomal protein S3a         201   9e-61   
ref|XP_009040503.1|  hypothetical protein AURANDRAFT_38843              202   9e-61   
ref|XP_003433155.1|  PREDICTED: 40S ribosomal protein S3a-like          202   9e-61   
ref|XP_005572524.1|  PREDICTED: 40S ribosomal protein S3a-like          201   9e-61   
gb|ACY95341.1|  ribosomal protein S3A                                   201   1e-60   
gb|AFR93504.1|  small subunit ribosomal protein S1                      201   1e-60   
ref|XP_007843081.1|  40s ribosomal protein s3ae                         201   1e-60   
ref|XP_003038024.1|  40S ribosomal protein S1                           201   1e-60   
gb|ABX44775.1|  putative 40S ribosomal protein RPS3A                    201   1e-60   
ref|XP_007116397.1|  PREDICTED: 40S ribosomal protein S3a-like          201   1e-60   
gb|EPS95373.1|  hypothetical protein FOMPIDRAFT_157719                  201   1e-60   
gb|KIV90937.1|  40S ribosomal protein S1                                201   1e-60   
ref|XP_002116071.1|  expressed hypothetical protein                     201   1e-60   
sp|B0CY45.2|RS3A_LACBS  RecName: Full=40S ribosomal protein S1          201   1e-60   
emb|CBJ29379.1|  conserved unknown protein                              201   1e-60   
dbj|BAM17666.1|  ribosomal protein S3A                                  201   2e-60   
ref|XP_007382215.1|  S-phase-specific ribosomal protein cyc07           201   2e-60   
sp|Q9XEG7.3|RS3A_TORRU  RecName: Full=40S ribosomal protein S3a         200   2e-60   
ref|XP_007686274.1|  hypothetical protein COCMIDRAFT_90741              201   2e-60   
ref|XP_005641295.1|  PREDICTED: 40S ribosomal protein S3a-like          201   2e-60   
ref|XP_007767741.1|  ribosomal protein S3Ae                             201   2e-60   
gb|ADT80700.1|  ribosomal protein S3A                                   201   2e-60   
gb|KIJ70171.1|  hypothetical protein HYDPIDRAFT_104846                  201   2e-60   
ref|XP_007862325.1|  40S ribosomal protein S1                           200   2e-60   
ref|XP_004349214.1|  ribosomal protein S3a                              201   2e-60   
ref|XP_001931333.1|  40S ribosomal protein S1                           200   2e-60   
gb|ACV83781.1|  ribosomal protein S3A                                   201   2e-60   
gb|KIK65348.1|  hypothetical protein GYMLUDRAFT_38796                   200   2e-60   



>ref|XP_011090682.1| PREDICTED: 40S ribosomal protein S3a [Sesamum indicum]
Length=260

 Score =   270 bits (690),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/133 (95%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF+TRN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED+AFRKIRLR
Sbjct  28   DWYDIKAPSVFNTRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGDEDHAFRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTDNYTLRMFCI FTKKRV
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDNYTLRMFCIAFTKKRV  147

Query  533  NQQKRTCYAQSSQ  571
            NQQKRTCYAQSSQ
Sbjct  148  NQQKRTCYAQSSQ  160



>ref|XP_011073454.1| PREDICTED: 40S ribosomal protein S3a-like [Sesamum indicum]
Length=260

 Score =   269 bits (687),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 126/133 (95%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF+TRN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED+AFRKIRLR
Sbjct  28   DWYDIKAPSVFNTRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGDEDHAFRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTDNYTLRMFCI FTKKRV
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDNYTLRMFCIAFTKKRV  147

Query  533  NQQKRTCYAQSSQ  571
            NQQKRTCYAQSSQ
Sbjct  148  NQQKRTCYAQSSQ  160



>gb|EPS65103.1| hypothetical protein M569_09676, partial [Genlisea aurea]
Length=165

 Score =   265 bits (676),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAPS+F+TRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED++FRKIRLR
Sbjct  30   DWYDVKAPSIFNTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDHSFRKIRLR  89

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG++VLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTDNYTLRMFCI FTKKR 
Sbjct  90   AEDVQGKSVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDNYTLRMFCIAFTKKRA  149

Query  533  NQQKRTCYAQSSQ  571
            NQQKRTCYAQSSQ
Sbjct  150  NQQKRTCYAQSSQ  162



>gb|EYU23687.1| hypothetical protein MIMGU_mgv1a012196mg [Erythranthe guttata]
Length=259

 Score =   266 bits (681),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED+AFRKIRLR
Sbjct  28   DWYDVKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGDEDHAFRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLR+FCI FTKKR 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRLFCIAFTKKRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQQKRTCYAQSSQ
Sbjct  148  NQQKRTCYAQSSQ  160



>ref|XP_004247589.1| PREDICTED: 40S ribosomal protein S3a [Solanum lycopersicum]
Length=260

 Score =   266 bits (679),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF  RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED++FRKIRLR
Sbjct  28   DWYDIKAPSVFGVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDHSFRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNF GMDFTTDKLRSLVKKWQSLIEAHVDVKTTD+YTLRMFCIGFTKKR 
Sbjct  88   AEDVQGRNVLTNFHGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDSYTLRMFCIGFTKKRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQQKRTCYAQSSQ
Sbjct  148  NQQKRTCYAQSSQ  160



>emb|CDO99096.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   266 bits (679),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVFS RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DE++AFRKIRLR
Sbjct  28   DWYDIKAPSVFSVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEEHAFRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTDNY+LR+FCIGFTKKR+
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDNYSLRLFCIGFTKKRL  147

Query  533  NQQKRTCYAQSSQ  571
            NQQKRTCYAQSSQ
Sbjct  148  NQQKRTCYAQSSQ  160



>ref|NP_001275164.1| 40S ribosomal protein S3a-like protein [Solanum tuberosum]
 gb|ABB72801.1| 40S ribosomal protein S3a-like protein [Solanum tuberosum]
Length=260

 Score =   266 bits (679),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF  RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED++FRKIRLR
Sbjct  28   DWYDIKAPSVFGVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDHSFRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNF GMDFTTDKLRSLVKKWQSLIEAHVDVKTTD+YTLRMFCIGFTKKR 
Sbjct  88   AEDVQGRNVLTNFHGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDSYTLRMFCIGFTKKRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQQKRTCYAQSSQ
Sbjct  148  NQQKRTCYAQSSQ  160



>gb|EPS71864.1| hypothetical protein M569_02887, partial [Genlisea aurea]
Length=266

 Score =   265 bits (678),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAPS+F+TRN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED++FRKIRLR
Sbjct  34   DWYDVKAPSIFNTRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDHSFRKIRLR  93

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG++VLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTDNYTLR+FCI FTKKR 
Sbjct  94   AEDVQGKSVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDNYTLRLFCIAFTKKRA  153

Query  533  NQQKRTCYAQSSQ  571
            NQQKRTCYAQSSQ
Sbjct  154  NQQKRTCYAQSSQ  166



>sp|P33444.4|RS3A_CATRO RecName: Full=40S ribosomal protein S3a; AltName: Full=CYC07 
protein [Catharanthus roseus]
Length=261

 Score =   264 bits (675),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVFS RN+GKTLVTRTQGTKIASEGL+HRVFE+SLADLQ DED++FRKIRLR
Sbjct  28   DWYDIKAPSVFSVRNVGKTLVTRTQGTKIASEGLEHRVFEISLADLQGDEDHSFRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AED+QG+NVLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTD+YTLRMFCIGFTKKR 
Sbjct  88   AEDIQGKNVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDSYTLRMFCIGFTKKRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQQKRTCYAQSSQ
Sbjct  148  NQQKRTCYAQSSQ  160



>dbj|BAA05057.1| cyc07 [Catharanthus roseus]
Length=245

 Score =   264 bits (674),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVFS RN+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ DED++FRKIRLR
Sbjct  28   DWYDIKAPSVFSVRNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQGDEDHSFRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AED+QG+NVLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTD+YTLRMFCIGFTKKR 
Sbjct  88   AEDIQGKNVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDSYTLRMFCIGFTKKRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQQKRTCYAQSSQ
Sbjct  148  NQQKRTCYAQSSQ  160



>ref|XP_010938988.1| PREDICTED: 40S ribosomal protein S3a-like [Elaeis guineensis]
Length=261

 Score =   264 bits (674),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVFS RNIGKTLV+RTQGTKIASEGLKHRVFE+SLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTKIASEGLKHRVFEISLADLQNDEDQAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  148  NQVKRTCYAQTSQ  160



>ref|XP_010553762.1| PREDICTED: 40S ribosomal protein S3a-1-like [Tarenaya hassleriana]
Length=261

 Score =   263 bits (673),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVFS RN+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQGDEDNAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNYTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYTLRLFCIAFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>dbj|BAA00860.1| cyc07 [Catharanthus roseus]
Length=245

 Score =   263 bits (671),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVFS RN+GKTLVTRTQGTKIASEGL+HRVFE+SLADLQ DED++FRKIRLR
Sbjct  28   DWYDIKAPSVFSVRNVGKTLVTRTQGTKIASEGLEHRVFEISLADLQGDEDHSFRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AED+QG+NVLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTD+YTLRMFCIGFTKKR 
Sbjct  88   AEDIQGKNVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDSYTLRMFCIGFTKKRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQQKRTCYAQSSQ
Sbjct  148  NQQKRTCYAQSSQ  160



>ref|XP_010546607.1| PREDICTED: 40S ribosomal protein S3a-1-like [Tarenaya hassleriana]
Length=262

 Score =   263 bits (671),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVFS RN+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQGDEDNAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQ+LIEAH+DVKTTDNYTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHIDVKTTDNYTLRLFCIAFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_010553319.1| PREDICTED: 40S ribosomal protein S3a-1-like [Tarenaya hassleriana]
Length=261

 Score =   262 bits (670),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSVFTVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNYTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYTLRLFCIAFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>gb|KDP23643.1| hypothetical protein JCGZ_23476 [Jatropha curcas]
Length=263

 Score =   262 bits (670),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF+ RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDNAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRLFCIAFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>sp|P49198.2|RS3A_HELAN RecName: Full=40S ribosomal protein S3a [Helianthus annuus]
 gb|AAA80978.1| ribosomal protein S3a [Helianthus annuus]
Length=260

 Score =   261 bits (668),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS+F TRN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED+++RKIRLR
Sbjct  28   DWYDIKAPSLFITRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDHSYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMD TTDKLRSLVKKWQSLIEAHVDVKTTDN+TLRMFCIGFTKKR 
Sbjct  88   AEDVQGKNVLTNFWGMDVTTDKLRSLVKKWQSLIEAHVDVKTTDNFTLRMFCIGFTKKRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_010550935.1| PREDICTED: 40S ribosomal protein S3a-2-like [Tarenaya hassleriana]
Length=261

 Score =   261 bits (668),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAPSVFS RN+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSVFSVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQGDEDNAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRLFCIAFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_009628663.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122} 
[Nicotiana tomentosiformis]
 ref|XP_009763951.1| PREDICTED: 40S ribosomal protein S3a-like [Nicotiana sylvestris]
Length=261

 Score =   261 bits (667),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  28   DWYDIKAPSVFDIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQAFRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQQKRTCYAQSSQ
Sbjct  148  NQQKRTCYAQSSQ  160



>ref|XP_009591686.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
[Nicotiana tomentosiformis]
Length=261

 Score =   261 bits (667),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  28   DWYDIKAPSVFDIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQAFRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQQKRTCYAQSSQ
Sbjct  148  NQQKRTCYAQSSQ  160



>ref|XP_009779517.1| PREDICTED: 40S ribosomal protein S3a [Nicotiana sylvestris]
 sp|Q285L8.1|RS3A_TOBAC RecName: Full=40S ribosomal protein S3a; AltName: Full=Protein 
cyc07 [Nicotiana tabacum]
 gb|ABA41527.1| cyc07 [Nicotiana tabacum]
Length=261

 Score =   261 bits (667),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED +FRKIRLR
Sbjct  28   DWYDIKAPSVFDIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQSFRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQQKRTCYAQSSQ
Sbjct  148  NQQKRTCYAQSSQ  160



>ref|XP_009775368.1| PREDICTED: 40S ribosomal protein S3a-like [Nicotiana sylvestris]
Length=261

 Score =   261 bits (667),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  28   DWYDIKAPSVFDIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQAFRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQQKRTCYAQSSQ
Sbjct  148  NQQKRTCYAQSSQ  160



>ref|XP_009618011.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
[Nicotiana tomentosiformis]
Length=260

 Score =   261 bits (666),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED +FRKIRLR
Sbjct  28   DWYDIKAPSVFDIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQSFRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQQKRTCYAQSSQ
Sbjct  148  NQQKRTCYAQSSQ  160



>ref|XP_010524908.1| PREDICTED: 40S ribosomal protein S3a-2 [Tarenaya hassleriana]
 ref|XP_010524909.1| PREDICTED: 40S ribosomal protein S3a-2 [Tarenaya hassleriana]
Length=262

 Score =   261 bits (667),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVFS RN+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQGDEDNAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIE+HVDVKTTDNYTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIESHVDVKTTDNYTLRLFCIAFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>gb|AFS65104.1| 40S ribosomal protein S3a-like protein [Elaeis guineensis]
Length=261

 Score =   261 bits (666),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFE+SLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEISLADLQNDEDQAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  148  NQVKRTCYAQTSQ  160



>ref|XP_010034641.1| PREDICTED: 40S ribosomal protein S3a [Eucalyptus grandis]
Length=261

 Score =   261 bits (666),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVFS +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            +EDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   SEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_010942777.1| PREDICTED: 40S ribosomal protein S3a [Elaeis guineensis]
Length=261

 Score =   261 bits (666),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFE+SLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEISLADLQNDEDQAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  148  NQVKRTCYAQTSQ  160



>ref|XP_007034836.1| Ribosomal protein S3Ae isoform 2 [Theobroma cacao]
 gb|EOY05762.1| Ribosomal protein S3Ae isoform 2 [Theobroma cacao]
Length=246

 Score =   260 bits (664),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 122/134 (91%), Positives = 130/134 (97%), Gaps = 1/134 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  349
            DWYDIKAPSVF+TRN+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ  DED+A+RKIRL
Sbjct  12   DWYDIKAPSVFTTRNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQGGDEDHAYRKIRL  71

Query  350  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKR  529
            RAEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R
Sbjct  72   RAEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRR  131

Query  530  VNQQKRTCYAQSSQ  571
             NQ KRTCYAQSSQ
Sbjct  132  PNQVKRTCYAQSSQ  145



>ref|XP_006284351.1| hypothetical protein CARUB_v10005523mg [Capsella rubella]
 gb|EOA17249.1| hypothetical protein CARUB_v10005523mg [Capsella rubella]
Length=262

 Score =   261 bits (666),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDEDNA+RKIRLR
Sbjct  28   DWYDVKAPSSFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDNAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQSLIEAHVDVKT+D YTLRMFCIGFTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTSDGYTLRMFCIGFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_003610736.1| 40S ribosomal protein S3a-like protein [Medicago truncatula]
 gb|AES93694.1| 40S ribosomal protein S3a-1 [Medicago truncatula]
Length=261

 Score =   260 bits (665),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNAFRKIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAFRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+N+LTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNLLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRS  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_002517085.1| 40S ribosomal protein S3a, putative [Ricinus communis]
 gb|EEF45248.1| 40S ribosomal protein S3a, putative [Ricinus communis]
Length=260

 Score =   260 bits (665),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ DED+A+RKIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQGDEDHAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQIKRTCYAQSSQ  160



>emb|CDO98656.1| unnamed protein product [Coffea canephora]
Length=261

 Score =   260 bits (665),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF  RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  28   DWYDIKAPSVFEVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQKDEDHAFKKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGM+FTTDK+RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTKKR 
Sbjct  88   AEDVQGKNVLTNFWGMNFTTDKVRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKKRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ+KRTCYAQSSQ
Sbjct  148  NQRKRTCYAQSSQ  160



>ref|XP_011026951.1| PREDICTED: 40S ribosomal protein S3a-2 [Populus euphratica]
Length=259

 Score =   260 bits (665),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVFS +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSVFSVKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRT YAQSSQ
Sbjct  148  NQVKRTTYAQSSQ  160



>ref|XP_007034835.1| Ribosomal protein S3Ae isoform 1 [Theobroma cacao]
 gb|EOY05761.1| Ribosomal protein S3Ae isoform 1 [Theobroma cacao]
Length=262

 Score =   260 bits (665),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/134 (91%), Positives = 130/134 (97%), Gaps = 1/134 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  349
            DWYDIKAPSVF+TRN+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTTRNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQGGDEDHAYRKIRL  87

Query  350  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKR  529
            RAEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R
Sbjct  88   RAEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRR  147

