BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF039P04

Length=652
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006350186.1|  PREDICTED: serine carboxypeptidase-like 18-l...    284   6e-91   
ref|XP_006350185.1|  PREDICTED: serine carboxypeptidase-like 18-l...    282   2e-89   Solanum tuberosum [potatoes]
ref|XP_009614132.1|  PREDICTED: serine carboxypeptidase-like 18 i...    281   1e-88   Nicotiana tomentosiformis
ref|XP_004248779.1|  PREDICTED: serine carboxypeptidase-like 18         280   3e-88   Solanum lycopersicum
gb|AAF64227.1|AF248647_1  glucose acyltransferase                       279   3e-88   Solanum pennellii
gb|AAD01264.1|  glucose acyltransferase                                 278   9e-88   Solanum berthaultii
ref|XP_009795830.1|  PREDICTED: serine carboxypeptidase-like 18 i...    278   2e-87   Nicotiana sylvestris
gb|AAD01263.1|  glucose acyltransferase                                 275   1e-86   Solanum berthaultii
ref|XP_006353976.1|  PREDICTED: serine carboxypeptidase-like 18-like    275   1e-86   Solanum tuberosum [potatoes]
gb|AAD01265.1|  glucose acyltransferase                                 272   2e-85   Solanum berthaultii
ref|XP_006353974.1|  PREDICTED: serine carboxypeptidase-like 18-like    268   5e-84   Solanum tuberosum [potatoes]
ref|XP_006353975.1|  PREDICTED: serine carboxypeptidase-like 18-like    268   6e-84   Solanum tuberosum [potatoes]
gb|KCW55074.1|  hypothetical protein EUGRSUZ_I01040                     267   7e-84   Eucalyptus grandis [rose gum]
ref|XP_010028344.1|  PREDICTED: serine carboxypeptidase-like 7          268   1e-83   Eucalyptus grandis [rose gum]
gb|KCW55073.1|  hypothetical protein EUGRSUZ_I01040                     267   2e-83   Eucalyptus grandis [rose gum]
ref|XP_010028339.1|  PREDICTED: serine carboxypeptidase-like 18         266   5e-83   Eucalyptus grandis [rose gum]
ref|XP_010030617.1|  PREDICTED: serine carboxypeptidase-like 18         265   9e-83   
gb|KCW55058.1|  hypothetical protein EUGRSUZ_I01033                     263   1e-82   Eucalyptus grandis [rose gum]
ref|XP_010028343.1|  PREDICTED: serine carboxypeptidase-like 18 i...    264   1e-82   Eucalyptus grandis [rose gum]
ref|XP_010040883.1|  PREDICTED: serine carboxypeptidase-like 18         263   2e-82   
ref|XP_004248778.1|  PREDICTED: serine carboxypeptidase-like 18         264   3e-82   Solanum lycopersicum
ref|XP_010028341.1|  PREDICTED: serine carboxypeptidase-like 18 i...    263   7e-82   Eucalyptus grandis [rose gum]
ref|XP_010028346.1|  PREDICTED: serine carboxypeptidase-like 18         262   2e-81   Eucalyptus grandis [rose gum]
ref|XP_010028342.1|  PREDICTED: serine carboxypeptidase-like 18 i...    261   2e-81   
ref|XP_010028345.1|  PREDICTED: serine carboxypeptidase-like 18         261   2e-81   Eucalyptus grandis [rose gum]
ref|XP_007201135.1|  hypothetical protein PRUPE_ppa016992mg             258   5e-80   
ref|XP_008236294.1|  PREDICTED: serine carboxypeptidase-like 14         255   6e-79   Prunus mume [ume]
ref|XP_008236346.1|  PREDICTED: serine carboxypeptidase-like 18         253   2e-78   
ref|XP_011030311.1|  PREDICTED: serine carboxypeptidase-like 18 i...    253   2e-78   Populus euphratica
ref|XP_011030309.1|  PREDICTED: serine carboxypeptidase-like 18 i...    253   3e-78   Populus euphratica
ref|XP_010647903.1|  PREDICTED: serine carboxypeptidase-like 13         254   3e-78   Vitis vinifera
ref|XP_009343183.1|  PREDICTED: serine carboxypeptidase-like 18 i...    251   4e-78   
ref|XP_011030308.1|  PREDICTED: serine carboxypeptidase-like 18 i...    252   7e-78   Populus euphratica
ref|XP_007200784.1|  hypothetical protein PRUPE_ppa024053mg             252   9e-78   
ref|XP_011030310.1|  PREDICTED: serine carboxypeptidase-like 18 i...    253   1e-77   Populus euphratica
ref|XP_011030307.1|  PREDICTED: serine carboxypeptidase-like 18 i...    253   1e-77   Populus euphratica
ref|XP_006486896.1|  PREDICTED: serine carboxypeptidase-like 18-like    252   1e-77   Citrus sinensis [apfelsine]
emb|CBI22421.3|  unnamed protein product                                255   1e-77   Vitis vinifera
ref|XP_006422777.1|  hypothetical protein CICLE_v10028360mg             252   1e-77   Citrus clementina [clementine]
ref|XP_009343180.1|  PREDICTED: serine carboxypeptidase-like 1          252   2e-77   Pyrus x bretschneideri [bai li]
ref|XP_011457834.1|  PREDICTED: serine carboxypeptidase-like 18         251   2e-77   Fragaria vesca subsp. vesca
ref|XP_009343914.1|  PREDICTED: serine carboxypeptidase-like 7          251   3e-77   Pyrus x bretschneideri [bai li]
ref|XP_009375674.1|  PREDICTED: serine carboxypeptidase-like 7          251   3e-77   Pyrus x bretschneideri [bai li]
ref|XP_009343181.1|  PREDICTED: serine carboxypeptidase-like 1 is...    251   4e-77   
ref|XP_006486895.1|  PREDICTED: serine carboxypeptidase-like 18-like    251   7e-77   Citrus sinensis [apfelsine]
ref|XP_002522133.1|  serine carboxypeptidase, putative                  250   1e-76   Ricinus communis
ref|XP_009614133.1|  PREDICTED: serine carboxypeptidase-like 18 i...    249   1e-76   Nicotiana tomentosiformis
ref|XP_006369725.1|  hypothetical protein POPTR_0001s29900g             249   2e-76   
emb|CBI22419.3|  unnamed protein product                                248   3e-76   Vitis vinifera
gb|KDP44532.1|  hypothetical protein JCGZ_16365                         248   3e-76   Jatropha curcas
ref|XP_002269439.1|  PREDICTED: serine carboxypeptidase-like 7          249   4e-76   Vitis vinifera
ref|XP_006369726.1|  hypothetical protein POPTR_0001s29910g             244   5e-76   
ref|XP_002298786.2|  hypothetical protein POPTR_0001s29870g             248   7e-76   
ref|XP_010065873.1|  PREDICTED: serine carboxypeptidase-like 2          247   1e-75   Eucalyptus grandis [rose gum]
ref|XP_006422780.1|  hypothetical protein CICLE_v10028349mg             246   3e-75   Citrus clementina [clementine]
ref|XP_002534183.1|  serine carboxypeptidase, putative                  242   3e-75   
ref|XP_008236293.1|  PREDICTED: serine carboxypeptidase-like 18 i...    245   3e-75   
ref|XP_006486897.1|  PREDICTED: serine carboxypeptidase-like 17-like    246   3e-75   Citrus sinensis [apfelsine]
gb|KCW63574.1|  hypothetical protein EUGRSUZ_G01198                     245   3e-75   Eucalyptus grandis [rose gum]
ref|XP_002522135.1|  serine carboxypeptidase, putative                  246   5e-75   
gb|KCW63573.1|  hypothetical protein EUGRSUZ_G01198                     244   5e-75   Eucalyptus grandis [rose gum]
ref|XP_010065870.1|  PREDICTED: serine carboxypeptidase-like 13 i...    244   5e-75   
gb|KCW63571.1|  hypothetical protein EUGRSUZ_G01198                     245   6e-75   Eucalyptus grandis [rose gum]
gb|KCW63578.1|  hypothetical protein EUGRSUZ_G01202                     244   7e-75   Eucalyptus grandis [rose gum]
ref|XP_010065869.1|  PREDICTED: serine carboxypeptidase-like 2 is...    245   8e-75   Eucalyptus grandis [rose gum]
ref|XP_002266354.2|  PREDICTED: serine carboxypeptidase-like 18         245   8e-75   Vitis vinifera
ref|XP_008236292.1|  PREDICTED: serine carboxypeptidase-like 13 i...    245   9e-75   Prunus mume [ume]
ref|XP_008236291.1|  PREDICTED: serine carboxypeptidase-like 13 i...    245   1e-74   
ref|XP_008236287.1|  PREDICTED: serine carboxypeptidase-like 13         245   1e-74   Prunus mume [ume]
emb|CBI22420.3|  unnamed protein product                                245   1e-74   Vitis vinifera
ref|XP_011088733.1|  PREDICTED: serine carboxypeptidase-like 7          244   2e-74   Sesamum indicum [beniseed]
gb|KCW63570.1|  hypothetical protein EUGRSUZ_G01197                     242   4e-74   Eucalyptus grandis [rose gum]
ref|XP_011069858.1|  PREDICTED: serine carboxypeptidase-like 18         243   6e-74   Sesamum indicum [beniseed]
gb|KCW63569.1|  hypothetical protein EUGRSUZ_G01197                     242   9e-74   Eucalyptus grandis [rose gum]
ref|XP_007199854.1|  hypothetical protein PRUPE_ppa005665mg             242   9e-74   
ref|XP_010065871.1|  PREDICTED: serine carboxypeptidase-like 2 is...    242   9e-74   
gb|KDP44531.1|  hypothetical protein JCGZ_16364                         244   9e-74   Jatropha curcas
gb|KCW63576.1|  hypothetical protein EUGRSUZ_G01200                     241   2e-73   Eucalyptus grandis [rose gum]
ref|XP_007199818.1|  hypothetical protein PRUPE_ppa005264mg             241   2e-73   
ref|XP_011100014.1|  PREDICTED: serine carboxypeptidase-like 18 i...    240   2e-73   
ref|XP_007201000.1|  hypothetical protein PRUPE_ppa005249mg             240   2e-73   
ref|XP_006422770.1|  hypothetical protein CICLE_v10028371mg             241   3e-73   Citrus clementina [clementine]
ref|XP_007199819.1|  hypothetical protein PRUPE_ppa005264mg             241   4e-73   
ref|XP_010065864.1|  PREDICTED: serine carboxypeptidase-like 2 is...    241   4e-73   Eucalyptus grandis [rose gum]
ref|XP_008236347.1|  PREDICTED: serine carboxypeptidase-like 13         242   4e-73   
ref|XP_010028338.1|  PREDICTED: serine carboxypeptidase-like 13         241   4e-73   Eucalyptus grandis [rose gum]
ref|XP_010065865.1|  PREDICTED: serine carboxypeptidase-like 2 is...    240   4e-73   Eucalyptus grandis [rose gum]
ref|XP_011070163.1|  PREDICTED: serine carboxypeptidase-like 18         241   5e-73   Sesamum indicum [beniseed]
ref|XP_007201001.1|  hypothetical protein PRUPE_ppa005249mg             240   6e-73   
ref|XP_011100016.1|  PREDICTED: serine carboxypeptidase-like 18 i...    238   7e-73   Sesamum indicum [beniseed]
ref|XP_011100013.1|  PREDICTED: serine carboxypeptidase-like 13 i...    240   7e-73   
ref|XP_011069856.1|  PREDICTED: serine carboxypeptidase-like 18 i...    240   8e-73   Sesamum indicum [beniseed]
ref|XP_011100017.1|  PREDICTED: serine carboxypeptidase-like 13         239   8e-73   Sesamum indicum [beniseed]
gb|KCW63567.1|  hypothetical protein EUGRSUZ_G01195                     239   8e-73   Eucalyptus grandis [rose gum]
gb|KDP32094.1|  hypothetical protein JCGZ_12555                         239   1e-72   Jatropha curcas
ref|XP_011069855.1|  PREDICTED: serine carboxypeptidase-like 18 i...    240   1e-72   Sesamum indicum [beniseed]
ref|XP_008236275.1|  PREDICTED: serine carboxypeptidase-like 17 i...    238   2e-72   Prunus mume [ume]
ref|XP_010065872.1|  PREDICTED: serine carboxypeptidase-like 2          239   2e-72   
ref|XP_008236286.1|  PREDICTED: serine carboxypeptidase-like 2 is...    238   3e-72   Prunus mume [ume]
ref|XP_008236285.1|  PREDICTED: serine carboxypeptidase-like 2 is...    238   3e-72   Prunus mume [ume]
ref|XP_011100015.1|  PREDICTED: serine carboxypeptidase-like 7 is...    238   3e-72   Sesamum indicum [beniseed]
ref|XP_007201024.1|  hypothetical protein PRUPE_ppa006101mg             236   6e-72   
ref|XP_002265842.1|  PREDICTED: serine carboxypeptidase-like 18         238   9e-72   Vitis vinifera
ref|XP_007200276.1|  hypothetical protein PRUPE_ppa014806mg             234   1e-71   
ref|XP_010046973.1|  PREDICTED: serine carboxypeptidase-like 18         237   1e-71   Eucalyptus grandis [rose gum]
emb|CBI22424.3|  unnamed protein product                                238   1e-71   Vitis vinifera
ref|XP_010065879.1|  PREDICTED: serine carboxypeptidase-like 13         236   2e-71   Eucalyptus grandis [rose gum]
ref|XP_006345611.1|  PREDICTED: serine carboxypeptidase-like 19-like    234   2e-71   
gb|KDP35358.1|  hypothetical protein JCGZ_10342                         236   2e-71   Jatropha curcas
ref|XP_007201023.1|  hypothetical protein PRUPE_ppa005420mg             235   4e-71   Prunus persica
ref|XP_002283413.1|  PREDICTED: serine carboxypeptidase-like 2          235   6e-71   Vitis vinifera
ref|XP_008236344.1|  PREDICTED: serine carboxypeptidase-like 13         236   6e-71   
ref|XP_010094886.1|  Serine carboxypeptidase-like 18                    234   6e-71   
emb|CBI19380.3|  unnamed protein product                                236   7e-71   Vitis vinifera
emb|CAN74923.1|  hypothetical protein VITISV_038590                     235   8e-71   Vitis vinifera
ref|XP_008236280.1|  PREDICTED: serine carboxypeptidase-like 17 i...    234   1e-70   Prunus mume [ume]
ref|XP_008236281.1|  PREDICTED: serine carboxypeptidase-like 17 i...    234   2e-70   Prunus mume [ume]
gb|EYU37561.1|  hypothetical protein MIMGU_mgv1a005963mg                233   2e-70   Erythranthe guttata [common monkey flower]
ref|XP_002522137.1|  serine carboxypeptidase, putative                  233   3e-70   
ref|XP_011458874.1|  PREDICTED: serine carboxypeptidase-like 18 i...    232   5e-70   Fragaria vesca subsp. vesca
gb|EYU37560.1|  hypothetical protein MIMGU_mgv1a005845mg                232   6e-70   Erythranthe guttata [common monkey flower]
ref|XP_004292764.2|  PREDICTED: serine carboxypeptidase-like 7 is...    232   7e-70   Fragaria vesca subsp. vesca
ref|XP_006345532.1|  PREDICTED: serine carboxypeptidase-like 18-l...    228   1e-69   
ref|XP_010692123.1|  PREDICTED: serine carboxypeptidase-like 13         231   2e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006345531.1|  PREDICTED: serine carboxypeptidase-like 18-l...    228   2e-69   Solanum tuberosum [potatoes]
ref|XP_004296446.1|  PREDICTED: serine carboxypeptidase-like 18         231   3e-69   Fragaria vesca subsp. vesca
ref|XP_010682454.1|  PREDICTED: serine carboxypeptidase-like 18 i...    230   3e-69   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO81469.1|  hypothetical protein CISIN_1g012276mg                   227   4e-69   Citrus sinensis [apfelsine]
dbj|BAF56655.1|  serine carboxypeptitase-like protein 1                 229   5e-69   Diospyros kaki [Japanese persimmon]
dbj|BAF99696.1|  1-O-acylglucose:anthocyanin-O-acyltransferase- l...    230   6e-69   Gentiana triflora
gb|KDP44530.1|  hypothetical protein JCGZ_16363                         229   8e-69   Jatropha curcas
ref|XP_010321497.1|  PREDICTED: serine carboxypeptidase-like 12         229   1e-68   Solanum lycopersicum
ref|XP_004306039.2|  PREDICTED: serine carboxypeptidase-like 16 i...    223   1e-68   Fragaria vesca subsp. vesca
ref|XP_008236498.1|  PREDICTED: serine carboxypeptidase-like 18         222   1e-68   
ref|XP_011457835.1|  PREDICTED: serine carboxypeptidase-like 7          229   1e-68   Fragaria vesca subsp. vesca
emb|CDP20368.1|  unnamed protein product                                227   3e-68   Coffea canephora [robusta coffee]
ref|XP_008236290.1|  PREDICTED: serine carboxypeptidase-like 17 i...    228   3e-68   Prunus mume [ume]
ref|XP_006472320.1|  PREDICTED: serine carboxypeptidase-like 18-l...    228   4e-68   
ref|XP_002525293.1|  serine carboxypeptidase, putative                  231   4e-68   
ref|XP_010694002.1|  PREDICTED: serine carboxypeptidase-like 10 i...    223   1e-67   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO81468.1|  hypothetical protein CISIN_1g012276mg                   226   2e-67   Citrus sinensis [apfelsine]
ref|XP_009771130.1|  PREDICTED: serine carboxypeptidase-like 13 i...    224   2e-67   Nicotiana sylvestris
ref|XP_006433655.1|  hypothetical protein CICLE_v10001060mg             226   2e-67   Citrus clementina [clementine]
gb|KEH33547.1|  serine carboxypeptidase-like protein                    225   3e-67   Medicago truncatula
ref|XP_003556796.2|  PREDICTED: serine carboxypeptidase-like 17-l...    222   4e-67   
ref|XP_008385684.1|  PREDICTED: uncharacterized protein LOC103448207    225   4e-67   
gb|EPS73196.1|  hypothetical protein M569_01551                         224   5e-67   Genlisea aurea
ref|XP_011466208.1|  PREDICTED: serine carboxypeptidase-like 18 i...    224   5e-67   Fragaria vesca subsp. vesca
ref|XP_009771129.1|  PREDICTED: serine carboxypeptidase-like 13 i...    224   6e-67   Nicotiana sylvestris
ref|XP_010656845.1|  PREDICTED: serine carboxypeptidase-like 13         224   6e-67   Vitis vinifera
gb|KCW80986.1|  hypothetical protein EUGRSUZ_C02352                     225   8e-67   Eucalyptus grandis [rose gum]
ref|XP_009626153.1|  PREDICTED: serine carboxypeptidase-like 13         224   8e-67   Nicotiana tomentosiformis
ref|XP_010277006.1|  PREDICTED: serine carboxypeptidase-like 1 is...    224   9e-67   Nelumbo nucifera [Indian lotus]
ref|XP_010694001.1|  PREDICTED: serine carboxypeptidase-like 10 i...    223   1e-66   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009771128.1|  PREDICTED: serine carboxypeptidase-like 13 i...    224   1e-66   Nicotiana sylvestris
emb|CBI17847.3|  unnamed protein product                                225   1e-66   Vitis vinifera
ref|XP_010048652.1|  PREDICTED: serine carboxypeptidase-like 18         224   2e-66   Eucalyptus grandis [rose gum]
ref|XP_004289672.1|  PREDICTED: serine carboxypeptidase-like 13         223   2e-66   Fragaria vesca subsp. vesca
ref|XP_010314600.1|  PREDICTED: serine carboxypeptidase-like 11         223   2e-66   
gb|KDP35359.1|  hypothetical protein JCGZ_10343                         216   2e-66   Jatropha curcas
ref|NP_174619.1|  serine carboxypeptidase-like 18                       222   2e-66   
sp|Q9C7Z9.2|SCP18_ARATH  RecName: Full=Serine carboxypeptidase-li...    223   2e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002510077.1|  serine carboxypeptidase, putative                  223   3e-66   Ricinus communis
ref|XP_010321496.1|  PREDICTED: serine carboxypeptidase-like 13 i...    222   4e-66   Solanum lycopersicum
ref|XP_004288266.1|  PREDICTED: serine carboxypeptidase-like 2 is...    223   4e-66   Fragaria vesca subsp. vesca
ref|XP_011466202.1|  PREDICTED: serine carboxypeptidase-like 2 is...    224   5e-66   Fragaria vesca subsp. vesca
ref|XP_009343188.1|  PREDICTED: serine carboxypeptidase-like 18         221   6e-66   
ref|XP_010046975.1|  PREDICTED: serine carboxypeptidase-like 17         223   6e-66   Eucalyptus grandis [rose gum]
ref|XP_006415270.1|  hypothetical protein EUTSA_v10009366mg             221   7e-66   
gb|KJB58678.1|  hypothetical protein B456_009G221000                    219   8e-66   Gossypium raimondii
gb|KDP41601.1|  hypothetical protein JCGZ_16008                         222   9e-66   Jatropha curcas
ref|XP_006433653.1|  hypothetical protein CICLE_v10001059mg             221   9e-66   Citrus clementina [clementine]
ref|XP_009761854.1|  PREDICTED: serine carboxypeptidase-like 18         220   1e-65   Nicotiana sylvestris
ref|XP_003633199.2|  PREDICTED: serine carboxypeptidase-like 13 i...    221   1e-65   Vitis vinifera
ref|XP_004289772.1|  PREDICTED: serine carboxypeptidase-like 18         221   1e-65   Fragaria vesca subsp. vesca
ref|XP_006415268.1|  hypothetical protein EUTSA_v10007570mg             221   2e-65   Eutrema salsugineum [saltwater cress]
gb|KCW55082.1|  hypothetical protein EUGRSUZ_I01044                     219   2e-65   Eucalyptus grandis [rose gum]
ref|XP_010321495.1|  PREDICTED: serine carboxypeptidase-like 13 i...    220   3e-65   
ref|XP_002268517.1|  PREDICTED: serine carboxypeptidase-like 17         220   3e-65   Vitis vinifera
ref|XP_007018461.1|  Serine carboxypeptidase-like 7, putative           220   3e-65   
ref|XP_008338878.1|  PREDICTED: serine carboxypeptidase-like 1          220   3e-65   
gb|KDO81474.1|  hypothetical protein CISIN_1g012236mg                   220   3e-65   Citrus sinensis [apfelsine]
ref|XP_009600999.1|  PREDICTED: serine carboxypeptidase-like 7 is...    220   3e-65   Nicotiana tomentosiformis
ref|XP_004513965.1|  PREDICTED: serine carboxypeptidase-like 18-l...    218   4e-65   
ref|XP_009601001.1|  PREDICTED: serine carboxypeptidase-like 7 is...    219   4e-65   Nicotiana tomentosiformis
gb|KJB58677.1|  hypothetical protein B456_009G221000                    219   4e-65   Gossypium raimondii
ref|XP_010694008.1|  PREDICTED: serine carboxypeptidase-like 7 is...    218   4e-65   
gb|KCW68631.1|  hypothetical protein EUGRSUZ_F02236                     219   4e-65   Eucalyptus grandis [rose gum]
gb|KDO81473.1|  hypothetical protein CISIN_1g012205mg                   217   5e-65   Citrus sinensis [apfelsine]
ref|XP_011006039.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    215   5e-65   Populus euphratica
ref|XP_010048542.1|  PREDICTED: serine carboxypeptidase-like 13         219   5e-65   Eucalyptus grandis [rose gum]
emb|CDP17658.1|  unnamed protein product                                219   6e-65   Coffea canephora [robusta coffee]
ref|XP_003593859.1|  Serine carboxypeptidase-like protein               219   6e-65   Medicago truncatula
ref|XP_010040884.1|  PREDICTED: serine carboxypeptidase-like 18         219   7e-65   
ref|XP_010061646.1|  PREDICTED: serine carboxypeptidase-like 2          219   8e-65   Eucalyptus grandis [rose gum]
ref|XP_006594522.1|  PREDICTED: serine carboxypeptidase-like 12-like    219   9e-65   Glycine max [soybeans]
ref|XP_010028347.1|  PREDICTED: serine carboxypeptidase-like 18         219   1e-64   Eucalyptus grandis [rose gum]
ref|XP_010694004.1|  PREDICTED: serine carboxypeptidase-like 7 is...    218   1e-64   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB73513.1|  hypothetical protein B456_011G236800                    215   1e-64   Gossypium raimondii
emb|CBI17848.3|  unnamed protein product                                221   1e-64   Vitis vinifera
ref|XP_006840207.1|  hypothetical protein AMTR_s00089p00129670          214   2e-64   
ref|XP_010694003.1|  PREDICTED: serine carboxypeptidase-like 7 is...    218   2e-64   
ref|XP_004163543.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    218   2e-64   
gb|KHG24307.1|  Serine carboxypeptidase-like 18                         218   2e-64   Gossypium arboreum [tree cotton]
emb|CDP06920.1|  unnamed protein product                                213   2e-64   Coffea canephora [robusta coffee]
ref|XP_010936153.1|  PREDICTED: serine carboxypeptidase-like 18 i...    217   2e-64   
gb|KDP41600.1|  hypothetical protein JCGZ_16007                         218   2e-64   Jatropha curcas
gb|KDO81472.1|  hypothetical protein CISIN_1g012205mg                   216   2e-64   Citrus sinensis [apfelsine]
ref|XP_004513964.1|  PREDICTED: serine carboxypeptidase-like 18-l...    218   3e-64   Cicer arietinum [garbanzo]
ref|XP_009114926.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    218   3e-64   Brassica rapa
ref|XP_007047573.1|  Serine carboxypeptidase-like 2, putative iso...    218   3e-64   
emb|CDP18838.1|  unnamed protein product                                216   3e-64   Coffea canephora [robusta coffee]
ref|XP_010936152.1|  PREDICTED: serine carboxypeptidase-like 18 i...    217   3e-64   
ref|XP_006415267.1|  hypothetical protein EUTSA_v10007571mg             217   3e-64   Eutrema salsugineum [saltwater cress]
ref|XP_009784016.1|  PREDICTED: serine carboxypeptidase-like 11 i...    218   3e-64   Nicotiana sylvestris
gb|KDO81471.1|  hypothetical protein CISIN_1g012205mg                   217   4e-64   Citrus sinensis [apfelsine]
ref|XP_009612197.1|  PREDICTED: serine carboxypeptidase-like 11 i...    217   4e-64   Nicotiana tomentosiformis
ref|XP_007159376.1|  hypothetical protein PHAVU_002G233100g             217   5e-64   Phaseolus vulgaris [French bean]
ref|XP_010694006.1|  PREDICTED: serine carboxypeptidase-like 7 is...    216   5e-64   
ref|XP_006433654.1|  hypothetical protein CICLE_v10001055mg             217   5e-64   Citrus clementina [clementine]
ref|XP_010694000.1|  PREDICTED: serine carboxypeptidase-like 7          216   5e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010936150.1|  PREDICTED: serine carboxypeptidase-like 18 i...    217   6e-64   
ref|XP_011006024.1|  PREDICTED: serine carboxypeptidase-like 3 is...    216   6e-64   Populus euphratica
ref|XP_010555479.1|  PREDICTED: serine carboxypeptidase-like 7          216   7e-64   Tarenaya hassleriana [spider flower]
ref|XP_010461188.1|  PREDICTED: serine carboxypeptidase-like 18         216   8e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010320198.1|  PREDICTED: serine carboxypeptidase-like 17         216   9e-64   
gb|KJB73514.1|  hypothetical protein B456_011G236800                    215   9e-64   Gossypium raimondii
ref|XP_006472317.1|  PREDICTED: serine carboxypeptidase-like 18-l...    216   1e-63   
ref|XP_010694009.1|  PREDICTED: serine carboxypeptidase-like 7          216   1e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011006023.1|  PREDICTED: serine carboxypeptidase-like 3 is...    216   1e-63   Populus euphratica