Query  530  VNQQKRTCYAQSSQ  571
             NQ KRTCYAQSSQ
Sbjct  148  PNQVKRTCYAQSSQ  161



>ref|XP_004985319.1| PREDICTED: 40S ribosomal protein S3a-like isoform X2 [Setaria 
italica]
Length=263

 Score =   260 bits (665),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVFS RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQ+DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQSDEDQAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AED+QGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDIQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  148  NQVKRTCYAQASQ  160



>ref|XP_002283142.1| PREDICTED: 40S ribosomal protein S3a-1 [Vitis vinifera]
 sp|A5B4K1.1|RS3A1_VITVI RecName: Full=40S ribosomal protein S3a-1 [Vitis vinifera]
 emb|CAN67522.1| hypothetical protein VITISV_020206 [Vitis vinifera]
 emb|CBI26295.3| unnamed protein product [Vitis vinifera]
Length=261

 Score =   260 bits (664),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF  RN+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFEVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQADEDQAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLR+FCI FTKKRV
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRLFCIAFTKKRV  147

Query  533  NQQKRTCYAQSSQ  571
            NQ K+TCYAQSSQ
Sbjct  148  NQNKKTCYAQSSQ  160



>ref|XP_006663973.1| PREDICTED: 40S ribosomal protein S3a-like [Oryza brachyantha]
Length=261

 Score =   260 bits (664),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  148  NQVKRTCYAQASQ  160



>ref|XP_006649574.1| PREDICTED: 40S ribosomal protein S3a-like [Oryza brachyantha]
Length=260

 Score =   259 bits (663),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  148  NQVKRTCYAQASQ  160



>gb|KHN02741.1| 40S ribosomal protein S3a [Glycine soja]
Length=261

 Score =   259 bits (663),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHAFKKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_006663971.1| PREDICTED: 40S ribosomal protein S3a-like [Oryza brachyantha]
Length=261

 Score =   259 bits (663),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  148  NQVKRTCYAQASQ  160



>ref|NP_001265990.1| 40S ribosomal protein S3a [Cicer arietinum]
 sp|Q8GTE3.1|RS3A_CICAR RecName: Full=40S ribosomal protein S3a [Cicer arietinum]
 emb|CAD56219.1| ribosomal protein S3a [Cicer arietinum]
Length=261

 Score =   259 bits (663),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQ DEDNAFRKIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQGDEDNAFRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNF+GMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFYGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRS  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_008811659.1| PREDICTED: LOW QUALITY PROTEIN: 40S ribosomal protein S3a-like 
[Phoenix dactylifera]
Length=261

 Score =   259 bits (663),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  148  NQVKRTCYAQTSQ  160



>ref|XP_006663974.1| PREDICTED: 40S ribosomal protein S3a-like [Oryza brachyantha]
Length=261

 Score =   259 bits (662),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  148  NQVKRTCYAQASQ  160



>gb|ABK24527.1| unknown [Picea sitchensis]
Length=165

 Score =   256 bits (653),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAPS F+TR +GKTLVTRTQGTKIASEGLKHRVFE+SLADLQNDED AFRKI+LR
Sbjct  28   DWYDVKAPSTFNTRTVGKTLVTRTQGTKIASEGLKHRVFELSLADLQNDEDQAFRKIKLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>gb|KHN30486.1| 40S ribosomal protein S3a, partial [Glycine soja]
Length=242

 Score =   258 bits (660),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  9    DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHAFKKIRLR  68

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  69   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRS  128

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  129  NQVKRTCYAQSSQ  141



>ref|XP_004958212.1| PREDICTED: 40S ribosomal protein S3a-like [Setaria italica]
Length=262

 Score =   259 bits (662),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVFS RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ+DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQSDEDQAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  148  NQVKRTCYAQASQ  160



>ref|NP_001241005.1| uncharacterized protein LOC100805519 [Glycine max]
 gb|ACU23898.1| unknown [Glycine max]
Length=261

 Score =   259 bits (662),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHAFKKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRS  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_004985318.1| PREDICTED: 40S ribosomal protein S3a-like isoform X1 [Setaria 
italica]
Length=290

 Score =   260 bits (664),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVFS RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQ+DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQSDEDQAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AED+QGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDIQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  148  NQVKRTCYAQASQ  160



>gb|ACU17112.1| unknown [Glycine max]
Length=227

 Score =   258 bits (659),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHAFKKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRS  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_004235324.1| PREDICTED: 40S ribosomal protein S3a [Solanum lycopersicum]
Length=261

 Score =   259 bits (661),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  28   DWYDIKAPSVFEIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQAFRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNF GMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR 
Sbjct  88   AEDVQGRNVLTNFHGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQQKRTCYAQSSQ
Sbjct  148  NQQKRTCYAQSSQ  160



>ref|XP_002312545.2| ribosomal protein S3a [Populus trichocarpa]
 gb|EEE89912.2| ribosomal protein S3a [Populus trichocarpa]
Length=262

 Score =   259 bits (661),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVFS +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSVFSVKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGM+FT DKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMNFTNDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRT YAQSSQ
Sbjct  148  NQVKRTTYAQSSQ  160



>ref|XP_003572000.1| PREDICTED: 40S ribosomal protein S3a [Brachypodium distachyon]
Length=265

 Score =   259 bits (661),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            +WYDIKAP +F+TRN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   EWYDIKAPLLFNTRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNY +RMFCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMIRMFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_010256142.1| PREDICTED: 40S ribosomal protein S3a-1-like [Nelumbo nucifera]
Length=261

 Score =   258 bits (660),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS+F+TRN+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ D+D ++RKIRLR
Sbjct  28   DWYDIKAPSIFTTRNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQADDDQSYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>gb|ABK22319.1| unknown [Picea sitchensis]
Length=245

 Score =   258 bits (658),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAPS F+TR +GKTLVTRTQGTKIASEGLKHRVFE+SLADLQNDED AFRKI+LR
Sbjct  12   DWYDVKAPSTFNTRTVGKTLVTRTQGTKIASEGLKHRVFELSLADLQNDEDQAFRKIKLR  71

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R 
Sbjct  72   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRRP  131

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  132  NQVKRTCYAQSSQ  144



>ref|XP_006379849.1| hypothetical protein POPTR_0008s15610g [Populus trichocarpa]
 gb|ABK95865.1| unknown [Populus trichocarpa]
 gb|ERP57646.1| hypothetical protein POPTR_0008s15610g [Populus trichocarpa]
Length=259

 Score =   258 bits (660),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVFS +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSVFSVKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGM+FT DKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMNFTNDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRT YAQSSQ
Sbjct  148  NQVKRTTYAQSSQ  160



>ref|NP_001241430.1| uncharacterized protein LOC100813273 [Glycine max]
 gb|ACU21516.1| unknown [Glycine max]
 gb|KHN15736.1| 40S ribosomal protein S3a [Glycine soja]
Length=261

 Score =   258 bits (660),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS+F  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  28   DWYDIKAPSLFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHAFKKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_010259119.1| PREDICTED: 40S ribosomal protein S3a-1 [Nelumbo nucifera]
Length=261

 Score =   258 bits (660),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS+F+TRN+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ D+D ++RKIRLR
Sbjct  28   DWYDIKAPSIFTTRNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQADDDQSYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_002463138.1| hypothetical protein SORBIDRAFT_02g038370 [Sorghum bicolor]
 gb|EER99659.1| hypothetical protein SORBIDRAFT_02g038370 [Sorghum bicolor]
Length=263

 Score =   258 bits (659),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVFS RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQ+DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQSDEDQAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AED+QGRNVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDIQGRNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  148  NQVKRTCYAQASQ  160



>gb|KDP40219.1| hypothetical protein JCGZ_02217 [Jatropha curcas]
Length=262

 Score =   258 bits (659),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS FS +N+GKTLV+RTQGTKIASEGLKHRVF++SLADLQ DED AFRKIRLR
Sbjct  28   DWYDIKAPSAFSVKNVGKTLVSRTQGTKIASEGLKHRVFDISLADLQGDEDYAFRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQIKRTCYAQSSQ  160



>gb|AFK33413.1| unknown [Lotus japonicus]
Length=261

 Score =   258 bits (659),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS+F  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNAFRKIRLR
Sbjct  28   DWYDIKAPSLFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAFRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKRRS  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>gb|KJB34507.1| hypothetical protein B456_006G069600 [Gossypium raimondii]
Length=262

 Score =   258 bits (659),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 121/134 (90%), Positives = 130/134 (97%), Gaps = 1/134 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  349
            DWYDIKAPSVF++RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ  DED+AFRKIRL
Sbjct  28   DWYDIKAPSVFTSRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGGDEDHAFRKIRL  87

Query  350  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKR  529
            RAEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRR  147

Query  530  VNQQKRTCYAQSSQ  571
             NQ KRTCYAQSSQ
Sbjct  148  PNQVKRTCYAQSSQ  161



>gb|ABK56834.1| RPS3 [Cymbidium hybrid cultivar]
Length=261

 Score =   258 bits (659),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFE+SLADLQNDED ++RKIRLR
Sbjct  28   DWYDIKAPSVFTVRNIGKTLVSRTQGTKIASEGLKHRVFEISLADLQNDEDQSYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAH+DVKTTDNYTLR+FCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHIDVKTTDNYTLRLFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  148  NQVKRTCYAQTSQ  160



>ref|NP_001275123.1| cyc07-like protein [Solanum tuberosum]
 gb|ABB87133.1| 40S ribosomal protein S3a-like [Solanum tuberosum]
Length=261

 Score =   258 bits (658),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  28   DWYDIKAPSVFEIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQAFRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNF GMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR 
Sbjct  88   AEDVQGRNVLTNFHGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQQKRTCYAQSSQ
Sbjct  148  NQQKRTCYAQSSQ  160



>ref|XP_004241461.1| PREDICTED: 40S ribosomal protein S3a [Solanum lycopersicum]
Length=261

 Score =   258 bits (658),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  28   DWYDIKAPSVFEIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQAFRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNF GMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR 
Sbjct  88   AEDVQGRNVLTNFHGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQQKRTCYAQSSQ
Sbjct  148  NQQKRTCYAQSSQ  160



>ref|NP_001046578.1| Os02g0287000 [Oryza sativa Japonica Group]
 dbj|BAD21513.1| putative ribosomal protein S3a, cytosolic [Oryza sativa Japonica 
Group]
 dbj|BAD21711.1| putative ribosomal protein S3a, cytosolic [Oryza sativa Japonica 
Group]
 dbj|BAF08492.1| Os02g0287000 [Oryza sativa Japonica Group]
 gb|EAY85405.1| hypothetical protein OsI_06784 [Oryza sativa Indica Group]
Length=261

 Score =   258 bits (658),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAP+VFS RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RK+RLR
Sbjct  28   DWYDIKAPTVFSVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKVRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  148  NQVKRTCYAQASQ  160



>gb|KHG05975.1| 40S ribosomal S3a [Gossypium arboreum]
 gb|KHG27725.1| 40S ribosomal S3a [Gossypium arboreum]
Length=262

 Score =   258 bits (658),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 121/134 (90%), Positives = 130/134 (97%), Gaps = 1/134 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  349
            DWYDIKAPSVF+TRN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTTRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRL  87

Query  350  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKR  529
            RAEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRR  147

Query  530  VNQQKRTCYAQSSQ  571
             NQ KRTCYAQSSQ
Sbjct  148  PNQVKRTCYAQSSQ  161



>ref|XP_008804511.1| PREDICTED: 40S ribosomal protein S3a [Phoenix dactylifera]
Length=261

 Score =   258 bits (658),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  148  NQVKRTCYAQTSQ  160



>ref|XP_007030615.1| Ribosomal protein S3Ae [Theobroma cacao]
 gb|EOY11117.1| Ribosomal protein S3Ae [Theobroma cacao]
Length=261

 Score =   257 bits (657),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF+ RNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNERNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIE+HVDVKTTDNY+LR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIESHVDVKTTDNYSLRLFCIAFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_010229024.1| PREDICTED: 40S ribosomal protein S3a-like [Brachypodium distachyon]
Length=264

 Score =   258 bits (658),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            +WYDIKAP +FSTRN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  28   EWYDIKAPLLFSTRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQADEDQAFRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNY LRMFCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYMLRMFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>sp|A7Q5X9.1|RS3A2_VITVI RecName: Full=40S ribosomal protein S3a-2 [Vitis vinifera]
Length=234

 Score =   256 bits (655),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS+FS RN+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQNDED+A+RKIRLR
Sbjct  28   DWYDIKAPSIFSVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQNDEDHAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTKKR 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKKRQ  147

Query  533  NQQKRTCYAQSSQ  571
            NQ K+T YAQSSQ
Sbjct  148  NQNKKTSYAQSSQ  160



>ref|XP_002277791.1| PREDICTED: 40S ribosomal protein S3a-2-like [Vitis vinifera]
Length=261

 Score =   257 bits (657),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS+FS RN+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQNDED+A+RKIRLR
Sbjct  28   DWYDIKAPSIFSVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQNDEDHAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTKKR 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKKRQ  147

Query  533  NQQKRTCYAQSSQ  571
            NQ K+T YAQSSQ
Sbjct  148  NQNKKTSYAQSSQ  160



>ref|XP_006408143.1| hypothetical protein EUTSA_v10021341mg [Eutrema salsugineum]
 gb|ESQ49596.1| hypothetical protein EUTSA_v10021341mg [Eutrema salsugineum]
Length=262

 Score =   257 bits (657),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAPS+FS RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDEDNA+RKIRLR
Sbjct  28   DWYDVKAPSIFSQRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDNAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVL  FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLCQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRLFCIAFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|NP_001239858.1| uncharacterized protein LOC100808747 [Glycine max]
 gb|ACU23875.1| unknown [Glycine max]
 gb|KHN35171.1| 40S ribosomal protein S3a [Glycine soja]
Length=261

 Score =   257 bits (656),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS+F  +NIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED++F+KIRLR
Sbjct  28   DWYDIKAPSLFQVKNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHSFKKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRS  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|NP_001066631.1| Os12g0406200 [Oryza sativa Japonica Group]
 gb|ABG21991.1| 40S ribosomal protein S3a, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF29650.1| Os12g0406200 [Oryza sativa Japonica Group]
Length=260

 Score =   257 bits (656),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  148  NQVKRTCYAQASQ  160



>ref|XP_003559021.1| PREDICTED: 40S ribosomal protein S3a-like [Brachypodium distachyon]
Length=265

 Score =   257 bits (656),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            +WYDIKAP +FSTRN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED A+RKIRLR
Sbjct  28   EWYDIKAPLIFSTRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQADEDQAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNY LRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYMLRMFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_002512232.1| 40S ribosomal protein S3a, putative [Ricinus communis]
 gb|EEF49684.1| 40S ribosomal protein S3a, putative [Ricinus communis]
Length=263

 Score =   257 bits (656),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF  RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED+A+RKIRLR
Sbjct  28   DWYDIKAPSVFKVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDHAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIE+HVDVKTTDNYTLR+FCI FTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIESHVDVKTTDNYTLRLFCIAFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|NP_001274913.1| 40S ribosomal protein S3a-like [Solanum tuberosum]
 gb|ABB55367.1| cyc07-like [Solanum tuberosum]
 gb|ABB72794.1| cyc07-like protein [Solanum tuberosum]
Length=261

 Score =   257 bits (656),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFEIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNF GMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR 
Sbjct  88   AEDVQGRNVLTNFHGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQQKRTCYAQSSQ
Sbjct  148  NQQKRTCYAQSSQ  160



>dbj|BAJ93929.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=262

 Score =   257 bits (656),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAP++F+TRNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  28   DWYDIKAPTLFNTRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDQAFRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  148  NQVKRTCYAQASQ  160



>gb|KJB28386.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=255

 Score =   256 bits (655),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 130/134 (97%), Gaps = 1/134 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  349
            DWYDIKAPSVF++RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTSRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRL  87

Query  350  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKR  529
            RAEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRR  147

Query  530  VNQQKRTCYAQSSQ  571
             NQ KRTCYAQSSQ
Sbjct  148  PNQVKRTCYAQSSQ  161



>ref|XP_008449325.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis melo]
Length=260

 Score =   257 bits (656),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF+ +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DE++A+RKIRLR
Sbjct  28   DWYDIKAPSVFTVKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQEDEEHAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGM+FTTDKLRSLV+KW +LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVRKWHTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_004145387.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis sativus]
 ref|XP_004153483.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis sativus]
 gb|KGN61672.1| hypothetical protein Csa_2G223140 [Cucumis sativus]
Length=260

 Score =   256 bits (655),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF+ +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DE++A+RKIRLR
Sbjct  28   DWYDIKAPSVFTVKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQEDEEHAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGM+FTTDKLRSLV+KW +LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVRKWHTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_008438626.1| PREDICTED: 40S ribosomal protein S3a [Cucumis melo]
Length=261

 Score =   257 bits (656),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF+ +N+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ DE++A+RKIRLR
Sbjct  28   DWYDIKAPSVFTVKNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQEDEEHAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGM+FTTDKLRSLV+KW +LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVRKWHTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>gb|KFK37895.1| hypothetical protein AALP_AA3G043200 [Arabis alpina]
Length=261

 Score =   256 bits (655),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAPS+F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDEDNA+RKIRLR
Sbjct  28   DWYDVKAPSIFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDNAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLT FWGMDFTTDKLRSLVKKWQ+LIE HVDVKTTD+YTLRMFCI FTK+R 
Sbjct  88   AEDVQGKNVLTQFWGMDFTTDKLRSLVKKWQTLIECHVDVKTTDSYTLRMFCIAFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_004134125.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis sativus]
 ref|XP_004166384.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis sativus]
 gb|KGN56950.1| hypothetical protein Csa_3G146360 [Cucumis sativus]
Length=261

 Score =   256 bits (655),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF+ +N+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ DE++A+RKIRLR
Sbjct  28   DWYDIKAPSVFTVKNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQEDEEHAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGM+FTTDKLRSLV+KW +LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVRKWHTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|NP_001276152.1| 40S ribosomal protein S3a-like [Glycine max]
 gb|ACU22108.1| unknown [Glycine max]
Length=261

 Score =   256 bits (655),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ D D+AF+KIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDGDHAFKKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|NP_195193.1| 40S ribosomal protein S3a-2 [Arabidopsis thaliana]
 sp|Q42262.3|RS3A2_ARATH RecName: Full=40S ribosomal protein S3a-2 [Arabidopsis thaliana]
 emb|CAA04689.1| Putative S-phase-specific ribosomal protein [Arabidopsis thaliana]
 emb|CAA18846.1| Putative S-phase-specific ribosomal protein [Arabidopsis thaliana]
 emb|CAB80184.1| Putative S-phase-specific ribosomal protein [Arabidopsis thaliana]
 gb|AAL32578.1| Putative S-phase-specific ribosomal protein [Arabidopsis thaliana]
 gb|AEE86408.1| 40S ribosomal protein S3a-2 [Arabidopsis thaliana]
Length=262

 Score =   256 bits (655),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAP  F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDEDNA+RKIRLR
Sbjct  28   DWYDVKAPGSFTNRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDNAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD YTLRMFCI FTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDGYTLRMFCIAFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>gb|KHG19560.1| 40S ribosomal S3a [Gossypium arboreum]
 gb|KJB28387.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=262

 Score =   256 bits (655),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 130/134 (97%), Gaps = 1/134 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  349
            DWYDIKAPSVF++RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTSRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRL  87

Query  350  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKR  529
            RAEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRR  147

Query  530  VNQQKRTCYAQSSQ  571
             NQ KRTCYAQSSQ
Sbjct  148  PNQVKRTCYAQSSQ  161



>ref|XP_007143300.1| hypothetical protein PHAVU_007G060700g [Phaseolus vulgaris]
 gb|ESW15294.1| hypothetical protein PHAVU_007G060700g [Phaseolus vulgaris]
Length=261

 Score =   256 bits (655),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED++FRKIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHSFRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AED+QG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R 
Sbjct  88   AEDIQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>emb|CDY17474.1| BnaC03g65890D [Brassica napus]
Length=245

 Score =   256 bits (653),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ+DED+A+RKIRLR
Sbjct  28   DWYDIKAPSNFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQSDEDHAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_002463137.1| hypothetical protein SORBIDRAFT_02g038365 [Sorghum bicolor]
 gb|EER99658.1| hypothetical protein SORBIDRAFT_02g038365 [Sorghum bicolor]
Length=263

 Score =   256 bits (655),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVFS R+IGKTLV+RTQGTKIASEGLKHRVFEVSLADLQ+DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRDIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQSDEDQAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AED+QGRNVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDIQGRNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  148  NQVKRTCYAQASQ  160



>gb|ABB55362.1| cyc07-like [Solanum tuberosum]
 gb|ABB72815.1| cyc07-like protein [Solanum tuberosum]
Length=261

 Score =   256 bits (654),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIAS+GLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  28   DWYDIKAPSVFEIKNVGKTLVTRTQGTKIASDGLKHRVFEVSLADLQKDEDQAFRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNF GMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR 
Sbjct  88   AEDVQGRNVLTNFHGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQQKRTCYAQSSQ
Sbjct  148  NQQKRTCYAQSSQ  160



>ref|XP_008218237.1| PREDICTED: 40S ribosomal protein S3a-2 [Prunus mume]
Length=260

 Score =   256 bits (654),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS+F+ R IGKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DE++A+RKIRLR
Sbjct  28   DWYDIKAPSLFTERQIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQKDEEHAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKRRT  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>gb|KJB28382.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=248

 Score =   255 bits (652),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 130/134 (97%), Gaps = 1/134 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  349
            DWYDIKAPSVF++RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTSRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRL  87

Query  350  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKR  529
            RAEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRR  147

Query  530  VNQQKRTCYAQSSQ  571
             NQ KRTCYAQSSQ
Sbjct  148  PNQVKRTCYAQSSQ  161



>gb|KHG11221.1| 40S ribosomal S3a [Gossypium arboreum]
Length=262

 Score =   256 bits (654),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 130/134 (97%), Gaps = 1/134 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  349
            DWYDIKAPSVF++RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTSRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRL  87

Query  350  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKR  529
            RAEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRR  147

Query  530  VNQQKRTCYAQSSQ  571
             NQ KRTCYAQSSQ
Sbjct  148  PNQVKRTCYAQSSQ  161



>ref|XP_007205738.1| hypothetical protein PRUPE_ppa010179mg [Prunus persica]
 gb|EMJ06937.1| hypothetical protein PRUPE_ppa010179mg [Prunus persica]
Length=260

 Score =   256 bits (653),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS+F+ R IGKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DE++A+RKIRLR
Sbjct  28   DWYDIKAPSLFTERQIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQKDEEHAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKRRT  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>gb|ABB72808.1| cyc07-like protein [Solanum tuberosum]
Length=260

 Score =   256 bits (653),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIAS+GLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  27   DWYDIKAPSVFEIKNVGKTLVTRTQGTKIASDGLKHRVFEVSLADLQKDEDQAFRKIRLR  86

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNF GMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR 
Sbjct  87   AEDVQGRNVLTNFHGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRP  146

Query  533  NQQKRTCYAQSSQ  571
            NQQKRTCYAQSSQ
Sbjct  147  NQQKRTCYAQSSQ  159



>ref|XP_007157117.1| hypothetical protein PHAVU_002G044200g [Phaseolus vulgaris]
 gb|AGZ15363.1| 40S ribosomal protein S3a-like protein [Phaseolus vulgaris]
 gb|ESW29111.1| hypothetical protein PHAVU_002G044200g [Phaseolus vulgaris]
Length=261

 Score =   256 bits (653),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED++F+KIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHSFKKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRRS  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_010274385.1| PREDICTED: 40S ribosomal protein S3a-like [Nelumbo nucifera]
Length=261

 Score =   256 bits (653),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIK PS+FS R IGKTLVTRTQGTKIASEGLKHRVFEV LADLQND+D ++RKIRLR
Sbjct  28   DWYDIKVPSIFSVRTIGKTLVTRTQGTKIASEGLKHRVFEVCLADLQNDDDQSYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFT++R 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTRRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_004496691.1| PREDICTED: 40S ribosomal protein S3a-like [Cicer arietinum]
 ref|XP_004517272.1| PREDICTED: 40S ribosomal protein S3a-like [Cicer arietinum]
Length=261

 Score =   256 bits (653),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS+F  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DE++AF+KIRLR
Sbjct  28   DWYDIKAPSLFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEEHAFKKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQSLIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQSLIEAHVDVKTTDNYTLRMFCIGFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>gb|EEE56753.1| hypothetical protein OsJ_06287 [Oryza sativa Japonica Group]
Length=399

 Score =   260 bits (665),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAP+VFS RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RK+RLR
Sbjct  28   DWYDIKAPTVFSVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKVRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  148  NQVKRTCYAQASQ  160



>gb|KJB72261.1| hypothetical protein B456_011G167500 [Gossypium raimondii]
Length=262

 Score =   256 bits (653),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 130/134 (97%), Gaps = 1/134 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  349
            DWYDIKAPSVF+TRN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTTRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRL  87

Query  350  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKR  529
            RAEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRR  147

Query  530  VNQQKRTCYAQSSQ  571
             NQ KRTCYAQSSQ
Sbjct  148  PNQVKRTCYAQSSQ  161



>ref|NP_001049289.1| Os03g0200500 [Oryza sativa Japonica Group]
 sp|P49397.2|RS3A_ORYSJ RecName: Full=40S ribosomal protein S3a; AltName: Full=CYC07 
protein [Oryza sativa Japonica Group]
 pdb|3J60|B Chain B, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAA05059.1| cyc07 [Oryza sativa]
 gb|ABF94491.1| 40S ribosomal protein S3a, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11203.1| Os03g0200500 [Oryza sativa Japonica Group]
 gb|EAY88924.1| hypothetical protein OsI_10409 [Oryza sativa Indica Group]
 gb|EAZ25948.1| hypothetical protein OsJ_09804 [Oryza sativa Japonica Group]
 dbj|BAG91340.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96538.1| unnamed protein product [Oryza sativa Japonica Group]
Length=262

 Score =   256 bits (653),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTD Y LR+FCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDGYMLRLFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  148  NQVKRTCYAQASQ  160



>ref|XP_011030646.1| PREDICTED: 40S ribosomal protein S3a-2-like [Populus euphratica]
Length=259

 Score =   256 bits (653),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVFS +N+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ DED+A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVKNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQGDEDHAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGM+FT DKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMNFTNDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRT YAQSSQ
Sbjct  148  NQIKRTTYAQSSQ  160



>gb|KFK30101.1| hypothetical protein AALP_AA7G217000 [Arabis alpina]
Length=262

 Score =   256 bits (653),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADL  DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSSFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLNGDEDNAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNYTLRMFCI FTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYTLRMFCIAFTKRRT  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|NP_001152574.1| 40S ribosomal protein S3a [Zea mays]
 gb|ACG48293.1| 40S ribosomal protein S3a [Zea mays]
 gb|AFW89328.1| 40S ribosomal protein S3a [Zea mays]
Length=260

 Score =   255 bits (652),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  148  NQVKRTCYAQASQ  160



>gb|ACR37738.1| unknown [Zea mays]
 gb|AFW89327.1| hypothetical protein ZEAMMB73_166147 [Zea mays]
Length=175

 Score =   252 bits (644),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  148  NQVKRTCYAQASQ  160



>ref|NP_001141038.1| hypothetical protein [Zea mays]
 ref|XP_008660439.1| PREDICTED: 40S ribosomal protein S3a [Zea mays]
 gb|ACF79246.1| unknown [Zea mays]
 gb|ACF85254.1| unknown [Zea mays]
 gb|AFW89336.1| hypothetical protein ZEAMMB73_605321 [Zea mays]
Length=260

 Score =   255 bits (652),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  148  NQVKRTCYAQASQ  160



>sp|Q9MBB3.1|RS3A_DAUCA RecName: Full=40S ribosomal protein S3a; AltName: Full=Protein 
cyc07 [Daucus carota]
 dbj|BAA89498.1| cyc07 [Daucus carota]
Length=261

 Score =   255 bits (652),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAP+VF  +N+GKTLV+RTQGTKIASEGLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPNVFQNKNVGKTLVSRTQGTKIASEGLKHRVFEVCLADLQGDEDQAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNF+GMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCIGFTKKR 
Sbjct  88   AEDVQGKNVLTNFYGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIGFTKKRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQQKRTCYAQSSQ
Sbjct  148  NQQKRTCYAQSSQ  160



>gb|EYU41450.1| hypothetical protein MIMGU_mgv1a002668mg [Erythranthe guttata]
Length=648

 Score =   267 bits (682),  Expect = 7e-82, Method: Composition-based stats.
 Identities = 122/133 (92%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAPSVF+TRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQ+DED+AFRKIRLR
Sbjct  416  DWYDVKAPSVFNTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQSDEDHAFRKIRLR  475

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLR+FCI FTKKR 
Sbjct  476  AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRLFCIAFTKKRA  535

Query  533  NQQKRTCYAQSSQ  571
            NQQKRTCYAQSSQ
Sbjct  536  NQQKRTCYAQSSQ  548



>gb|KJB28385.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=249

 Score =   254 bits (650),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 130/134 (97%), Gaps = 1/134 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  349
            DWYDIKAPSVF++RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTSRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRL  87

Query  350  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKR  529
            RAEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRR  147

Query  530  VNQQKRTCYAQSSQ  571
             NQ KRTCYAQSSQ
Sbjct  148  PNQVKRTCYAQSSQ  161



>gb|AFW89330.1| 40S ribosomal protein S3a [Zea mays]
 gb|AFW89331.1| 40S ribosomal protein S3a [Zea mays]
 gb|AFW89332.1| 40S ribosomal protein S3a [Zea mays]
Length=330

 Score =   257 bits (657),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  98   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLR  157

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  158  AEDVQGRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  217

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  218  NQVKRTCYAQASQ  230



>gb|ACU18272.1| unknown [Glycine max]
Length=261

 Score =   254 bits (650),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF  +N+GKTLV+RTQGTK ASEGLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKTASEGLKHRVFEVSLADLQGDEDHAFKKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG TK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGLTKRRS  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>gb|AFW89335.1| 40S ribosomal protein S3a [Zea mays]
Length=332

 Score =   257 bits (657),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  100  DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLR  159

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  160  AEDVQGRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  219

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  220  NQVKRTCYAQASQ  232



>ref|XP_002463139.1| hypothetical protein SORBIDRAFT_02g038380 [Sorghum bicolor]
 gb|EER99660.1| hypothetical protein SORBIDRAFT_02g038380 [Sorghum bicolor]
Length=218

 Score =   253 bits (646),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVFS RNIGKTLV+RTQGTKIASEGLKHRVFE SLADLQ+DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTKIASEGLKHRVFEASLADLQSDEDQAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGM FTTDKLRSLVKKWQ+L EAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMSFTTDKLRSLVKKWQTLTEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  148  NQVKRTCYAQASQ  160



>ref|XP_002314671.2| ribosomal protein S3a [Populus trichocarpa]
 gb|ABK93373.1| unknown [Populus trichocarpa]
 gb|ABK93864.1| unknown [Populus trichocarpa]
 gb|EEF00842.2| ribosomal protein S3a [Populus trichocarpa]
Length=260

 Score =   254 bits (650),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVFS +N+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ DED+A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVKNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQGDEDHAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGM+FT DKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMNFTNDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRT YAQSSQ
Sbjct  148  NQIKRTTYAQSSQ  160



>ref|XP_010272784.1| PREDICTED: 40S ribosomal protein S3a-like [Nelumbo nucifera]
Length=261

 Score =   254 bits (650),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF+ R +GKTLVTRTQGTKIASEGLKHRVFEV LADLQND+D ++RKIRLR
Sbjct  28   DWYDIKAPSVFNVRTVGKTLVTRTQGTKIASEGLKHRVFEVCLADLQNDDDQSYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFT++R 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTRRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  148  NQVKRTCYAQTSQ  160



>ref|XP_003638196.1| 40S ribosomal protein S3a [Medicago truncatula]
Length=244

 Score =   254 bits (648),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIAS+GLKHRVFEVSLADLQ DE++AFRKIRLR
Sbjct  11   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASDGLKHRVFEVSLADLQGDEEHAFRKIRLR  70

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+N+LTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  71   AEDVQGKNLLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRA  130

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  131  NQVKRTCYAQSSQ  143



>ref|XP_006848758.1| hypothetical protein AMTR_s00026p00042160 [Amborella trichopoda]
 gb|ERN10339.1| hypothetical protein AMTR_s00026p00042160 [Amborella trichopoda]
Length=261

 Score =   254 bits (650),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS+F+ R +GKTLVTRTQGTKIASEGLKHRVFE  LADLQNDED A++KIRLR
Sbjct  28   DWYDIKAPSIFNVRTVGKTLVTRTQGTKIASEGLKHRVFECCLADLQNDEDQAYKKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AED+QGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDIQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  148  NQVKRTCYAQTSQ  160



>ref|XP_010090259.1| 40S ribosomal protein S3a [Morus notabilis]
 gb|EXB39197.1| 40S ribosomal protein S3a [Morus notabilis]
Length=262