ref|XP_010314652.1|  PREDICTED: serine carboxypeptidase-like 11         220   1e-63   
gb|KDP44534.1|  hypothetical protein JCGZ_16367                         216   1e-63   Jatropha curcas
ref|XP_006472315.1|  PREDICTED: serine carboxypeptidase-like 18-l...    216   1e-63   Citrus sinensis [apfelsine]
gb|KJB48748.1|  hypothetical protein B456_008G084200                    215   1e-63   Gossypium raimondii
gb|KJB48749.1|  hypothetical protein B456_008G084200                    215   2e-63   Gossypium raimondii
ref|XP_003593858.1|  Serine carboxypeptidase-like protein               215   2e-63   Medicago truncatula
ref|XP_008790305.1|  PREDICTED: serine carboxypeptidase-like 18         222   2e-63   
ref|XP_006472316.1|  PREDICTED: serine carboxypeptidase-like 18-l...    215   2e-63   Citrus sinensis [apfelsine]
gb|KJB73512.1|  hypothetical protein B456_011G236800                    215   2e-63   Gossypium raimondii
gb|KFK44962.1|  hypothetical protein AALP_AA1G326200                    215   2e-63   Arabis alpina [alpine rockcress]
emb|CDP21040.1|  unnamed protein product                                215   3e-63   Coffea canephora [robusta coffee]
ref|XP_007018464.1|  Serine carboxypeptidase-like 2, putative           213   4e-63   
ref|XP_008237699.1|  PREDICTED: serine carboxypeptidase-like 2          214   4e-63   Prunus mume [ume]
ref|XP_004163541.1|  PREDICTED: serine carboxypeptidase-like 19-like    214   4e-63   
ref|XP_006415266.1|  hypothetical protein EUTSA_v10007559mg             214   5e-63   Eutrema salsugineum [saltwater cress]
emb|CBI24085.3|  unnamed protein product                                214   5e-63   Vitis vinifera
ref|XP_007138067.1|  hypothetical protein PHAVU_009G177800g             215   5e-63   Phaseolus vulgaris [French bean]
ref|XP_010656846.1|  PREDICTED: serine carboxypeptidase-like 13 i...    214   5e-63   Vitis vinifera
ref|XP_003593861.1|  Serine carboxypeptidase family protein             214   5e-63   Medicago truncatula
ref|XP_008452662.1|  PREDICTED: serine carboxypeptidase-like 13         214   5e-63   Cucumis melo [Oriental melon]
ref|XP_002265154.3|  PREDICTED: serine carboxypeptidase-like 13         214   6e-63   Vitis vinifera
ref|XP_006376417.1|  serine carboxypeptidase S10 family protein         213   6e-63   
ref|XP_006472322.1|  PREDICTED: serine carboxypeptidase-like 18-like    214   8e-63   Citrus sinensis [apfelsine]
ref|XP_010936155.1|  PREDICTED: serine carboxypeptidase-like 18         214   9e-63   Elaeis guineensis
ref|XP_004238067.1|  PREDICTED: uncharacterized protein LOC101252078    220   1e-62   Solanum lycopersicum
ref|XP_010556471.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    213   1e-62   
ref|XP_006356866.1|  PREDICTED: uncharacterized protein LOC102592829    220   1e-62   
emb|CDP06925.1|  unnamed protein product                                213   1e-62   Coffea canephora [robusta coffee]
gb|KDP44547.1|  hypothetical protein JCGZ_16380                         213   2e-62   Jatropha curcas
gb|KJB73511.1|  hypothetical protein B456_011G236800                    213   2e-62   Gossypium raimondii
ref|XP_006342727.1|  PREDICTED: uncharacterized protein LOC102585123    219   2e-62   
ref|XP_010556480.1|  PREDICTED: serine carboxypeptidase-like 1          212   2e-62   Tarenaya hassleriana [spider flower]
ref|XP_010320337.1|  PREDICTED: serine carboxypeptidase-like 13 i...    213   2e-62   Solanum lycopersicum
ref|XP_006369794.1|  hypothetical protein POPTR_0001s31980g             213   2e-62   Populus trichocarpa [western balsam poplar]
ref|XP_006356850.1|  PREDICTED: serine carboxypeptidase-like 18-like    213   2e-62   Solanum tuberosum [potatoes]
dbj|BAF99694.1|  1-O-acylglucose:anthocyanin-O-acyltransferase          213   2e-62   Clitoria ternatea
gb|KCW63486.1|  hypothetical protein EUGRSUZ_G01118                     211   3e-62   Eucalyptus grandis [rose gum]
ref|XP_008790306.1|  PREDICTED: uncharacterized protein LOC103707552    219   3e-62   
ref|XP_002300184.2|  hypothetical protein POPTR_0001s31980g             212   3e-62   
ref|XP_006855958.1|  hypothetical protein AMTR_s00037p00227730          213   3e-62   
ref|XP_010068327.1|  PREDICTED: serine carboxypeptidase-like 18         212   4e-62   Eucalyptus grandis [rose gum]
ref|XP_002522136.1|  serine carboxypeptidase, putative                  210   5e-62   
dbj|BAF99699.1|  1-O-acylglucose:anthocyanin-O-acyltransferase- l...    212   6e-62   Lobelia erinus
ref|XP_006303239.1|  hypothetical protein CARUB_v10012575mg             211   7e-62   
ref|XP_010527656.1|  PREDICTED: serine carboxypeptidase-like 2          211   7e-62   Tarenaya hassleriana [spider flower]
emb|CDY59210.1|  BnaA09g54030D                                          211   8e-62   Brassica napus [oilseed rape]
ref|XP_002266615.3|  PREDICTED: serine carboxypeptidase-like 17         211   9e-62   Vitis vinifera
ref|XP_006343161.1|  PREDICTED: serine carboxypeptidase-like 18-l...    211   9e-62   
ref|XP_007146212.1|  hypothetical protein PHAVU_006G021700g             211   9e-62   Phaseolus vulgaris [French bean]
ref|XP_011003871.1|  PREDICTED: serine carboxypeptidase-like 18 i...    211   1e-61   
ref|XP_009764359.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    211   1e-61   
ref|XP_006343160.1|  PREDICTED: serine carboxypeptidase-like 18-l...    211   1e-61   
ref|XP_011045684.1|  PREDICTED: serine carboxypeptidase-like 18 i...    211   1e-61   
ref|XP_009120840.1|  PREDICTED: serine carboxypeptidase-like 15         209   1e-61   
ref|XP_010108032.1|  Serine carboxypeptidase-like 7                     215   2e-61   
emb|CDP08178.1|  unnamed protein product                                211   2e-61   
ref|XP_006403279.1|  hypothetical protein EUTSA_v10003211mg             207   2e-61   
ref|XP_008777952.1|  PREDICTED: serine carboxypeptidase-like 18 i...    202   2e-61   
ref|XP_010499905.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    210   2e-61   
ref|XP_009115052.1|  PREDICTED: serine carboxypeptidase-like 14         209   2e-61   
ref|XP_008452664.1|  PREDICTED: serine carboxypeptidase-like 2          210   3e-61   
dbj|BAF99695.1|  1-O-acylglucose:anthocyanin-O-acyltransferase          209   3e-61   
ref|XP_006342726.1|  PREDICTED: serine carboxypeptidase-like 11-like    209   3e-61   
emb|CDP06922.1|  unnamed protein product                                206   4e-61   
gb|KCW54736.1|  hypothetical protein EUGRSUZ_I00690                     209   4e-61   
ref|XP_009382032.1|  PREDICTED: serine carboxypeptidase-like 7          209   6e-61   
ref|XP_006403280.1|  hypothetical protein EUTSA_v10003211mg             207   6e-61   
ref|XP_003593232.1|  Serine carboxypeptidase-like protein               208   7e-61   
ref|XP_010939018.1|  PREDICTED: serine carboxypeptidase-like 18 i...    206   7e-61   
ref|XP_010106920.1|  Serine carboxypeptidase-like 18                    209   7e-61   
ref|XP_008452663.1|  PREDICTED: serine carboxypeptidase-like 13         208   8e-61   
dbj|BAO04183.1|  putative acyl-glucose-dependent anthocyanin acyl...    208   9e-61   
ref|XP_006404766.1|  hypothetical protein EUTSA_v10000651mg             207   9e-61   
ref|XP_006401830.1|  hypothetical protein EUTSA_v10015511mg             207   1e-60   
dbj|BAF99698.1|  1-O-acylglucose:anthocyanin-O-acyltransferase- l...    208   1e-60   
ref|XP_010694007.1|  PREDICTED: serine carboxypeptidase-like 7 is...    207   1e-60   
gb|ABR16352.1|  unknown                                                 209   1e-60   
ref|XP_006403281.1|  hypothetical protein EUTSA_v10003211mg             207   1e-60   
ref|XP_010936154.1|  PREDICTED: serine carboxypeptidase-like 18         209   1e-60   
emb|CDY02322.1|  BnaA09g25800D                                          207   1e-60   
ref|XP_002522112.1|  serine carboxypeptidase, putative                  208   1e-60   
ref|XP_010556477.1|  PREDICTED: serine carboxypeptidase-like 18         207   1e-60   
emb|CDY22581.1|  BnaC05g24190D                                          207   1e-60   
ref|XP_011003870.1|  PREDICTED: serine carboxypeptidase-like 18 i...    208   2e-60   
gb|KDP40909.1|  hypothetical protein JCGZ_24908                         208   2e-60   
ref|XP_011045683.1|  PREDICTED: serine carboxypeptidase-like 18 i...    207   2e-60   
emb|CDY09545.1|  BnaC05g23740D                                          207   2e-60   
ref|XP_008777951.1|  PREDICTED: serine carboxypeptidase-like 18 i...    201   2e-60   
ref|XP_002266867.3|  PREDICTED: serine carboxypeptidase-like 17         207   2e-60   
emb|CAN67390.1|  hypothetical protein VITISV_034715                     207   2e-60   
emb|CDP01267.1|  unnamed protein product                                207   3e-60   
ref|XP_006597032.1|  PREDICTED: uncharacterized protein LOC100794...    207   3e-60   
emb|CAN82418.1|  hypothetical protein VITISV_044003                     207   3e-60   
gb|KCW63482.1|  hypothetical protein EUGRSUZ_G01114                     206   3e-60   
emb|CDP01265.1|  unnamed protein product                                207   3e-60   
ref|XP_004238557.1|  PREDICTED: uncharacterized protein LOC101252581    213   3e-60   
ref|XP_009135216.1|  PREDICTED: serine carboxypeptidase-like 15         206   3e-60   
gb|KHN45449.1|  Serine carboxypeptidase-like 11                         206   4e-60   
ref|XP_010939014.1|  PREDICTED: serine carboxypeptidase-like 17 i...    206   4e-60   
ref|NP_198467.2|  serine carboxypeptidase-like 1                        206   4e-60   
emb|CAN78674.1|  hypothetical protein VITISV_009248                     206   4e-60   
ref|XP_010486652.1|  PREDICTED: serine carboxypeptidase-like 7 is...    206   4e-60   
ref|XP_010939015.1|  PREDICTED: serine carboxypeptidase-like 18 i...    206   4e-60   
ref|NP_001242803.1|  uncharacterized protein LOC100794342               207   4e-60   
emb|CDY53115.1|  BnaCnng24430D                                          206   5e-60   
ref|XP_008790304.1|  PREDICTED: uncharacterized protein LOC103707550    213   5e-60   
ref|XP_010939013.1|  PREDICTED: serine carboxypeptidase-like 18 i...    206   5e-60   
ref|XP_003520964.1|  PREDICTED: serine carboxypeptidase-like 11-like    206   6e-60   
ref|XP_009139974.1|  PREDICTED: serine carboxypeptidase-like 13 i...    204   6e-60   
emb|CDX73832.1|  BnaA03g32150D                                          205   6e-60   
ref|XP_009384628.1|  PREDICTED: serine carboxypeptidase-like 18         206   6e-60   
ref|XP_010939012.1|  PREDICTED: serine carboxypeptidase-like 17 i...    206   7e-60   
ref|XP_009395245.1|  PREDICTED: serine carboxypeptidase-like 12         206   8e-60   
ref|XP_004252000.2|  PREDICTED: serine carboxypeptidase-like 7          206   8e-60   
ref|XP_003604930.1|  Serine carboxypeptidase family protein             212   8e-60   
ref|XP_010065819.1|  PREDICTED: serine carboxypeptidase-like 18         206   8e-60   
dbj|BAF99697.1|  1-O-acylglucose:anthocyanin-O-acyltransferase- l...    206   8e-60   
ref|XP_010106919.1|  Serine carboxypeptidase-like 18                    206   9e-60   
ref|XP_003633198.1|  PREDICTED: serine carboxypeptidase-like 13 i...    205   9e-60   
ref|XP_006581278.1|  PREDICTED: serine carboxypeptidase-like 19-l...    205   1e-59   
ref|XP_010555764.1|  PREDICTED: serine carboxypeptidase-like 18         209   1e-59   
ref|XP_003525944.2|  PREDICTED: serine carboxypeptidase-like 19-l...    205   1e-59   
gb|EPS59025.1|  hypothetical protein M569_15786                         197   1e-59   
dbj|BAA96893.1|  serine carboxypeptidase                                206   1e-59   
ref|XP_004299782.1|  PREDICTED: serine carboxypeptidase-like 13         206   1e-59   
ref|XP_010939016.1|  PREDICTED: serine carboxypeptidase-like 18 i...    206   1e-59   
ref|XP_006401829.1|  hypothetical protein EUTSA_v10013495mg             205   1e-59   
ref|XP_008452659.1|  PREDICTED: serine carboxypeptidase-like 18 i...    202   1e-59   
ref|XP_010065816.1|  PREDICTED: serine carboxypeptidase-like 18 i...    205   2e-59   
ref|XP_010515304.1|  PREDICTED: serine carboxypeptidase-like 7          204   2e-59   
ref|XP_004299781.1|  PREDICTED: serine carboxypeptidase-like 13         205   2e-59   
emb|CDY11114.1|  BnaC06g23660D                                          204   2e-59   
gb|KHN45135.1|  Serine carboxypeptidase-like 19                         205   2e-59   
ref|XP_010065898.1|  PREDICTED: serine carboxypeptidase-like 18         205   2e-59   
ref|XP_004299780.2|  PREDICTED: serine carboxypeptidase-like 13         205   2e-59   
ref|XP_007199857.1|  hypothetical protein PRUPE_ppa006297mg             203   2e-59   
ref|XP_002878649.1|  hypothetical protein ARALYDRAFT_481165             203   3e-59   
ref|XP_006581276.1|  PREDICTED: serine carboxypeptidase-like 19-l...    205   3e-59   
gb|KFK38432.1|  hypothetical protein AALP_AA3G112600                    204   3e-59   
gb|AES63483.2|  serine carboxypeptidase-like protein                    203   3e-59   
ref|XP_009131551.1|  PREDICTED: serine carboxypeptidase-like 7 is...    204   3e-59   
gb|AAG52139.1|AC010556_21  putative serine carboxypeptidase; 1519...    203   4e-59   
ref|XP_009131550.1|  PREDICTED: serine carboxypeptidase-like 7 is...    204   4e-59   
ref|XP_010320345.1|  PREDICTED: serine carboxypeptidase-like 10 i...    202   4e-59   
ref|NP_177470.4|  serine carboxypeptidase-like 6                        204   4e-59   
ref|XP_008452658.1|  PREDICTED: serine carboxypeptidase-like 18 i...    202   4e-59   
ref|XP_006404748.1|  hypothetical protein EUTSA_v10000461mg             201   4e-59   
ref|XP_009795831.1|  PREDICTED: serine carboxypeptidase-like 18 i...    202   5e-59   
ref|XP_008337031.1|  PREDICTED: serine carboxypeptidase-like 18         203   5e-59   
ref|XP_009139971.1|  PREDICTED: serine carboxypeptidase-like 13 i...    203   5e-59   
ref|XP_010429234.1|  PREDICTED: serine carboxypeptidase-like 12 i...    203   5e-59   
ref|XP_006399445.1|  hypothetical protein EUTSA_v10015495mg             204   5e-59   
emb|CDY52618.1|  BnaCnng22970D                                          203   5e-59   
gb|AES73172.2|  1-O-acylglucose:anthocyanin acyltransferase             204   5e-59   
ref|XP_009120828.1|  PREDICTED: serine carboxypeptidase-like 15 i...    202   6e-59   
emb|CDX78700.1|  BnaA03g06120D                                          203   6e-59   
gb|KHN40232.1|  Serine carboxypeptidase-like 18                         200   6e-59   
ref|XP_006581277.1|  PREDICTED: serine carboxypeptidase-like 19-l...    203   6e-59   
emb|CDX70702.1|  BnaC03g07860D                                          202   7e-59   
emb|CDP17360.1|  unnamed protein product                                204   7e-59   
ref|XP_010108033.1|  Serine carboxypeptidase-like 7                     201   8e-59   
ref|XP_009393004.1|  PREDICTED: serine carboxypeptidase-like 2          203   8e-59   
ref|NP_973517.1|  serine carboxypeptidase-like 9                        202   8e-59   
ref|XP_009104821.1|  PREDICTED: serine carboxypeptidase-like 2 is...    202   9e-59   
ref|NP_179884.1|  serine carboxypeptidase-like 9                        202   9e-59   
ref|XP_010691546.1|  PREDICTED: serine carboxypeptidase-like 18         203   1e-58   
ref|XP_010464720.1|  PREDICTED: serine carboxypeptidase-like 7          202   1e-58   
ref|XP_009120822.1|  PREDICTED: serine carboxypeptidase-like 15 i...    202   1e-58   
ref|XP_006297701.1|  hypothetical protein CARUB_v10013730mg             202   1e-58   
emb|CDY44586.1|  BnaA04g10040D                                          202   1e-58   
ref|XP_010556479.1|  PREDICTED: serine carboxypeptidase-like 19         202   1e-58   
ref|XP_010556476.1|  PREDICTED: serine carboxypeptidase-like 18 i...    202   1e-58   
ref|XP_010065817.1|  PREDICTED: serine carboxypeptidase-like 18         203   1e-58   
ref|XP_010556475.1|  PREDICTED: serine carboxypeptidase-like 18 i...    202   1e-58   
ref|XP_008452656.1|  PREDICTED: serine carboxypeptidase-like 13 i...    202   1e-58   
ref|XP_010556474.1|  PREDICTED: serine carboxypeptidase-like 18 i...    202   1e-58   
ref|XP_009104819.1|  PREDICTED: serine carboxypeptidase-like 2 is...    201   2e-58   
ref|XP_008452657.1|  PREDICTED: serine carboxypeptidase-like 13 i...    201   2e-58   
gb|KFK27798.1|  hypothetical protein AALP_AA8G430800                    210   2e-58   
gb|KFK27799.1|  hypothetical protein AALP_AA8G430800                    210   2e-58   
ref|XP_009104820.1|  PREDICTED: serine carboxypeptidase-like 2 is...    202   2e-58   
ref|XP_009365383.1|  PREDICTED: serine carboxypeptidase-like 13         202   2e-58   
ref|XP_009102688.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    201   2e-58   
ref|XP_006407354.1|  hypothetical protein EUTSA_v10022069mg             201   2e-58   
ref|NP_001052165.1|  Os04g0176400                                       202   2e-58   
gb|KFK27800.1|  hypothetical protein AALP_AA8G430800                    210   2e-58   
ref|XP_003573757.1|  PREDICTED: serine carboxypeptidase-like 13         202   2e-58   
dbj|BAJ85895.1|  predicted protein                                      202   2e-58   
ref|XP_003602922.1|  Serine carboxypeptidase-like protein               196   2e-58   
gb|KFK25893.1|  hypothetical protein AALP_AA8G176200                    200   2e-58   
ref|XP_010065818.1|  PREDICTED: serine carboxypeptidase-like 18         202   2e-58   
gb|KHN06942.1|  Serine carboxypeptidase-like 19                         202   2e-58   
ref|XP_010556472.1|  PREDICTED: serine carboxypeptidase-like 18 i...    202   2e-58   
gb|AES87127.2|  1-O-acylglucose:anthocyanin acyltransferase             202   2e-58   
ref|XP_009768014.1|  PREDICTED: serine carboxypeptidase-like 17         202   3e-58   
ref|XP_010556473.1|  PREDICTED: serine carboxypeptidase-like 18 i...    202   3e-58   
ref|XP_010426467.1|  PREDICTED: serine carboxypeptidase-like 7          201   3e-58   
emb|CDP08179.1|  unnamed protein product                                202   3e-58   
ref|XP_006354895.1|  PREDICTED: serine carboxypeptidase-like 18-like    202   3e-58   
emb|CDP21038.1|  unnamed protein product                                202   3e-58   
ref|XP_008452655.1|  PREDICTED: serine carboxypeptidase-like 13 i...    202   3e-58   
gb|KFK44963.1|  hypothetical protein AALP_AA1G326300                    201   3e-58   
emb|CDY49438.1|  BnaA09g42290D                                          201   3e-58   
ref|XP_010320342.1|  PREDICTED: serine carboxypeptidase-like 10 i...    201   3e-58   
gb|KFK41349.1|  hypothetical protein AALP_AA2G118800                    201   3e-58   
gb|AIW39897.1|  serine carboxypeptidase-like protein                    202   3e-58   
emb|CAB89366.1|  carboxypeptidase-like protein                          200   3e-58   
gb|KFK41348.1|  hypothetical protein AALP_AA2G118800                    201   4e-58   
ref|NP_177473.1|  serine carboxypeptidase-like 2                        201   4e-58   
ref|XP_007200900.1|  hypothetical protein PRUPE_ppb017681mg             200   4e-58   
ref|NP_001031402.1|  serine carboxypeptidase-like 13                    200   4e-58   
ref|XP_010428248.1|  PREDICTED: serine carboxypeptidase-like 2 is...    200   4e-58   
emb|CDY68040.1|  BnaAnng25990D                                          200   5e-58   
ref|XP_009388678.1|  PREDICTED: serine carboxypeptidase-like 18         201   5e-58   
ref|NP_001077947.1|  serine carboxypeptidase-like 13                    200   5e-58   
gb|AAN60354.1|  unknown                                                 199   5e-58   
emb|CDY50564.1|  BnaA01g30780D                                          200   6e-58   
ref|NP_179881.3|  serine carboxypeptidase-like 13                       200   6e-58   
gb|KDP44533.1|  hypothetical protein JCGZ_16366                         201   7e-58   
ref|XP_006653168.1|  PREDICTED: serine carboxypeptidase-like 18-like    200   7e-58   
ref|XP_002893774.1|  hypothetical protein ARALYDRAFT_890934             200   7e-58   
ref|XP_010320341.1|  PREDICTED: serine carboxypeptidase-like 18 i...    200   8e-58   
ref|XP_010428244.1|  PREDICTED: serine carboxypeptidase-like 2 is...    200   8e-58   
ref|NP_177472.1|  serine carboxypeptidase-like 5                        200   9e-58   
ref|XP_010484511.1|  PREDICTED: serine carboxypeptidase-like 7          194   9e-58   
gb|KJB73510.1|  hypothetical protein B456_011G236800                    201   1e-57   
ref|XP_002871383.1|  hypothetical protein ARALYDRAFT_487780             200   1e-57   
sp|Q9CAU2.2|SCP5_ARATH  RecName: Full=Serine carboxypeptidase-lik...    199   1e-57   
gb|EMT01866.1|  Serine carboxypeptidase-like 18                         193   1e-57   
ref|XP_009122528.1|  PREDICTED: serine carboxypeptidase-like 19         200   1e-57   
gb|EAY93240.1|  hypothetical protein OsI_15047                          200   1e-57   
ref|XP_004151544.1|  PREDICTED: serine carboxypeptidase-like 7-like     199   1e-57   
ref|XP_010509544.1|  PREDICTED: serine carboxypeptidase-like 9 is...    197   1e-57   
gb|AAK32769.1|AF361601_1  T20K9.20/T20K9.20                             194   1e-57   
ref|XP_009117322.1|  PREDICTED: serine carboxypeptidase-like 8 is...    197   2e-57   
emb|CDX85493.1|  BnaA02g03200D                                          199   2e-57   
gb|KHG22591.1|  Serine carboxypeptidase-like 15                         194   2e-57   
ref|XP_006415429.1|  hypothetical protein EUTSA_v10007675mg             199   2e-57   
ref|XP_009126130.1|  PREDICTED: serine carboxypeptidase-like 12 i...    199   2e-57   
gb|AAK52316.1|  sinapoylglucose:choline sinapoyltransferase             199   2e-57   
emb|CDY52617.1|  BnaCnng22960D                                          205   2e-57   
emb|CDX83199.1|  BnaA03g23070D                                          192   2e-57   
emb|CDX77573.1|  BnaA07g07110D                                          199   2e-57   
emb|CDY49647.1|  BnaC09g41250D                                          199   2e-57   
ref|XP_010429230.1|  PREDICTED: serine carboxypeptidase-like 11 i...    199   2e-57   
emb|CDY21591.1|  BnaC09g47010D                                          199   2e-57   
ref|XP_010320340.1|  PREDICTED: serine carboxypeptidase-like 13 i...    199   2e-57   
ref|XP_006299183.1|  hypothetical protein CARUB_v10015328mg             199   2e-57   
ref|XP_006407566.1|  hypothetical protein EUTSA_v10020743mg             199   2e-57   
ref|XP_010231763.1|  PREDICTED: serine carboxypeptidase-like 13 i...    199   2e-57   
emb|CDY00759.1|  BnaC03g37430D                                          192   2e-57   
ref|XP_002522131.1|  serine carboxypeptidase, putative                  200   2e-57   
ref|XP_003604934.1|  Serine carboxypeptidase-like protein               194   2e-57   
ref|NP_568215.2|  serine carboxypeptidase-like 19                       199   2e-57   
ref|XP_010484310.1|  PREDICTED: serine carboxypeptidase-like 7          199   2e-57   
ref|XP_002272116.1|  PREDICTED: serine carboxypeptidase-like 16         199   2e-57   
ref|XP_003566614.1|  PREDICTED: serine carboxypeptidase-like 13 i...    200   3e-57   
ref|XP_010464717.1|  PREDICTED: serine carboxypeptidase-like 7 is...    199   3e-57   
ref|XP_002882669.1|  hypothetical protein ARALYDRAFT_478377             198   3e-57   
ref|XP_006356867.1|  PREDICTED: serine carboxypeptidase-like 19-like    204   3e-57   
emb|CDX69437.1|  BnaA10g17860D                                          198   3e-57   
ref|XP_010028337.1|  PREDICTED: serine carboxypeptidase-like 18         199   3e-57   
gb|AAX92980.1|  Serine carboxypeptidase                                 192   4e-57   
ref|XP_003571685.1|  PREDICTED: serine carboxypeptidase-like 17         199   4e-57   
ref|XP_010464977.1|  PREDICTED: serine carboxypeptidase-like 16         198   4e-57   
ref|XP_009121469.1|  PREDICTED: serine carboxypeptidase-like 7          198   5e-57   
ref|XP_009117321.1|  PREDICTED: serine carboxypeptidase-like 10 i...    198   5e-57   
ref|XP_006399444.1|  hypothetical protein EUTSA_v10016050mg             199   5e-57   
gb|KHN47358.1|  ABC transporter B family member 9                       206   6e-57   
ref|XP_006345612.1|  PREDICTED: serine carboxypeptidase-like 13-like    195   6e-57   



>ref|XP_006350186.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X2 [Solanum 
tuberosum]
Length=389

 Score =   284 bits (726),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H +VETLPGF  +LPFKL TGYIGVGE +++QLFYYF+ESE+ P+ DPL++WL GGPGCS
Sbjct  21   HFIVETLPGFDGQLPFKLETGYIGVGEEEKLQLFYYFVESERDPQNDPLIIWLIGGPGCS  80

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            GLSAF +EIGPLT +YANS+G+ P LELN ++W+KVANIIF+DQPVG GYSY++TS+AYN
Sbjct  81   GLSAFLYEIGPLTFDYANSSGNFPKLELNLHSWSKVANIIFIDQPVGAGYSYAKTSEAYN  140

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            +NDTLSA   Y FL +WL+DHP +L NPLYVAGDSY+GI + LV R IYDG+E G EP++
Sbjct  141  SNDTLSATLIYDFLRKWLMDHPEYLKNPLYVAGDSYAGIYIALVTRKIYDGVEVGDEPQM  200

Query  639  NMKG  650
            N+KG
Sbjct  201  NIKG  204



>ref|XP_006350185.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X1 [Solanum 
tuberosum]
Length=461

 Score =   282 bits (722),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H +VETLPGF  +LPFKL TGYIGVGE +++QLFYYF+ESE+ P+ DPL++WL GGPGCS
Sbjct  21   HFIVETLPGFDGQLPFKLETGYIGVGEEEKLQLFYYFVESERDPQNDPLIIWLIGGPGCS  80

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            GLSAF +EIGPLT +YANS+G+ P LELN ++W+KVANIIF+DQPVG GYSY++TS+AYN
Sbjct  81   GLSAFLYEIGPLTFDYANSSGNFPKLELNLHSWSKVANIIFIDQPVGAGYSYAKTSEAYN  140

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            +NDTLSA   Y FL +WL+DHP +L NPLYVAGDSY+GI + LV R IYDG+E G EP++
Sbjct  141  SNDTLSATLIYDFLRKWLMDHPEYLKNPLYVAGDSYAGIYIALVTRKIYDGVEVGDEPQM  200

Query  639  NMKG  650
            N+KG
Sbjct  201  NIKG  204



>ref|XP_009614132.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Nicotiana 
tomentosiformis]
Length=468

 Score =   281 bits (718),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 154/184 (84%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H +VETLPGF  KLPFKL TGY+GVGE +++QL+YYF+ESE+ PE DPL+LWLTGGPGCS
Sbjct  24   HFIVETLPGFNGKLPFKLETGYVGVGEEEKVQLYYYFVESERDPENDPLMLWLTGGPGCS  83

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            GLS+F +EIGPLT +YANS GD P LEL   +WTKVANIIF+DQP G+GYSY++TS+AYN
Sbjct  84   GLSSFVYEIGPLTFDYANSIGDFPKLELKSNSWTKVANIIFIDQPAGSGYSYAKTSEAYN  143

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             NDTL+   TY FL +WL+DHP FL NPLYV+GDSYSGI V L+ R IYDG+E G +PR+
Sbjct  144  FNDTLAVALTYEFLRKWLMDHPEFLKNPLYVSGDSYSGIFVALLTRRIYDGIEVGEKPRV  203

Query  639  NMKG  650
            N+KG
Sbjct  204  NIKG  207



>ref|XP_004248779.1| PREDICTED: serine carboxypeptidase-like 18 [Solanum lycopersicum]
Length=464

 Score =   280 bits (715),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H +VETLPGF  KLPF L TGYI VGE +++QLFY+F++SE+ P  DPL++WLTGGPGCS
Sbjct  20   HFIVETLPGFHGKLPFTLETGYISVGEEEKVQLFYFFVQSERDPRNDPLMIWLTGGPGCS  79

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            GLS+F +EIGPLT +YANS+G+ P LELN Y+WTKVANIIF+DQP GTGYSY+ TS+AYN
Sbjct  80   GLSSFVYEIGPLTFDYANSSGNFPKLELNSYSWTKVANIIFIDQPAGTGYSYANTSEAYN  139

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             NDTLS   TY FL +WL+DHP +LNNPLYV GDSYSGI V L+ R IYDG+E G  PR+
Sbjct  140  CNDTLSVTLTYDFLRKWLMDHPEYLNNPLYVGGDSYSGIFVALLTRKIYDGIEVGDRPRV  199

Query  639  NMKG  650
            N+KG
Sbjct  200  NIKG  203



>gb|AAF64227.1|AF248647_1 glucose acyltransferase [Solanum pennellii]
Length=464

 Score =   279 bits (714),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H +VETLPGF  KLPF L TGYI VGE +++QLFY+F++SE+ P  DPL++WLTGGPGCS
Sbjct  20   HFIVETLPGFHGKLPFTLETGYISVGEEEKVQLFYFFVQSERDPRNDPLMIWLTGGPGCS  79

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            GLS+F +EIGPLT +YANS+G+ P LELN Y+WTKVANIIF+DQP GTGYSY+ TS+AYN
Sbjct  80   GLSSFVYEIGPLTFDYANSSGNFPKLELNSYSWTKVANIIFIDQPAGTGYSYANTSEAYN  139

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             NDTLS   TY FL +WL+DHP +LNNPLYV GDSYSGI V L+ R IYDG+E G  PR+
Sbjct  140  CNDTLSVTLTYDFLRKWLMDHPEYLNNPLYVGGDSYSGIFVALLTRKIYDGIEVGDRPRV  199

Query  639  NMKG  650
            N+KG
Sbjct  200  NIKG  203



>gb|AAD01264.1| glucose acyltransferase [Solanum berthaultii]
Length=456

 Score =   278 bits (711),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 155/184 (84%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H +VETLPGF  +LPFKL TGYIGVGE +++QLFY+F+ESE+ P+ DPL++WLTGGPGCS
Sbjct  21   HFIVETLPGFDGQLPFKLETGYIGVGEEEKLQLFYFFVESERDPQNDPLMIWLTGGPGCS  80

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            GLS F +E GPLT +YANS+G+ P LELN ++WTKVANIIF+DQPVGTGYSY++TS+AYN
Sbjct  81   GLSTFLYEFGPLTFDYANSSGNFPKLELNLHSWTKVANIIFIDQPVGTGYSYAKTSEAYN  140

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            +NDTLSA  TY FL +WL+DHP +L NPLYV  +SY+GI   LV R IYDG+E G EP++
Sbjct  141  SNDTLSATLTYDFLRKWLMDHPEYLKNPLYVGSESYAGIYSALVTRKIYDGVEVGDEPQM  200

Query  639  NMKG  650
            N+KG
Sbjct  201  NIKG  204



>ref|XP_009795830.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Nicotiana 
sylvestris]
Length=467

 Score =   278 bits (710),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H +VE LPGF  KLPFKL TGY+GVGE +++QL+YYF+ESE+ PE DPL+LWLTGGPGCS
Sbjct  23   HFIVENLPGFQGKLPFKLETGYVGVGEEEKVQLYYYFVESERDPENDPLMLWLTGGPGCS  82

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            GLS+F +EIGPL  +YANS+GD P LELN  +WTKVANIIF+DQP G+GYSY++TS+AYN
Sbjct  83   GLSSFVYEIGPLMFDYANSSGDFPKLELNSNSWTKVANIIFIDQPAGSGYSYAKTSEAYN  142

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             NDTL+   TY FL +WL+DHP +L NP YV GDSYSGI V L+ R IYDG+E G +PR+
Sbjct  143  CNDTLAVTLTYEFLRKWLMDHPKYLKNPQYVGGDSYSGIFVALLTRRIYDGIEVGEKPRV  202

Query  639  NMKG  650
            N+KG
Sbjct  203  NIKG  206



>gb|AAD01263.1| glucose acyltransferase [Solanum berthaultii]
Length=464

 Score =   275 bits (704),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H +VETLPGF  KLPF L TGYIGVGE +++QLFY+F+ SE+ P  DPL++WLTGGPGCS
Sbjct  20   HFIVETLPGFHGKLPFTLETGYIGVGEEEKVQLFYFFVPSERDPLNDPLMIWLTGGPGCS  79

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            GLS+F +EIGPLT +YANS G+ P LELN  +WTKVANIIF+DQP GTGYSY+ TS+AYN
Sbjct  80   GLSSFVYEIGPLTFDYANSNGNFPKLELNSNSWTKVANIIFIDQPAGTGYSYANTSEAYN  139

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             NDTLS   TY FL +WL+DHP +LNNPLYV GDSYSGI V L+ R IYDG+E G +PRL
Sbjct  140  CNDTLSVTLTYDFLRKWLMDHPEYLNNPLYVGGDSYSGIFVALLTRKIYDGIEVGDKPRL  199

Query  639  NMKG  650
            N+KG
Sbjct  200  NIKG  203



>ref|XP_006353976.1| PREDICTED: serine carboxypeptidase-like 18-like [Solanum tuberosum]
Length=464

 Score =   275 bits (703),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H +VETLPGF  KLPF L TGYIGVGE +++QLFY+F+ SE+ P  DPL++WLTGGPGCS
Sbjct  20   HFIVETLPGFHGKLPFTLETGYIGVGEEEKVQLFYFFVPSERDPLNDPLMIWLTGGPGCS  79

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            GLS+F +EIGPLT +YANS G+ P LELN Y+WTKVANIIF+DQP GTGYSY+ TS+AYN
Sbjct  80   GLSSFVYEIGPLTFDYANSNGNFPKLELNSYSWTKVANIIFIDQPAGTGYSYANTSEAYN  139

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             NDTLS   TY FL +WL+DHP +LNNPLYV GDSYSGI V  + R IYDG+E G +PRL
Sbjct  140  CNDTLSVTLTYDFLRKWLMDHPEYLNNPLYVGGDSYSGIFVAPLTRKIYDGIEVGDKPRL  199

Query  639  NMKG  650
            N+KG
Sbjct  200  NIKG  203



>gb|AAD01265.1| glucose acyltransferase [Solanum berthaultii]
Length=461

 Score =   272 bits (696),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H +VETLPGF  KLPF L TGYIGVGE +++QLFY+F+ SE+ P  DPL++WLTGGPGCS
Sbjct  20   HFIVETLPGFHGKLPFTLETGYIGVGEEEKVQLFYFFVPSERDPLNDPLMIWLTGGPGCS  79

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            GLS+F +EIGPLT +YANS G+ P LELN  +WTKVANIIF+DQP GTGYSY+ TS+AYN
Sbjct  80   GLSSFVYEIGPLTFDYANSNGNFPKLELNSNSWTKVANIIFIDQPAGTGYSYANTSEAYN  139

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             NDTLS   TY FL +WL+DHP +LNNPLYV GDSYSGI V  + R IYDG+E G +PRL
Sbjct  140  CNDTLSVTLTYDFLRKWLMDHPEYLNNPLYVGGDSYSGIFVAPLTRKIYDGIEVGDKPRL  199

Query  639  NMKG  650
            N+KG
Sbjct  200  NIKG  203



>ref|XP_006353974.1| PREDICTED: serine carboxypeptidase-like 18-like [Solanum tuberosum]
Length=464

 Score =   268 bits (686),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H +VETLPGF  KLPF L TGYIGVGE  ++QLFY+F++SE+ PE DPL++WLTGGPGCS
Sbjct  20   HFIVETLPGFDGKLPFTLETGYIGVGEEGKVQLFYFFVKSERDPENDPLMIWLTGGPGCS  79

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LS FF+E+GPLT +YANS+G+ P LELN Y+WTKVANIIF+DQP GTGYSYS TS+AYN
Sbjct  80   ALSTFFYEMGPLTFDYANSSGNFPKLELNSYSWTKVANIIFIDQPAGTGYSYSNTSEAYN  139

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             +DTLS   TY FL +WL+DHP +L NPLYV G SYSG  V  + R IYDG+E G +PR+
Sbjct  140  CSDTLSVTLTYDFLRKWLMDHPEYLKNPLYVTGGSYSGFFVGPLTRKIYDGIELGDKPRV  199

Query  639  NMKG  650
            N+KG
Sbjct  200  NIKG  203



>ref|XP_006353975.1| PREDICTED: serine carboxypeptidase-like 18-like [Solanum tuberosum]
Length=460

 Score =   268 bits (685),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +VE+LPGF  KLPF L TGYIGVG+ +++QLFY+FIESE+ P+ DPL+LWLTGGPGCSGL
Sbjct  22   IVESLPGFEGKLPFTLETGYIGVGQEEKVQLFYFFIESERDPQNDPLMLWLTGGPGCSGL  81

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTN  464
            S   +E+GPLT +YANS+G+ P LELN Y+WTKVANIIF+DQP GTGYSY+ TS+AYN +
Sbjct  82   STLLYEMGPLTFDYANSSGNFPKLELNSYSWTKVANIIFIDQPAGTGYSYANTSEAYNCS  141

Query  465  DTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNM  644
            DTLS   TY FL +WL+DHP +L NPLYV+G SY+G  VP + R IYDG+E G +P+LN+
Sbjct  142  DTLSVTLTYEFLRKWLMDHPKYLKNPLYVSGSSYAGFFVPPLTRKIYDGIEVGDKPQLNI  201

Query  645  KG  650
            KG
Sbjct  202  KG  203



>gb|KCW55074.1| hypothetical protein EUGRSUZ_I01040 [Eucalyptus grandis]
Length=426

 Score =   267 bits (683),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 148/183 (81%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            A++E+LPGFP  LPFKL TGY+GVGE +E+QLFYYFIESE+SP  DPLLLWLTGGPGCS 
Sbjct  21   AIIESLPGFPGDLPFKLETGYVGVGELEEVQLFYYFIESERSPNDDPLLLWLTGGPGCSA  80

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            LS   FEIGPL  +Y+NS+G  P  ELNPY+WTK+ANIIF+D PVGTG+SY+ T  AYN 
Sbjct  81   LSGLLFEIGPLQFDYSNSSGIRPLFELNPYSWTKIANIIFLDAPVGTGFSYAMTWAAYNI  140

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            NDT SA  TY FL +WLL HP FL N LY++GDSYSG+ VP++V+ IYDG E+G EP +N
Sbjct  141  NDTSSAAQTYEFLRKWLLAHPKFLTNQLYISGDSYSGVVVPIIVKEIYDGNEAGREPPMN  200

Query  642  MKG  650
            +KG
Sbjct  201  LKG  203



>ref|XP_010028344.1| PREDICTED: serine carboxypeptidase-like 7 [Eucalyptus grandis]
Length=465

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 148/183 (81%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            A++E+LPGFP  LPFKL TGY+GVGE +E+QLFYYFIESE+SP  DPLLLWLTGGPGCS 
Sbjct  21   AIIESLPGFPGDLPFKLETGYVGVGELEEVQLFYYFIESERSPNDDPLLLWLTGGPGCSA  80

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            LS   FEIGPL  +Y+NS+G  P  ELNPY+WTK+ANIIF+D PVGTG+SY+ T  AYN 
Sbjct  81   LSGLLFEIGPLQFDYSNSSGIRPLFELNPYSWTKIANIIFLDAPVGTGFSYAMTWAAYNI  140

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            NDT SA  TY FL +WLL HP FL N LY++GDSYSG+ VP++V+ IYDG E+G EP +N
Sbjct  141  NDTSSAAQTYEFLRKWLLAHPKFLTNQLYISGDSYSGVVVPIIVKEIYDGNEAGREPPMN  200

Query  642  MKG  650
            +KG
Sbjct  201  LKG  203



>gb|KCW55073.1| hypothetical protein EUGRSUZ_I01040 [Eucalyptus grandis]
Length=484

 Score =   267 bits (683),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 148/183 (81%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            A++E+LPGFP  LPFKL TGY+GVGE +E+QLFYYFIESE+SP  DPLLLWLTGGPGCS 
Sbjct  21   AIIESLPGFPGDLPFKLETGYVGVGELEEVQLFYYFIESERSPNDDPLLLWLTGGPGCSA  80

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            LS   FEIGPL  +Y+NS+G  P  ELNPY+WTK+ANIIF+D PVGTG+SY+ T  AYN 
Sbjct  81   LSGLLFEIGPLQFDYSNSSGIRPLFELNPYSWTKIANIIFLDAPVGTGFSYAMTWAAYNI  140

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            NDT SA  TY FL +WLL HP FL N LY++GDSYSG+ VP++V+ IYDG E+G EP +N
Sbjct  141  NDTSSAAQTYEFLRKWLLAHPKFLTNQLYISGDSYSGVVVPIIVKEIYDGNEAGREPPMN  200

Query  642  MKG  650
            +KG
Sbjct  201  LKG  203



>ref|XP_010028339.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
Length=464

 Score =   266 bits (680),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 151/183 (83%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            A++E+LPGFP  LPFKL TGY+GVGE +E+QLFYYFIESE+SP+ DPLLLWLTGGPGCS 
Sbjct  21   AIIESLPGFPEDLPFKLETGYVGVGELEEVQLFYYFIESERSPKDDPLLLWLTGGPGCSA  80

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            LS   +EIGPL  +Y+NS+G+ P L+LNPY+WTK+ANIIF+D PVGTG+SY+ T  AY+ 
Sbjct  81   LSGLLYEIGPLQFDYSNSSGNRPVLKLNPYSWTKIANIIFLDAPVGTGFSYATTWTAYDN  140

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            +DT SA  TY FL +WL+ HP FL NPLY+ GDSYSG+ VP++V+ +YDG E+G EP +N
Sbjct  141  SDTSSAAQTYEFLRKWLMAHPKFLTNPLYITGDSYSGVIVPIIVKEVYDGNEAGREPPMN  200

Query  642  MKG  650
            +KG
Sbjct  201  LKG  203



>ref|XP_010030617.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
Length=432

 Score =   265 bits (676),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 148/183 (81%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            A+VE+LPGFP  LPFKL TGY+GVGE +E+QLFYYFIESE+SP+ DPLLLWLTGGPGCS 
Sbjct  21   AIVESLPGFPGDLPFKLETGYVGVGELEEVQLFYYFIESERSPKDDPLLLWLTGGPGCSA  80

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            LS   FEIGPL  +Y+NS+G  P L+LNPY+WTK+ANIIF+D PVGTG+SY+ T  AY+ 
Sbjct  81   LSGLLFEIGPLQFDYSNSSGIRPILKLNPYSWTKIANIIFLDAPVGTGFSYATTWTAYDI  140

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            NDT SA  +Y FL +WL+ HP FL N LY+ GDSYSG+  P++V+ +YDG E+G EP +N
Sbjct  141  NDTSSAAQSYEFLRKWLMSHPKFLTNSLYITGDSYSGVVAPIIVKEVYDGNEAGREPPMN  200

Query  642  MKG  650
            +KG
Sbjct  201  LKG  203



>gb|KCW55058.1| hypothetical protein EUGRSUZ_I01033, partial [Eucalyptus grandis]
Length=412

 Score =   263 bits (673),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 148/183 (81%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            A+VE+LPGFP  LPFKL TGY+GVGE +E+QLFYYFIESE+SP+ DPLLLWLTGGPGCS 
Sbjct  21   AIVESLPGFPGDLPFKLETGYVGVGELEEVQLFYYFIESERSPKDDPLLLWLTGGPGCSA  80

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            LS   FEIGPL  +Y+NS+G  P L+LNPY+WTK+ANIIF+D PVGTG+SY+ T  AY+ 
Sbjct  81   LSGLLFEIGPLQFDYSNSSGIRPILKLNPYSWTKIANIIFLDAPVGTGFSYATTWTAYDI  140

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            NDT SA  +Y FL +WL+ HP FL N LY+ GDSYSG+  P++V+ +YDG E+G EP +N
Sbjct  141  NDTSSAAQSYEFLRKWLMSHPKFLTNSLYITGDSYSGVVAPIIVKEVYDGNEAGREPPMN  200

Query  642  MKG  650
            +KG
Sbjct  201  LKG  203



>ref|XP_010028343.1| PREDICTED: serine carboxypeptidase-like 18 isoform X3 [Eucalyptus 
grandis]
Length=426

 Score =   264 bits (674),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 149/183 (81%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            AVV++LPGF   LPFKL TGY+GVGE QE+QLFYYFIESE+SP+ DPLLLWLTGGPGCS 
Sbjct  21   AVVKSLPGFSGDLPFKLETGYVGVGELQEVQLFYYFIESERSPKDDPLLLWLTGGPGCSA  80

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            LS   FEIGPL  +Y++S+ + P L+LNPY+WTK+ANIIF+D PVGTG+SY+    AYN+
Sbjct  81   LSGLLFEIGPLQFDYSDSSENRPVLKLNPYSWTKIANIIFLDAPVGTGFSYATAWRAYNS  140

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            +DT SA  TY FL +WL+ HP FL NPLY+ GDSYSG+ VP++V+ +YDG E+G EP +N
Sbjct  141  SDTSSATQTYEFLRKWLMSHPRFLTNPLYITGDSYSGVVVPIIVKEVYDGNEAGREPPMN  200

Query  642  MKG  650
            +KG
Sbjct  201  LKG  203



>ref|XP_010040883.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
 gb|KCW44821.1| hypothetical protein EUGRSUZ_L01608 [Eucalyptus grandis]
Length=418

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 153/183 (84%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            A+VE++PGFP +LPFKL TGY+GVGE +E+QLFYYFIESE+SP+ DPLLLWLTGGPGCS 
Sbjct  21   AIVESIPGFPGELPFKLETGYVGVGELEEVQLFYYFIESERSPKDDPLLLWLTGGPGCSS  80

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            LS   +EIGP+  ++++S+G  P L+ NPY+WTKVANIIF+D PVGTG+SY+ TS AY+ 
Sbjct  81   LSGLIYEIGPMQFDFSSSSGTKPILKYNPYSWTKVANIIFLDAPVGTGFSYATTSTAYDI  140

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            +DT SA  TY FL +WL+ HP+FL NPLYV GDSYSG+ +P++V+NI DG+E+G +P++N
Sbjct  141  SDTSSAAQTYEFLRKWLVSHPSFLANPLYVTGDSYSGVVIPIIVKNIQDGIEAGRQPQMN  200

Query  642  MKG  650
            + G
Sbjct  201  LVG  203



>ref|XP_004248778.1| PREDICTED: serine carboxypeptidase-like 18 [Solanum lycopersicum]
Length=465

 Score =   264 bits (675),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 148/182 (81%), Gaps = 0/182 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +VETLPGF  KL F L TGYIGVGE +++QLFY+FI+SE+ PE DPL++WLTGGPGCS L
Sbjct  23   IVETLPGFDGKLSFTLETGYIGVGEDEQVQLFYFFIQSERDPENDPLMIWLTGGPGCSAL  82

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTN  464
            S FF+E+GPLT +YANS+G+ P LELN Y+WTKVANIIF+DQP GTGYSY+ TS+AYN +
Sbjct  83   STFFYEMGPLTFDYANSSGNFPKLELNSYSWTKVANIIFIDQPAGTGYSYANTSEAYNCS  142

Query  465  DTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNM  644
            DTLS   TY FL +WL++HP +L NPLYV G SYSG  VP +   IYDG+E G +P+LN+
Sbjct  143  DTLSVTLTYDFLRKWLMEHPEYLKNPLYVTGGSYSGFFVPPLTHKIYDGIEVGDKPQLNI  202

Query  645  KG  650
            KG
Sbjct  203  KG  204



>ref|XP_010028341.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Eucalyptus 
grandis]
Length=464

 Score =   263 bits (672),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 149/183 (81%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            AVV++LPGF   LPFKL TGY+GVGE QE+QLFYYFIESE+SP+ DPLLLWLTGGPGCS 
Sbjct  21   AVVKSLPGFSGDLPFKLETGYVGVGELQEVQLFYYFIESERSPKDDPLLLWLTGGPGCSA  80

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            LS   FEIGPL  +Y++S+ + P L+LNPY+WTK+ANIIF+D PVGTG+SY+    AYN+
Sbjct  81   LSGLLFEIGPLQFDYSDSSENRPVLKLNPYSWTKIANIIFLDAPVGTGFSYATAWRAYNS  140

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            +DT SA  TY FL +WL+ HP FL NPLY+ GDSYSG+ VP++V+ +YDG E+G EP +N
Sbjct  141  SDTSSATQTYEFLRKWLMSHPRFLTNPLYITGDSYSGVVVPIIVKEVYDGNEAGREPPMN  200

Query  642  MKG  650
            +KG
Sbjct  201  LKG  203



>ref|XP_010028346.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
 gb|KCW55075.1| hypothetical protein EUGRSUZ_I01041 [Eucalyptus grandis]
Length=464

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 153/183 (84%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            A+VE+LPGFP +LPFKL TGY+GVGE +E+QLFYYFIESE+SP+ DPLL+WLTGGPGCS 
Sbjct  21   AIVESLPGFPGELPFKLETGYVGVGELEEVQLFYYFIESERSPKRDPLLVWLTGGPGCSS  80

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            LS+  +EIGP+  ++++S+G  P L+ NPY+WTKVAN+IF+D PVGTG+SY+ T  AYN 
Sbjct  81   LSSLIYEIGPMQFDFSSSSGTKPILKYNPYSWTKVANVIFLDAPVGTGFSYATTDTAYNV  140

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            +DT SA  TY FL +WL+ HP+FL NPLY+ GDSYSG+ +P++V+NI DG+E+G +P++N
Sbjct  141  SDTSSAAQTYEFLRKWLVSHPSFLANPLYITGDSYSGVVIPIIVKNIQDGIEAGHQPQMN  200

Query  642  MKG  650
            + G
Sbjct  201  LVG  203



>ref|XP_010028342.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Eucalyptus 
grandis]
Length=430

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 148/182 (81%), Gaps = 0/182 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            AVV++LPGF   LPFKL TGY+GVGE QE+QLFYYFIESE+SP+ DPLLLWLTGGPGCS 
Sbjct  21   AVVKSLPGFSGDLPFKLETGYVGVGELQEVQLFYYFIESERSPKDDPLLLWLTGGPGCSA  80

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            LS   FEIGPL  +Y++S+ + P L+LNPY+WTK+ANIIF+D PVGTG+SY+    AYN+
Sbjct  81   LSGLLFEIGPLQFDYSDSSENRPVLKLNPYSWTKIANIIFLDAPVGTGFSYATAWRAYNS  140

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            +DT SA  TY FL +WL+ HP FL NPLY+ GDSYSG+ VP++V+ +YDG E+G EP +N
Sbjct  141  SDTSSATQTYEFLRKWLMSHPRFLTNPLYITGDSYSGVVVPIIVKEVYDGNEAGREPPMN  200

Query  642  MK  647
            +K
Sbjct  201  LK  202



>ref|XP_010028345.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
 gb|KCW55077.1| hypothetical protein EUGRSUZ_I01042 [Eucalyptus grandis]
Length=464

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 153/183 (84%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            A+VE+LPGFP +LPFKL TGY+GVGE +E+QLFYYFIESE+SP+ DPLLLWLTGGPGCS 
Sbjct  21   AIVESLPGFPGELPFKLETGYVGVGELEEVQLFYYFIESERSPKDDPLLLWLTGGPGCSS  80

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            LS   +EIGP+  ++++S+G  P L+ NPY+WTK+ANIIF+D PVGTG+SY+ T  AYN 
Sbjct  81   LSGLIYEIGPMQFDFSSSSGTKPILKYNPYSWTKIANIIFLDAPVGTGFSYATTPTAYNI  140

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            +DT SA  TY FL +WL+ +P+FL NPLYV+GDSYSG+ +P+VV+NI DG+E+G +P++N
Sbjct  141  SDTSSAAQTYEFLRKWLVSYPSFLANPLYVSGDSYSGVVIPIVVKNIQDGIEAGRQPQMN  200