 Score =   254 bits (650),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS+F+ R +GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED+A+RKIRLR
Sbjct  28   DWYDIKAPSLFNQRQVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDHAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FT++R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTRRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>gb|ACJ85751.1| unknown [Medicago truncatula]
 gb|AFK34441.1| unknown [Medicago truncatula]
 gb|KEH43817.1| 40S ribosomal protein S3a-1 [Medicago truncatula]
Length=261

 Score =   254 bits (650),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIAS+GLKHRVFEVSLADLQ DE++AFRKIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASDGLKHRVFEVSLADLQGDEEHAFRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+N+LTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNLLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_007137418.1| hypothetical protein PHAVU_009G125400g [Phaseolus vulgaris]
 gb|ESW09412.1| hypothetical protein PHAVU_009G125400g [Phaseolus vulgaris]
Length=261

 Score =   254 bits (649),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIAS+GLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVTRTQGTKIASDGLKHRVFEVSLADLQGDEDHAFKKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFT DKLRSLV+KWQ+LIEAH DVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTNDKLRSLVRKWQTLIEAHADVKTTDNYTLRMFCIGFTKRRS  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>gb|KCW60693.1| hypothetical protein EUGRSUZ_H03423 [Eucalyptus grandis]
Length=237

 Score =   253 bits (647),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF+ +N+GKTLV+RTQGTKIASEGLKHRVFE SLADLQ DED+++RKIRLR
Sbjct  28   DWYDIKAPSVFTVKNVGKTLVSRTQGTKIASEGLKHRVFETSLADLQGDEDHSYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
             EDVQGRNVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   CEDVQGRNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_010419205.1| PREDICTED: 40S ribosomal protein S3a-1-like [Camelina sativa]
Length=262

 Score =   254 bits (649),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAPS+F++RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSMFTSRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVL  FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD YTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLCQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDGYTLRLFCIAFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_010485869.1| PREDICTED: 40S ribosomal protein S3a-1 [Camelina sativa]
Length=262

 Score =   254 bits (649),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAPS+F++RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSMFTSRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVL  FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD YTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLCQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDGYTLRLFCIAFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_010675082.1| PREDICTED: 40S ribosomal protein S3a [Beta vulgaris subsp. vulgaris]
Length=262

 Score =   254 bits (649),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS+FS RN+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQNDED  FRKIRLR
Sbjct  28   DWYDIKAPSIFSVRNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQNDEDQFFRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNF+GMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDN+TLRMFCI FTK+R 
Sbjct  88   AEDVQGRNVLTNFYGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNFTLRMFCIAFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRT YAQSSQ
Sbjct  148  NQVKRTTYAQSSQ  160



>gb|AGT16352.1| 40S ribosomal protein S3a [Saccharum hybrid cultivar R570]
Length=260

 Score =   254 bits (648),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGM FTTDKLRSLV+KWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMSFTTDKLRSLVRKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  148  NQVKRTCYAQASQ  160



>ref|XP_008224264.1| PREDICTED: 40S ribosomal protein S3a [Prunus mume]
Length=260

 Score =   254 bits (648),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS+F  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DE++A+RK+RLR
Sbjct  28   DWYDIKAPSLFQNKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEEHAYRKMRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLR+FCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRLFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_010024230.1| PREDICTED: 40S ribosomal protein S3a-like [Eucalyptus grandis]
 gb|KCW60692.1| hypothetical protein EUGRSUZ_H03423 [Eucalyptus grandis]
Length=261

 Score =   254 bits (648),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF+ +N+GKTLV+RTQGTKIASEGLKHRVFE SLADLQ DED+++RKIRLR
Sbjct  28   DWYDIKAPSVFTVKNVGKTLVSRTQGTKIASEGLKHRVFETSLADLQGDEDHSYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
             EDVQGRNVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   CEDVQGRNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>tpg|DAA43947.1| TPA: hypothetical protein ZEAMMB73_528269, partial [Zea mays]
Length=188

 Score =   251 bits (641),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IAS+GLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASDGLKHRVFEVCLADLQGDEDQAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  148  NQVKRTCYAQASQ  160



>ref|NP_001149096.1| 40S ribosomal protein S3a [Zea mays]
 gb|ACG34188.1| 40S ribosomal protein S3a [Zea mays]
 gb|ACN31605.1| unknown [Zea mays]
Length=260

 Score =   254 bits (648),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IAS+GLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASDGLKHRVFEVCLADLQGDEDQAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  148  NQVKRTCYAQASQ  160



>gb|AFW89333.1| hypothetical protein ZEAMMB73_166147 [Zea mays]
Length=313

 Score =   255 bits (652),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  98   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLR  157

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  158  AEDVQGRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  217

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  218  NQVKRTCYAQASQ  230



>ref|XP_010092425.1| 40S ribosomal protein S3a [Morus notabilis]
 gb|EXB51143.1| 40S ribosomal protein S3a [Morus notabilis]
Length=267

 Score =   254 bits (648),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF+ RN+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQ+DE++A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQDDEEHAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            +EDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDN+TLR+FCIGFT++R 
Sbjct  88   SEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNFTLRLFCIGFTRRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|NP_187135.1| 40S ribosomal protein S3a-1 [Arabidopsis thaliana]
 sp|Q9CAV0.3|RS3A1_ARATH RecName: Full=40S ribosomal protein S3a-1 [Arabidopsis thaliana]
 gb|AAG51414.1|AC009465_14 putative 40S ribosomal protein S3A (S phase specific); 75194-73527 
[Arabidopsis thaliana]
 gb|AAL32874.1| putative 40S ribosomal protein S3A (S phase specific) [Arabidopsis 
thaliana]
 gb|AAM10147.1| putative 40S ribosomal protein S3A (S phase specific) [Arabidopsis 
thaliana]
 gb|AAM63004.1| putative 40S ribosomal protein S3A (S phase specific) [Arabidopsis 
thaliana]
 gb|AEE74143.1| 40S ribosomal protein S3a-1 [Arabidopsis thaliana]
Length=262

 Score =   253 bits (647),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAPS+F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSIFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVL  FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLCQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRLFCIAFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>emb|CDY40680.1| BnaC03g33960D [Brassica napus]
Length=262

 Score =   253 bits (647),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSNFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIE+HVDVKTTDN+TLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIESHVDVKTTDNFTLRLFCIAFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>emb|CDX76296.1| BnaA08g11040D [Brassica napus]
Length=261

 Score =   253 bits (647),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ+DED+++RKIRLR
Sbjct  28   DWYDIKAPSNFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQSDEDHSYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLT FWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_009124201.1| PREDICTED: 40S ribosomal protein S3a-2 [Brassica rapa]
Length=262

 Score =   253 bits (647),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+A+RKIRLR
Sbjct  28   DWYDIKAPSNFNNRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIE+HVDVKTTDNYTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIESHVDVKTTDNYTLRLFCIAFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_009108713.1| PREDICTED: 40S ribosomal protein S3a-2-like [Brassica rapa]
Length=261

 Score =   253 bits (646),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ+DED+++RKIRLR
Sbjct  28   DWYDIKAPSNFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQSDEDHSYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLT FWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>emb|CDY50760.1| BnaAnng10670D [Brassica napus]
 emb|CDY41904.1| BnaC05g47000D [Brassica napus]
Length=262

 Score =   253 bits (646),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+A+RKIRLR
Sbjct  28   DWYDIKAPSNFNNRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIE+HVDVKTTDNYTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIESHVDVKTTDNYTLRLFCIAFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_009138316.1| PREDICTED: 40S ribosomal protein S3a-2-like [Brassica rapa]
 ref|XP_009138317.1| PREDICTED: 40S ribosomal protein S3a-2-like [Brassica rapa]
 emb|CDY45324.1| BnaA03g52970D [Brassica napus]
 emb|CDX72495.1| BnaC07g45170D [Brassica napus]
Length=261

 Score =   253 bits (646),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS+F  RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+++RKIRLR
Sbjct  28   DWYDIKAPSIFKQRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHSYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRLFCIAFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_010432386.1| PREDICTED: 40S ribosomal protein S3a-2-like [Camelina sativa]
Length=262

 Score =   253 bits (646),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSSFTKRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD +TLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDGFTLRLFCIAFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_009110285.1| PREDICTED: 40S ribosomal protein S3a-2 [Brassica rapa]
Length=262

 Score =   253 bits (645),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS F  RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+++RKIRLR
Sbjct  28   DWYDIKAPSNFKQRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHSYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLR+FCIGFTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRLFCIGFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>emb|CDX75453.1| BnaA01g02490D [Brassica napus]
Length=262

 Score =   253 bits (645),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS F  RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+++RKIRLR
Sbjct  28   DWYDIKAPSNFKQRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHSYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLR+FCIGFTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRLFCIGFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>emb|CDX69078.1| BnaC01g03750D [Brassica napus]
Length=262

 Score =   253 bits (645),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS F  RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+++RKIRLR
Sbjct  28   DWYDIKAPSNFKQRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHSYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLR+FCIGFTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRLFCIGFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_009134791.1| PREDICTED: 40S ribosomal protein S3a-2-like [Brassica rapa]
Length=262

 Score =   253 bits (645),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSNFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIE HVDVKTTDN+TLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIECHVDVKTTDNFTLRLFCIAFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>emb|CDX74165.1| BnaA03g28820D [Brassica napus]
Length=262

 Score =   253 bits (645),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSNFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIE HVDVKTTDN+TLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIECHVDVKTTDNFTLRLFCIAFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_002869131.1| 40S ribosomal protein S3A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45390.1| 40S ribosomal protein S3A [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   253 bits (645),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAP+ F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPASFTNRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQVDEDNAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD YTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDGYTLRLFCIAFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_006298355.1| hypothetical protein CARUB_v10014425mg [Capsella rubella]
 gb|EOA31253.1| hypothetical protein CARUB_v10014425mg [Capsella rubella]
Length=261

 Score =   252 bits (644),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAPS+F+ +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSIFTHKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVL  FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLCQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRLFCIAFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_006412198.1| hypothetical protein EUTSA_v10026006mg [Eutrema salsugineum]
 gb|ESQ53651.1| hypothetical protein EUTSA_v10026006mg [Eutrema salsugineum]
Length=262

 Score =   252 bits (644),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAP+ F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA RKIRLR
Sbjct  28   DWYDVKAPASFTVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAHRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRLFCIAFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_010463973.1| PREDICTED: 40S ribosomal protein S3a-1-like [Camelina sativa]
Length=261

 Score =   252 bits (643),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAPS+F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSLFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVL  FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD YTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLCQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDAYTLRLFCIAFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_010437575.1| PREDICTED: 40S ribosomal protein S3a-2 [Camelina sativa]
Length=262

 Score =   252 bits (643),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSSFTNRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQVDEDNAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD +TLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDGFTLRLFCIAFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_002882377.1| 40S ribosomal protein S3A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58636.1| 40S ribosomal protein S3A [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   252 bits (643),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSNFTKRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQVDEDNAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVL  FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNYTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLCQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYTLRLFCIAFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_003526635.1| PREDICTED: 40S ribosomal protein S3a-like [Glycine max]
Length=261

 Score =   252 bits (643),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF  +N+GKTLVTRTQGTK AS+GLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVTRTQGTKTASDGLKHRVFEVSLADLQGDEDHAFKKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGM FTTDKLRSLV+KWQ+LIEAH DVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMSFTTDKLRSLVRKWQTLIEAHADVKTTDNYTLRMFCIGFTKRRS  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>gb|AAC98779.1| S-phase-specific ribosomal protein [Oryza sativa Japonica Group]
Length=261

 Score =   252 bits (643),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAP+VFS RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADL+NDED A+RK+RLR
Sbjct  28   DWYDIKAPTVFSVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLRNDEDQAYRKVRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ ++
Sbjct  148  NQVKRTCYAQVAR  160



>ref|XP_010447045.1| PREDICTED: 40S ribosomal protein S3a-2-like [Camelina sativa]
Length=262

 Score =   251 bits (642),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAPS+F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSLFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD +T R+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDGFTFRLFCIAFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>gb|KJB38201.1| hypothetical protein B456_006G241700 [Gossypium raimondii]
Length=258

 Score =   251 bits (641),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 129/134 (96%), Gaps = 1/134 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  349
            DWYDIKAPSVF+TRN+GKTLV+RTQGTKIASEGLKHRVFEV LADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTTRNVGKTLVSRTQGTKIASEGLKHRVFEVFLADLQGGDEDHAYRKIRL  87

Query  350  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKR  529
            RAEDVQG+NVLTNFWGM+FTTD+LRSLV+KWQ+LIEAHVDVKTTDNYTLR+FCIGFTK+R
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDRLRSLVRKWQTLIEAHVDVKTTDNYTLRLFCIGFTKRR  147

Query  530  VNQQKRTCYAQSSQ  571
             NQ KRTCYAQSSQ
Sbjct  148  PNQVKRTCYAQSSQ  161



>ref|XP_009394355.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122} 
[Musa acuminata subsp. malaccensis]
Length=261

 Score =   251 bits (642),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAHRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMD TTDK+R LV+KWQ+LIEAHVDVKTTDNYTLR+FC GFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDLTTDKVRYLVRKWQTLIEAHVDVKTTDNYTLRLFCFGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>gb|ACN40078.1| unknown [Picea sitchensis]
Length=260

 Score =   251 bits (641),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 127/133 (95%), Gaps = 1/133 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAPS F+TR +GKTLVTRTQGTKIASEGLKHRVFE+SLADLQN ED AFRKI+LR
Sbjct  28   DWYDVKAPSTFNTRTVGKTLVTRTQGTKIASEGLKHRVFELSLADLQN-EDQAFRKIKLR  86

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R 
Sbjct  87   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRRP  146

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  147  NQVKRTCYAQSSQ  159



>ref|XP_011032434.1| PREDICTED: 40S ribosomal protein S3a [Populus euphratica]
Length=261

 Score =   251 bits (641),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWY +KAPS F+ ++IG+TLVTRTQGTKIASEGLKHRVFEVSLADLQNDED+AFRKIRLR
Sbjct  28   DWYVVKAPSGFTVKDIGRTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDHAFRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGM FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMSFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_006382773.1| 40S ribosomal protein S3A [Populus trichocarpa]
 gb|ERP60570.1| 40S ribosomal protein S3A [Populus trichocarpa]
Length=261

 Score =   251 bits (641),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWY +KAPS F+ ++IG+TLVTRTQGTKIASEGLKHRVFEVSLADLQNDED+AFRKIRLR
Sbjct  28   DWYVVKAPSGFTVKDIGRTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDHAFRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGM FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMSFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>gb|KJB38202.1| hypothetical protein B456_006G241700 [Gossypium raimondii]
Length=262

 Score =   251 bits (641),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 129/134 (96%), Gaps = 1/134 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  349
            DWYDIKAPSVF+TRN+GKTLV+RTQGTKIASEGLKHRVFEV LADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTTRNVGKTLVSRTQGTKIASEGLKHRVFEVFLADLQGGDEDHAYRKIRL  87

Query  350  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKR  529
            RAEDVQG+NVLTNFWGM+FTTD+LRSLV+KWQ+LIEAHVDVKTTDNYTLR+FCIGFTK+R
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDRLRSLVRKWQTLIEAHVDVKTTDNYTLRLFCIGFTKRR  147

Query  530  VNQQKRTCYAQSSQ  571
             NQ KRTCYAQSSQ
Sbjct  148  PNQVKRTCYAQSSQ  161



>gb|ACG33267.1| 40S ribosomal protein S3a [Zea mays]
Length=260

 Score =   251 bits (640),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IAS+GLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASDGLKHRVFEVCLADLQGDEDQAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTT NY LR+FCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTXNYMLRLFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  148  NQVKRTCYAQASQ  160



>ref|XP_006838990.1| hypothetical protein AMTR_s00002p00271660 [Amborella trichopoda]
 gb|ERN01559.1| hypothetical protein AMTR_s00002p00271660 [Amborella trichopoda]
Length=265

 Score =   251 bits (641),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS+F+ R +GKTLVTRTQGTKIASEGLKHRVFE +LADLQ DED ++RKIRLR
Sbjct  33   DWYDIKAPSIFNVRTVGKTLVTRTQGTKIASEGLKHRVFECNLADLQADEDQSYRKIRLR  92

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AED+QGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLR+FCIGFTK+R 
Sbjct  93   AEDIQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRLFCIGFTKRRP  152

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  153  NQVKRTCYAQTSQ  165



>ref|NP_001288829.1| 40S ribosomal protein S3a [Brassica rapa]
 sp|P49396.2|RS3A_BRACM RecName: Full=40S ribosomal protein S3a; AltName: Full=S phase-specific 
protein BIS289 [Brassica rapa]
 gb|AAA33013.1| S-phase-specific protein [Brassica rapa]
 emb|CAA81030.1| unnamed protein product [Brassica rapa]
Length=262