Query  642  MKG  650
            + G
Sbjct  201  LVG  203



>ref|XP_007201135.1| hypothetical protein PRUPE_ppa016992mg, partial [Prunus persica]
 gb|EMJ02334.1| hypothetical protein PRUPE_ppa016992mg, partial [Prunus persica]
Length=450

 Score =   258 bits (659),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 148/183 (81%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            + ++TLPGF  +LPFKL TGY+GVG+  ++QLFYYFIESE+SP+ DPL+LWLTGGPGCSG
Sbjct  8    STIDTLPGFSGELPFKLETGYVGVGDLDDVQLFYYFIESERSPKEDPLVLWLTGGPGCSG  67

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
             S   ++IGP+  NYANS+G+ P L LNPY+WTKVANIIF+DQPVG+G+SY+++   Y T
Sbjct  68   FSGLAYQIGPIMFNYANSSGNEPTLMLNPYSWTKVANIIFLDQPVGSGFSYAKSWQGYET  127

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
             D  SA HTY FL +WL DHP FL NPLY+AGDSYSGITVP+VV+ + +G E G EP LN
Sbjct  128  GDISSASHTYEFLRKWLKDHPEFLKNPLYIAGDSYSGITVPIVVQEVSNGNEVGHEPPLN  187

Query  642  MKG  650
            +KG
Sbjct  188  LKG  190



>ref|XP_008236294.1| PREDICTED: serine carboxypeptidase-like 14 [Prunus mume]
Length=463

 Score =   255 bits (652),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 148/183 (81%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            + ++TLPGF  +LPFKL TGY+GVG+  ++QLFYYFIESE+SP+ DPL+LWLTGGPGCSG
Sbjct  21   STIDTLPGFSGELPFKLETGYVGVGDLDDVQLFYYFIESERSPKEDPLVLWLTGGPGCSG  80

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
             S   ++IGP+  NYANS+G+ P L LNPY+WTKVANIIF+DQPVG+G+SY+++ + Y T
Sbjct  81   FSGLAYQIGPIMFNYANSSGNEPTLVLNPYSWTKVANIIFLDQPVGSGFSYAKSWEGYET  140

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
             D  SA HTY FL +WL DHP FL NPLY+AGDSYSGITVP+VV+ + +G E   EP LN
Sbjct  141  GDISSAAHTYEFLRKWLKDHPEFLKNPLYIAGDSYSGITVPIVVQEVSNGNEVRHEPPLN  200

Query  642  MKG  650
            +KG
Sbjct  201  LKG  203



>ref|XP_008236346.1| PREDICTED: serine carboxypeptidase-like 18 [Prunus mume]
Length=444

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 147/184 (80%), Gaps = 1/184 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +++ TLPGF   LPFKL TGY+GVG   +IQLFY+FIESE+SP+ DPLLLWL+GGPGCS 
Sbjct  21   SIINTLPGFSGNLPFKLETGYVGVGNLDDIQLFYFFIESERSPKEDPLLLWLSGGPGCSS  80

Query  282  LSAFFFE-IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             +A  ++ IGPL  NYANS+G+ P   LNPYAWTK+AN+IF+DQPVGTGYSY+++ + Y 
Sbjct  81   FTAMVYDSIGPLIFNYANSSGNEPTFLLNPYAWTKIANVIFLDQPVGTGYSYAKSWEEYR  140

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            T DTLS+  TY FL +WL DHP FL NPLY+AGDSYSGITVP+V + + +G E+G EP +
Sbjct  141  TGDTLSSSQTYEFLRKWLKDHPRFLKNPLYIAGDSYSGITVPIVAQQVSNGNEAGHEPPM  200

Query  639  NMKG  650
            N+KG
Sbjct  201  NLKG  204



>ref|XP_011030311.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Populus 
euphratica]
Length=446

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 147/184 (80%), Gaps = 1/184 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +++++LPGF   LPF L TGYIGVGE + +QLFYYF+ESE+SP+ DPL+LWLTGGPGCS 
Sbjct  35   SIIKSLPGFHGNLPFVLETGYIGVGELEAVQLFYYFVESERSPKDDPLVLWLTGGPGCSA  94

Query  282  LSAFFFEIGPLTINYANSTGD-IPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            LS F +EIGPL+ +YA S+G   P L LNPY+WTK+ANIIFVD PVGTG+SYS T + Y+
Sbjct  95   LSGFIYEIGPLSFDYAKSSGGGKPVLALNPYSWTKIANIIFVDAPVGTGFSYSTTWEGYD  154

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             +DTLSA  TY FL +WL+DHP FL NPLYVAGDSYSGI  P++V+ I DG E G +P +
Sbjct  155  VSDTLSAAETYEFLRKWLVDHPKFLTNPLYVAGDSYSGIVAPIIVQEISDGNEVGRQPTM  214

Query  639  NMKG  650
            N+KG
Sbjct  215  NLKG  218



>ref|XP_011030309.1| PREDICTED: serine carboxypeptidase-like 18 isoform X3 [Populus 
euphratica]
Length=446

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 147/185 (79%), Gaps = 1/185 (1%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             +++++LPGF   LPF L TGYIGVGE + +QLFYYF+ESE+SP+ DPL+LWLTGGPGCS
Sbjct  34   KSIIKSLPGFHGNLPFVLETGYIGVGELEAVQLFYYFVESERSPKDDPLVLWLTGGPGCS  93

Query  279  GLSAFFFEIGPLTINYANSTGD-IPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
             LS F +EIGPL+ +YA S+G   P L LNPY+WTK+ANIIFVD PVGTG+SYS T + Y
Sbjct  94   ALSGFIYEIGPLSFDYAKSSGGGKPVLALNPYSWTKIANIIFVDAPVGTGFSYSTTWEGY  153

Query  456  NTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPR  635
            + +DTLSA  TY FL +WL+DHP FL NPLYVAGDSYSGI  P++V+ I DG E G +P 
Sbjct  154  DVSDTLSAAETYEFLRKWLVDHPKFLTNPLYVAGDSYSGIVAPIIVQEISDGNEVGRQPT  213

Query  636  LNMKG  650
            +N+KG
Sbjct  214  MNLKG  218



>ref|XP_010647903.1| PREDICTED: serine carboxypeptidase-like 13 [Vitis vinifera]
Length=464

 Score =   254 bits (648),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 147/184 (80%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             ++++TLPGF   LPFKL TGY+GVG+S +IQLFYYFIESE++P  DPL+LWLTGGPGCS
Sbjct  18   ESIIKTLPGFEGDLPFKLETGYVGVGKSDDIQLFYYFIESERNPSLDPLMLWLTGGPGCS  77

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              S   +EIGPL  +YAN +GDIP L  NPY+WTKVA+IIF+D PVG+G+SY+++S+ Y 
Sbjct  78   AFSGLVYEIGPLIFDYANRSGDIPALLSNPYSWTKVASIIFLDSPVGSGFSYAQSSEGYR  137

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            T+D+L+A H Y FL +WL+DHP FL N LY+AGDSYSG+ VP++ + I DG E+G EP +
Sbjct  138  TSDSLAAAHGYDFLKKWLIDHPEFLRNRLYIAGDSYSGLFVPIIAQKISDGNEAGQEPHM  197

Query  639  NMKG  650
            N+ G
Sbjct  198  NLNG  201



>ref|XP_009343183.1| PREDICTED: serine carboxypeptidase-like 18 isoform X3 [Pyrus 
x bretschneideri]
Length=371

 Score =   251 bits (640),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 143/183 (78%), Gaps = 1/183 (1%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            ++  LPGFP  LPFKL TGY+GVG+  ++QLFYYFIESE SPE DPL+LWLTGGPGCS  
Sbjct  22   IITALPGFPGNLPFKLETGYVGVGDIDDVQLFYYFIESEGSPEYDPLVLWLTGGPGCSAF  81

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY-NT  461
            SA  +EIGPL+ +YA+S G+ P L+LNPY+WTKVANIIFVD PVGTG+SY++T   Y N 
Sbjct  82   SALVYEIGPLSFDYADSIGNKPKLKLNPYSWTKVANIIFVDAPVGTGFSYAKTWRGYANM  141

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            +DTLSA  TY FL +WL+DHP F NNPLY+ GDSYSGI +PL+V+ I DG      P +N
Sbjct  142  SDTLSAAQTYEFLRKWLMDHPKFFNNPLYIGGDSYSGIVIPLIVQEISDGNHDDNMPPMN  201

Query  642  MKG  650
            +KG
Sbjct  202  IKG  204



>ref|XP_011030308.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Populus 
euphratica]
Length=455

 Score =   252 bits (644),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 147/184 (80%), Gaps = 1/184 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +++++LPGF   LPF L TGYIGVGE + +QLFYYF+ESE+SP+ DPL+LWLTGGPGCS 
Sbjct  35   SIIKSLPGFHGNLPFVLETGYIGVGELEAVQLFYYFVESERSPKDDPLVLWLTGGPGCSA  94

Query  282  LSAFFFEIGPLTINYANSTGD-IPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            LS F +EIGPL+ +YA S+G   P L LNPY+WTK+ANIIFVD PVGTG+SYS T + Y+
Sbjct  95   LSGFIYEIGPLSFDYAKSSGGGKPVLALNPYSWTKIANIIFVDAPVGTGFSYSTTWEGYD  154

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             +DTLSA  TY FL +WL+DHP FL NPLYVAGDSYSGI  P++V+ I DG E G +P +
Sbjct  155  VSDTLSAAETYEFLRKWLVDHPKFLTNPLYVAGDSYSGIVAPIIVQEISDGNEVGRQPTM  214

Query  639  NMKG  650
            N+KG
Sbjct  215  NLKG  218



>ref|XP_007200784.1| hypothetical protein PRUPE_ppa024053mg [Prunus persica]
 gb|EMJ01983.1| hypothetical protein PRUPE_ppa024053mg [Prunus persica]
Length=456

 Score =   252 bits (644),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 146/184 (79%), Gaps = 1/184 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +++ TLPGF   LPFKL TGY+GVG   +IQLFY+FIESE+SP+ DPLLLWL+GGPGCS 
Sbjct  22   SIINTLPGFSGDLPFKLETGYVGVGNLDDIQLFYFFIESERSPKEDPLLLWLSGGPGCSS  81

Query  282  LSAFFFE-IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             +A  ++ IGPL  NYANS+G+ P   LNPYAWTK+AN+IF+DQPVGTGYSY+++ + Y 
Sbjct  82   FTAMVYDSIGPLIFNYANSSGNEPTFLLNPYAWTKIANVIFLDQPVGTGYSYAKSWEEYR  141

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            T DTLS   TY FL +WL DHP FL NPLY+AGDSYSGITVP+V + + +G E+G EP +
Sbjct  142  TGDTLSCTQTYEFLRKWLKDHPQFLKNPLYIAGDSYSGITVPIVAQQVSNGNEAGHEPPM  201

Query  639  NMKG  650
            N+KG
Sbjct  202  NLKG  205



>ref|XP_011030310.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Populus 
euphratica]
Length=484

 Score =   253 bits (646),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 147/184 (80%), Gaps = 1/184 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +++++LPGF   LPF L TGYIGVGE + +QLFYYF+ESE+SP+ DPL+LWLTGGPGCS 
Sbjct  35   SIIKSLPGFHGNLPFVLETGYIGVGELEAVQLFYYFVESERSPKDDPLVLWLTGGPGCSA  94

Query  282  LSAFFFEIGPLTINYANSTGD-IPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            LS F +EIGPL+ +YA S+G   P L LNPY+WTK+ANIIFVD PVGTG+SYS T + Y+
Sbjct  95   LSGFIYEIGPLSFDYAKSSGGGKPVLALNPYSWTKIANIIFVDAPVGTGFSYSTTWEGYD  154

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             +DTLSA  TY FL +WL+DHP FL NPLYVAGDSYSGI  P++V+ I DG E G +P +
Sbjct  155  VSDTLSAAETYEFLRKWLVDHPKFLTNPLYVAGDSYSGIVAPIIVQEISDGNEVGRQPTM  214

Query  639  NMKG  650
            N+KG
Sbjct  215  NLKG  218



>ref|XP_011030307.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Populus 
euphratica]
Length=484

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 147/184 (80%), Gaps = 1/184 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +++++LPGF   LPF L TGYIGVGE + +QLFYYF+ESE+SP+ DPL+LWLTGGPGCS 
Sbjct  35   SIIKSLPGFHGNLPFVLETGYIGVGELEAVQLFYYFVESERSPKDDPLVLWLTGGPGCSA  94

Query  282  LSAFFFEIGPLTINYANSTGD-IPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            LS F +EIGPL+ +YA S+G   P L LNPY+WTK+ANIIFVD PVGTG+SYS T + Y+
Sbjct  95   LSGFIYEIGPLSFDYAKSSGGGKPVLALNPYSWTKIANIIFVDAPVGTGFSYSTTWEGYD  154

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             +DTLSA  TY FL +WL+DHP FL NPLYVAGDSYSGI  P++V+ I DG E G +P +
Sbjct  155  VSDTLSAAETYEFLRKWLVDHPKFLTNPLYVAGDSYSGIVAPIIVQEISDGNEVGRQPTM  214

Query  639  NMKG  650
            N+KG
Sbjct  215  NLKG  218



>ref|XP_006486896.1| PREDICTED: serine carboxypeptidase-like 18-like [Citrus sinensis]
Length=470

 Score =   252 bits (644),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 143/184 (78%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              ++ TLPGF   LPFKL TGYIGVG++ ++QLFYYFIESE+SPE DPL+LWLTGGPGCS
Sbjct  21   QQIITTLPGFDGDLPFKLETGYIGVGQNDDVQLFYYFIESERSPEDDPLVLWLTGGPGCS  80

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            G S   FEIGPL+ +Y  S  ++P   LNPY+WTKVAN+IF+D PVGTG+SY+ T   Y 
Sbjct  81   GFSGLVFEIGPLSFDYEKSKVNLPKFLLNPYSWTKVANVIFLDAPVGTGFSYANTWQGYI  140

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             NDTLSA   Y FL +WL+ HP+FL NPLY+ GDSYSGI VP++V+++ DG++ G  PR+
Sbjct  141  MNDTLSAAQNYYFLRKWLIAHPSFLANPLYIGGDSYSGIIVPMIVQHVSDGIDVGHRPRM  200

Query  639  NMKG  650
            N+KG
Sbjct  201  NLKG  204



>emb|CBI22421.3| unnamed protein product [Vitis vinifera]
Length=589

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 147/183 (80%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++++TLPGF   LPFKL TGY+GVG+S +IQLFYYFIESE++P  DPL+LWLTGGPGCS 
Sbjct  144  SIIKTLPGFEGDLPFKLETGYVGVGKSDDIQLFYYFIESERNPSLDPLMLWLTGGPGCSA  203

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
             S   +EIGPL  +YAN +GDIP L  NPY+WTKVA+IIF+D PVG+G+SY+++S+ Y T
Sbjct  204  FSGLVYEIGPLIFDYANRSGDIPALLSNPYSWTKVASIIFLDSPVGSGFSYAQSSEGYRT  263

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            +D+L+A H Y FL +WL+DHP FL N LY+AGDSYSG+ VP++ + I DG E+G EP +N
Sbjct  264  SDSLAAAHGYDFLKKWLIDHPEFLRNRLYIAGDSYSGLFVPIIAQKISDGNEAGQEPHMN  323

Query  642  MKG  650
            + G
Sbjct  324  LNG  326



>ref|XP_006422777.1| hypothetical protein CICLE_v10028360mg [Citrus clementina]
 gb|ESR36017.1| hypothetical protein CICLE_v10028360mg [Citrus clementina]
Length=470

 Score =   252 bits (643),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 143/184 (78%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              ++ TLPGF   LPFKL TGYIGVG++ ++QLFYYFIESE+SPE DPL+LWL+GGPGCS
Sbjct  21   QQIITTLPGFDGDLPFKLETGYIGVGQNDDVQLFYYFIESERSPEDDPLVLWLSGGPGCS  80

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            G S   FEIGPL+ +Y  S  ++P   LNPY+WTKVANIIF+D PVGTG+SY+ T   Y 
Sbjct  81   GFSGLVFEIGPLSFDYEKSKVNLPKFLLNPYSWTKVANIIFLDAPVGTGFSYANTWQGYI  140

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             NDTLSA   Y FL +WL+ HP+FL NPLY+ GDSYSGI VP++V++I DG++ G  PR+
Sbjct  141  MNDTLSAAQNYYFLRKWLIAHPSFLANPLYIGGDSYSGIIVPMIVQHISDGIDVGHRPRM  200

Query  639  NMKG  650
            N+KG
Sbjct  201  NLKG  204



>ref|XP_009343180.1| PREDICTED: serine carboxypeptidase-like 1 [Pyrus x bretschneideri]
Length=470

 Score =   252 bits (643),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 144/183 (79%), Gaps = 1/183 (1%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            ++  LPGFP+ LPFKL TGY+GVG+  ++QLFYYFIESE SPE DPL+LWLTGGPGCS  
Sbjct  22   IITALPGFPSNLPFKLETGYVGVGDMDDVQLFYYFIESEGSPEYDPLVLWLTGGPGCSAF  81

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY-NT  461
            SA  +EIGPL+ +YA+S G+ P L+LNPY+WTKVANIIFVD PVGTG+SY++T   Y N 
Sbjct  82   SALVYEIGPLSFDYADSIGNKPKLKLNPYSWTKVANIIFVDAPVGTGFSYAKTWRGYANM  141

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            +DTLSA  TY FL +WL+DHP F NNPLY+ GDSYSGI +PL+V+ I DG      P +N
Sbjct  142  SDTLSAAQTYEFLRKWLMDHPKFFNNPLYIGGDSYSGIVIPLIVQEISDGNHDDNMPPMN  201

Query  642  MKG  650
            +KG
Sbjct  202  IKG  204



>ref|XP_011457834.1| PREDICTED: serine carboxypeptidase-like 18 [Fragaria vesca subsp. 
vesca]
Length=465

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 148/185 (80%), Gaps = 2/185 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +++ TLPGF   LPFKL TGY+GVG+  ++QLFYYFIESE SPE DPL+LWLTGGPGCSG
Sbjct  19   SIINTLPGFSGDLPFKLETGYVGVGDLDDVQLFYYFIESEGSPEYDPLVLWLTGGPGCSG  78

Query  282  LSAFFFE-IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY-  455
             SA  +E IGPL+ + ANSTG+ P L+LNPY+WTKVANIIF+D PVGTGYSY++T + Y 
Sbjct  79   FSALVYESIGPLSFDAANSTGNKPQLKLNPYSWTKVANIIFLDAPVGTGYSYAKTWEGYS  138

Query  456  NTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPR  635
            N +DTLSA   Y F  +WL+DHP FL NPLYVAGDSYSGI VP+VV+ I DG E+G  P 
Sbjct  139  NMSDTLSAAEIYEFFRKWLMDHPKFLENPLYVAGDSYSGIIVPIVVQEISDGNEAGRHPP  198

Query  636  LNMKG  650
            +N++G
Sbjct  199  MNIQG  203



>ref|XP_009343914.1| PREDICTED: serine carboxypeptidase-like 7 [Pyrus x bretschneideri]
Length=462

 Score =   251 bits (641),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 143/184 (78%), Gaps = 1/184 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +++ +LPGFP  LPFKL TGY+GVG+  ++QLFYYFIESE+SPE DPL+LWLTGGP CSG
Sbjct  22   SIINSLPGFPGDLPFKLETGYVGVGDDDDVQLFYYFIESERSPENDPLVLWLTGGPACSG  81

Query  282  LSAFFF-EIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
                 +  IGPL+ +YA+S G+ P L+LNPY+WTKVANIIF+D PVGTG+SY+ T   YN
Sbjct  82   FHTLVYVNIGPLSFDYAHSIGNKPKLKLNPYSWTKVANIIFIDAPVGTGFSYATTWKGYN  141

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             +DT  A  TY FL +WL+DHP FLNNPLY+ G SYSGI VP+VV+ I DG E G+ P +
Sbjct  142  ISDTSHAAQTYQFLRKWLVDHPKFLNNPLYIGGASYSGIVVPVVVQEIADGNEKGVAPAM  201

Query  639  NMKG  650
            N+KG
Sbjct  202  NLKG  205



>ref|XP_009375674.1| PREDICTED: serine carboxypeptidase-like 7 [Pyrus x bretschneideri]
Length=462

 Score =   251 bits (640),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 143/184 (78%), Gaps = 1/184 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +++ +LPGFP  LPFKL TGY+GVG+  ++QLFYYFIESE+SPE DPL+LWLTGGP CSG
Sbjct  22   SIINSLPGFPGDLPFKLETGYVGVGDDDDVQLFYYFIESERSPENDPLVLWLTGGPACSG  81

Query  282  LSAFFF-EIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
                 +  IGPL+ +YA+S G+ P L+LNPY+WTKVANIIF+D PVGTG+SY+ T   YN
Sbjct  82   FHTLVYVNIGPLSFDYAHSIGNKPKLKLNPYSWTKVANIIFIDAPVGTGFSYATTWKGYN  141

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             +DT  A  TY FL +WL+DHP FLNNPLY+ G SYSGI VP+VV+ I DG E G+ P +
Sbjct  142  ISDTSHAAQTYQFLRKWLVDHPKFLNNPLYIGGASYSGIVVPVVVQEIADGNEKGVAPAM  201

Query  639  NMKG  650
            N+KG
Sbjct  202  NLKG  205



>ref|XP_009343181.1| PREDICTED: serine carboxypeptidase-like 1 isoform X1 [Pyrus x 
bretschneideri]
Length=470

 Score =   251 bits (640),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 143/183 (78%), Gaps = 1/183 (1%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            ++  LPGFP  LPFKL TGY+GVG+  ++QLFYYFIESE SPE DPL+LWLTGGPGCS  
Sbjct  22   IITALPGFPGNLPFKLETGYVGVGDIDDVQLFYYFIESEGSPEYDPLVLWLTGGPGCSAF  81

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY-NT  461
            SA  +EIGPL+ +YA+S G+ P L+LNPY+WTKVANIIFVD PVGTG+SY++T   Y N 
Sbjct  82   SALVYEIGPLSFDYADSIGNKPKLKLNPYSWTKVANIIFVDAPVGTGFSYAKTWRGYANM  141

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            +DTLSA  TY FL +WL+DHP F NNPLY+ GDSYSGI +PL+V+ I DG      P +N
Sbjct  142  SDTLSAAQTYEFLRKWLMDHPKFFNNPLYIGGDSYSGIVIPLIVQEISDGNHDDNMPPMN  201

Query  642  MKG  650
            +KG
Sbjct  202  IKG  204



>ref|XP_006486895.1| PREDICTED: serine carboxypeptidase-like 18-like [Citrus sinensis]
Length=476

 Score =   251 bits (640),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 140/184 (76%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H  V  LPGF   LPFKL TGYIGVGE+ ++QLFYYFIESE+SPE DPL+LWLTGGPGCS
Sbjct  27   HQTVAALPGFDGHLPFKLETGYIGVGENDDVQLFYYFIESERSPEDDPLVLWLTGGPGCS  86

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            G S   FEIGPL  +Y NS   +P   LN Y+WTKVANIIF+D PVGTG+SY+ + + Y 
Sbjct  87   GFSGLVFEIGPLVFDYENSKASLPRFSLNQYSWTKVANIIFLDAPVGTGFSYANSWEGYI  146

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             NDTLSA   Y FL +WL+ H  FL NPLY+AGDSYSG  VP+VV+ I DG+++G +PR+
Sbjct  147  MNDTLSATQIYHFLRKWLIVHSDFLANPLYIAGDSYSGKIVPIVVQEISDGIDAGHKPRM  206

Query  639  NMKG  650
            N+KG
Sbjct  207  NLKG  210



>ref|XP_002522133.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF40333.1| serine carboxypeptidase, putative [Ricinus communis]
Length=480

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              +V+TLPGFP KLPFK+ TGY+GVGE +++QLFYYF ESE+ P  DPL+LWLTGGPGCS
Sbjct  36   QTIVDTLPGFPGKLPFKMETGYVGVGEMEDVQLFYYFFESERDPTFDPLVLWLTGGPGCS  95

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            G SA  FE GPL I Y   TG +P L+LNP++WTKVA+II++D PVG+G+SY+ T++  N
Sbjct  96   GFSAIAFENGPLAIAYDTYTGGLPSLKLNPFSWTKVASIIYIDAPVGSGFSYATTNEGAN  155

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            T+DTLSA  +Y FL +WL++HP FL + +Y+ GDSYSGI VPL+V+NI +G+ESG++P +
Sbjct  156  TSDTLSAHQSYIFLRKWLMNHPKFLGSQIYIGGDSYSGIIVPLLVQNILEGIESGLKPSI  215

Query  639  NMKG  650
            +++G
Sbjct  216  DLQG  219



>ref|XP_009614133.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Nicotiana 
tomentosiformis]
Length=451

 Score =   249 bits (635),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = +3

Query  162  YIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLSAFFFEIGPLTINYANSTG  341
            Y+GVGE +++QL+YYF+ESE+ PE DPL+LWLTGGPGCSGLS+F +EIGPLT +YANS G
Sbjct  28   YVGVGEEEKVQLYYYFVESERDPENDPLMLWLTGGPGCSGLSSFVYEIGPLTFDYANSIG  87

Query  342  DIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDH  521
            D P LEL   +WTKVANIIF+DQP G+GYSY++TS+AYN NDTL+   TY FL +WL+DH
Sbjct  88   DFPKLELKSNSWTKVANIIFIDQPAGSGYSYAKTSEAYNFNDTLAVALTYEFLRKWLMDH  147

Query  522  PTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKG  650
            P FL NPLYV+GDSYSGI V L+ R IYDG+E G +PR+N+KG
Sbjct  148  PEFLKNPLYVSGDSYSGIFVALLTRRIYDGIEVGEKPRVNIKG  190



>ref|XP_006369725.1| hypothetical protein POPTR_0001s29900g [Populus trichocarpa]
 gb|ERP66294.1| hypothetical protein POPTR_0001s29900g [Populus trichocarpa]
Length=441

 Score =   249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 146/184 (79%), Gaps = 1/184 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +++++LPGF   LPF L TGYIGVGE + +QLFYYFIESE+SP+ DPL+LWLTGGPGCS 
Sbjct  20   SIIKSLPGFDGNLPFVLETGYIGVGELEAVQLFYYFIESERSPKDDPLVLWLTGGPGCSA  79

Query  282  LSAFFFEIGPLTINYANSTGD-IPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            LS   +EIGPL+ +YA S+G   P L LNPY+WTK+ANIIFVD PVGTG+SYS T + Y+
Sbjct  80   LSGIIYEIGPLSFDYAKSSGGGKPVLALNPYSWTKIANIIFVDAPVGTGFSYSTTWEGYH  139

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             +DT+SA  TY FL +WL+DHP FL NPLYVAGDSY+GI  P++V+ I DG E G +P +
Sbjct  140  VSDTISAAETYEFLRKWLVDHPKFLTNPLYVAGDSYTGIVAPIIVQEISDGNEVGHQPTM  199

Query  639  NMKG  650
            N+KG
Sbjct  200  NLKG  203



>emb|CBI22419.3| unnamed protein product [Vitis vinifera]
Length=463

 Score =   248 bits (634),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 143/184 (78%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             ++VETLPGFP KLPFKL TGYI VG+  ++QLFYYFIESE++P  DPL+LWLTGGPGCS
Sbjct  18   QSIVETLPGFPGKLPFKLETGYISVGDVDDVQLFYYFIESERNPRLDPLVLWLTGGPGCS  77

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            G SA  +EIGPL  +     G +P L+LNPY+WTKVA+IIF+D PVGTG+SY+ETS  YN
Sbjct  78   GFSALVYEIGPLAFDVEGYDGILPTLKLNPYSWTKVASIIFIDAPVGTGFSYAETSYGYN  137

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             +DT SA  TY FL +WL  HP F  NPLY+ GDSYSGI  P+++++I  GLE G++P++
Sbjct  138  VSDTSSAAQTYQFLRKWLTFHPNFAGNPLYIGGDSYSGIVAPILIKDILHGLEVGLQPKI  197

Query  639  NMKG  650
             ++G
Sbjct  198  ELQG  201



>gb|KDP44532.1| hypothetical protein JCGZ_16365 [Jatropha curcas]
Length=472

 Score =   248 bits (634),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 146/184 (79%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              ++ETLPGFP KLPFK+ TGYI VGE Q+++LFYYF ESE+ P  DPL+LWLTGGPGCS
Sbjct  28   QTIIETLPGFPGKLPFKMETGYISVGEMQDVELFYYFFESERDPIYDPLVLWLTGGPGCS  87

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            G SA  FE GPL I     +G +P L+LNPY+WTKVA+IIF+D PVG G+SY+ T++  N
Sbjct  88   GFSAIAFENGPLAIARDTYSGGLPSLKLNPYSWTKVASIIFIDAPVGAGFSYATTAEGRN  147

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            T+DTLSA  TY+FL +WL+ HP FL + +Y+ GDSYSGI VPLVV+NI +G+ESG++P +
Sbjct  148  TSDTLSAFQTYNFLRRWLVSHPKFLGSQVYIGGDSYSGIVVPLVVQNILEGIESGLKPSI  207

Query  639  NMKG  650
            +++G
Sbjct  208  DLQG  211



>ref|XP_002269439.1| PREDICTED: serine carboxypeptidase-like 7 [Vitis vinifera]
Length=488

 Score =   249 bits (635),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 143/184 (78%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             ++VETLPGFP KLPFKL TGYI VG+  ++QLFYYFIESE++P  DPL+LWLTGGPGCS
Sbjct  43   QSIVETLPGFPGKLPFKLETGYISVGDVDDVQLFYYFIESERNPRLDPLVLWLTGGPGCS  102

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            G SA  +EIGPL  +     G +P L+LNPY+WTKVA+IIF+D PVGTG+SY+ETS  YN
Sbjct  103  GFSALVYEIGPLAFDVEGYDGILPTLKLNPYSWTKVASIIFIDAPVGTGFSYAETSYGYN  162

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             +DT SA  TY FL +WL  HP F  NPLY+ GDSYSGI  P+++++I  GLE G++P++
Sbjct  163  VSDTSSAAQTYQFLRKWLTFHPNFAGNPLYIGGDSYSGIVAPILIKDILHGLEVGLQPKI  222

Query  639  NMKG  650
             ++G
Sbjct  223  ELQG  226



>ref|XP_006369726.1| hypothetical protein POPTR_0001s29910g [Populus trichocarpa]
 gb|ERP66295.1| hypothetical protein POPTR_0001s29910g [Populus trichocarpa]
Length=334

 Score =   244 bits (623),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 144/185 (78%), Gaps = 1/185 (1%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             +++++LPGF   LPF L TGYIGVGE + +QLFYYFIESE+SP+ DPL+LWLTGGPGCS
Sbjct  34   KSIIKSLPGFDGNLPFVLETGYIGVGELEAVQLFYYFIESERSPKDDPLVLWLTGGPGCS  93

Query  279  GLSAFFFEIGPLTINYANSTGD-IPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
             LS   +EIGPL+ +YA S+G   P   LNPY+WTK+ANIIFVD PVGTG+SYS T + Y
Sbjct  94   ALSGIIYEIGPLSFDYAKSSGGGKPVFALNPYSWTKIANIIFVDAPVGTGFSYSTTWEGY  153

Query  456  NTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPR  635
            + +DT+SA  TY FL +WL+DHP FL N LYVAGDS+SGI  P++V+ I DG E G +P 
Sbjct  154  HVSDTISAAETYEFLRKWLVDHPKFLANQLYVAGDSFSGIVAPIIVQEISDGNEVGRQPT  213

Query  636  LNMKG  650
            +N+KG
Sbjct  214  MNLKG  218



>ref|XP_002298786.2| hypothetical protein POPTR_0001s29870g [Populus trichocarpa]
 gb|EEE83591.2| hypothetical protein POPTR_0001s29870g [Populus trichocarpa]
Length=469

 Score =   248 bits (632),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 145/185 (78%), Gaps = 1/185 (1%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             +++++LPGF   LPF L TGYIGVGE + +QLFYYFIESE+SP+ DPL+LWLTGGPGCS
Sbjct  19   KSIIKSLPGFDGNLPFVLETGYIGVGELEAVQLFYYFIESERSPKDDPLVLWLTGGPGCS  78

Query  279  GLSAFFFEIGPLTINYANSTGD-IPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
             LS   +EIGPL+ +YA S+G   P   LNPY+WTK+ANIIFVD PVGTG+SYS T + Y
Sbjct  79   ALSGLIYEIGPLSFDYAKSSGGGKPVFALNPYSWTKIANIIFVDAPVGTGFSYSTTGEGY  138

Query  456  NTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPR  635
            + +DT+SA  TY FL +WL+DHP FL NPLYVAGDS+SGI  P++V+ I DG E G +P 
Sbjct  139  HVSDTISAAETYEFLRKWLVDHPKFLTNPLYVAGDSFSGIVAPIIVQEISDGNEVGRQPT  198

Query  636  LNMKG  650
            +N+KG
Sbjct  199  INLKG  203



>ref|XP_010065873.1| PREDICTED: serine carboxypeptidase-like 2 [Eucalyptus grandis]
 gb|KCW63566.1| hypothetical protein EUGRSUZ_G01194 [Eucalyptus grandis]
Length=470

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 141/184 (77%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              VV+ LPG P  LPF L TGYIGVGE  ++QLFYYF+ESE+SP  DPL+LWLTGGPGCS
Sbjct  25   QTVVKLLPGLPGDLPFYLETGYIGVGELDDVQLFYYFVESERSPRDDPLVLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LS   +EIGP T NY  ST   P L+LN Y+WTKVANIIF+DQPVGTG+SY+ + ++YN
Sbjct  85   ALSGLIYEIGPFTFNYEKSTRFRPALKLNDYSWTKVANIIFLDQPVGTGFSYANSWESYN  144

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             ND +S   +Y FL +WL  HP FL+NPLY+AGDSYSG+TVP+V   +  G E+G+EP++
Sbjct  145  MNDNISVAESYEFLRKWLKLHPQFLSNPLYIAGDSYSGVTVPMVALEVDKGNEAGLEPKI  204

Query  639  NMKG  650
            N+KG
Sbjct  205  NLKG  208



>ref|XP_006422780.1| hypothetical protein CICLE_v10028349mg [Citrus clementina]
 gb|ESR36020.1| hypothetical protein CICLE_v10028349mg [Citrus clementina]
Length=476

 Score =   246 bits (629),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 139/184 (76%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H  V TLPGF   LPFKL TGYIGVG+  ++QLFYYFIESE+SPE DPL+LWLTGGPGCS
Sbjct  27   HQTVATLPGFDGHLPFKLETGYIGVGDDDDVQLFYYFIESERSPEDDPLVLWLTGGPGCS  86

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            G S   FEIGPL  +Y +S   +P   LN Y+WTKVAN+IF+D PVGTG+SY+ +   Y 
Sbjct  87   GFSGLVFEIGPLVFDYESSRPSLPRFSLNQYSWTKVANVIFLDAPVGTGFSYANSWQGYI  146

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             NDTLSA   Y FL +WL+ H  FL NPLY+AGDSYSG  VP+VV+ I DG+++G +PR+
Sbjct  147  MNDTLSATQIYHFLRKWLVVHSDFLANPLYIAGDSYSGKIVPIVVQEISDGIDAGHKPRM  206

Query  639  NMKG  650
            N+KG
Sbjct  207  NLKG  210



>ref|XP_002534183.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF28200.1| serine carboxypeptidase, putative [Ricinus communis]
Length=329

 Score =   242 bits (617),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 140/184 (76%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              VV TLPGF  +LPF L TGYIGVGES E QLFYYF+ES++SP  DPL+LWLTGGPGCS
Sbjct  31   KTVVTTLPGFDGELPFYLETGYIGVGESNESQLFYYFVESQRSPAVDPLMLWLTGGPGCS  90

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LSAFF+E GP+T +Y+N  G +P L LNP+AWT+  NI++VD P+GTG+SYS T + Y 
Sbjct  91   VLSAFFYESGPVTFDYSNYNGSLPSLHLNPFAWTQGINILYVDAPIGTGFSYSTTQENYY  150

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             +D  SA  TY FL +WLLDHP FL N L++ GDSYSGI +P++V ++ DG E G+ P +
Sbjct  151  VDDIKSAAQTYEFLRKWLLDHPQFLQNQLFIGGDSYSGIPLPIIVSHVLDGNELGLTPMM  210

Query  639  NMKG  650
            N+KG
Sbjct  211  NLKG  214



>ref|XP_008236293.1| PREDICTED: serine carboxypeptidase-like 18 isoform X3 [Prunus 
mume]
Length=439

 Score =   245 bits (626),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 146/184 (79%), Gaps = 2/184 (1%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +++TLPGF   LPFKL TGY+GVG   ++QLFYYF ESE SPE DPL+LWLTGGPGCS  
Sbjct  32   IIKTLPGFRGDLPFKLETGYVGVGGMDDVQLFYYFFESEGSPEYDPLVLWLTGGPGCSAF  91

Query  285  SAFFFE-IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY-N  458
            SA  +E +GPL+ +YA+S G+ P LELNPY+WTKVANIIF+D PVGTG+SY++T + Y N
Sbjct  92   SAIVYENLGPLSFDYAHSIGNKPKLELNPYSWTKVANIIFLDAPVGTGFSYAKTWEGYSN  151

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             NDTLSA  TY FL +WL+DHP F N+PLY+AGDSYSGITVP++V+ I DG +    P +
Sbjct  152  LNDTLSAAQTYEFLRKWLMDHPKFYNSPLYIAGDSYSGITVPMLVQEISDGNQDEHVPPM  211

Query  639  NMKG  650
            N+KG
Sbjct  212  NLKG  215



>ref|XP_006486897.1| PREDICTED: serine carboxypeptidase-like 17-like [Citrus sinensis]
Length=468

 Score =   246 bits (628),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 142/184 (77%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              ++ TLPGF   LPFKL TGYIGVGE+ ++QLFYYFIESE+SPE DPL+LWL+GGPGCS
Sbjct  21   RQIITTLPGFDGDLPFKLETGYIGVGENDDVQLFYYFIESERSPEDDPLVLWLSGGPGCS  80

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            G SA  +++GPL  +Y NS  + P L LNPY+WTKVA+IIF+D P GTG+SY +    + 
Sbjct  81   GFSALAYQLGPLAFDYENSRENSPKLLLNPYSWTKVASIIFIDAPAGTGFSYVKNWQGFV  140

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             NDTLSA  TY FL +WL+ HP+FL NPLY+ GDSYSG  +P+VV+ I DG++ G EPR+
Sbjct  141  MNDTLSAVQTYFFLRKWLIAHPSFLANPLYIFGDSYSGKVLPIVVQKISDGIDLGDEPRM  200

Query  639  NMKG  650
            N+KG
Sbjct  201  NLKG  204



>gb|KCW63574.1| hypothetical protein EUGRSUZ_G01198 [Eucalyptus grandis]
Length=436

 Score =   245 bits (625),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 140/184 (76%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              VV++LPG P  LPF L TGYIGVGE  ++QLFYYF+ESE+SP  DPL+LWLTGGPGCS
Sbjct  25   QTVVKSLPGLPGDLPFYLETGYIGVGELDDVQLFYYFVESERSPRDDPLVLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LS   +EIGP T NY  ST   P L+LN Y+WTKVANIIF+DQPVGTG+SY+   ++YN
Sbjct  85   ALSGLIYEIGPFTFNYEKSTRFRPSLKLNDYSWTKVANIIFLDQPVGTGFSYANNWESYN  144

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             ND +S   +Y FL +WL  HP FL+NPLY+AGDSYSG+TVP V   +  G E+G+EP++
Sbjct  145  INDNISVAESYEFLRKWLKLHPQFLSNPLYIAGDSYSGVTVPRVALEVDKGNEAGLEPKM  204

Query  639  NMKG  650
            N++G
Sbjct  205  NLEG  208



>ref|XP_002522135.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF40335.1| serine carboxypeptidase, putative [Ricinus communis]
Length=478

 Score =   246 bits (627),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 145/184 (79%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             +++++LPGF   LPF L TGYIGVG+ +E+QLFYYF+ESE+SPE DPL+LWLTGGPGCS
Sbjct  29   QSIIKSLPGFDGNLPFFLETGYIGVGKMEEVQLFYYFVESERSPENDPLMLWLTGGPGCS  88

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              S   +E+GPL  NY +S  + P  ELNPY+WTKVANIIF+D PVGTG+SY++T +AY+
Sbjct  89   AFSGLVYEVGPLKFNYVDSKHNKPVFELNPYSWTKVANIIFLDSPVGTGFSYAKTGEAYH  148

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             NDT++A   Y FL +WL+ +P FL NPLY+ GDSYSGI VP+VV+ I +G E G++P +
Sbjct  149  VNDTIAAAEIYDFLRKWLVSNPQFLANPLYIGGDSYSGIIVPIVVQEILNGNEMGLQPPM  208

Query  639  NMKG  650
            +++G
Sbjct  209  DLRG  212



>gb|KCW63573.1| hypothetical protein EUGRSUZ_G01198 [Eucalyptus grandis]
Length=441

 Score =   244 bits (624),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 140/184 (76%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              VV++LPG P  LPF L TGYIGVGE  ++QLFYYF+ESE+SP  DPL+LWLTGGPGCS
Sbjct  25   QTVVKSLPGLPGDLPFYLETGYIGVGELDDVQLFYYFVESERSPRDDPLVLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LS   +EIGP T NY  ST   P L+LN Y+WTKVANIIF+DQPVGTG+SY+   ++YN
Sbjct  85   ALSGLIYEIGPFTFNYEKSTRFRPSLKLNDYSWTKVANIIFLDQPVGTGFSYANNWESYN  144

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             ND +S   +Y FL +WL  HP FL+NPLY+AGDSYSG+TVP V   +  G E+G+EP++
Sbjct  145  INDNISVAESYEFLRKWLKLHPQFLSNPLYIAGDSYSGVTVPRVALEVDKGNEAGLEPKM  204

Query  639  NMKG  650
            N++G
Sbjct  205  NLEG  208



>ref|XP_010065870.1| PREDICTED: serine carboxypeptidase-like 13 isoform X2 [Eucalyptus 
grandis]
Length=441

 Score =   244 bits (624),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 140/184 (76%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              VV++LPG P  LPF L TGYIGVGE  ++QLFYYF+ESE+SP  DPL+LWLTGGPGCS
Sbjct  25   QTVVKSLPGLPGDLPFYLETGYIGVGELDDVQLFYYFVESERSPRDDPLVLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LS   +EIGP T NY  ST   P L+LN Y+WTKVANIIF+DQPVGTG+SY+   ++YN
Sbjct  85   ALSGLIYEIGPFTFNYEKSTRFRPSLKLNDYSWTKVANIIFLDQPVGTGFSYANNWESYN  144

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             ND +S   +Y FL +WL  HP FL+NPLY+AGDSYSG+TVP V   +  G E+G+EP++
Sbjct  145  INDNISVAESYEFLRKWLKLHPQFLSNPLYIAGDSYSGVTVPRVALEVDKGNEAGLEPKM  204

Query  639  NMKG  650
            N++G
Sbjct  205  NLEG  208



>gb|KCW63571.1| hypothetical protein EUGRSUZ_G01198 [Eucalyptus grandis]
Length=471

 Score =   245 bits (626),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 140/184 (76%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              VV++LPG P  LPF L TGYIGVGE  ++QLFYYF+ESE+SP  DPL+LWLTGGPGCS
Sbjct  25   QTVVKSLPGLPGDLPFYLETGYIGVGELDDVQLFYYFVESERSPRDDPLVLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LS   +EIGP T NY  ST   P L+LN Y+WTKVANIIF+DQPVGTG+SY+   ++YN
Sbjct  85   ALSGLIYEIGPFTFNYEKSTRFRPSLKLNDYSWTKVANIIFLDQPVGTGFSYANNWESYN  144

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             ND +S   +Y FL +WL  HP FL+NPLY+AGDSYSG+TVP V   +  G E+G+EP++
Sbjct  145  INDNISVAESYEFLRKWLKLHPQFLSNPLYIAGDSYSGVTVPRVALEVDKGNEAGLEPKM  204

Query  639  NMKG  650
            N++G
Sbjct  205  NLEG  208



>gb|KCW63578.1| hypothetical protein EUGRSUZ_G01202 [Eucalyptus grandis]
Length=420

 Score =   244 bits (622),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 144/184 (78%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              VV++LPG P  LPF L TGYIG GE +++QLFYYF++SE+SP+ DPL+LWLTGGPGCS
Sbjct  22   QTVVKSLPGLPGDLPFYLETGYIGAGEREDVQLFYYFVKSERSPKDDPLVLWLTGGPGCS  81

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LSA  +EIGP T +Y  ST D P L+LN Y+WTKVANIIF+DQPVGTG+SY+ + ++YN
Sbjct  82   ALSAILYEIGPFTFDYDKSTRDRPALKLNEYSWTKVANIIFLDQPVGTGFSYANSWESYN  141

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             ND +SA  +Y FL +WL  HP F +NPLY+AGDSYSGI VP++   + +G  +G++PR+
Sbjct  142  INDNISAAESYEFLRKWLKLHPEFQSNPLYIAGDSYSGIIVPMLTLQVDEGNIAGLKPRM  201

Query  639  NMKG  650
            N++G
Sbjct  202  NLEG  205



>ref|XP_010065869.1| PREDICTED: serine carboxypeptidase-like 2 isoform X1 [Eucalyptus 
grandis]
 gb|KCW63572.1| hypothetical protein EUGRSUZ_G01198 [Eucalyptus grandis]
Length=470

 Score =   245 bits (625),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 140/184 (76%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              VV++LPG P  LPF L TGYIGVGE  ++QLFYYF+ESE+SP  DPL+LWLTGGPGCS
Sbjct  25   QTVVKSLPGLPGDLPFYLETGYIGVGELDDVQLFYYFVESERSPRDDPLVLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LS   +EIGP T NY  ST   P L+LN Y+WTKVANIIF+DQPVGTG+SY+   ++YN
Sbjct  85   ALSGLIYEIGPFTFNYEKSTRFRPSLKLNDYSWTKVANIIFLDQPVGTGFSYANNWESYN  144

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             ND +S   +Y FL +WL  HP FL+NPLY+AGDSYSG+TVP V   +  G E+G+EP++
Sbjct  145  INDNISVAESYEFLRKWLKLHPQFLSNPLYIAGDSYSGVTVPRVALEVDKGNEAGLEPKM  204

Query  639  NMKG  650
            N++G
Sbjct  205  NLEG  208



>ref|XP_002266354.2| PREDICTED: serine carboxypeptidase-like 18 [Vitis vinifera]
Length=468

 Score =   245 bits (625),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = +3

Query  111  ETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLSA  290
            + LPGFP  LPFKL TGY+GV +  ++QLFYYF++SE++P  DPLLLWLTGGPGCS  S 
Sbjct  27   KALPGFPGNLPFKLETGYVGVDDMDDVQLFYYFVKSERNPRDDPLLLWLTGGPGCSAFSG  86

Query  291  FFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDT  470
              +E+GPL+ +YA S  ++P  +LNPY+WTK+A++IF+D PVGTG+SYS T++ YN NDT
Sbjct  87   LVYEVGPLSFDYAKSNENLPTFKLNPYSWTKLASMIFLDAPVGTGFSYSRTAEGYNMNDT  146

Query  471  LSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKG  650
            LSA   Y+FL +WL++HP F  NPLYV+GDSYSGI +P+VV+ I +G + G EP++N++G
Sbjct  147  LSASQIYAFLRKWLINHPKFQKNPLYVSGDSYSGIIIPMVVQEISNGNDEGKEPKMNIQG  206



>ref|XP_008236292.1| PREDICTED: serine carboxypeptidase-like 13 isoform X2 [Prunus 
mume]
Length=480

 Score =   245 bits (625),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 146/184 (79%), Gaps = 2/184 (1%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +++TLPGF   LPFKL TGY+GVG   ++QLFYYF ESE SPE DPL+LWLTGGPGCS  
Sbjct  32   IIKTLPGFRGDLPFKLETGYVGVGGMDDVQLFYYFFESEGSPEYDPLVLWLTGGPGCSAF  91

Query  285  SAFFFE-IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY-N  458
            SA  +E +GPL+ +YA+S G+ P LELNPY+WTKVANIIF+D PVGTG+SY++T + Y N
Sbjct  92   SAIVYENLGPLSFDYAHSIGNKPKLELNPYSWTKVANIIFLDAPVGTGFSYAKTWEGYSN  151

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             NDTLSA  TY FL +WL+DHP F N+PLY+AGDSYSGITVP++V+ I DG +    P +
Sbjct  152  LNDTLSAAQTYEFLRKWLMDHPKFYNSPLYIAGDSYSGITVPMLVQEISDGNQDEHVPPM  211

Query  639  NMKG  650
            N+KG
Sbjct  212  NLKG  215



>ref|XP_008236291.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Prunus 
mume]
Length=480

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 146/184 (79%), Gaps = 2/184 (1%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +++TLPGF   LPFKL TGY+GVG   ++QLFYYF ESE SPE DPL+LWLTGGPGCS  
Sbjct  32   IIKTLPGFRGDLPFKLETGYVGVGGMDDVQLFYYFFESEGSPEYDPLVLWLTGGPGCSAF  91

Query  285  SAFFFE-IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY-N  458
            SA  +E +GPL+ +YA+S G+ P LELNPY+WTKVANIIF+D PVGTG+SY++T + Y N
Sbjct  92   SAIVYENLGPLSFDYAHSIGNKPKLELNPYSWTKVANIIFLDAPVGTGFSYAKTWEGYSN  151

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             NDTLSA  TY FL +WL+DHP F N+PLY+AGDSYSGITVP++V+ I DG +    P +
Sbjct  152  LNDTLSAAQTYEFLRKWLMDHPKFYNSPLYIAGDSYSGITVPMLVQEISDGNQDEHVPPM  211

Query  639  NMKG  650
            N+KG
Sbjct  212  NLKG  215



>ref|XP_008236287.1| PREDICTED: serine carboxypeptidase-like 13 [Prunus mume]
Length=480

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 144/184 (78%), Gaps = 2/184 (1%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +++TLPGF   LPFKL TGY+GVG   ++QLFYYF ESE SPE DPL+LWLTGGPGCS  
Sbjct  32   IIKTLPGFRGDLPFKLETGYVGVGSMDDVQLFYYFFESEGSPEYDPLVLWLTGGPGCSAF  91

Query  285  SAFFFE-IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY-N  458
            SA  +E +GPL+ +YA+S G+ P L+LNPY+WTKVANIIF+D PVGTG+SY++  + Y N
Sbjct  92   SALVYENLGPLSFDYAHSIGNKPKLKLNPYSWTKVANIIFLDAPVGTGFSYAKNWEGYSN  151

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             NDTLSA  TY FL +WL+DHP F NNPLY+AGDSYSGI VP+VV+ I DG +    P +
Sbjct  152  LNDTLSAAQTYEFLRKWLMDHPKFYNNPLYIAGDSYSGIIVPMVVQEISDGNQDEHVPPM  211

Query  639  NMKG  650
            N+KG
Sbjct  212  NLKG  215



>emb|CBI22420.3| unnamed protein product [Vitis vinifera]
Length=503

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = +3

Query  111  ETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLSA  290
            + LPGFP  LPFKL TGY+GV +  ++QLFYYF++SE++P  DPLLLWLTGGPGCS  S 
Sbjct  63   KALPGFPGNLPFKLETGYVGVDDMDDVQLFYYFVKSERNPRDDPLLLWLTGGPGCSAFSG  122

Query  291  FFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDT  470
              +E+GPL+ +YA S  ++P  +LNPY+WTK+A++IF+D PVGTG+SYS T++ YN NDT
Sbjct  123  LVYEVGPLSFDYAKSNENLPTFKLNPYSWTKLASMIFLDAPVGTGFSYSRTAEGYNMNDT  182

Query  471  LSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKG  650
            LSA   Y+FL +WL++HP F  NPLYV+GDSYSGI +P+VV+ I +G + G EP++N++G
Sbjct  183  LSASQIYAFLRKWLINHPKFQKNPLYVSGDSYSGIIIPMVVQEISNGNDEGKEPKMNIQG  242



>ref|XP_011088733.1| PREDICTED: serine carboxypeptidase-like 7 [Sesamum indicum]
Length=493

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 136/184 (74%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             +++ TLPGF   LPFKL TGYIGVGE+ E+QLFYYFI+SE  PE DPL+LWLTGGPGCS
Sbjct  26   QSIINTLPGFHGTLPFKLETGYIGVGENDEVQLFYYFIQSENDPERDPLILWLTGGPGCS  85

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            G S   +EIGPL  +     G  P   LNPY+WTK+ANIIF+D PVGTG+SY+ T  AYN
Sbjct  86   GFSGLVYEIGPLAFDLEAFDGSFPSFTLNPYSWTKIANIIFIDSPVGTGFSYATTPQAYN  145

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            +NDT SA+H YSFL +WLL+HP F+ N LYVAGDSY G   P+V   I  G ++G EPR+
Sbjct  146  SNDTKSAEHNYSFLRKWLLNHPEFVKNRLYVAGDSYGGKITPMVALEIVKGNDAGFEPRM  205

Query  639  NMKG  650
             ++G
Sbjct  206  LLQG  209



>gb|KCW63570.1| hypothetical protein EUGRSUZ_G01197 [Eucalyptus grandis]
Length=436

 Score =   242 bits (618),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 140/184 (76%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              VV++LPG P  LPF L TGYIGVGE  ++QLFYYF+ESE+SP  DPL+LWLTGGPGCS
Sbjct  25   QTVVKSLPGLPGDLPFYLETGYIGVGELDDVQLFYYFVESERSPRDDPLVLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LS   +EIGP T NY  S+   P L+LN Y+WTKVANIIF+DQPVGTG+SY+   ++YN
Sbjct  85   ALSGLIYEIGPFTFNYEKSSRFRPALKLNDYSWTKVANIIFLDQPVGTGFSYANNWESYN  144

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             +D +S   +Y FL +WL  HP FL+NPLY+AGDSYSG+TVP V   +  G E+G+EP++
Sbjct  145  VDDNISVAESYEFLRKWLKLHPQFLSNPLYIAGDSYSGVTVPRVALEVDKGNEAGLEPKM  204

Query  639  NMKG  650
            N++G
Sbjct  205  NLEG  208



>ref|XP_011069858.1| PREDICTED: serine carboxypeptidase-like 18 [Sesamum indicum]
Length=481

 Score =   243 bits (620),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 142/182 (78%), Gaps = 0/182 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +VE+LPG P KLP K  TGYIGVG ++E+QLFY+F ESE +PE DPLLLW+TGGPGC+GL
Sbjct  27   LVESLPGLPDKLPNKFETGYIGVGVNEEVQLFYFFFESESNPEKDPLLLWMTGGPGCTGL  86

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTN  464
            S    E+G   ++YANS G    L+LN YAWTK ANI+F+DQP GTG+SY++T + +  N
Sbjct  87   STILLEMGTFMLDYANSKGGSVALKLNEYAWTKAANILFIDQPAGTGFSYAKTLEGFLAN  146