 Score =   251 bits (640),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADL  DED A+RKIRLR
Sbjct  28   DWYDIKAPSSFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLNKDEDQAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIE+HVDVKTTDNYTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIESHVDVKTTDNYTLRLFCIAFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_009406016.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=260

 Score =   251 bits (640),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFEV LADLQNDED A RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEVCLADLQNDEDQAHRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVL NFWGMD TTDK+R +V+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLANFWGMDLTTDKVRYVVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>gb|KEH32959.1| 40S ribosomal protein S3a-1 [Medicago truncatula]
Length=261

 Score =   251 bits (640),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIA +GLKHRVFEVSL DLQ DE++AFRKIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIALDGLKHRVFEVSLVDLQGDEEHAFRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+N+LTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNLLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>emb|CDY21109.1| BnaA01g33400D [Brassica napus]
Length=261

 Score =   250 bits (639),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADL  DED A+RKIRLR
Sbjct  28   DWYDIKAPSSFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLNKDEDQAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIE+HVDVKTTDNYTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIESHVDVKTTDNYTLRLFCIAFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>gb|ACG34058.1| 40S ribosomal protein S3a [Zea mays]
Length=260

 Score =   250 bits (639),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IAS+GLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASDGLKHRVFEVCLADLQGDEDQAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQ RNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQDRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  148  NQVKRTCYAQASQ  160



>ref|XP_006382772.1| hypothetical protein POPTR_0005s05280g [Populus trichocarpa]
 gb|ERP60569.1| hypothetical protein POPTR_0005s05280g [Populus trichocarpa]
Length=265

 Score =   250 bits (639),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWY +KAPS F+ ++IG+TLVTRTQGTKIASEGLKHRVFEVSLADLQNDED+AFRKIRLR
Sbjct  32   DWYVVKAPSGFTVKDIGRTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDHAFRKIRLR  91

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGM FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTK+R 
Sbjct  92   AEDVQGRNVLTNFWGMSFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKRRP  151

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  152  NQVKRTCYAQSSQ  164



>emb|CDY30019.1| BnaC01g39890D [Brassica napus]
Length=302

 Score =   251 bits (642),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADL  DED A+RKIRLR
Sbjct  69   DWYDIKAPSSFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLNKDEDQAYRKIRLR  128

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIE+HVDVKTTDNYTLR+FCI FTK+R 
Sbjct  129  AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIESHVDVKTTDNYTLRLFCIAFTKRRA  188

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  189  NQVKRTCYAQSSQ  201



>ref|XP_004296667.1| PREDICTED: 40S ribosomal protein S3a [Fragaria vesca subsp. vesca]
Length=259

 Score =   250 bits (638),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS+F+ + +GKTLVTRTQGTKIASEGLKHRVFE SLADLQ DE++A+RK+RLR
Sbjct  28   DWYDIKAPSIFNIKQVGKTLVTRTQGTKIASEGLKHRVFETSLADLQGDEEHAYRKMRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGR VLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGRTVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_009408135.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
[Musa acuminata subsp. malaccensis]
Length=261

 Score =   250 bits (638),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAHRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            +EDVQG+NVLTNFWGMD TTDKLR +V++WQ+LIEAHVDVKTTDNYTLR+FCI FTK+R 
Sbjct  88   SEDVQGKNVLTNFWGMDLTTDKLRHIVRRWQTLIEAHVDVKTTDNYTLRLFCIAFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_002987274.1| hypothetical protein SELMODRAFT_271906 [Selaginella moellendorffii]
 ref|XP_002987332.1| hypothetical protein SELMODRAFT_271907 [Selaginella moellendorffii]
 ref|XP_002989169.1| hypothetical protein SELMODRAFT_184408 [Selaginella moellendorffii]
 ref|XP_002989210.1| hypothetical protein SELMODRAFT_160008 [Selaginella moellendorffii]
 gb|EFJ09763.1| hypothetical protein SELMODRAFT_184408 [Selaginella moellendorffii]
 gb|EFJ09804.1| hypothetical protein SELMODRAFT_160008 [Selaginella moellendorffii]
 gb|EFJ11589.1| hypothetical protein SELMODRAFT_271906 [Selaginella moellendorffii]
 gb|EFJ11647.1| hypothetical protein SELMODRAFT_271907 [Selaginella moellendorffii]
Length=263

 Score =   249 bits (637),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KA S F+ R IGKTLVTRTQGTKIAS+GLK RVFEVSLADLQNDED+AFRKI+LR
Sbjct  28   DWYDVKAMSTFNVRQIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEDHAFRKIKLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTDNYTLR+FCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDNYTLRLFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_008391001.1| PREDICTED: 40S ribosomal protein S3a-2-like [Malus domestica]
 ref|XP_008360360.1| PREDICTED: 40S ribosomal protein S3a-2-like [Malus domestica]
 ref|XP_009371956.1| PREDICTED: 40S ribosomal protein S3a-2-like [Pyrus x bretschneideri]
Length=259

 Score =   249 bits (637),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAP +F+ +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DE++A+RK+RLR
Sbjct  28   DWYDIKAPKLFNHQNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEEHAYRKMRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+ VLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKTVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_009400022.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
[Musa acuminata subsp. malaccensis]
Length=261

 Score =   249 bits (636),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAHRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMD TTDK+R +V+KW +LIEAHVDVKTTDNYTLRMFCI FTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDLTTDKVRYIVRKWLTLIEAHVDVKTTDNYTLRMFCIAFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_008390932.1| PREDICTED: 40S ribosomal protein S3a-2-like [Malus domestica]
Length=259

 Score =   249 bits (635),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAP +F+  N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DE++A+RK+RLR
Sbjct  28   DWYDIKAPKLFNNTNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEEHAYRKMRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+ VLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKTVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_009335287.1| PREDICTED: 40S ribosomal protein S3a-2-like [Pyrus x bretschneideri]
Length=259

 Score =   249 bits (635),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAP +F+  N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DE++A+RK+RLR
Sbjct  28   DWYDIKAPKLFNNTNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEEHAYRKMRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+ VLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKTVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>gb|KHN21710.1| 40S ribosomal protein S3a [Glycine soja]
Length=335

 Score =   251 bits (641),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF  +N+GKTLVTRTQGTK AS+GLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVTRTQGTKTASDGLKHRVFEVSLADLQGDEDHAFKKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGM FTTDKLRSLV+KWQ+LIEAH DVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMSFTTDKLRSLVRKWQTLIEAHADVKTTDNYTLRMFCIGFTKRRS  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>ref|XP_004302028.1| PREDICTED: 40S ribosomal protein S3a-2 [Fragaria vesca subsp. 
vesca]
Length=259

 Score =   248 bits (633),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+ APS+F+ R +G TLVTRTQGTKIASEGLKHRVFEVSLADLQ DED+A+RKIRLR
Sbjct  28   DWYDVTAPSLFNVRKVGVTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDHAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG++VLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLR+FCI FTK+R 
Sbjct  88   AEDVQGKDVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRLFCIAFTKRRA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>gb|ABK93399.1| unknown [Populus trichocarpa]
Length=261

 Score =   248 bits (632),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWY +KAPS F+ ++IG+TLVTRTQGTKIASEGLKHRVFEVSLADLQNDED+AFRKIRLR
Sbjct  28   DWYVVKAPSGFTVKDIGRTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDHAFRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGM FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTK+  
Sbjct  88   AEDVQGRNVLTNFWGMSFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKRCP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  148  NQVKRTCYAQSSQ  160



>gb|AAP80855.1| cyc07 [Triticum aestivum]
Length=242

 Score =   246 bits (629),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +2

Query  176  WYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRA  355
            WYDIKAP +F++RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLRA
Sbjct  29   WYDIKAPLLFTSRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLRA  88

Query  356  EDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVN  535
            EDVQG NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNY LRMF IGFTK+R N
Sbjct  89   EDVQGMNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYMLRMFAIGFTKRRPN  148

Query  536  QQKRTCYAQSSQ  571
            Q KRTCYAQ+SQ
Sbjct  149  QVKRTCYAQASQ  160



>ref|XP_006420004.1| hypothetical protein CICLE_v10005663mg [Citrus clementina]
 ref|XP_006489441.1| PREDICTED: 40S ribosomal protein S3a-like [Citrus sinensis]
 gb|ESR33244.1| hypothetical protein CICLE_v10005663mg [Citrus clementina]
 gb|KDO74487.1| hypothetical protein CISIN_1g024879mg [Citrus sinensis]
Length=261

 Score =   247 bits (630),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS F  RN+GKTLVTRTQGTKIASEGLKHRVFEVSL DL N+E++A+RKIRLR
Sbjct  28   DWYDIKAPSCFRVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLGDLHNEEEHAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KW +LIEA+VDVKTTDNYTLRMFCIGFTK+  
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWHTLIEAYVDVKTTDNYTLRMFCIGFTKRLP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  148  NQVKRTCYAQASQ  160



>gb|KDO74488.1| hypothetical protein CISIN_1g024879mg [Citrus sinensis]
Length=245

 Score =   246 bits (628),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS F  RN+GKTLVTRTQGTKIASEGLKHRVFEVSL DL N+E++A+RKIRLR
Sbjct  28   DWYDIKAPSCFRVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLGDLHNEEEHAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KW +LIEA+VDVKTTDNYTLRMFCIGFTK+  
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWHTLIEAYVDVKTTDNYTLRMFCIGFTKRLP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  148  NQVKRTCYAQASQ  160



>ref|XP_001761018.1| predicted protein [Physcomitrella patens]
 gb|EDQ74085.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   244 bits (624),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAP+ F+ +N+GKTLVTRT GTKIAS+GLK RVFEVSLADLQNDED AFRKI+LR
Sbjct  28   DWYDIKAPNTFTQKNLGKTLVTRTAGTKIASDGLKGRVFEVSLADLQNDEDQAFRKIKLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMD TTDKLRSLV+KWQSLIEAHVDVKTTDNY +RMFCI FTKKR 
Sbjct  88   AEDVQGKNVLTNFWGMDLTTDKLRSLVRKWQSLIEAHVDVKTTDNYQIRMFCIAFTKKRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ K+TCYAQSSQ
Sbjct  148  NQIKKTCYAQSSQ  160



>ref|XP_007226551.1| hypothetical protein PRUPE_ppa024854mg [Prunus persica]
 gb|EMJ27750.1| hypothetical protein PRUPE_ppa024854mg [Prunus persica]
Length=629

 Score =   253 bits (647),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS+F  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DE++A+RK+RLR
Sbjct  397  DWYDIKAPSLFQNKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEEHAYRKMRLR  456

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLR+FCIGFTK+R 
Sbjct  457  AEDVQGRNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRLFCIGFTKRRP  516

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQSSQ
Sbjct  517  NQVKRTCYAQSSQ  529



>ref|XP_001767326.1| predicted protein [Physcomitrella patens]
 gb|EDQ67817.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   242 bits (618),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAP++F+ + +GKTLVTRT GTKIAS+GLK RVFEVSLADLQNDED AFRKI+LR
Sbjct  28   DWYDIKAPNIFTQKALGKTLVTRTAGTKIASDGLKGRVFEVSLADLQNDEDQAFRKIKLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMD TTDKLRSLV+KWQSLIEAHVDVKTTDNY LR+FCI FTKKR 
Sbjct  88   AEDVQGKNVLTNFWGMDLTTDKLRSLVRKWQSLIEAHVDVKTTDNYQLRIFCIAFTKKRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ K+TCYAQSSQ
Sbjct  148  NQIKKTCYAQSSQ  160



>gb|EEE53089.1| hypothetical protein OsJ_35850 [Oryza sativa Japonica Group]
Length=764

 Score =   254 bits (650),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  148  NQVKRTCYAQASQ  160



>gb|KDO37446.1| hypothetical protein CISIN_1g045491mg, partial [Citrus sinensis]
Length=241

 Score =   240 bits (613),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS F  RN+GKTLVTRTQGTKIASEGLKHRVFEVSL DL N+E++A+RKIRLR
Sbjct  8    DWYDIKAPSCFRVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLGDLLNEEEHAYRKIRLR  67

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGM+FTTDKLRSLV+KW +LIEA+VDVKTTDN+TLR+FCIGFTK+  
Sbjct  68   AEDVQGKNVLTNFWGMNFTTDKLRSLVRKWHTLIEAYVDVKTTDNFTLRLFCIGFTKRLP  127

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  128  NQVKRTCYAQTSQ  140



>ref|XP_001755439.1| predicted protein [Physcomitrella patens]
 gb|EDQ79919.1| predicted protein [Physcomitrella patens]
Length=265

 Score =   241 bits (615),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAP+ F+ +++GKTLVTRT GTKIAS+GLK RVFEVSLADLQNDED AFRKI+LR
Sbjct  28   DWYDIKAPNTFTQKSLGKTLVTRTAGTKIASDGLKGRVFEVSLADLQNDEDQAFRKIKLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMD TTDKLRSLV+KWQSLIEAHVDVKTTDNY LR+FCI FTKKR 
Sbjct  88   AEDVQGKNVLTNFWGMDLTTDKLRSLVRKWQSLIEAHVDVKTTDNYQLRIFCIAFTKKRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ K+TCYAQSSQ
Sbjct  148  NQIKKTCYAQSSQ  160



>gb|EEC69140.1| hypothetical protein OsI_38068 [Oryza sativa Indica Group]
Length=818

 Score =   255 bits (651),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPSVF+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  148  NQVKRTCYAQASQ  160



>ref|XP_006428321.1| hypothetical protein CICLE_v10012508mg [Citrus clementina]
 ref|XP_006480359.1| PREDICTED: 40S ribosomal protein S3a-like [Citrus sinensis]
 gb|ESR41561.1| hypothetical protein CICLE_v10012508mg [Citrus clementina]
Length=261

 Score =   241 bits (614),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS F  RN+GKTLVTRTQGTKIASEGLKHRVFEVSL DL N+E++A+RKIRLR
Sbjct  28   DWYDIKAPSCFRVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLGDLLNEEEHAYRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGM+FTTDKLRSLV+KW +LIEA+VDVKTTDN+TLR+FCIGFTK+  
Sbjct  88   AEDVQGKNVLTNFWGMNFTTDKLRSLVRKWHTLIEAYVDVKTTDNFTLRLFCIGFTKRLP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  148  NQVKRTCYAQTSQ  160



>gb|KDO43437.1| hypothetical protein CISIN_1g040060mg, partial [Citrus sinensis]
Length=241

 Score =   240 bits (612),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS F  RN+GKTLVTRTQGTKIASEGLKHRVFEVSL DL N+E++A+RKIRLR
Sbjct  8    DWYDIKAPSCFRVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLGDLLNEEEHAYRKIRLR  67

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGM FTTDKLRSLV+KW +LIEA+VDVKTTDN+TLR+FCIGFTK+  
Sbjct  68   AEDVQGKNVLTNFWGMSFTTDKLRSLVRKWHTLIEAYVDVKTTDNFTLRLFCIGFTKRLP  127

Query  533  NQQKRTCYAQSSQ  571
            NQ KRTCYAQ+SQ
Sbjct  128  NQVKRTCYAQTSQ  140



>ref|XP_001774632.1| predicted protein [Physcomitrella patens]
 gb|EDQ60566.1| predicted protein [Physcomitrella patens]
Length=264

 Score =   241 bits (614),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAP+ F+ +++GKTLVTRT GTKIAS+GLK RVFEVSLADLQNDED AFRKI+LR
Sbjct  28   DWYDIKAPNTFTQKSLGKTLVTRTAGTKIASDGLKGRVFEVSLADLQNDEDQAFRKIKLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMD TTDKLRSLV+KWQSLIEAHVDVKTTDNY LR+FCI FTKKR 
Sbjct  88   AEDVQGKNVLTNFWGMDLTTDKLRSLVRKWQSLIEAHVDVKTTDNYQLRIFCIAFTKKRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ K+TCYAQSSQ
Sbjct  148  NQIKKTCYAQSSQ  160



>ref|XP_001765908.1| predicted protein [Physcomitrella patens]
 gb|EDQ69229.1| predicted protein [Physcomitrella patens]
Length=244

 Score =   240 bits (612),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAP+ F+ +++GKTLVTRT GTKIAS+GLK RVFEVSLADLQNDED AFRKI+LR
Sbjct  28   DWYDIKAPNTFTQKSLGKTLVTRTAGTKIASDGLKGRVFEVSLADLQNDEDQAFRKIKLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMD TTDKLRSLV+KWQSLIE+HVDVKTTDNY LR+FCI FTKKR 
Sbjct  88   AEDVQGKNVLTNFWGMDLTTDKLRSLVRKWQSLIESHVDVKTTDNYMLRIFCIAFTKKRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ K+TCYAQSSQ
Sbjct  148  NQIKKTCYAQSSQ  160