Query  465  DTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNM  644
            DTLSA+  Y FL +WL+DHP +L NPLY+ G+SYSGI +PLVV  +Y+G+E+G +P LNM
Sbjct  147  DTLSARLCYDFLKKWLIDHPKYLENPLYIFGESYSGIVLPLVVNEVYNGIETGDKPVLNM  206

Query  645  KG  650
            KG
Sbjct  207  KG  208



>gb|KCW63569.1| hypothetical protein EUGRSUZ_G01197 [Eucalyptus grandis]
Length=470

 Score =   242 bits (618),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 140/184 (76%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              VV++LPG P  LPF L TGYIGVGE  ++QLFYYF+ESE+SP  DPL+LWLTGGPGCS
Sbjct  25   QTVVKSLPGLPGDLPFYLETGYIGVGELDDVQLFYYFVESERSPRDDPLVLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LS   +EIGP T NY  S+   P L+LN Y+WTKVANIIF+DQPVGTG+SY+   ++YN
Sbjct  85   ALSGLIYEIGPFTFNYEKSSRFRPALKLNDYSWTKVANIIFLDQPVGTGFSYANNWESYN  144

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             +D +S   +Y FL +WL  HP FL+NPLY+AGDSYSG+TVP V   +  G E+G+EP++
Sbjct  145  VDDNISVAESYEFLRKWLKLHPQFLSNPLYIAGDSYSGVTVPRVALEVDKGNEAGLEPKM  204

Query  639  NMKG  650
            N++G
Sbjct  205  NLEG  208



>ref|XP_007199854.1| hypothetical protein PRUPE_ppa005665mg [Prunus persica]
 gb|EMJ01053.1| hypothetical protein PRUPE_ppa005665mg [Prunus persica]
Length=449

 Score =   242 bits (617),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 144/183 (79%), Gaps = 2/183 (1%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            ++TLPGF   LPFKL TGY+GVG   ++QLFYYF ESE SPE DPL+LWLTGGPGCS  S
Sbjct  23   IKTLPGFGGDLPFKLETGYVGVGGMDDVQLFYYFFESEGSPEYDPLVLWLTGGPGCSAFS  82

Query  288  AFFFE-IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY-NT  461
            A  +E +GPL+ +YA+S G+ P L+LNPY+WTKVANIIF+D PVGTG+SY++  + Y N 
Sbjct  83   AIVYENLGPLSFDYAHSIGNKPKLKLNPYSWTKVANIIFLDAPVGTGFSYAKNWEGYSNL  142

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            NDTLSA  TY FL +WL+DHP F NNPLY+AGDSYSGITVP++V+ I DG +    P +N
Sbjct  143  NDTLSAAQTYEFLRKWLMDHPKFYNNPLYIAGDSYSGITVPMLVQEISDGNQDEHVPPMN  202

Query  642  MKG  650
            +KG
Sbjct  203  LKG  205



>ref|XP_010065871.1| PREDICTED: serine carboxypeptidase-like 2 isoform X3 [Eucalyptus 
grandis]
Length=470

 Score =   242 bits (618),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 140/184 (76%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              VV++LPG P  LPF L TGYIGVGE  ++QLFYYF+ESE+SP  DPL+LWLTGGPGCS
Sbjct  25   QTVVKSLPGLPGDLPFYLETGYIGVGELDDVQLFYYFVESERSPRDDPLVLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LS   +EIGP T NY  S+   P L+LN Y+WTKVANIIF+DQPVGTG+SY+   ++YN
Sbjct  85   ALSGLIYEIGPFTFNYEKSSRFRPALKLNDYSWTKVANIIFLDQPVGTGFSYANNWESYN  144

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             +D +S   +Y FL +WL  HP FL+NPLY+AGDSYSG+TVP V   +  G E+G+EP++
Sbjct  145  VDDNISVAESYEFLRKWLKLHPQFLSNPLYIAGDSYSGVTVPRVALEVDKGNEAGLEPKM  204

Query  639  NMKG  650
            N++G
Sbjct  205  NLEG  208



>gb|KDP44531.1| hypothetical protein JCGZ_16364 [Jatropha curcas]
Length=549

 Score =   244 bits (623),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 142/184 (77%), Gaps = 1/184 (1%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             ++++TLPGFP  LPFKL TGYIGVG+  E+QLFYYF+ESE +P+ DPLLLWLTGGPGCS
Sbjct  21   QSIIKTLPGFPGNLPFKLETGYIGVGQLDEVQLFYYFVESEGNPQEDPLLLWLTGGPGCS  80

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            G SA  +EIGPL+ NYA S    P LELNPY+WTKVA+IIF+D PVGTG+SY+ TS AY 
Sbjct  81   GFSALVYEIGPLSFNYAKSRVK-PTLELNPYSWTKVASIIFLDAPVGTGFSYATTSQAYQ  139

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            ++DT      Y FL +WLLDHP F +N LY+AGDSYSG  VPLVV+   +G ++G  P++
Sbjct  140  SSDTNQGAANYEFLRKWLLDHPEFQSNRLYIAGDSYSGKIVPLVVKETVNGNDAGRNPKM  199

Query  639  NMKG  650
            N+ G
Sbjct  200  NLVG  203



>gb|KCW63576.1| hypothetical protein EUGRSUZ_G01200 [Eucalyptus grandis]
Length=436

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 140/184 (76%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              VV++LPG P  LPF L TGYIGVGE  ++QLFYYF+ESE+SP  DPL+LWLTGGPGCS
Sbjct  25   QTVVKSLPGLPGDLPFHLETGYIGVGELDDVQLFYYFVESERSPRDDPLVLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LS   +EIGP T NY  S+   P L+LN Y+WTKVANIIF+DQP+GTG+SY+   ++YN
Sbjct  85   ALSGLIYEIGPFTFNYEKSSRFRPALKLNDYSWTKVANIIFLDQPIGTGFSYANNWESYN  144

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             +D +S   +Y FL +WL  HP FL+NPLY+AGDSYSG+TVP V   +  G E+G+EP++
Sbjct  145  IDDNISIAESYEFLRKWLKLHPQFLSNPLYIAGDSYSGVTVPNVALEVDKGNEAGLEPKM  204

Query  639  NMKG  650
            N++G
Sbjct  205  NLEG  208



>ref|XP_007199818.1| hypothetical protein PRUPE_ppa005264mg [Prunus persica]
 gb|EMJ01017.1| hypothetical protein PRUPE_ppa005264mg [Prunus persica]
Length=451

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 142/184 (77%), Gaps = 2/184 (1%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +++TLPGF   LPFKL TGY+GVG   ++QLFYYF ESE SPE DPL+LWL GGPGCS  
Sbjct  22   IIKTLPGFRGDLPFKLETGYVGVGSMDDVQLFYYFFESEGSPEYDPLVLWLNGGPGCSAF  81

Query  285  SAFFFE-IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY-N  458
            S   +E +GPL+ +YA+S G+ P L+LNPY+WTKVANIIF+D PVGTG+SY++  + Y N
Sbjct  82   SGLVYENLGPLSFDYAHSIGNKPKLKLNPYSWTKVANIIFLDAPVGTGFSYAKNWEGYSN  141

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             NDTLSA  TY FL +WL+DHP F NNPLY+AGDSYSGI VP+VV+ I DG +    P +
Sbjct  142  LNDTLSAAQTYEFLRKWLMDHPKFYNNPLYIAGDSYSGIIVPMVVQEISDGNQDEHVPPM  201

Query  639  NMKG  650
            N+KG
Sbjct  202  NLKG  205



>ref|XP_011100014.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Sesamum 
indicum]
Length=416

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 136/184 (74%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             +++ TLPGF   LPFKL TGYIGVGE  E+QLFYYFIESE  P+TDPL+LWLTGGPGCS
Sbjct  24   QSIINTLPGFHGTLPFKLETGYIGVGEEDEVQLFYYFIESENDPQTDPLILWLTGGPGCS  83

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            G S   +EIGPL  +     G  P    NPY+WTKVANIIF+D PVGTG+SY+ TS+AYN
Sbjct  84   GFSGLVYEIGPLAFDLEAFDGSFPSFITNPYSWTKVANIIFIDSPVGTGFSYATTSEAYN  143

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            T+DT S +  YSFL +WL +HP F+ N LY+AG+SY G  VP+V   I  G E+G EPR+
Sbjct  144  TSDTKSVEQNYSFLRKWLSNHPEFVKNHLYIAGNSYGGKIVPMVALEIAKGNEAGFEPRI  203

Query  639  NMKG  650
            +++G
Sbjct  204  SLQG  207



>ref|XP_007201000.1| hypothetical protein PRUPE_ppa005249mg [Prunus persica]
 gb|EMJ02199.1| hypothetical protein PRUPE_ppa005249mg [Prunus persica]
Length=429

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 141/184 (77%), Gaps = 2/184 (1%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +V+TLPGF   LPFKL TGY+GVG   ++QLFYYF ESE SPE DPL+LWL GGPGCS  
Sbjct  22   IVKTLPGFRGDLPFKLETGYVGVGSMDDVQLFYYFFESEGSPEYDPLVLWLNGGPGCSAF  81

Query  285  SAFFFE-IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            S   +E +GPL+ +YA+S G+ P L+LNPY+WTKVANIIF+D PVGTG+SY++  + YN 
Sbjct  82   SGLVYENLGPLSFDYAHSIGNKPKLKLNPYSWTKVANIIFLDAPVGTGFSYAKNWEGYNN  141

Query  462  -NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             NDTLSA  TY FL +WL+DHP F NNPLY+ GDSYSGI VP+VV+ I DG +    P +
Sbjct  142  LNDTLSAAQTYEFLRKWLMDHPKFYNNPLYITGDSYSGIIVPMVVQEISDGNQDEHVPPM  201

Query  639  NMKG  650
            N+KG
Sbjct  202  NLKG  205



>ref|XP_006422770.1| hypothetical protein CICLE_v10028371mg [Citrus clementina]
 gb|ESR36010.1| hypothetical protein CICLE_v10028371mg [Citrus clementina]
Length=468

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 141/184 (77%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              ++ TLPGF   LPFKL TGYIGVGE+  +QLFYYFIESE+SPE DPL+LWL+GGPGCS
Sbjct  21   RQIITTLPGFDGDLPFKLETGYIGVGENDNVQLFYYFIESERSPEDDPLVLWLSGGPGCS  80

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            G  A  +++GPL+ +Y NS  + P L LNPY+WTKVA+IIF+D P GTG+SY +    + 
Sbjct  81   GFWALAYQLGPLSFDYENSRENSPKLLLNPYSWTKVASIIFIDAPAGTGFSYVKNWQGFV  140

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             NDTLSA  TY FL +WL+ HP+FL NPLY+ G+SYSG  +P+VV+ I DG++ G EPR+
Sbjct  141  MNDTLSAVQTYFFLRKWLIAHPSFLANPLYIFGESYSGKVLPIVVQKISDGIDLGDEPRM  200

Query  639  NMKG  650
            N+KG
Sbjct  201  NLKG  204



>ref|XP_007199819.1| hypothetical protein PRUPE_ppa005264mg [Prunus persica]
 gb|EMJ01018.1| hypothetical protein PRUPE_ppa005264mg [Prunus persica]
Length=470

 Score =   241 bits (614),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 142/184 (77%), Gaps = 2/184 (1%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +++TLPGF   LPFKL TGY+GVG   ++QLFYYF ESE SPE DPL+LWL GGPGCS  
Sbjct  22   IIKTLPGFRGDLPFKLETGYVGVGSMDDVQLFYYFFESEGSPEYDPLVLWLNGGPGCSAF  81

Query  285  SAFFFE-IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY-N  458
            S   +E +GPL+ +YA+S G+ P L+LNPY+WTKVANIIF+D PVGTG+SY++  + Y N
Sbjct  82   SGLVYENLGPLSFDYAHSIGNKPKLKLNPYSWTKVANIIFLDAPVGTGFSYAKNWEGYSN  141

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             NDTLSA  TY FL +WL+DHP F NNPLY+AGDSYSGI VP+VV+ I DG +    P +
Sbjct  142  LNDTLSAAQTYEFLRKWLMDHPKFYNNPLYIAGDSYSGIIVPMVVQEISDGNQDEHVPPM  201

Query  639  NMKG  650
            N+KG
Sbjct  202  NLKG  205



>ref|XP_010065864.1| PREDICTED: serine carboxypeptidase-like 2 isoform X1 [Eucalyptus 
grandis]
Length=471

 Score =   241 bits (614),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 140/184 (76%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              VV++LPG P  LPF L TGYIGVGE  ++QLFYYF+ESE+SP  DPL+LWLTGGPGCS
Sbjct  25   QTVVKSLPGLPGDLPFHLETGYIGVGELDDVQLFYYFVESERSPRDDPLVLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LS   +EIGP T NY  S+   P L+LN Y+WTKVANIIF+DQP+GTG+SY+   ++YN
Sbjct  85   ALSGLIYEIGPFTFNYEKSSRFRPALKLNDYSWTKVANIIFLDQPIGTGFSYANNWESYN  144

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             +D +S   +Y FL +WL  HP FL+NPLY+AGDSYSG+TVP V   +  G E+G+EP++
Sbjct  145  IDDNISIAESYEFLRKWLKLHPQFLSNPLYIAGDSYSGVTVPNVALEVDKGNEAGLEPKM  204

Query  639  NMKG  650
            N++G
Sbjct  205  NLEG  208



>ref|XP_008236347.1| PREDICTED: serine carboxypeptidase-like 13 [Prunus mume]
Length=536

 Score =   242 bits (618),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 144/184 (78%), Gaps = 2/184 (1%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +++TLPGF   LPFKL TGY+GVG   ++QLFYYF ESE SPE DPL+LWLTGGPGCSG 
Sbjct  32   IIKTLPGFRGDLPFKLETGYVGVGGMDDVQLFYYFFESEGSPEYDPLVLWLTGGPGCSGF  91

Query  285  SAFFFE-IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY-N  458
            S   +E +GPL+ +YA+S G+ P L+LNPY+WTKVAN+IF+D PVGTG+SY++  + Y N
Sbjct  92   SGIVYENLGPLSFDYAHSIGNKPKLKLNPYSWTKVANVIFLDAPVGTGFSYAKNWEGYSN  151

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             NDTLSA  TY FL +WL+DHP F NNPLY+AGDSYSGI VP++V+ I DG +    P +
Sbjct  152  LNDTLSAAQTYEFLRKWLMDHPKFYNNPLYIAGDSYSGIIVPMLVQEISDGNQDEHVPPM  211

Query  639  NMKG  650
            N+KG
Sbjct  212  NLKG  215



>ref|XP_010028338.1| PREDICTED: serine carboxypeptidase-like 13 [Eucalyptus grandis]
 gb|KCW55061.1| hypothetical protein EUGRSUZ_I01037 [Eucalyptus grandis]
Length=473

 Score =   241 bits (614),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 138/182 (76%), Gaps = 0/182 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            ++ETLPGFP KLPF L TGYIGV E  ++QLFYYFIES++ P  DPL+ W+TGGPGCSG 
Sbjct  28   IIETLPGFPGKLPFTLETGYIGVNEIDDVQLFYYFIESQRDPANDPLVFWMTGGPGCSGF  87

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTN  464
            SA  FEIGPLT +Y    G +P L +N Y+WT+ ANIIF+D PVG G+SY+ T +   T+
Sbjct  88   SALAFEIGPLTFDYGTYNGTLPSLLINKYSWTQAANIIFIDAPVGAGFSYATTEEGKYTS  147

Query  465  DTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNM  644
            D  SA   Y+FL +WLL HP FL N LYV GDSYSGIT+P+VV+NI +G+E+G+ P++ +
Sbjct  148  DIESAYQYYTFLRKWLLSHPQFLGNELYVGGDSYSGITLPIVVKNILEGIEAGVRPKMEL  207

Query  645  KG  650
            +G
Sbjct  208  QG  209



>ref|XP_010065865.1| PREDICTED: serine carboxypeptidase-like 2 isoform X2 [Eucalyptus 
grandis]
 gb|KCW63575.1| hypothetical protein EUGRSUZ_G01200 [Eucalyptus grandis]
Length=470

 Score =   240 bits (613),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 140/184 (76%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              VV++LPG P  LPF L TGYIGVGE  ++QLFYYF+ESE+SP  DPL+LWLTGGPGCS
Sbjct  25   QTVVKSLPGLPGDLPFHLETGYIGVGELDDVQLFYYFVESERSPRDDPLVLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LS   +EIGP T NY  S+   P L+LN Y+WTKVANIIF+DQP+GTG+SY+   ++YN
Sbjct  85   ALSGLIYEIGPFTFNYEKSSRFRPALKLNDYSWTKVANIIFLDQPIGTGFSYANNWESYN  144

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             +D +S   +Y FL +WL  HP FL+NPLY+AGDSYSG+TVP V   +  G E+G+EP++
Sbjct  145  IDDNISIAESYEFLRKWLKLHPQFLSNPLYIAGDSYSGVTVPNVALEVDKGNEAGLEPKM  204

Query  639  NMKG  650
            N++G
Sbjct  205  NLEG  208



>ref|XP_011070163.1| PREDICTED: serine carboxypeptidase-like 18 [Sesamum indicum]
Length=485

 Score =   241 bits (614),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 137/184 (74%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              V++TLPG P KLP KL TGYIGVGE +E+QLFY+F ESE  PE DP + W+TGGPGCS
Sbjct  28   QRVIQTLPGLPDKLPNKLETGYIGVGEDEEVQLFYFFFESEGDPEKDPFIFWITGGPGCS  87

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            GLS    EIG   I++ N TG    L+LN YAWTK A+I+F+DQP GTGYSYS T   Y 
Sbjct  88   GLSVILMEIGTFVIDFPNCTGGPTALKLNEYAWTKSASILFIDQPAGTGYSYSNTLKGYI  147

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            TNDTLS + +Y FL +WL+ HP +L NPLY+ G+SYSGIT+PL+V  +Y GLE+G +P L
Sbjct  148  TNDTLSTRLSYDFLRKWLIKHPQYLKNPLYIVGESYSGITLPLIVDEVYKGLEAGDKPTL  207

Query  639  NMKG  650
            N+KG
Sbjct  208  NIKG  211



>ref|XP_007201001.1| hypothetical protein PRUPE_ppa005249mg [Prunus persica]
 gb|EMJ02200.1| hypothetical protein PRUPE_ppa005249mg [Prunus persica]
Length=470

 Score =   240 bits (612),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 141/184 (77%), Gaps = 2/184 (1%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +V+TLPGF   LPFKL TGY+GVG   ++QLFYYF ESE SPE DPL+LWL GGPGCS  
Sbjct  22   IVKTLPGFRGDLPFKLETGYVGVGSMDDVQLFYYFFESEGSPEYDPLVLWLNGGPGCSAF  81

Query  285  SAFFFE-IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            S   +E +GPL+ +YA+S G+ P L+LNPY+WTKVANIIF+D PVGTG+SY++  + YN 
Sbjct  82   SGLVYENLGPLSFDYAHSIGNKPKLKLNPYSWTKVANIIFLDAPVGTGFSYAKNWEGYNN  141

Query  462  -NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             NDTLSA  TY FL +WL+DHP F NNPLY+ GDSYSGI VP+VV+ I DG +    P +
Sbjct  142  LNDTLSAAQTYEFLRKWLMDHPKFYNNPLYITGDSYSGIIVPMVVQEISDGNQDEHVPPM  201

Query  639  NMKG  650
            N+KG
Sbjct  202  NLKG  205



>ref|XP_011100016.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Sesamum 
indicum]
Length=416

 Score =   238 bits (608),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 134/184 (73%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             +++ TLPGF   LPFKL TGYIGVGE  E+QLFYYFIESE  P+TDPL+LWLTGGPGCS
Sbjct  24   QSIINTLPGFHGTLPFKLETGYIGVGEEDEVQLFYYFIESENDPQTDPLILWLTGGPGCS  83

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            G S   +EIGPL  +     G  P    NPY+WTKVANIIF+D PVGTG+SY+ TS AYN
Sbjct  84   GFSGLVYEIGPLAFDVEAFDGSFPSFITNPYSWTKVANIIFIDSPVGTGFSYATTSQAYN  143

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            T+DT S +H Y FL +WL +HP F+ N LY+AGDSY G  VP+V   I  G E+ IEPR+
Sbjct  144  TSDTKSVEHNYLFLRKWLSNHPEFVKNHLYIAGDSYGGKIVPMVALEIAKGNEARIEPRI  203

Query  639  NMKG  650
             ++G
Sbjct  204  LIQG  207



>ref|XP_011100013.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Sesamum 
indicum]
Length=467

 Score =   240 bits (612),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 136/184 (74%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             +++ TLPGF   LPFKL TGYIGVGE  E+QLFYYFIESE  P+TDPL+LWLTGGPGCS
Sbjct  24   QSIINTLPGFHGTLPFKLETGYIGVGEEDEVQLFYYFIESENDPQTDPLILWLTGGPGCS  83

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            G S   +EIGPL  +     G  P    NPY+WTKVANIIF+D PVGTG+SY+ TS+AYN
Sbjct  84   GFSGLVYEIGPLAFDLEAFDGSFPSFITNPYSWTKVANIIFIDSPVGTGFSYATTSEAYN  143

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            T+DT S +  YSFL +WL +HP F+ N LY+AG+SY G  VP+V   I  G E+G EPR+
Sbjct  144  TSDTKSVEQNYSFLRKWLSNHPEFVKNHLYIAGNSYGGKIVPMVALEIAKGNEAGFEPRI  203

Query  639  NMKG  650
            +++G
Sbjct  204  SLQG  207



>ref|XP_011069856.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Sesamum 
indicum]
Length=477

 Score =   240 bits (612),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 141/182 (77%), Gaps = 0/182 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +VE+LPG P KLP K  TGYIGVGE++E QLFY+F+ESE +PE DP + WLTGGPGC+GL
Sbjct  27   LVESLPGLPDKLPNKFETGYIGVGENEEAQLFYFFLESESNPEKDPFVFWLTGGPGCAGL  86

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTN  464
            S    E+G   ++YAN  GD   L+LN YAWTK ANI+F+DQPVGTG+SY++T  +   N
Sbjct  87   STILLEMGTFMLDYANCKGDSVALKLNEYAWTKAANILFIDQPVGTGFSYAKTLASSLAN  146

Query  465  DTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNM  644
            DTLSA+  Y FL +WL+DHP +L NPLY+ G+SY+GI +PLVV  +Y+G+++G +P LNM
Sbjct  147  DTLSARLCYDFLKKWLIDHPKYLENPLYIFGESYAGIVLPLVVNEVYNGIKTGDKPVLNM  206

Query  645  KG  650
            KG
Sbjct  207  KG  208



>ref|XP_011100017.1| PREDICTED: serine carboxypeptidase-like 13 [Sesamum indicum]
Length=467

 Score =   239 bits (611),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 136/184 (74%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             +++ TLPGF   LPFKL TGYIGVGE  E+QLFYYFIESE  P+TDPL+LWLTGGPGC+
Sbjct  24   QSIINTLPGFHGTLPFKLETGYIGVGEEDEVQLFYYFIESENDPQTDPLILWLTGGPGCT  83

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            G SA  +EIGPL  +     G  P    NPY+WTKVANIIF+D PVGTG+SY+ T++AYN
Sbjct  84   GFSALVYEIGPLAFDLEAFDGSFPSFITNPYSWTKVANIIFIDSPVGTGFSYATTTEAYN  143

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            T+DT S +H YSF+ +WL +HP F+ N LYVAGDSY G  VP+V   I  G E+  EPR+
Sbjct  144  TSDTKSVEHNYSFMRKWLSNHPEFVKNHLYVAGDSYGGKIVPMVALEIAKGNEARFEPRI  203

Query  639  NMKG  650
             ++G
Sbjct  204  LLQG  207



>gb|KCW63567.1| hypothetical protein EUGRSUZ_G01195 [Eucalyptus grandis]
Length=436

 Score =   239 bits (609),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 138/184 (75%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              VV++LPG P  LPF L TGYIGVGE  ++QLFYYF+ESE+SP  D L+LWLTGGPGCS
Sbjct  25   QTVVKSLPGLPGDLPFHLETGYIGVGELDDVQLFYYFVESERSPRDDHLVLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LS   +EIGP T NY NS+   P L+ N Y+WTKVANIIF+DQPV TG+SY+   ++YN
Sbjct  85   ALSGLIYEIGPFTFNYENSSRFRPTLKFNDYSWTKVANIIFLDQPVRTGFSYANNWESYN  144

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             ND +S   +Y FL +WL  HP FL+NPLY+AGDSYSG+TVP V   +  G E+G+EP++
Sbjct  145  INDNISVAESYEFLRKWLKLHPQFLSNPLYIAGDSYSGVTVPRVALEVDKGNEAGLEPKM  204

Query  639  NMKG  650
            N++G
Sbjct  205  NLEG  208



>gb|KDP32094.1| hypothetical protein JCGZ_12555 [Jatropha curcas]
Length=472

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 140/183 (77%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            + ++ LPGF   LPFKL TGY+ VG+  ++QLFYYFIESE++P  DPLLLWLTGGPGCS 
Sbjct  32   STIKNLPGFSGPLPFKLETGYVEVGKKGDVQLFYYFIESERNPREDPLLLWLTGGPGCSS  91

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            LS   FEIGPL  N     G +P L+LNP++WTKV++IIF+D PVGTG+SYS +  +  T
Sbjct  92   LSGLIFEIGPLQFNIVEYNGSLPTLKLNPHSWTKVSSIIFLDAPVGTGFSYSRSYHSSET  151

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
             DT+ A HTY+FL +WLL HP F+ NPLY+AGDSYSG+ VP++ + I  G+E G++P++N
Sbjct  152  GDTIQAIHTYTFLKKWLLSHPEFIKNPLYIAGDSYSGMVVPVITKQISIGIELGVQPQIN  211

Query  642  MKG  650
            +KG
Sbjct  212  LKG  214



>ref|XP_011069855.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Sesamum 
indicum]
Length=481

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 141/182 (77%), Gaps = 0/182 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +VE+LPG P KLP K  TGYIGVGE++E QLFY+F+ESE +PE DP + WLTGGPGC+GL
Sbjct  27   LVESLPGLPDKLPNKFETGYIGVGENEEAQLFYFFLESESNPEKDPFVFWLTGGPGCAGL  86

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTN  464
            S    E+G   ++YAN  GD   L+LN YAWTK ANI+F+DQPVGTG+SY++T  +   N
Sbjct  87   STILLEMGTFMLDYANCKGDSVALKLNEYAWTKAANILFIDQPVGTGFSYAKTLASSLAN  146

Query  465  DTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNM  644
            DTLSA+  Y FL +WL+DHP +L NPLY+ G+SY+GI +PLVV  +Y+G+++G +P LNM
Sbjct  147  DTLSARLCYDFLKKWLIDHPKYLENPLYIFGESYAGIVLPLVVNEVYNGIKTGDKPVLNM  206

Query  645  KG  650
            KG
Sbjct  207  KG  208



>ref|XP_008236275.1| PREDICTED: serine carboxypeptidase-like 17 isoform X1 [Prunus 
mume]
Length=461

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 141/184 (77%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              +++ LPGF   LPFKL TGY+GVG   E+QLFYYFIESE+SPE DPLLLW+TGGP CS
Sbjct  35   QTIIKNLPGFSGDLPFKLETGYVGVGNKDELQLFYYFIESERSPENDPLLLWITGGPRCS  94

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            G S   +E GP++ ++ + T    +L LNPY+WTK+ANIIF+D P GTG+SYS T+D YN
Sbjct  95   GFSGLVYENGPISFSFTSITKHPVELVLNPYSWTKLANIIFLDAPAGTGFSYSTTTDGYN  154