>ref|XP_001765967.1| predicted protein [Physcomitrella patens]
 gb|EDQ69288.1| predicted protein [Physcomitrella patens]
Length=259

 Score =   240 bits (613),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAP+ F+ +++GKTLVTRT GTKIAS+GLK RVFEVSLADLQNDED AFRKI+LR
Sbjct  28   DWYDIKAPNTFTQKSLGKTLVTRTAGTKIASDGLKGRVFEVSLADLQNDEDQAFRKIKLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMD TTDKLRSLV+KWQSLIE+HVDVKTTDNY LR+FCI FTKKR 
Sbjct  88   AEDVQGKNVLTNFWGMDLTTDKLRSLVRKWQSLIESHVDVKTTDNYMLRIFCIAFTKKRP  147

Query  533  NQQKRTCYAQSSQ  571
            NQ K+TCYAQSSQ
Sbjct  148  NQIKKTCYAQSSQ  160



>ref|XP_002949135.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ49628.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
Length=257

 Score =   239 bits (610),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAP+VF+ RN+GKTLVTRTQGTKIASE LK RVFEVSLADLQ +ED+AFRK+RLR
Sbjct  28   DWYDIKAPTVFTVRNVGKTLVTRTQGTKIASEALKGRVFEVSLADLQKNEDDAFRKMRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
             EDVQGRN LTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD YTLR+FCI FTKKR 
Sbjct  88   VEDVQGRNCLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDGYTLRVFCISFTKKRQ  147

Query  533  NQQKRTCYAQSSQ  571
             Q KRTCYAQS+Q
Sbjct  148  GQIKRTCYAQSAQ  160



>gb|AAX55706.1| cyc07 [Vitis vinifera]
Length=237

 Score =   238 bits (608),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 122/133 (92%), Gaps = 2/133 (2%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS+FS RN+GKTLV+RTQGTKIASEGLKHRV  +SLADLQNDED A+RKIRLR
Sbjct  6    DWYDIKAPSIFSVRNVGKTLVSRTQGTKIASEGLKHRVSGISLADLQNDEDRAYRKIRLR  65

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTK+  
Sbjct  66   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKRST  125

Query  533  NQQKRTCYAQSSQ  571
             Q  +T YAQSSQ
Sbjct  126  RQ--KTSYAQSSQ  136



>ref|XP_001693710.1| ribosomal protein S3a, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
 sp|A8HS48.1|RS3A_CHLRE RecName: Full=40S ribosomal protein S3a [Chlamydomonas reinhardtii]
 gb|EDP08964.1| ribosomal protein S3a [Chlamydomonas reinhardtii]
Length=259

 Score =   238 bits (608),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAP++F+ RN+GKTLVTRTQGTKIASE LK RVFEVSLADLQ +ED+AFRK+RLR
Sbjct  28   DWYDIKAPTMFTVRNVGKTLVTRTQGTKIASEALKGRVFEVSLADLQKNEDDAFRKMRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
             EDVQGRN LTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD YTLR+FCI FTKKR 
Sbjct  88   VEDVQGRNCLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDGYTLRVFCISFTKKRQ  147

Query  533  NQQKRTCYAQSSQ  571
             Q KRTCYAQS+Q
Sbjct  148  GQIKRTCYAQSAQ  160



>ref|XP_001777314.1| predicted protein [Physcomitrella patens]
 gb|EDQ57844.1| predicted protein [Physcomitrella patens]
Length=269

 Score =   236 bits (602),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 123/139 (88%), Gaps = 6/139 (4%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTK------IASEGLKHRVFEVSLADLQNDEDNAF  334
            DWYDIKAP+ F+ +N+GKTLVTRT GTK      IAS+GLK RVFEVSLADLQNDED AF
Sbjct  28   DWYDIKAPNTFTQKNLGKTLVTRTAGTKAISSSDIASDGLKGRVFEVSLADLQNDEDQAF  87

Query  335  RKIRLRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  514
            RKI+LRAEDVQG+NVLTNFWGMD TTDKLRSLV+KWQSLIEAHVDVKTTDNY +RMFCI 
Sbjct  88   RKIKLRAEDVQGKNVLTNFWGMDLTTDKLRSLVRKWQSLIEAHVDVKTTDNYMIRMFCIA  147

Query  515  FTKKRVNQQKRTCYAQSSQ  571
            FTKKR NQ K+TCYAQ+SQ
Sbjct  148  FTKKRPNQIKKTCYAQTSQ  166



>emb|CBX25071.1| 40S ribosomal protein S3a [Polytomella sp. Pringsheim 198.80]
Length=262

 Score =   234 bits (598),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAP  FS RN+GKTLVTRTQGTKIASEGLK RVFEVSLADLQ +E++AF+KIRLR
Sbjct  28   DWYDLKAPGFFSVRNVGKTLVTRTQGTKIASEGLKGRVFEVSLADLQKNEEDAFKKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
             EDVQGRN LTNF+GMDFTTDKLR L++KWQSLIEAHVDVKTTD Y+LRMFCI FTKKR 
Sbjct  88   VEDVQGRNCLTNFYGMDFTTDKLRFLIRKWQSLIEAHVDVKTTDGYSLRMFCIAFTKKRQ  147

Query  533  NQQKRTCYAQSSQ  571
             Q KRTCYAQ+ Q
Sbjct  148  GQIKRTCYAQTGQ  160



>gb|EMT30223.1| 40S ribosomal protein S3a [Aegilops tauschii]
Length=257

 Score =   231 bits (590),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 119/132 (90%), Gaps = 6/132 (5%)
 Frame = +2

Query  176  WYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRA  355
            WYDIKAP +F++RN+GKTLV+RTQ      EGLKHRVFEVSLADLQNDED A+RKIRLRA
Sbjct  29   WYDIKAPLLFTSRNVGKTLVSRTQ------EGLKHRVFEVSLADLQNDEDQAYRKIRLRA  82

Query  356  EDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVN  535
            EDVQG NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNY LRMF IGFTK+R N
Sbjct  83   EDVQGMNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYMLRMFTIGFTKRRPN  142

Query  536  QQKRTCYAQSSQ  571
            Q KRTCYAQ+SQ
Sbjct  143  QVKRTCYAQASQ  154



>emb|CEG00819.1| Ribosomal protein S3Ae [Ostreococcus tauri]
Length=258

 Score =   230 bits (587),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS+FS RNIGKTLVTRTQGTKIAS+GLK R+FE+SLADL NDED +FRK++L+
Sbjct  28   DWYDIKAPSMFSVRNIGKTLVTRTQGTKIASDGLKGRIFEISLADLNNDEDQSFRKMKLK  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
             EDVQG+NVLTNF GMDFTTDK+RSLV+KW SLIE  VDVKTTD Y+LR+FCIGFTK+R+
Sbjct  88   CEDVQGKNVLTNFAGMDFTTDKIRSLVRKWFSLIECFVDVKTTDGYSLRVFCIGFTKRRI  147

Query  533  NQQKRTCYAQSSQ  571
            +Q KRTCYAQS+Q
Sbjct  148  DQAKRTCYAQSAQ  160



>ref|XP_001422366.1| Ribosomal protein S3a, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
 sp|A4SAD2.1|RS3A_OSTLU RecName: Full=40S ribosomal protein S3a [Ostreococcus lucimarinus 
CCE9901]
 gb|ABP00683.1| Ribosomal protein S3a, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
Length=260

 Score =   230 bits (586),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS+FS RNIGKTLV+RTQGTKIAS+GLK R+FE+SLADL NDED +FRK++L+
Sbjct  28   DWYDIKAPSMFSVRNIGKTLVSRTQGTKIASDGLKGRIFEISLADLNNDEDQSFRKMKLK  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
             EDVQG+NVLTNF GMDFTTDK+RSLV+KW SLIE  VDVKTTD YTLR+FCIGFTK+R+
Sbjct  88   CEDVQGKNVLTNFAGMDFTTDKIRSLVRKWFSLIECFVDVKTTDGYTLRVFCIGFTKRRM  147

Query  533  NQQKRTCYAQSSQ  571
            +Q KRTCYAQS+Q
Sbjct  148  DQAKRTCYAQSAQ  160



>ref|XP_005650618.1| ribosomal protein S3Ae [Coccomyxa subellipsoidea C-169]
 gb|EIE26074.1| ribosomal protein S3Ae [Coccomyxa subellipsoidea C-169]
Length=259

 Score =   229 bits (584),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAPS F++RN+GKTLVTRTQGTKIAS+GLK RVFEVSLADLQ +E +AFRKIRLR
Sbjct  28   DWYDVKAPSSFTSRNVGKTLVTRTQGTKIASDGLKGRVFEVSLADLQTNEADAFRKIRLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
             EDVQGRN LTNFWGMD+TTDKLRSLV+KWQ+LIEA VDVKTTD Y LRMF I FTKKR 
Sbjct  88   VEDVQGRNCLTNFWGMDYTTDKLRSLVRKWQTLIEAQVDVKTTDGYLLRMFAIAFTKKRT  147

Query  533  NQQKRTCYAQSSQ  571
             Q K+T YAQSSQ
Sbjct  148  GQVKKTAYAQSSQ  160



>ref|XP_008671813.1| PREDICTED: 40S ribosomal protein S3a-like [Zea mays]
Length=238

 Score =   224 bits (570),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            D YDIKAP VFS RNIGKTLV+RTQGTKIASEGLKHRVFEVSL DL +DED  + KIRL 
Sbjct  28   DRYDIKAPPVFSVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLVDLHSDEDKTYMKIRLC  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG NV+TNFWGM FTTDKL SLVKKWQ LIEAHV++KTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGGNVITNFWGMSFTTDKLHSLVKKWQRLIEAHVNIKTTDNYMLRLFCIGFTKRRP  147

Query  533  NQQKRTCYAQSSQ  571
            N+ KRT YAQ+SQ
Sbjct  148  NRVKRTSYAQASQ  160



>gb|AFW89329.1| hypothetical protein ZEAMMB73_166147 [Zea mays]
Length=231

 Score =   222 bits (566),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = +2

Query  221  GKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGM  400
            GKTLV+RTQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLRAEDVQGRNVLTNFWGM
Sbjct  15   GKTLVSRTQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLRAEDVQGRNVLTNFWGM  74

Query  401  DFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQ  571
            +FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQ
Sbjct  75   NFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQ  131



>gb|KFM56731.1| 40S ribosomal protein S3a, partial [Stegodyphus mimosarum]
Length=187

 Score =   219 bits (559),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 117/133 (88%), Gaps = 1/133 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAP++FS RN+GKTLV RTQGTKIASEGLK RVFE+SLADLQNDE  AFRK RL 
Sbjct  29   DWYDVKAPAMFSVRNVGKTLVNRTQGTKIASEGLKGRVFEISLADLQNDEI-AFRKFRLI  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AE+VQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y LRMFCIGFTKK  
Sbjct  88   AEEVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLLRMFCIGFTKKWA  147

Query  533  NQQKRTCYAQSSQ  571
             Q K+TCYAQ +Q
Sbjct  148  TQVKKTCYAQHAQ  160



>ref|XP_002428136.1| 40S ribosomal protein S3A, putative [Pediculus humanus corporis]
 gb|EEB15398.1| 40S ribosomal protein S3A, putative [Pediculus humanus corporis]
Length=263

 Score =   222 bits (565),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 117/135 (87%), Gaps = 2/135 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  346
            DWYD+KAPS+F+TR IGKTLV RTQGTKIASEGLK+RVFEVSLADLQND D   +FRK R
Sbjct  29   DWYDVKAPSMFATRQIGKTLVNRTQGTKIASEGLKNRVFEVSLADLQNDTDAERSFRKFR  88

Query  347  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKK  526
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEAHVDVKTTD Y LR+FCIGFT K
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEAHVDVKTTDGYLLRVFCIGFTNK  148

Query  527  RVNQQKRTCYAQSSQ  571
                QK+TCYAQ +Q
Sbjct  149  DQMSQKKTCYAQHTQ  163



>gb|ACD65096.1| putative 40S ribosomal protein RPS3A [Novocrania anomala]
Length=185

 Score =   219 bits (557),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 119/133 (89%), Gaps = 1/133 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAPS+F+ R IGKTLVTRTQGTKIAS+GLK RVFE +LADLQNDE  +FRK +L 
Sbjct  29   DWYDVKAPSMFAVRQIGKTLVTRTQGTKIASDGLKGRVFECALADLQNDE-ISFRKFKLM  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQGRNVLTNF GM+ TTDKLRS+VKKWQ+LIEA+VDVKTTD Y LR+FCIGFTKKR 
Sbjct  88   AEDVQGRNVLTNFHGMNLTTDKLRSMVKKWQTLIEANVDVKTTDGYLLRVFCIGFTKKRQ  147

Query  533  NQQKRTCYAQSSQ  571
            NQ K+TCYAQS+Q
Sbjct  148  NQIKKTCYAQSTQ  160



>ref|XP_007508881.1| predicted protein [Bathycoccus prasinos]
 emb|CCO19967.1| predicted protein [Bathycoccus prasinos]
Length=267

 Score =   221 bits (564),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS+F+ RN+GKT  TRTQGTKIAS+GLK R+FE SLADL  DED AFRK+ L+
Sbjct  36   DWYDIKAPSMFTVRNVGKTPQTRTQGTKIASDGLKGRIFECSLADLNQDEDQAFRKMFLK  95

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
             EDVQG+NVLTNF+GMDFTTDK+RSLV+KW SLIE  VDVKTTD YT+R+FCIGFTK+RV
Sbjct  96   CEDVQGKNVLTNFYGMDFTTDKIRSLVRKWFSLIECFVDVKTTDGYTMRVFCIGFTKRRV  155

Query  533  NQQKRTCYAQSSQ  571
            +Q KRTCYAQS+Q
Sbjct  156  DQTKRTCYAQSAQ  168



>gb|ABX75452.1| 40S ribosomal protein S3a [Lycosa singoriensis]
Length=223

 Score =   218 bits (556),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 116/133 (87%), Gaps = 1/133 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAP +FS RN+GKTLV RTQGTKIASEGLK RVFE+SLADLQNDE  AFRK RL 
Sbjct  29   DWYDVKAPVMFSVRNVGKTLVNRTQGTKIASEGLKGRVFEISLADLQNDE-IAFRKFRLI  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AE+VQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y LRMFCIGFTKK  
Sbjct  88   AEEVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLLRMFCIGFTKKWA  147

Query  533  NQQKRTCYAQSSQ  571
             Q K+TCYAQ +Q
Sbjct  148  TQVKKTCYAQHTQ  160



>gb|ABW23199.1| ribosomal protein rps3a [Eurythoe complanata]
Length=263

 Score =   218 bits (556),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 119/133 (89%), Gaps = 1/133 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAPS+F+ R IGKTLVTRTQGTKIASEGLK RVFEVSLADLQNDE  AFRK +L 
Sbjct  29   DWYDVKAPSMFNIRQIGKTLVTRTQGTKIASEGLKGRVFEVSLADLQNDE-VAFRKFKLV  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AE+VQGRNVLTNF GM+ TTDKLRS+VKKWQ+LIEA+VDV+TTD + LR+FCIGFTKKR 
Sbjct  88   AEEVQGRNVLTNFHGMNLTTDKLRSMVKKWQTLIEANVDVRTTDAFLLRLFCIGFTKKRQ  147

Query  533  NQQKRTCYAQSSQ  571
            NQ K+TCYAQ +Q
Sbjct  148  NQIKKTCYAQHTQ  160



>gb|KDR16079.1| 40S ribosomal protein S3a [Zootermopsis nevadensis]
Length=263

 Score =   218 bits (555),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 117/135 (87%), Gaps = 2/135 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  346
            DWYD+KAPS+F+TR IGKTLV RTQGTKIASEGLK+RVFEVSLADLQND D   +FRK R
Sbjct  29   DWYDVKAPSMFATRQIGKTLVNRTQGTKIASEGLKYRVFEVSLADLQNDNDAERSFRKFR  88

Query  347  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKK  526
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y LR+FCIGFT K
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLLRVFCIGFTNK  148

Query  527  RVNQQKRTCYAQSSQ  571
                Q++TCYAQ +Q
Sbjct  149  DQMSQRKTCYAQHTQ  163



>gb|ACD61705.1| ribosomal protein S3 [Chironomus riparius]
Length=270

 Score =   218 bits (555),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 116/135 (86%), Gaps = 2/135 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  346
            DWYDIKAPS+F+TR +GKTLV RTQGTKIASEGLK RVFEVSLADLQND D   +FRK +
Sbjct  29   DWYDIKAPSMFTTRQVGKTLVNRTQGTKIASEGLKGRVFEVSLADLQNDNDAERSFRKFK  88