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            T+DT+ A+    F+ +WLL HP FL NPLY++GDSYSG  VP++V++I +G+E+GI P L
Sbjct  155  TSDTIHAKRASEFVQRWLLTHPKFLANPLYISGDSYSGKIVPIIVQDITNGIEAGISPFL  214

Query  639  NMKG  650
            N+KG
Sbjct  215  NLKG  218



>ref|XP_010065872.1| PREDICTED: serine carboxypeptidase-like 2 [Eucalyptus grandis]
Length=470

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 138/184 (75%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              VV++LPG P  LPF L TGYIGVGE  ++QLFYYF+ESE+SP  D L+LWLTGGPGCS
Sbjct  25   QTVVKSLPGLPGDLPFHLETGYIGVGELDDVQLFYYFVESERSPRDDHLVLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LS   +EIGP T NY NS+   P L+ N Y+WTKVANIIF+DQPV TG+SY+   ++YN
Sbjct  85   ALSGLIYEIGPFTFNYENSSRFRPTLKFNDYSWTKVANIIFLDQPVRTGFSYANNWESYN  144

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             ND +S   +Y FL +WL  HP FL+NPLY+AGDSYSG+TVP V   +  G E+G+EP++
Sbjct  145  INDNISVAESYEFLRKWLKLHPQFLSNPLYIAGDSYSGVTVPRVALEVDKGNEAGLEPKM  204

Query  639  NMKG  650
            N++G
Sbjct  205  NLEG  208



>ref|XP_008236286.1| PREDICTED: serine carboxypeptidase-like 2 isoform X2 [Prunus 
mume]
Length=470

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 143/184 (78%), Gaps = 2/184 (1%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +++TLPGF   LPFKL TGY+GVG   ++QLFYYF ESE SPE DPL+LWLTGGPGCS  
Sbjct  23   IIKTLPGFRGDLPFKLETGYVGVGGMDDVQLFYYFFESEGSPEYDPLVLWLTGGPGCSAF  82

Query  285  SAFFFE-IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY-N  458
            SA  +E +GPL+ + A+S G+ P L+LNPY+WTKVANIIF+D PVGTG+SY++  + Y N
Sbjct  83   SAIVYENLGPLSFDSAHSIGNKPKLKLNPYSWTKVANIIFLDAPVGTGFSYAKNWEGYTN  142

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             NDT+SA  TY FL +WL+DHP F NNPLY+AGDSYSGI VP++V+ I DG +    P +
Sbjct  143  LNDTISAAQTYQFLRKWLMDHPKFYNNPLYIAGDSYSGIIVPMLVQEISDGNQDEHAPPM  202

Query  639  NMKG  650
            N+KG
Sbjct  203  NLKG  206



>ref|XP_008236285.1| PREDICTED: serine carboxypeptidase-like 2 isoform X1 [Prunus 
mume]
Length=472

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 143/184 (78%), Gaps = 2/184 (1%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +++TLPGF   LPFKL TGY+GVG   ++QLFYYF ESE SPE DPL+LWLTGGPGCS  
Sbjct  23   IIKTLPGFRGDLPFKLETGYVGVGGMDDVQLFYYFFESEGSPEYDPLVLWLTGGPGCSAF  82

Query  285  SAFFFE-IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY-N  458
            SA  +E +GPL+ + A+S G+ P L+LNPY+WTKVANIIF+D PVGTG+SY++  + Y N
Sbjct  83   SAIVYENLGPLSFDSAHSIGNKPKLKLNPYSWTKVANIIFLDAPVGTGFSYAKNWEGYTN  142

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             NDT+SA  TY FL +WL+DHP F NNPLY+AGDSYSGI VP++V+ I DG +    P +
Sbjct  143  LNDTISAAQTYQFLRKWLMDHPKFYNNPLYIAGDSYSGIIVPMLVQEISDGNQDEHAPPM  202

Query  639  NMKG  650
            N+KG
Sbjct  203  NLKG  206



>ref|XP_011100015.1| PREDICTED: serine carboxypeptidase-like 7 isoform X1 [Sesamum 
indicum]
Length=467

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 134/184 (73%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             +++ TLPGF   LPFKL TGYIGVGE  E+QLFYYFIESE  P+TDPL+LWLTGGPGCS
Sbjct  24   QSIINTLPGFHGTLPFKLETGYIGVGEEDEVQLFYYFIESENDPQTDPLILWLTGGPGCS  83

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            G S   +EIGPL  +     G  P    NPY+WTKVANIIF+D PVGTG+SY+ TS AYN
Sbjct  84   GFSGLVYEIGPLAFDVEAFDGSFPSFITNPYSWTKVANIIFIDSPVGTGFSYATTSQAYN  143

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            T+DT S +H Y FL +WL +HP F+ N LY+AGDSY G  VP+V   I  G E+ IEPR+
Sbjct  144  TSDTKSVEHNYLFLRKWLSNHPEFVKNHLYIAGDSYGGKIVPMVALEIAKGNEARIEPRI  203

Query  639  NMKG  650
             ++G
Sbjct  204  LIQG  207



>ref|XP_007201024.1| hypothetical protein PRUPE_ppa006101mg [Prunus persica]
 gb|EMJ02223.1| hypothetical protein PRUPE_ppa006101mg [Prunus persica]
Length=427

 Score =   236 bits (602),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 138/184 (75%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              +++ LPGF   LPFKL TGY GVG   E+QLFYYFIESE+SPE DPLLLW+TGGP CS
Sbjct  35   QTIIKNLPGFSGDLPFKLETGYFGVGNKDELQLFYYFIESERSPENDPLLLWITGGPRCS  94

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              S   +EIGP++ ++ + T D  +L LNPY+WTK+ANIIF+D P GTG+SYS T+D YN
Sbjct  95   AFSGLVYEIGPISFSFTSITKDPAELVLNPYSWTKLANIIFLDAPAGTGFSYSTTTDGYN  154

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            T+D++ A+    FL +WL  H  FL NPLY++GDSYSG  VP++V+ I +G+E+G EP L
Sbjct  155  TSDSIHAKRASDFLQKWLSTHRKFLANPLYISGDSYSGKIVPIIVQEIVNGIEAGTEPPL  214

Query  639  NMKG  650
            N+KG
Sbjct  215  NLKG  218



>ref|XP_002265842.1| PREDICTED: serine carboxypeptidase-like 18 [Vitis vinifera]
Length=491

 Score =   238 bits (606),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 139/184 (76%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             ++V+TLPGF  +LPFKL TGY+ VGE  +++LFYYFIESE+ P  DPL+LWLTGGPGCS
Sbjct  42   QSIVDTLPGFSGELPFKLETGYVSVGELNDVELFYYFIESERDPARDPLILWLTGGPGCS  101

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            G S   +EIGPL  NY    G +P LELNPY+WTKVA+IIF+D PVGTG+SY+   D Y 
Sbjct  102  GFSGLVYEIGPLRFNYTAFNGSLPSLELNPYSWTKVASIIFLDAPVGTGFSYATNPDDYY  161

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             +DT+SA+  Y F+ +WL+DHP FL NPLY+ GDSYSGI VP++   I +G++ G++P +
Sbjct  162  ASDTISARDNYIFIRKWLIDHPRFLYNPLYIGGDSYSGIIVPILTLEIANGIQMGLKPLM  221

Query  639  NMKG  650
             + G
Sbjct  222  TLMG  225



>ref|XP_007200276.1| hypothetical protein PRUPE_ppa014806mg [Prunus persica]
 gb|EMJ01475.1| hypothetical protein PRUPE_ppa014806mg [Prunus persica]
Length=392

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 141/184 (77%), Gaps = 2/184 (1%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +++TLPGF   LPFKL TGY+GVG   ++QLFYYF ESE SPE DPL+LWL GG GCS  
Sbjct  11   IIKTLPGFGGDLPFKLETGYVGVGAMDDVQLFYYFFESEGSPEYDPLVLWLNGGSGCSTF  70

Query  285  SAFFFE-IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY-N  458
            S F +E +GPL+ +Y NS G+ P L+LNPY+WTKVANIIFVD+PVGTG+SY+ +   Y N
Sbjct  71   SDFVYENLGPLSFDYLNSIGNKPKLKLNPYSWTKVANIIFVDEPVGTGFSYANSWVGYSN  130

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             +DTLSA  TY FL +WL+DHP F NNPLY+AGDSYSGIT+P+VV+ I DG      P +
Sbjct  131  VSDTLSAVQTYEFLRKWLMDHPKFYNNPLYIAGDSYSGITLPIVVQEISDGNRDEHLPPM  190

Query  639  NMKG  650
            N+KG
Sbjct  191  NLKG  194



>ref|XP_010046973.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
 gb|KCW78694.1| hypothetical protein EUGRSUZ_C00146 [Eucalyptus grandis]
Length=478

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 139/182 (76%), Gaps = 0/182 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +++ LPG+  +LPF L  GYIGVGE++++QLFYYF+ES++SP  DP++LWLTGGPGCS L
Sbjct  35   IIKYLPGYDGELPFTLEAGYIGVGETEDVQLFYYFVESQRSPAMDPVVLWLTGGPGCSTL  94

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTN  464
             AFF+E GPL+  Y+   G +P L LNPY WTK  NII++DQPVGTG+SYS T D Y+T 
Sbjct  95   LAFFYESGPLSFVYSGYNGSLPSLTLNPYTWTKALNIIYLDQPVGTGFSYSTTQDGYDTG  154

Query  465  DTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNM  644
            DT SA  TY F+ +W+L HP F +N LYV GDSYSG+TVPLV++ I D  +  + P++N+
Sbjct  155  DTRSAALTYEFIRKWMLSHPNFKSNQLYVGGDSYSGVTVPLVIQAIMDSNQEQVYPQMNL  214

Query  645  KG  650
            KG
Sbjct  215  KG  216



>emb|CBI22424.3| unnamed protein product [Vitis vinifera]
Length=507

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 139/184 (76%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             ++V+TLPGF  +LPFKL TGY+ VGE  +++LFYYFIESE+ P  DPL+LWLTGGPGCS
Sbjct  58   QSIVDTLPGFSGELPFKLETGYVSVGELNDVELFYYFIESERDPARDPLILWLTGGPGCS  117

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            G S   +EIGPL  NY    G +P LELNPY+WTKVA+IIF+D PVGTG+SY+   D Y 
Sbjct  118  GFSGLVYEIGPLRFNYTAFNGSLPSLELNPYSWTKVASIIFLDAPVGTGFSYATNPDDYY  177

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             +DT+SA+  Y F+ +WL+DHP FL NPLY+ GDSYSGI VP++   I +G++ G++P +
Sbjct  178  ASDTISARDNYIFIRKWLIDHPRFLYNPLYIGGDSYSGIIVPILTLEIANGIQMGLKPLM  237

Query  639  NMKG  650
             + G
Sbjct  238  TLMG  241



>ref|XP_010065879.1| PREDICTED: serine carboxypeptidase-like 13 [Eucalyptus grandis]
 gb|KCW63577.1| hypothetical protein EUGRSUZ_G01201 [Eucalyptus grandis]
Length=465

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 142/182 (78%), Gaps = 0/182 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            V++TLPG+P +LPF L TGY+GVG+ +++Q+FYYF++SE+SP+ DPL+LW+TGGPGCS L
Sbjct  24   VIKTLPGYPGELPFYLETGYVGVGDLEDVQMFYYFVKSERSPKDDPLVLWITGGPGCSTL  83

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTN  464
            SA  +EIGP T NY N T   P L+++ Y+WTKVANIIFVD+PVG G+SY+   ++YN N
Sbjct  84   SAILYEIGPFTFNYENLTPSRPTLKVHEYSWTKVANIIFVDEPVGAGFSYANNWESYNVN  143

Query  465  DTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNM  644
            D +SA  TY FL +WL  HP FL+NPLY+ GDSY G   P+V   + +G+E+G+EP +N+
Sbjct  144  DNISATDTYEFLRKWLTLHPEFLSNPLYIGGDSYGGFINPIVTLKVAEGIEAGLEPIMNL  203

Query  645  KG  650
            KG
Sbjct  204  KG  205



>ref|XP_006345611.1| PREDICTED: serine carboxypeptidase-like 19-like [Solanum tuberosum]
Length=388

 Score =   234 bits (596),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/181 (60%), Positives = 140/181 (77%), Gaps = 0/181 (0%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            V+ LPGF   LPF+L TGYIGVGE+ E+QLFYYFI+S+ + + DPL+ W TGGPGCS LS
Sbjct  33   VKYLPGFEGPLPFQLETGYIGVGEANEVQLFYYFIKSQSNSKIDPLIYWFTGGPGCSPLS  92

Query  288  AFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTND  467
            A  FE+GP+T++     G +P L LNPYA+TKVAN+IFVD PVG+GYSY+ T  A  ++D
Sbjct  93   AILFELGPITMDIRAYNGSLPTLSLNPYAYTKVANMIFVDLPVGSGYSYATTQKANYSDD  152

Query  468  TLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMK  647
              SA H Y FL +WL++H  +LNNP YVAGDSYSGITVP+V + I +G++ GI+PR+N+K
Sbjct  153  LQSADHAYEFLRKWLIEHQVYLNNPFYVAGDSYSGITVPIVTQVISNGIDMGIKPRINLK  212

Query  648  G  650
            G
Sbjct  213  G  213



>gb|KDP35358.1| hypothetical protein JCGZ_10342 [Jatropha curcas]
Length=485

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/182 (60%), Positives = 136/182 (75%), Gaps = 0/182 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            VV  LPGF   LPF L TGYIGVG S E QLFYYF+ES++SP  DPL+LWLTGGPGCS L
Sbjct  41   VVTNLPGFDGDLPFYLETGYIGVGASNESQLFYYFVESQRSPTLDPLMLWLTGGPGCSVL  100

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTN  464
            SAFF+E GP+  +Y+N  G +P L LNP+AWT+  NII+VD P+GTG+SYS T + Y  +
Sbjct  101  SAFFYESGPVAFDYSNYNGSLPSLHLNPFAWTQGINIIYVDAPIGTGFSYSTTQENYYVD  160

Query  465  DTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNM  644
            D  SA  TY FL +WLLDHP +L N L++ GDSYSGI +P++V++I DG E G  P +N+
Sbjct  161  DIKSAAQTYEFLKKWLLDHPQYLTNQLFIGGDSYSGIPLPMIVQHILDGNEDGTSPTMNL  220

Query  645  KG  650
            KG
Sbjct  221  KG  222



>ref|XP_007201023.1| hypothetical protein PRUPE_ppa005420mg [Prunus persica]
 gb|EMJ02222.1| hypothetical protein PRUPE_ppa005420mg [Prunus persica]
Length=462

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 139/184 (76%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              +++ LPGF   LPFKL TGY+GVG   E+QLFYYFIESE+SPE DPLLLW+TGGP CS
Sbjct  35   QTIIKNLPGFSGDLPFKLETGYVGVGNKDELQLFYYFIESERSPENDPLLLWITGGPRCS  94

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              S   +E GP++ ++ + T    +L LNPY+WTK+ANIIF+D P GTG+SYS T+D YN
Sbjct  95   SFSGLVYENGPISFSFTSITKHPVELVLNPYSWTKLANIIFLDAPAGTGFSYSTTTDGYN  154

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            T+DT+ A+    FL +WLL HP FL NPLY++GDSYSG  VP++V+ I +G+E+GI P L
Sbjct  155  TSDTIHAKRASEFLQRWLLTHPKFLANPLYISGDSYSGKIVPIIVQEITNGIEAGIGPSL  214

Query  639  NMKG  650
            N++G
Sbjct  215  NLEG  218



>ref|XP_002283413.1| PREDICTED: serine carboxypeptidase-like 2 [Vitis vinifera]
Length=469

 Score =   235 bits (599),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 141/184 (77%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H+ V+ LPGF   LPF+L TGY+GVGES+E+QLFYYF++SE +P  DPLLLWLTGGPGCS
Sbjct  28   HSPVKFLPGFEGPLPFELETGYVGVGESEEVQLFYYFVKSENNPTEDPLLLWLTGGPGCS  87

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              SA F+EIGPL        G +P LELNP++WT+V+NIIF+D PVGTG+SY+ TS A +
Sbjct  88   AFSALFYEIGPLYFESVPYHGSLPTLELNPHSWTQVSNIIFLDAPVGTGFSYATTSRASH  147

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            + D  +    + FL +WL+DHP FL+NP+YV GDSYSGITVP+VV++I +G E   EP +
Sbjct  148  SGDFQATHQAHEFLRKWLIDHPEFLSNPVYVGGDSYSGITVPVVVQHISNGNEDDTEPFI  207

Query  639  NMKG  650
            N+KG
Sbjct  208  NLKG  211



>ref|XP_008236344.1| PREDICTED: serine carboxypeptidase-like 13 [Prunus mume]
Length=509

 Score =   236 bits (602),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 141/184 (77%), Gaps = 2/184 (1%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +++TLPGF   LPFKL TGY+GVG   ++QLFYYF ESE SPE DPL+LWLTGGPGCS  
Sbjct  23   IIKTLPGFRGDLPFKLETGYVGVGGMDDVQLFYYFFESEGSPEYDPLVLWLTGGPGCSAF  82

Query  285  SAFFFE-IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY-N  458
            SA  +E +GP + + A+S G+ P L+LNPY+WTKVANIIF+D PVGTG+SY++  + Y N
Sbjct  83   SALVYENLGPFSFDSAHSIGNKPKLKLNPYSWTKVANIIFLDAPVGTGFSYTKNWEGYTN  142

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             NDT+SA  TY FL +WL+DH  F NNPLY+AGDSYSGI VP++V+ I DG +    P +
Sbjct  143  LNDTVSAAQTYEFLRKWLMDHSKFYNNPLYIAGDSYSGIIVPMLVQEISDGNQDEHAPSM  202

Query  639  NMKG  650
            N+KG
Sbjct  203  NLKG  206



>ref|XP_010094886.1| Serine carboxypeptidase-like 18 [Morus notabilis]
 gb|EXB57415.1| Serine carboxypeptidase-like 18 [Morus notabilis]
Length=427

 Score =   234 bits (596),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 141/184 (77%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             +++ TL  F   LPFKL TGY+GVG+++++QLFYYF+ESE+SPE DPLLLWLTGGP CS
Sbjct  32   RSIINTLTDFSGDLPFKLETGYVGVGDAEDLQLFYYFVESERSPENDPLLLWLTGGPCCS  91

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             +SA  +EIGPL+ +Y+NS  D   L LNPY+WTKVANIIF+D P GTG+SYS +S+ Y 
Sbjct  92   SVSALLYEIGPLSFDYSNSNTDTAPLILNPYSWTKVANIIFLDAPAGTGFSYSISSEGYP  151

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            T DTL     + F+ +WL+ HP F+ NPLY+ GDSYSG  VP+VV+ + +G+E+G +P +
Sbjct  152  TTDTLFGAQVFEFIKKWLVSHPKFIINPLYIGGDSYSGKIVPIVVQQLSNGIEAGDQPPI  211

Query  639  NMKG  650
            N+KG
Sbjct  212  NLKG  215



>emb|CBI19380.3| unnamed protein product [Vitis vinifera]
Length=503

 Score =   236 bits (601),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 141/184 (77%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H+ V+ LPGF   LPF+L TGY+GVGES+E+QLFYYF++SE +P  DPLLLWLTGGPGCS
Sbjct  62   HSPVKFLPGFEGPLPFELETGYVGVGESEEVQLFYYFVKSENNPTEDPLLLWLTGGPGCS  121

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              SA F+EIGPL        G +P LELNP++WT+V+NIIF+D PVGTG+SY+ TS A +
Sbjct  122  AFSALFYEIGPLYFESVPYHGSLPTLELNPHSWTQVSNIIFLDAPVGTGFSYATTSRASH  181

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            + D  +    + FL +WL+DHP FL+NP+YV GDSYSGITVP+VV++I +G E   EP +
Sbjct  182  SGDFQATHQAHEFLRKWLIDHPEFLSNPVYVGGDSYSGITVPVVVQHISNGNEDDTEPFI  241

Query  639  NMKG  650
            N+KG
Sbjct  242  NLKG  245



>emb|CAN74923.1| hypothetical protein VITISV_038590 [Vitis vinifera]
Length=499

 Score =   235 bits (600),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 138/182 (76%), Gaps = 0/182 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             ++V+TLPGF  +LPFKL TGY+ VGE  +++LFYYFIESE+ P  DPL+LWLTGGPGCS
Sbjct  42   QSIVDTLPGFSGELPFKLETGYVSVGELNDVELFYYFIESERDPARDPLILWLTGGPGCS  101

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            G S   +EIGPL  NY    G +P LELNPY+WTKVA+IIF+D PVGTG+SY+   D Y 
Sbjct  102  GFSGLVYEIGPLRFNYTAFNGSLPSLELNPYSWTKVASIIFLDAPVGTGFSYATNPDDYY  161

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             +DT+SA+  Y F+ +WL+DHP FL NPLY+ GDSYSGI VP++   I +G++ G++P +
Sbjct  162  ASDTISARDNYIFIRKWLIDHPRFLYNPLYIGGDSYSGIIVPILTLEIANGIQMGLKPLM  221

Query  639  NM  644
             +
Sbjct  222  TL  223



>ref|XP_008236280.1| PREDICTED: serine carboxypeptidase-like 17 isoform X1 [Prunus 
mume]
Length=476

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 136/184 (74%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              V++ LPGF   LPF+L TGY+GVG   E+QLFYYF ESE+SPE DPLLLW+TGGP CS
Sbjct  35   QTVIKNLPGFSGDLPFELETGYVGVGNKDELQLFYYFTESERSPENDPLLLWITGGPRCS  94

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              S   +EIGP+  ++   T D  +L LNPY+WTK+ANIIF+D P GTG+SYS T+D YN
Sbjct  95   AFSGLVYEIGPIAFSFTRITKDPVELVLNPYSWTKLANIIFLDAPAGTGFSYSTTTDGYN  154

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            T+DT+ A+    FL +WL  H  FL NPLY++GDSYSG  VP++V+ I +G+E+G EP L
Sbjct  155  TSDTIHAKRASEFLRKWLSTHRKFLANPLYISGDSYSGKIVPIIVQEIVNGIEAGTEPPL  214

Query  639  NMKG  650
            N+KG
Sbjct  215  NLKG  218



>ref|XP_008236281.1| PREDICTED: serine carboxypeptidase-like 17 isoform X2 [Prunus 
mume]
Length=472

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 136/184 (74%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              V++ LPGF   LPF+L TGY+GVG   E+QLFYYF ESE+SPE DPLLLW+TGGP CS
Sbjct  35   QTVIKNLPGFSGDLPFELETGYVGVGNKDELQLFYYFTESERSPENDPLLLWITGGPRCS  94

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              S   +EIGP+  ++   T D  +L LNPY+WTK+ANIIF+D P GTG+SYS T+D YN
Sbjct  95   AFSGLVYEIGPIAFSFTRITKDPVELVLNPYSWTKLANIIFLDAPAGTGFSYSTTTDGYN  154

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            T+DT+ A+    FL +WL  H  FL NPLY++GDSYSG  VP++V+ I +G+E+G EP L
Sbjct  155  TSDTIHAKRASEFLRKWLSTHRKFLANPLYISGDSYSGKIVPIIVQEIVNGIEAGTEPPL  214

Query  639  NMKG  650
            N+KG
Sbjct  215  NLKG  218



>gb|EYU37561.1| hypothetical protein MIMGU_mgv1a005963mg [Erythranthe guttata]
Length=463

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 134/184 (73%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             + V TLPG+P  LPFKL TGYIGVG+  E+QLFYYF+ESE+ P  DPL+ WLTGGPGCS
Sbjct  19   QSTVNTLPGYPGPLPFKLETGYIGVGDDDEVQLFYYFVESERDPRKDPLIFWLTGGPGCS  78

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            G S   +EIGPL  +  +  G  P   LNPY+WTK+A+IIF+D PVGTG+SY+ TS++Y 
Sbjct  79   GFSGLVYEIGPLAFDVVDFDGSFPSFTLNPYSWTKIASIIFIDSPVGTGFSYTNTSESYA  138

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            T+DT S +  Y FL +WL  HP FL N LY+AGDSY G   P+V R I +G E+G++PR+
Sbjct  139  TSDTKSTEDNYVFLRKWLSLHPRFLKNRLYIAGDSYGGKITPMVARAISEGNEAGLQPRM  198

Query  639  NMKG  650
             ++G
Sbjct  199  LLQG  202



>ref|XP_002522137.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF40337.1| serine carboxypeptidase, putative [Ricinus communis]
Length=479

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 136/182 (75%), Gaps = 0/182 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +VE+LPG+  KLPFKL TGY+GVGE +E+QLFYYFIESE+ P  DPLLLWLTGGPGCS  
Sbjct  36   IVESLPGYKGKLPFKLETGYVGVGELEELQLFYYFIESERDPVRDPLLLWLTGGPGCSAF  95

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTN  464
            S   +EIGPL  +Y    G +P L  N ++WTK+ANIIF+D PVGTG+SYS++ + Y T+
Sbjct  96   SGLVYEIGPLNYDYDAFNGSLPSLVANEFSWTKIANIIFLDAPVGTGFSYSKSQEGYYTS  155

Query  465  DTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNM  644
            DT S+Q  Y FL +WL+DHP F NNPLYVAGDSYSG+ VP V   I  G ++   P +N+
Sbjct  156  DTESSQAIYQFLRKWLVDHPKFKNNPLYVAGDSYSGMIVPTVTVEIAKGNKAKHRPYMNL  215

Query  645  KG  650
            +G
Sbjct  216  QG  217



>ref|XP_011458874.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=448

 Score =   232 bits (591),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 138/183 (75%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V+ LPG    LPF+L TGY+GVGES+E+QLFYYF++SE++PE DPL+LWLTGGPGCS 
Sbjct  34   SLVKFLPGLQGPLPFELETGYVGVGESEELQLFYYFVKSERNPEKDPLMLWLTGGPGCSA  93

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            +SA FFEIGPL        G +P L LNP++WTKV +IIF+D PVGTG+SY+ TS A   
Sbjct  94   VSALFFEIGPLNFKVEQYNGSLPTLVLNPHSWTKVCSIIFIDSPVGTGFSYARTSFASQP  153

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
             D    QH   FL +WL+DHP+F++NP Y+ GDSYSGI VP++   I +G E+G++P +N
Sbjct  154  GDLEQVQHALQFLRRWLVDHPSFMSNPFYIGGDSYSGIPVPVLAEQISNGNEAGVKPIIN  213

Query  642  MKG  650
            ++G
Sbjct  214  LQG  216



>gb|EYU37560.1| hypothetical protein MIMGU_mgv1a005845mg [Erythranthe guttata]
Length=468

 Score =   232 bits (592),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 134/184 (73%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             + V TLPG+P  LPFKL TGYIGVG+  E+QLFYYF+ESE+ P  DPL+ WLTGGPGCS
Sbjct  24   QSTVNTLPGYPGPLPFKLETGYIGVGDDDEVQLFYYFVESERDPRKDPLIFWLTGGPGCS  83

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            G S   +EIGPL  +  +  G  P   LNPY+WTK+A+IIF+D PVGTG+SY+ TS++Y 
Sbjct  84   GFSGLVYEIGPLAFDVVDFDGSFPSFTLNPYSWTKIASIIFIDSPVGTGFSYTNTSESYA  143

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            T+DT S +  Y FL +WL  HP F+ N LY+AGDSY G   P+V R I +G E+G++PR+
Sbjct  144  TSDTKSTEDNYVFLRKWLSLHPRFVKNRLYIAGDSYGGKITPMVARAISEGNEAGLQPRM  203