Query  347  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKK  526
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIE HVDVKTTD Y LR+FCIGFT K
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIECHVDVKTTDGYLLRVFCIGFTAK  148

Query  527  RVNQQKRTCYAQSSQ  571
              +  ++TCYAQ+SQ
Sbjct  149  DSSSHRKTCYAQTSQ  163



>sp|Q5G5C4.1|RS3A_PERAM RecName: Full=40S ribosomal protein S3a [Periplaneta americana]
 gb|AAW57773.1| Parcxpwex01 [Periplaneta americana]
Length=263

 Score =   218 bits (554),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 117/135 (87%), Gaps = 2/135 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  346
            DWYD+KAPS+F+TR IGKTLV RTQGTKIASEGLK+RVFEVSLADLQND D   +FRK R
Sbjct  29   DWYDVKAPSMFATRQIGKTLVNRTQGTKIASEGLKYRVFEVSLADLQNDNDAERSFRKFR  88

Query  347  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKK  526
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y LR+FCIGFT K
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLLRVFCIGFTNK  148

Query  527  RVNQQKRTCYAQSSQ  571
                Q++TCYAQ +Q
Sbjct  149  DQMSQRKTCYAQHTQ  163



>gb|AGM32131.1| 40S ribosomal protein S3a [Coptotermes formosanus]
Length=272

 Score =   218 bits (554),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 117/135 (87%), Gaps = 2/135 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  346
            DWYD+KAPS+F+TR IGKTLV RTQGTKIASEGLK+RVFEVSLADLQND D   +FRK R
Sbjct  38   DWYDVKAPSMFATRQIGKTLVNRTQGTKIASEGLKYRVFEVSLADLQNDNDAERSFRKFR  97

Query  347  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKK  526
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y LR+FCIGFT K
Sbjct  98   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLLRVFCIGFTNK  157

Query  527  RVNQQKRTCYAQSSQ  571
                Q++TCYAQ +Q
Sbjct  158  DQMSQRKTCYAQHTQ  172



>sp|Q6EV04.1|RS3A_BIPLU RecName: Full=40S ribosomal protein S3a [Biphyllus lunatus]
 emb|CAH04315.1| S3Ae ribosomal protein [Biphyllus lunatus]
Length=267

 Score =   217 bits (552),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 114/135 (84%), Gaps = 2/135 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  346
            DWYD+KAP +F+TR +GKTLV RTQGTKIASEGLKHRVFEVSLADLQND D   +FRK R
Sbjct  29   DWYDVKAPCMFATRQVGKTLVNRTQGTKIASEGLKHRVFEVSLADLQNDNDAERSFRKFR  88

Query  347  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKK  526
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQSLIEA  DVKTTD Y LR+FCIGFT K
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQSLIEASADVKTTDGYLLRVFCIGFTNK  148

Query  527  RVNQQKRTCYAQSSQ  571
                Q++TCYAQ +Q
Sbjct  149  DQLSQRKTCYAQHTQ  163



>gb|ABI52667.1| 40S ribosomal protein S3a [Argas monolakensis]
Length=255

 Score =   216 bits (550),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 114/133 (86%), Gaps = 1/133 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAP ++S RNIGKT V RTQGTKIASEGLK RVFEVS ADLQN ED AFRK RL 
Sbjct  15   DWYDVKAPMMYSVRNIGKTFVNRTQGTKIASEGLKGRVFEVSQADLQNGED-AFRKFRLI  73

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AE+VQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA VDV+TTD Y LRMFCIGFTKK  
Sbjct  74   AEEVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEATVDVRTTDGYLLRMFCIGFTKKCS  133

Query  533  NQQKRTCYAQSSQ  571
            NQ K+TCYAQ +Q
Sbjct  134  NQVKKTCYAQHTQ  146



>gb|ABS44871.1| ribosomal protein S3Ae [Pteromalus puparum]
Length=249

 Score =   216 bits (549),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 115/135 (85%), Gaps = 2/135 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQ--NDEDNAFRKIR  346
            DWYD+KAPSVF+ R +GKTLV RTQGTKIASEGLKHRVFEVSLADLQ  ND + +FRK R
Sbjct  11   DWYDVKAPSVFTLRQVGKTLVNRTQGTKIASEGLKHRVFEVSLADLQSDNDAERSFRKFR  70

Query  347  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKK  526
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA VDVKTTD Y+LR+FCIGFT K
Sbjct  71   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEAVVDVKTTDGYSLRVFCIGFTNK  130

Query  527  RVNQQKRTCYAQSSQ  571
                 ++TCYAQ +Q
Sbjct  131  DPQSSRKTCYAQHAQ  145



>gb|ABE66401.1| S phase protein [Striga asiatica]
Length=190

 Score =   214 bits (544),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/107 (93%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +2

Query  251  TKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLRSL  430
            TKIASEGLKHRVFEVSLADLQ DED++FRKIRLRAEDVQG+NVLTNFWGMDFTTDKLRSL
Sbjct  1    TKIASEGLKHRVFEVSLADLQGDEDHSFRKIRLRAEDVQGKNVLTNFWGMDFTTDKLRSL  60

Query  431  VKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQ  571
            V+KWQSLIEAHVDVKTTDNYTLR+FCI FTKKRVNQQKRTCYAQSSQ
Sbjct  61   VRKWQSLIEAHVDVKTTDNYTLRLFCIAFTKKRVNQQKRTCYAQSSQ  107



>ref|XP_001601315.1| PREDICTED: 40S ribosomal protein S3a [Nasonia vitripennis]
Length=267

 Score =   216 bits (550),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 115/135 (85%), Gaps = 2/135 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQ--NDEDNAFRKIR  346
            DWYD+KAPSVF+ R +GKTLV RTQGTKIASEGLKHRVFEVSLADLQ  ND + +FRK R
Sbjct  29   DWYDVKAPSVFTLRQVGKTLVNRTQGTKIASEGLKHRVFEVSLADLQSDNDAERSFRKFR  88

Query  347  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKK  526
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA VDVKTTD Y+LR+FCIGFT K
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEAVVDVKTTDGYSLRVFCIGFTNK  148

Query  527  RVNQQKRTCYAQSSQ  571
                 ++TCYAQ +Q
Sbjct  149  DPQSSRKTCYAQHAQ  163



>gb|KDD76342.1| ribosomal protein S3Ae [Helicosporidium sp. ATCC 50920]
Length=259

 Score =   216 bits (549),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYDIKAPS+FS RN+GKTLVTRT GTKIAS+GLK R+  VSLADLQ++E +A+R I+LR
Sbjct  28   DWYDIKAPSMFSVRNVGKTLVTRTAGTKIASDGLKGRIINVSLADLQSNEADAYRNIKLR  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
             EDVQGRN LT+F GMD TTDKLRSLV+KWQ+LIEAHVDV+T D YTLRMFCI FTKK  
Sbjct  88   IEDVQGRNCLTHFHGMDLTTDKLRSLVRKWQTLIEAHVDVRTADGYTLRMFCISFTKKGA  147

Query  533  NQQKRTCYAQSSQ  571
             Q K+TCYAQS+Q
Sbjct  148  GQIKKTCYAQSAQ  160



>gb|AAV84249.1| ribosomal protein S3 [Culicoides sonorensis]
Length=215

 Score =   214 bits (544),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 115/135 (85%), Gaps = 2/135 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  346
            DWYD+KAPS+F+ R +GKTLV RTQGTKIASEGLK RVFEVSLADLQND D   +FRK +
Sbjct  27   DWYDVKAPSMFAIRQVGKTLVNRTQGTKIASEGLKGRVFEVSLADLQNDTDAERSFRKFK  86

Query  347  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKK  526
            L AEDVQGR+VLTNF GMD TTDKLRS+VKKWQ+LIE HVDVKTTD Y LR+FCIGFT+K
Sbjct  87   LIAEDVQGRDVLTNFHGMDLTTDKLRSMVKKWQTLIECHVDVKTTDGYLLRVFCIGFTQK  146

Query  527  RVNQQKRTCYAQSSQ  571
                Q++TCYAQ SQ
Sbjct  147  DPQSQRKTCYAQHSQ  161



>gb|ACD65136.1| putative 40S ribosomal protein RPS3A [Phoronis muelleri]
Length=184

 Score =   212 bits (539),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 118/133 (89%), Gaps = 1/133 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAPS+F+ R IGKTLVTRTQGTKIAS+GLK RVFEVSLADLQNDE  AFRK +L 
Sbjct  29   DWYDVKAPSMFNIRQIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEI-AFRKFKLC  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AEDVQG+N+LTNF GM+ TTDK RS+VKKWQ++IEA+VDVKTTD   +R+FCIGFTKKR 
Sbjct  88   AEDVQGKNLLTNFHGMNLTTDKTRSMVKKWQTMIEANVDVKTTDGNLMRLFCIGFTKKRN  147

Query  533  NQQKRTCYAQSSQ  571
            NQ K+TCYAQS+Q
Sbjct  148  NQVKKTCYAQSTQ  160



>tpg|DAA34106.1| TPA_exp: 40S ribosomal protein S3a [Amblyomma variegatum]
Length=214

 Score =   213 bits (542),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 114/133 (86%), Gaps = 1/133 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAP++++ RNIGKT V RTQGTKIASEGLK RVFEVS ADL N ED AFRK RL 
Sbjct  29   DWYDVKAPTMYTVRNIGKTFVNRTQGTKIASEGLKGRVFEVSQADLTNGED-AFRKFRLI  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AE+VQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA VDV+TTD Y LRMFCIGFTKK  
Sbjct  88   AEEVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEATVDVRTTDGYLLRMFCIGFTKKCA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ K+TCYAQ +Q
Sbjct  148  NQLKKTCYAQHNQ  160



>dbj|BAN20332.1| ribosomal protein S3A [Riptortus pedestris]
Length=262

 Score =   214 bits (546),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 116/135 (86%), Gaps = 2/135 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  346
            DWYD+KAPS+F+TR IGKTLV RTQGTKIASEGLK RVFEVSLADLQND D   +FRK R
Sbjct  29   DWYDVKAPSMFNTRQIGKTLVNRTQGTKIASEGLKGRVFEVSLADLQNDSDAERSFRKFR  88

Query  347  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKK  526
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDV+TTD Y LR+FCIGFT K
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVRTTDGYLLRVFCIGFTNK  148

Query  527  RVNQQKRTCYAQSSQ  571
                Q++TCYAQ +Q
Sbjct  149  DQMSQRKTCYAQHNQ  163



>ref|XP_002505259.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66517.1| predicted protein [Micromonas sp. RCC299]
Length=263

 Score =   214 bits (546),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            +WYDIKAPS+F+ + +GKTLVTR+ GTKIAS+GLK R+FE SLADLQ DED AFRK+ L+
Sbjct  28   EWYDIKAPSMFTVKQVGKTLVTRSAGTKIASDGLKGRIFECSLADLQQDEDQAFRKMLLK  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
             EDVQG NVLT F GMDFTTDKLRSLV+KW SLIE  VDVKTTD YTLR+FCIGFTK+R+
Sbjct  88   CEDVQGTNVLTQFAGMDFTTDKLRSLVRKWFSLIETFVDVKTTDQYTLRVFCIGFTKRRM  147

Query  533  NQQKRTCYAQSSQ  571
            +Q KRTCYAQS Q
Sbjct  148  DQTKRTCYAQSGQ  160



>gb|AAU06483.1| ribosomal protein subunit 3 [Culicoides sonorensis]
Length=265

 Score =   214 bits (546),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 115/135 (85%), Gaps = 2/135 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  346
            DWYD+KAPS+F+ R +GKTLV RTQGTKIASEGLK RVFEVSLADLQND D   +FRK +
Sbjct  30   DWYDVKAPSMFAIRQVGKTLVNRTQGTKIASEGLKGRVFEVSLADLQNDTDAERSFRKFK  89

Query  347  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKK  526
            L AEDVQGR+VLTNF GMD TTDKLRS+VKKWQ+LIE HVDVKTTD Y LR+FCIGFT+K
Sbjct  90   LIAEDVQGRDVLTNFHGMDLTTDKLRSMVKKWQTLIECHVDVKTTDGYLLRVFCIGFTQK  149

Query  527  RVNQQKRTCYAQSSQ  571
                Q++TCYAQ SQ
Sbjct  150  DPQSQRKTCYAQHSQ  164



>gb|ABZ04255.1| ribosomal protein rps3a [Lineus viridis]
Length=229

 Score =   213 bits (543),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 117/133 (88%), Gaps = 1/133 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAPS+F+ R IGKTLVTRTQGTKIAS+GLK RVFE SLADLQNDE  AFRK +L 
Sbjct  30   DWYDVKAPSMFNIRQIGKTLVTRTQGTKIASDGLKGRVFECSLADLQNDE-VAFRKFKLM  88

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
             E+VQG+N+LTNF GMD TTDKL+S+VKKWQ+LIEAHV+VKTTD Y L +FCIGFTKKR 
Sbjct  89   CEEVQGKNLLTNFHGMDLTTDKLKSMVKKWQTLIEAHVEVKTTDGYYLSLFCIGFTKKRQ  148

Query  533  NQQKRTCYAQSSQ  571
            NQ K+TCYAQ++Q
Sbjct  149  NQVKKTCYAQTTQ  161



>ref|XP_002465526.1| hypothetical protein SORBIDRAFT_01g040570 [Sorghum bicolor]
 gb|EER92524.1| hypothetical protein SORBIDRAFT_01g040570 [Sorghum bicolor]
Length=254

 Score =   214 bits (545),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 110/132 (83%), Gaps = 7/132 (5%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQG-------TKIASEGLKHRVFEVSLADLQNDEDNA  331
            DWYDIKAPSVFS RNIGKT V  T           IASEGLKHRVFEV LADLQ DED A
Sbjct  28   DWYDIKAPSVFSVRNIGKTSVQDTGCYSISNFIQNIASEGLKHRVFEVCLADLQGDEDQA  87

Query  332  FRKIRLRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCI  511
            +RKIRLRAEDVQGRNVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCI
Sbjct  88   YRKIRLRAEDVQGRNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCI  147

Query  512  GFTKKRVNQQKR  547
            GFTK+R NQ +R
Sbjct  148  GFTKRRPNQIRR  159



>ref|XP_008555289.1| PREDICTED: 40S ribosomal protein S3a [Microplitis demolitor]
Length=266

 Score =   214 bits (545),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 117/135 (87%), Gaps = 2/135 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  346
            DWYD+KAPS+F+TR +GKTLV RTQGTKIASEGLK RVFEVSLADLQND+D   +FRK R
Sbjct  29   DWYDVKAPSMFTTRQVGKTLVNRTQGTKIASEGLKLRVFEVSLADLQNDQDAERSFRKFR  88

Query  347  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKK  526
            L AEDVQGR+VLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y LR+FCIGFT K
Sbjct  89   LIAEDVQGRSVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLLRVFCIGFTNK  148

Query  527  RVNQQKRTCYAQSSQ  571
                Q++TCYAQ +Q
Sbjct  149  DQLSQRKTCYAQHAQ  163



>ref|XP_011421732.1| PREDICTED: 40S ribosomal protein S3a-like [Crassostrea gigas]
Length=274

 Score =   214 bits (546),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 117/133 (88%), Gaps = 1/133 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAPS+F  R IGKTLVTRTQGT+IAS+GLK RVFEVSLADLQNDE  +FRK +L 
Sbjct  39   DWYDVKAPSMFVVRQIGKTLVTRTQGTRIASDGLKGRVFEVSLADLQNDE-VSFRKFKLM  97

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AE+VQGRNVLTNF GMD T DKL S+VKKWQ++I+AHVDVKTTD Y LR+FCIGFTKKRV
Sbjct  98   AEEVQGRNVLTNFHGMDLTRDKLCSMVKKWQTMIQAHVDVKTTDGYLLRLFCIGFTKKRV  157

Query  533  NQQKRTCYAQSSQ  571
             Q K+TCYAQ++Q
Sbjct  158  YQLKKTCYAQNTQ  170



>ref|XP_011495909.1| PREDICTED: 40S ribosomal protein S3a [Ceratosolen solmsi marchali]
Length=267

 Score =   214 bits (544),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 115/135 (85%), Gaps = 2/135 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  346
            DWYD+KAPSVF+ R++GKTLV RTQGTKIASEGLKHRVFEVSLADLQ+D D   +FRK R
Sbjct  29   DWYDVKAPSVFTVRHVGKTLVNRTQGTKIASEGLKHRVFEVSLADLQSDHDAERSFRKFR  88

Query  347  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKK  526
            L AEDVQGR VLTNF GMD TTDKLRS+VKKWQ+LIEA VDVKTTD Y+LR+FCIGFT K
Sbjct  89   LIAEDVQGRGVLTNFHGMDLTTDKLRSMVKKWQTLIEAVVDVKTTDGYSLRVFCIGFTNK  148

Query  527  RVNQQKRTCYAQSSQ  571
                 ++TCYAQ +Q
Sbjct  149  DQQSTRKTCYAQHAQ  163



>gb|EKC30815.1| 40S ribosomal protein S3a [Crassostrea gigas]
Length=306

 Score =   214 bits (546),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 117/133 (88%), Gaps = 1/133 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAPS+F  R IGKTLVTRTQGT+IAS+GLK RVFEVSLADLQNDE  +FRK +L 
Sbjct  71   DWYDVKAPSMFVVRQIGKTLVTRTQGTRIASDGLKGRVFEVSLADLQNDE-VSFRKFKLM  129

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AE+VQGRNVLTNF GMD T DKL S+VKKWQ++I+AHVDVKTTD Y LR+FCIGFTKKRV
Sbjct  130  AEEVQGRNVLTNFHGMDLTRDKLCSMVKKWQTMIQAHVDVKTTDGYLLRLFCIGFTKKRV  189

Query  533  NQQKRTCYAQSSQ  571
             Q K+TCYAQ++Q
Sbjct  190  YQLKKTCYAQNTQ  202



>sp|Q4PM31.1|RS3A_IXOSC RecName: Full=40S ribosomal protein S3a [Ixodes scapularis]
 gb|AAY66934.1| 40S ribosomal protein S3a [Ixodes scapularis]
Length=270

 Score =   213 bits (543),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 114/133 (86%), Gaps = 1/133 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAP++++ RNIGKT V RTQGTKIASEGLK RVFEVS ADL N ED A+RK RL 
Sbjct  29   DWYDVKAPTMYTVRNIGKTFVNRTQGTKIASEGLKGRVFEVSQADLTNGED-AYRKFRLI  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AE+VQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA VDV+TTD Y LRMFCIGFTKK  
Sbjct  88   AEEVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEATVDVRTTDGYLLRMFCIGFTKKCA  147

Query  533  NQQKRTCYAQSSQ  571
            NQ K+TCYAQ +Q
Sbjct  148  NQLKKTCYAQHNQ  160



>emb|CAJ17219.1| ribosomal protein S3Ae [Timarcha balearica]
Length=268

 Score =   213 bits (542),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 115/135 (85%), Gaps = 2/135 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  346
            DWYD+KAPS+F+TR +GKTLV RTQGTKIASEGLK+RVFEVSLADLQND D   +FRK R
Sbjct  29   DWYDVKAPSMFTTRQVGKTLVNRTQGTKIASEGLKYRVFEVSLADLQNDNDAERSFRKFR  88

Query  347  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKK  526
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA  DVKT+D Y LR+FCIGFT K
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEASADVKTSDGYLLRVFCIGFTNK  148

Query  527  RVNQQKRTCYAQSSQ  571
                Q++TCYAQ +Q
Sbjct  149  DQLSQRKTCYAQHTQ  163



>ref|XP_009024124.1| hypothetical protein HELRODRAFT_185887 [Helobdella robusta]
 gb|ESN97662.1| hypothetical protein HELRODRAFT_185887 [Helobdella robusta]
Length=262

 Score =   213 bits (542),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 117/133 (88%), Gaps = 1/133 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAPS+F+ RNIGKT+V+RT GTKIAS+GLK RVFEVSLADLQNDE   FRK +L 
Sbjct  29   DWYDVKAPSMFNNRNIGKTIVSRTVGTKIASDGLKGRVFEVSLADLQNDE-ITFRKFKLM  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            +E+VQGR+VLTNF GMD TTDKLRS+VKKWQ+LIEAHVDVKTTD Y LR+FCIGFT KR 
Sbjct  88   SEEVQGRHVLTNFHGMDMTTDKLRSMVKKWQTLIEAHVDVKTTDGYLLRLFCIGFTTKRQ  147

Query  533  NQQKRTCYAQSSQ  571
            NQ K+T YAQS+Q
Sbjct  148  NQLKKTSYAQSTQ  160



>ref|XP_968064.1| PREDICTED: 40S ribosomal protein S3a [Tribolium castaneum]
 gb|EFA05373.1| hypothetical protein TcasGA2_TC015539 [Tribolium castaneum]
Length=267

 Score =   213 bits (542),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 114/135 (84%), Gaps = 2/135 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  346
            DWYD+KAPS+F+TR +GKTLV RTQGTKIASEGLK RVFEVSLADLQND D   +FRK R
Sbjct  29   DWYDVKAPSMFATRQVGKTLVNRTQGTKIASEGLKGRVFEVSLADLQNDNDAERSFRKFR  88

Query  347  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKK  526
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA  DVKTTD Y LR+FCIGFT K
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEASADVKTTDGYLLRVFCIGFTNK  148

Query  527  RVNQQKRTCYAQSSQ  571
                Q++TCYAQ +Q
Sbjct  149  DQLSQRKTCYAQHTQ  163



>gb|EYU26004.1| hypothetical protein MIMGU_mgv1a019927mg, partial [Erythranthe 
guttata]
Length=209

 Score =   211 bits (536),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +2

Query  233  VTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTT  412
            V  T  TKIASEGLKHRVFEVSLADLQ+DED+AFRKIRLRAEDVQG+NVLTNFWGMDFTT
Sbjct  4    VKSTLNTKIASEGLKHRVFEVSLADLQSDEDHAFRKIRLRAEDVQGKNVLTNFWGMDFTT  63

Query  413  DKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQ  571
            DKLRSLV+KWQ+LIEAHVDVK TD+YTL++FCI FTKKR NQQKRTCYAQSSQ
Sbjct  64   DKLRSLVRKWQTLIEAHVDVKKTDSYTLKLFCIAFTKKRANQQKRTCYAQSSQ  116



>sp|Q4KTD9.1|RS3A_SUBDO RecName: Full=40S ribosomal protein S3a [Suberites domuncula]
 gb|AAX48879.1| S3a [Suberites domuncula]
Length=252

 Score =   212 bits (540),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 118/133 (89%), Gaps = 1/133 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAPS+F+ RNIGKTLVTRTQG K+AS+GLK RVFEVSLADLQNDE  +FRK RL 
Sbjct  28   DWYDVKAPSMFAVRNIGKTLVTRTQGKKLASDGLKGRVFEVSLADLQNDE-QSFRKFRLI  86

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            +ED+QG+NVLTNF GM  TTDKLR+LVKKWQ+LIEA+VDVKTTD Y LR+FCIGFTK++ 
Sbjct  87   SEDIQGKNVLTNFHGMTMTTDKLRALVKKWQTLIEANVDVKTTDGYLLRLFCIGFTKRQP  146

Query  533  NQQKRTCYAQSSQ  571
            NQ K+T YA+SSQ
Sbjct  147  NQIKKTSYAKSSQ  159



>gb|ERZ98268.1| hypothetical protein GLOINDRAFT_339726, partial [Rhizophagus 
irregularis DAOM 181602]
Length=253

 Score =   211 bits (538),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAPS+F  RNIGKTLV RTQG K A++ LK RVFEVSLADL  DE+ AFRKI+LR
Sbjct  24   DWYDVKAPSIFEVRNIGKTLVNRTQGLKNANDALKGRVFEVSLADLNKDEEQAFRKIKLR  83

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
             ++VQG+N+LTNF GMDFT+DKLRSLVKKWQSLIEAHVDVKTTD Y LR+F I FTK+R 
Sbjct  84   VDEVQGKNLLTNFHGMDFTSDKLRSLVKKWQSLIEAHVDVKTTDGYLLRLFAIAFTKRRP  143

Query  533  NQQKRTCYAQSSQ  571
            NQ ++T YAQSSQ
Sbjct  144  NQVRKTTYAQSSQ  156



>ref|XP_011421723.1| PREDICTED: 40S ribosomal protein S3a-like [Crassostrea gigas]
 gb|EKC30814.1| 40S ribosomal protein S3a [Crassostrea gigas]
Length=262

 Score =   212 bits (539),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 116/133 (87%), Gaps = 1/133 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAPS+F  R IGKTLVTRTQGT+IAS+GLK RVFEVSLADLQNDE  +FRK +L 
Sbjct  29   DWYDVKAPSMFVVRQIGKTLVTRTQGTRIASDGLKGRVFEVSLADLQNDE-VSFRKFKLM  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AE+VQGRNVLTNF GMD T DKL S+VKKWQ++I+AHVDVKTTD Y LRMFCIGFTKK+ 
Sbjct  88   AEEVQGRNVLTNFHGMDLTRDKLCSMVKKWQTMIQAHVDVKTTDGYLLRMFCIGFTKKKQ  147

Query  533  NQQKRTCYAQSSQ  571
             Q K+TCYAQ++Q
Sbjct  148  FQVKKTCYAQTTQ  160



>gb|ACY71306.1| ribosomal protein S3A [Chrysomela tremula]
Length=269

 Score =   212 bits (539),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 115/135 (85%), Gaps = 2/135 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  346
            DWYD+KAPS+F+TR +GKTLV RTQGT+IASEGLK RVFEVSLADLQND D   ++RK R
Sbjct  29   DWYDVKAPSMFATRQVGKTLVNRTQGTRIASEGLKSRVFEVSLADLQNDNDAERSYRKFR  88

Query  347  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKK  526
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA  DVKT+D Y LR+FCIGFT K
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEASADVKTSDGYLLRVFCIGFTNK  148

Query  527  RVNQQKRTCYAQSSQ  571
              + Q++TCYAQ +Q
Sbjct  149  DPSSQRKTCYAQHTQ  163



>sp|A6YPJ8.1|RS3A_TRIIF RecName: Full=40S ribosomal protein S3a [Triatoma infestans]
 gb|ABR27894.1| 40S ribosomal protein S3a [Triatoma infestans]
Length=262

 Score =   211 bits (536),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 115/135 (85%), Gaps = 2/135 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  346
            DWYD+KAPS+F+TR IGKTLV RTQGTKIASEGLK RVFEVSLADLQND D   ++RK R
Sbjct  29   DWYDVKAPSMFTTRQIGKTLVNRTQGTKIASEGLKGRVFEVSLADLQNDTDAERSYRKFR  88

Query  347  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKK  526
            L AEDVQ RNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDV+TTD Y LR+FCIGFT K
Sbjct  89   LIAEDVQARNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVRTTDGYLLRVFCIGFTNK  148

Query  527  RVNQQKRTCYAQSSQ  571
                Q++TCYAQ +Q
Sbjct  149  DQLSQRKTCYAQHTQ  163



>emb|CAD91420.1| ribosomal protein S3a [Crassostrea gigas]
Length=263

 Score =   211 bits (536),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 116/133 (87%), Gaps = 1/133 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            DWYD+KAPS+F  R IGKTLVTRTQGT+IAS+GLK RVFEVSLADLQNDE  +FRK +L 
Sbjct  30   DWYDVKAPSMFVVRQIGKTLVTRTQGTRIASDGLKGRVFEVSLADLQNDE-VSFRKFKLM  88

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
            AE+VQGRNVLTNF GMD T DKL S+VKKWQ++I+AHVDVKTTD Y LRMFCIGFTKK+ 
Sbjct  89   AEEVQGRNVLTNFHGMDLTRDKLCSMVKKWQTMIQAHVDVKTTDGYLLRMFCIGFTKKKQ  148

Query  533  NQQKRTCYAQSSQ  571
             Q K+TCYAQ++Q
Sbjct  149  FQVKKTCYAQTTQ  161



>gb|EYU30365.1| hypothetical protein MIMGU_mgv1a021183mg, partial [Erythranthe 
guttata]
Length=206

 Score =   209 bits (531),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +2

Query  233  VTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTT  412
            V  T  TKIASEGLKHRVFEVSLADLQ+DED AFRKIRLRAEDVQG+NVLTNFWGMDFTT
Sbjct  1    VKSTLNTKIASEGLKHRVFEVSLADLQSDEDLAFRKIRLRAEDVQGKNVLTNFWGMDFTT  60

Query  413  DKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQ  571
            DKLRSLV+KWQ+LIEAHVDVK TD+YTL++FCI FTKKR NQQKRTCYAQSSQ
Sbjct  61   DKLRSLVRKWQTLIEAHVDVKKTDSYTLKLFCIAFTKKRANQQKRTCYAQSSQ  113



>ref|XP_011155135.1| PREDICTED: 40S ribosomal protein S3a [Harpegnathos saltator]
 gb|EFN87627.1| 40S ribosomal protein S3a [Harpegnathos saltator]
Length=267

 Score =   211 bits (536),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 115/135 (85%), Gaps = 2/135 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  346
            DWYD+KAPS+F+ R +GKTLV RTQGTKIASEGLK RVFEVSLADLQ+D+D   +FRK R
Sbjct  29   DWYDVKAPSMFANRQVGKTLVNRTQGTKIASEGLKFRVFEVSLADLQSDQDAERSFRKFR  88

Query  347  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKK  526
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y LR+FCIGFT K
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLLRVFCIGFTNK  148

Query  527  RVNQQKRTCYAQSSQ  571
                 ++TCYAQ +Q
Sbjct  149  DQLSTRKTCYAQHAQ  163



>ref|XP_011142878.1| PREDICTED: 40S ribosomal protein S3a [Harpegnathos saltator]
 gb|EFN82270.1| 40S ribosomal protein S3a [Harpegnathos saltator]
Length=267

 Score =   210 bits (535),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 115/135 (85%), Gaps = 2/135 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  346
            DWYD+KAPS+F+ R +GKTLV RTQGTKIASEGLK RVFEVSLADLQ+D+D   +FRK R
Sbjct  29   DWYDVKAPSMFANRQVGKTLVNRTQGTKIASEGLKFRVFEVSLADLQSDQDAERSFRKFR  88

Query  347  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKK  526
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y LR+FCIGFT K
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLLRVFCIGFTNK  148

Query  527  RVNQQKRTCYAQSSQ  571
                 ++TCYAQ +Q
Sbjct  149  DQLSTRKTCYAQHAQ  163



>ref|XP_011159168.1| PREDICTED: 40S ribosomal protein S3a [Solenopsis invicta]
Length=267

 Score =   210 bits (535),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 115/135 (85%), Gaps = 2/135 (1%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  346
            DWYD+KAPS+F+ R +GKTLV RTQGTKIASEGLK RVFEVSLADLQ+D+D   +FRK R
Sbjct  29   DWYDVKAPSMFANRQVGKTLVNRTQGTKIASEGLKFRVFEVSLADLQSDQDAERSFRKFR  88

Query  347  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKK  526
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y LR+FCIGFT K
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLLRVFCIGFTNK  148

Query  527  RVNQQKRTCYAQSSQ  571
                 ++TCYAQ +Q
Sbjct  149  DQLSTRKTCYAQHAQ  163



>ref|XP_008478156.1| PREDICTED: 40S ribosomal protein S3a [Diaphorina citri]
Length=208

 Score =   208 bits (530),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 116/136 (85%), Gaps = 3/136 (2%)
 Frame = +2

Query  173  DWYDIKAPS-VFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKI  343
            DWYD+KAPS +F+ + +GKTLV RTQGTKIASEGLKHRVFEVSLADLQ+D+D   +FRK 
Sbjct  29   DWYDVKAPSAMFTNKQVGKTLVNRTQGTKIASEGLKHRVFEVSLADLQSDQDAERSFRKF  88

Query  344  RLRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTK  523
            RL AEDVQG NVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y LR+FCIGFT 
Sbjct  89   RLIAEDVQGHNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLLRLFCIGFTH  148

Query  524  KRVNQQKRTCYAQSSQ  571
            K    Q++TCYAQ +Q
Sbjct  149  KDQLSQRKTCYAQHNQ  164



>ref|XP_003060358.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55127.1| predicted protein [Micromonas pusilla CCMP1545]
Length=257

 Score =   210 bits (534),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  352
            +WY+IKAPS+FS + +GKTLVTR+ GTKIAS+GLK R+FEVSLADL  DED AFRK+ L+
Sbjct  28   EWYNIKAPSMFSVKQVGKTLVTRSAGTKIASDGLKGRIFEVSLADLNQDEDQAFRKMLLK  87

Query  353  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  532
             EDVQG NVLT F GMDFTTDK+RSLV+KW SLIE + DVKTTD Y LR+FCIGFTK+R+
Sbjct  88   CEDVQGTNVLTQFHGMDFTTDKIRSLVRKWFSLIECYADVKTTDGYRLRVFCIGFTKRRM  147

Query  533  NQQKRTCYAQSSQ  571
            +Q KRTCYAQS Q
Sbjct  148  DQTKRTCYAQSGQ  160



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 669314531515