Query  639  NMKG  650
             ++G
Sbjct  204  LLQG  207



>ref|XP_004292764.2| PREDICTED: serine carboxypeptidase-like 7 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=476

 Score =   232 bits (592),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 138/183 (75%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V+ LPG    LPF+L TGY+GVGES+E+QLFYYF++SE++PE DPL+LWLTGGPGCS 
Sbjct  34   SLVKFLPGLQGPLPFELETGYVGVGESEELQLFYYFVKSERNPEKDPLMLWLTGGPGCSA  93

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            +SA FFEIGPL        G +P L LNP++WTKV +IIF+D PVGTG+SY+ TS A   
Sbjct  94   VSALFFEIGPLNFKVEQYNGSLPTLVLNPHSWTKVCSIIFIDSPVGTGFSYARTSFASQP  153

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
             D    QH   FL +WL+DHP+F++NP Y+ GDSYSGI VP++   I +G E+G++P +N
Sbjct  154  GDLEQVQHALQFLRRWLVDHPSFMSNPFYIGGDSYSGIPVPVLAEQISNGNEAGVKPIIN  213

Query  642  MKG  650
            ++G
Sbjct  214  LQG  216



>ref|XP_006345532.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X2 [Solanum 
tuberosum]
Length=338

 Score =   228 bits (580),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 139/181 (77%), Gaps = 0/181 (0%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            V+ LPGF   LPF+L TGYIGVGE+ E+QLFYYFI+S+ +P+ DPL+ W TGGPGCS LS
Sbjct  27   VKYLPGFERPLPFQLETGYIGVGEADEVQLFYYFIKSQSNPKVDPLIYWFTGGPGCSPLS  86

Query  288  AFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTND  467
              FFE GP+T++     G +P L LNP+A+TKVA++IFVD PVGTG+SY+ T  A  ++D
Sbjct  87   GIFFEFGPITLDTRAYNGSLPTLSLNPHAYTKVASMIFVDLPVGTGFSYATTQKANYSDD  146

Query  468  TLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMK  647
              SA H Y FL +WL++H  +LNNP YVAGDSYSGITVP+V + I +G++ GI+P +N+K
Sbjct  147  LQSANHAYEFLRKWLIEHQEYLNNPFYVAGDSYSGITVPIVTQVISNGIDRGIKPWINLK  206

Query  648  G  650
            G
Sbjct  207  G  207



>ref|XP_010692123.1| PREDICTED: serine carboxypeptidase-like 13 [Beta vulgaris subsp. 
vulgaris]
Length=455

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 141/192 (73%), Gaps = 10/192 (5%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            VV++LPGF   LPFKLHTGYIGVG ++E+QLFYYFIESE+ PETDP++LWLTGGPGC+ L
Sbjct  28   VVKSLPGFSGNLPFKLHTGYIGVGRAEEVQLFYYFIESERDPETDPIMLWLTGGPGCTSL  87

Query  285  SAFFFE-IGPLTINY---------ANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSY  434
            SA FFE IGPL+ NY         +N   ++P L+LNPY+WTKV N++FV+ PVGTG+SY
Sbjct  88   SAIFFEHIGPLSFNYTGVYFNRTTSNWETNLPALQLNPYSWTKVVNLLFVEAPVGTGFSY  147

Query  435  SETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGL  614
            S T+++Y T D +S +  Y FL +WL +HP F  NPLY+ G SY G+ VP + + I +G 
Sbjct  148  SSTAESYLTTDIISGKQIYEFLRKWLTEHPQFATNPLYIGGSSYCGLIVPFITQEIVEGN  207

Query  615  ESGIEPRLNMKG  650
            E     ++N+KG
Sbjct  208  EDETGSQINIKG  219



>ref|XP_006345531.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X1 [Solanum 
tuberosum]
Length=389

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 139/181 (77%), Gaps = 0/181 (0%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            V+ LPGF   LPF+L TGYIGVGE+ E+QLFYYFI+S+ +P+ DPL+ W TGGPGCS LS
Sbjct  27   VKYLPGFERPLPFQLETGYIGVGEADEVQLFYYFIKSQSNPKVDPLIYWFTGGPGCSPLS  86

Query  288  AFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTND  467
              FFE GP+T++     G +P L LNP+A+TKVA++IFVD PVGTG+SY+ T  A  ++D
Sbjct  87   GIFFEFGPITLDTRAYNGSLPTLSLNPHAYTKVASMIFVDLPVGTGFSYATTQKANYSDD  146

Query  468  TLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMK  647
              SA H Y FL +WL++H  +LNNP YVAGDSYSGITVP+V + I +G++ GI+P +N+K
Sbjct  147  LQSANHAYEFLRKWLIEHQEYLNNPFYVAGDSYSGITVPIVTQVISNGIDRGIKPWINLK  206

Query  648  G  650
            G
Sbjct  207  G  207



>ref|XP_004296446.1| PREDICTED: serine carboxypeptidase-like 18 [Fragaria vesca subsp. 
vesca]
Length=475

 Score =   231 bits (588),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 135/184 (73%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              +V +LPGF   LPF L TGY+GVG+S   QLFYYF+ES++SP  DPL+LW TGGPGCS
Sbjct  34   QTIVTSLPGFEGDLPFTLETGYVGVGDSNTSQLFYYFVESQRSPAEDPLMLWFTGGPGCS  93

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LSAFF+E GPL+  Y +  G +P L LNPYAWT+  NII+VD PVGTG+SYS T + Y 
Sbjct  94   VLSAFFYESGPLSFTYVDYNGSLPSLHLNPYAWTQGLNIIYVDSPVGTGFSYSTTQEGYY  153

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             +D  +   +  FL +WL+ HP FLNN LY+ GDSYSGI +P++V+ +YDG  +G+EP L
Sbjct  154  IDDEDAVDQSVQFLRKWLMAHPQFLNNILYIGGDSYSGIPLPIIVQQLYDGNNAGVEPYL  213

Query  639  NMKG  650
            N++G
Sbjct  214  NLRG  217



>ref|XP_010682454.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=459

 Score =   230 bits (587),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 136/183 (74%), Gaps = 2/183 (1%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            ++TLPGF   LPF L TGYIGVG+S+E+QLFYYFIESE+  E DP+L+WLTGGPGCS  S
Sbjct  34   IKTLPGFTGNLPFNLETGYIGVGKSEEVQLFYYFIESERDVERDPVLIWLTGGPGCSAYS  93

Query  288  AFFFEIGPLTINYAN--STGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
               +EIGPLT NY+   S   IP  +LNPY+WTKVA+IIF+D PVGTG+SY  TSDAY +
Sbjct  94   GLVYEIGPLTFNYSAPYSEASIPKFQLNPYSWTKVASIIFLDSPVGTGFSYGTTSDAYYS  153

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            +D L +Q+ Y FL +WL  HP    NPLYVAGDSYSG+ VP++V+ I DG +     ++N
Sbjct  154  DDILQSQNIYEFLQKWLTGHPKLKANPLYVAGDSYSGLIVPILVQEILDGNKKRHMQKIN  213

Query  642  MKG  650
            + G
Sbjct  214  LMG  216



>gb|KDO81469.1| hypothetical protein CISIN_1g012276mg [Citrus sinensis]
Length=348

 Score =   227 bits (578),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 133/184 (72%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H+ V+ LPGF   LPF+L TGY+GVGES+E QLFYYF++S+K+P+ DPLLLWLTGGPGCS
Sbjct  24   HSTVKFLPGFQGPLPFELETGYVGVGESEEAQLFYYFVKSDKNPKEDPLLLWLTGGPGCS  83

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              S   +EIGP+  N     G +P L LNPY+WTK A+I+FVD PVGTG+SY+ T  A  
Sbjct  84   AFSGLAYEIGPVNFNTVEYNGSLPTLRLNPYSWTKEASILFVDSPVGTGFSYARTPHASQ  143

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            T D     H   FL +WL+DHP F++NP YV GDSYSGITVP +V+ I +  E  I+P +
Sbjct  144  TGDFKQVHHLDQFLRKWLMDHPEFISNPFYVGGDSYSGITVPALVQRISNENEEDIKPLI  203

Query  639  NMKG  650
            N++G
Sbjct  204  NLQG  207



>dbj|BAF56655.1| serine carboxypeptitase-like protein 1 [Diospyros kaki]
Length=452

 Score =   229 bits (585),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 137/184 (74%), Gaps = 1/184 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V+ LPGF  +LPFKL TGYIGVGE  E+QLFYYF+ES+  P  DPL+LWLTGGPGCSG
Sbjct  8    SIVKFLPGFDGELPFKLETGYIGVGEIDEVQLFYYFVESQGDPSNDPLILWLTGGPGCSG  67

Query  282  LSAFFFEIGPLTINYAN-STGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             SA  +EIGPL     +   G +P L  +  +WTKVANIIF+DQPVGTG+SY  T+ AYN
Sbjct  68   FSALVYEIGPLLFKVQSWKPGTLPSLRASKNSWTKVANIIFIDQPVGTGFSYGTTAAAYN  127

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            ++DT++A   Y FL +WL+ +P F  NPLYV GD YSGITVPL+V+ I DG+ SG  PR+
Sbjct  128  SSDTVAAAQVYKFLRKWLMYNPKFGANPLYVGGDLYSGITVPLLVQTILDGIGSGSLPRM  187

Query  639  NMKG  650
             +KG
Sbjct  188  QLKG  191



>dbj|BAF99696.1| 1-O-acylglucose:anthocyanin-O-acyltransferase- like protein [Gentiana 
triflora]
Length=481

 Score =   230 bits (586),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 136/184 (74%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             ++V+TLPGF   LPF L +GY+GVGE++E+QLFYYFIESE+ P  DPL++WLTGGPGCS
Sbjct  47   QSIVKTLPGFHGSLPFTLESGYVGVGENEELQLFYYFIESERDPANDPLVIWLTGGPGCS  106

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              S   FEIGPLT ++ +  G +P L  NP++WTK A+IIFVD PVGTGYSYS T + Y+
Sbjct  107  AFSGLIFEIGPLTFDFESYQGGVPTLNYNPHSWTKEASIIFVDSPVGTGYSYSNTFEGYH  166

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            + D  ++   Y+FL +WLL HP FL NP+YV GDSY G  V LV   I  G+++G EPR+
Sbjct  167  STDHKASDDLYAFLRKWLLKHPKFLKNPVYVGGDSYGGKFVALVTWRISQGIDAGHEPRI  226

Query  639  NMKG  650
            N++G
Sbjct  227  NLQG  230



>gb|KDP44530.1| hypothetical protein JCGZ_16363 [Jatropha curcas]
Length=467

 Score =   229 bits (584),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 136/184 (74%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             ++++ LPGF   LPF L TGY+GVG ++E+QLFYYF+ESE++P+ DPL+LW T GPGCS
Sbjct  24   QSIIKNLPGFDGDLPFNLETGYVGVGYNEEVQLFYYFVESERNPKDDPLVLWFTAGPGCS  83

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LSA  ++ GPL  NYAN T   P L LNP++WTKVANII++D PVGTG+SY+ T   YN
Sbjct  84   SLSAILYQHGPLHFNYANPTSSKPTLVLNPHSWTKVANIIYLDAPVGTGFSYATTWRGYN  143

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
              D  SA  TY FL +WL+ HP FL+NP+YV  DSY G+ VP++V+ I  G + G +P++
Sbjct  144  IGDLSSAAQTYDFLRKWLMAHPKFLSNPMYVGSDSYGGLVVPIIVQEITTGNDKGNKPKI  203

Query  639  NMKG  650
            N+KG
Sbjct  204  NLKG  207



>ref|XP_010321497.1| PREDICTED: serine carboxypeptidase-like 12 [Solanum lycopersicum]
Length=459

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 139/181 (77%), Gaps = 0/181 (0%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            V+ LPGF  +L F+L TGYIGVGE+ E+Q+FYYFI+SE +P+ DPL+ W TGGPGCS LS
Sbjct  27   VKYLPGFEGQLAFQLETGYIGVGEADEVQVFYYFIKSESNPKVDPLIYWFTGGPGCSALS  86

Query  288  AFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTND  467
            A FFE GP+T++     G +P L LNPYA+TKVA+IIFVD PVGTG+SY+ T  A  +++
Sbjct  87   AIFFEFGPITLDTRAYNGSLPTLSLNPYAYTKVASIIFVDLPVGTGFSYATTQKANYSDN  146

Query  468  TLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMK  647
             LSA H Y F+ +WL++H  +LNNP YV GDSYSGITVP+V + I +G + GI+P +N+K
Sbjct  147  LLSADHAYEFIRKWLIEHQEYLNNPFYVGGDSYSGITVPIVTQFISNGNDMGIKPWINLK  206

Query  648  G  650
            G
Sbjct  207  G  207



>ref|XP_004306039.2| PREDICTED: serine carboxypeptidase-like 16 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=274

 Score =   223 bits (568),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 127/182 (70%), Gaps = 0/182 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +  TLPG P  LPF L TGY+ VG+  ++Q FYYFIES++ P  DPLLLWLTGGPGCSG 
Sbjct  39   ITTTLPGHPGTLPFSLETGYVSVGDLDQLQFFYYFIESQRDPVKDPLLLWLTGGPGCSGF  98

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTN  464
            S   +EIGPLT +Y    G  P    NP++WT+VANIIF+D PVGTG+SYS   + Y +N
Sbjct  99   SGLVYEIGPLTFDYIAFNGSFPTFVDNPFSWTQVANIIFIDAPVGTGFSYSTAQEGYYSN  158

Query  465  DTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNM  644
            DT SA+  Y FL +W+L HP F  NPLY+AGDSYSGI VP V   + DG  +G+ P + +
Sbjct  159  DTESAEAVYQFLRKWMLKHPKFRYNPLYIAGDSYSGIIVPQVTLKVSDGNRNGVRPPMKL  218

Query  645  KG  650
            +G
Sbjct  219  QG  220



>ref|XP_008236498.1| PREDICTED: serine carboxypeptidase-like 18 [Prunus mume]
Length=247

 Score =   222 bits (566),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 137/183 (75%), Gaps = 14/183 (8%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V TLPG   +LPFKL TGY+GVG+S ++QLFYYFIESE++P+ DPL+LWLTGGP    
Sbjct  20   SIVNTLPGMSGELPFKLETGYLGVGDSDDVQLFYYFIESERNPKEDPLVLWLTGGP----  75

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
                      L  NYA+S+G+ P L L+PY+WTK+ANIIF+DQPVGTG+SY+++S  Y T
Sbjct  76   ----------LVFNYADSSGNQPTLLLDPYSWTKLANIIFLDQPVGTGFSYAKSSQGYMT  125

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
             D LSA  TY FL +W+ DHP FL NPLY+ GDSYSG+TVP++ + + +G E G EP +N
Sbjct  126  GDALSAAQTYEFLRKWIKDHPQFLKNPLYIGGDSYSGMTVPIITQEVSEGNEVGREPPMN  185

Query  642  MKG  650
            +KG
Sbjct  186  LKG  188



>ref|XP_011457835.1| PREDICTED: serine carboxypeptidase-like 7 [Fragaria vesca subsp. 
vesca]
Length=467

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 139/184 (76%), Gaps = 1/184 (1%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              +VETLPG+   LPFKL TGYI V +  E+ LFYYF+ES+++P  DPL+LWLTGGPGCS
Sbjct  23   RTIVETLPGWNGTLPFKLETGYISVDDLDEVNLFYYFVESDRNPIEDPLVLWLTGGPGCS  82

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            G SAF +EIGP T +  +  G IP + +NPY+WTKVANIIF+D PVG G+SYS +S+ + 
Sbjct  83   GFSAFAYEIGPFTFD-LHYNGSIPTIVMNPYSWTKVANIIFIDAPVGAGFSYSTSSEGWY  141

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            T+DT  A  TY+FL +WL  HP +  N LYV GDSYSG+ VP++++NI +GLE+G+ PR+
Sbjct  142  TSDTKQAAQTYTFLRKWLYTHPEYQGNQLYVGGDSYSGLIVPILLKNILEGLEAGLRPRM  201

Query  639  NMKG  650
             ++G
Sbjct  202  QLQG  205



>emb|CDP20368.1| unnamed protein product [Coffea canephora]
Length=445

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 135/184 (73%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             ++V+TLPG+   LPFKL TGYI  G   E+Q F+YFIESE+ P+ DPL+LWLTGGPGCS
Sbjct  23   RSIVDTLPGYSGTLPFKLETGYISAGRDDEVQFFHYFIESEREPDRDPLMLWLTGGPGCS  82

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              S   +EIGPL  ++    G +P   LNPY+WTK+A+IIF+D PVGTG++Y+ TS+ Y+
Sbjct  83   AFSGLVYEIGPLNFDFETFDGSLPAFVLNPYSWTKIASIIFLDAPVGTGFTYATTSEGYH  142

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            ++D  +    Y+FL +WLL HP F+ N LY+AGDS++G  VP+VV  I  G+E+G+ PR+
Sbjct  143  SSDVQTVGDIYTFLQKWLLKHPNFIKNRLYIAGDSFAGYLVPMVVNKISQGIEAGVNPRM  202

Query  639  NMKG  650
            N++G
Sbjct  203  NIQG  206



>ref|XP_008236290.1| PREDICTED: serine carboxypeptidase-like 17 isoform X2 [Prunus 
mume]
Length=473

 Score =   228 bits (581),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 136/184 (74%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              +V+ LPGF   LPFKL TGY+GVG S+E+Q+FYYF ESE SPE DPLLLW+TGGP CS
Sbjct  32   QTIVKNLPGFSGDLPFKLETGYVGVGNSEELQMFYYFTESESSPENDPLLLWMTGGPRCS  91

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
                  +EIGP++  + + + D   L LNPY+WTKVANIIF+D P  TGYSYS T +   
Sbjct  92   SFYGLIYEIGPISFQFNDLSKDPLKLVLNPYSWTKVANIIFLDAPAATGYSYSTTLEGLI  151

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            ++DTL A   Y FL +WL+ HP FL+NPLY++GDS++G  VP++V++I  G+E+G+EP L
Sbjct  152  SSDTLHATRAYQFLQKWLVAHPQFLSNPLYISGDSFTGKIVPIIVQHITQGIEAGMEPAL  211

Query  639  NMKG  650
            N+KG
Sbjct  212  NLKG  215



>ref|XP_006472320.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X1 [Citrus 
sinensis]
 ref|XP_006472321.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X2 [Citrus 
sinensis]
Length=467

 Score =   228 bits (580),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 133/184 (72%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H+ V+ LPGF   LPF+L TGY+GVGES+E QLFYYF++SEK+P+ DPLLLWLTGGPGCS
Sbjct  24   HSTVKFLPGFQGPLPFELETGYVGVGESEEAQLFYYFVKSEKNPKEDPLLLWLTGGPGCS  83

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              S   +EIGP+  N     G +P L LNPY+WTK A+I+FVD PVGTG+SY+ T  A  
Sbjct  84   AFSGLAYEIGPVNFNTVEYNGSLPTLRLNPYSWTKEASILFVDSPVGTGFSYARTPHASQ  143

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            T D     H   FL +WL+DHP F++NP YV GDSYSGITVP +V+ I +  E  I+P +
Sbjct  144  TGDFKQVHHLDQFLRKWLMDHPEFISNPFYVGGDSYSGITVPALVQRISNENEEDIKPLI  203

Query  639  NMKG  650
            N++G
Sbjct  204  NLQG  207



>ref|XP_002525293.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF37121.1| serine carboxypeptidase, putative [Ricinus communis]
Length=596

 Score =   231 bits (588),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 137/183 (75%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +++ TLPGF   +PFKL TGYIGV E +++QLFYYFIESE++   DPL+LWLTGGPGCS 
Sbjct  40   SIIRTLPGFSGSVPFKLETGYIGVDEKEDVQLFYYFIESERNAREDPLVLWLTGGPGCSA  99

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            LS   FEIGPL  N     G +P L+LNPY+WTKV+++IF+D PVGTG+SYS +     T
Sbjct  100  LSGLAFEIGPLLFNMVEYNGSLPTLKLNPYSWTKVSSVIFLDAPVGTGFSYSRSFQGSKT  159

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
             DT+ A  T +FL +WLL HP F+  PLY+AGDSYSGI VP++ + + +G+E G +P++N
Sbjct  160  ADTIYATQTSTFLKKWLLCHPQFIKIPLYIAGDSYSGIIVPIITKELSEGIELGEQPQIN  219

Query  642  MKG  650
            ++G
Sbjct  220  LEG  222



>ref|XP_010694002.1| PREDICTED: serine carboxypeptidase-like 10 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=374

 Score =   223 bits (569),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 139/184 (76%), Gaps = 2/184 (1%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            V++++PG+P  LPF L TGY+GVG+++ +QLFYYFI+SE++P+TDPL+LWLTGGPGCS L
Sbjct  38   VIKSVPGYPDNLPFYLETGYVGVGDNEGVQLFYYFIKSERNPQTDPLILWLTGGPGCSAL  97

Query  285  SAFFFEIGPLTINYA--NSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            S    EIGPL  N +  N     P  +LNP++WTKVA+IIF+D PVGTG+SY+   + Y 
Sbjct  98   SGLVLEIGPLIFNTSAFNWHSKAPTFQLNPFSWTKVASIIFLDSPVGTGFSYATDPEHYY  157

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            T+D  S++H Y FL +WL+DH  F NNPLY+ GDSYSG+ VP+VV+ I  G +  ++P +
Sbjct  158  TDDITSSEHIYQFLRKWLMDHVGFQNNPLYICGDSYSGMIVPIVVKEISKGNKVHVQPIM  217

Query  639  NMKG  650
            N++G
Sbjct  218  NLQG  221



>gb|KDO81468.1| hypothetical protein CISIN_1g012276mg [Citrus sinensis]
Length=467

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 133/184 (72%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H+ V+ LPGF   LPF+L TGY+GVGES+E QLFYYF++S+K+P+ DPLLLWLTGGPGCS
Sbjct  24   HSTVKFLPGFQGPLPFELETGYVGVGESEEAQLFYYFVKSDKNPKEDPLLLWLTGGPGCS  83

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              S   +EIGP+  N     G +P L LNPY+WTK A+I+FVD PVGTG+SY+ T  A  
Sbjct  84   AFSGLAYEIGPVNFNTVEYNGSLPTLRLNPYSWTKEASILFVDSPVGTGFSYARTPHASQ  143

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            T D     H   FL +WL+DHP F++NP YV GDSYSGITVP +V+ I +  E  I+P +
Sbjct  144  TGDFKQVHHLDQFLRKWLMDHPEFISNPFYVGGDSYSGITVPALVQRISNENEEDIKPLI  203

Query  639  NMKG  650
            N++G
Sbjct  204  NLQG  207



>ref|XP_009771130.1| PREDICTED: serine carboxypeptidase-like 13 isoform X3 [Nicotiana 
sylvestris]
Length=411

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 133/184 (72%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H+ VE LPGF   LPF L TGYIGVGE +E+QLFYYF++SE  P  DP+L+WL+GGPGCS
Sbjct  32   HSTVEFLPGFEGPLPFHLETGYIGVGEYEEVQLFYYFLKSESEPTKDPILIWLSGGPGCS  91

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              +A  ++IGPL        G +P L LNP +WTKVANIIF+DQPV +G+SY+ TS  + 
Sbjct  92   SFTALVYQIGPLYFEPNEYNGSLPKLTLNPNSWTKVANIIFLDQPVNSGFSYATTSTTFK  151

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            + D  +  H Y FL +WL+ H  F+ NP+Y+ GDSYSGITVP++ + I +G+E+G +P +
Sbjct  152  STDLQACHHIYQFLRKWLIKHQEFIRNPMYIGGDSYSGITVPVITQLISNGIEAGHKPSI  211

Query  639  NMKG  650
            N+KG
Sbjct  212  NLKG  215



>ref|XP_006433655.1| hypothetical protein CICLE_v10001060mg [Citrus clementina]
 gb|ESR46895.1| hypothetical protein CICLE_v10001060mg [Citrus clementina]
Length=467

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 133/184 (72%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H+ V+ LPGF   LPF+L TGY+GVGES+E QLFYYF++S+K+P+ DPLLLWLTGGPGCS
Sbjct  24   HSTVKFLPGFQGPLPFELETGYVGVGESEEAQLFYYFVKSDKNPKEDPLLLWLTGGPGCS  83

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              S   +EIGP+  N     G +P L LNPY+WTK A+I+FVD PVGTG+SY+ T  A  
Sbjct  84   AFSGLAYEIGPVNFNTVEYNGSLPTLRLNPYSWTKEASILFVDSPVGTGFSYARTPHASQ  143

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            T D     H   FL +WL+DHP F++NP YV GDSYSGITVP +V+ I +  E  I+P +
Sbjct  144  TGDFKQVHHLDQFLRKWLMDHPEFISNPFYVGGDSYSGITVPALVQRISNENEEDIKPLI  203

Query  639  NMKG  650
            N++G
Sbjct  204  NLQG  207



>gb|KEH33547.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=454

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 139/183 (76%), Gaps = 1/183 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V+ LPGF  +LPFKL TGYIGVGE  ++Q+FYYF+ES+++P  DP+LLW  GGPGCS 
Sbjct  25   SIVKNLPGFDGELPFKLETGYIGVGEGAKVQMFYYFVESQRNPFVDPILLWFVGGPGCSA  84

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            LSAFFFE GPLT+   + +G +P L+LNPY WT + N++++D PVGTG+SYSET + Y +
Sbjct  85   LSAFFFENGPLTME-DDYSGILPKLKLNPYGWTHMLNMMYIDIPVGTGFSYSETQEGYYS  143

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            +DTL   HTYSFL +W+LDHP F +NP Y+ G SYSG T   +V+ +YDG  +  +P +N
Sbjct  144  SDTLWVDHTYSFLQKWILDHPKFSSNPFYIGGGSYSGFTTGPLVQKVYDGNIARHKPHIN  203

Query  642  MKG  650
            +KG
Sbjct  204  IKG  206



>ref|XP_003556796.2| PREDICTED: serine carboxypeptidase-like 17-like isoform X1 [Glycine 
max]
Length=373

 Score =   222 bits (566),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 134/182 (74%), Gaps = 1/182 (1%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +V+ LPGF   LPF L+TGYIGVG+ +E+QL+YYF+ES++SP  DPLLLWL GGPGCS  
Sbjct  27   IVKNLPGF-GDLPFTLNTGYIGVGQREEVQLYYYFVESQRSPLNDPLLLWLVGGPGCSAH  85

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTN  464
            SAFF+E GPL  N+ +  G  P L LNP+ WTKV NI++VD PVGTGYSYS+T + Y +N
Sbjct  86   SAFFYENGPLMFNFHDFNGSFPQLLLNPHTWTKVLNILYVDAPVGTGYSYSKTQEGYYSN  145

Query  465  DTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNM  644
            D    +H Y F  +WL+DHP F +NPLY+ G SYSGI V  +V+ +Y+  E+G  P LN+
Sbjct  146  DEQLVEHMYDFFHKWLVDHPEFRSNPLYIGGGSYSGIVVLPLVQKVYEDYETGRSPILNI  205

Query  645  KG  650
            +G
Sbjct  206  QG  207



>ref|XP_008385684.1| PREDICTED: uncharacterized protein LOC103448207 [Malus domestica]
Length=466

 Score =   225 bits (573),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 133/198 (67%), Gaps = 29/198 (15%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            ++  LPGFP  LPFKL TGY+GVG   ++QLFYYFIESE SPE DPL+LWLTGGPGCS  
Sbjct  22   IITALPGFPGNLPFKLETGYVGVGNMDDVQLFYYFIESEGSPEYDPLVLWLTGGPGCSAF  81

Query  285  SA----------------------------FFFEIGPLTINYANSTGDIPDLELNPYAWT  380
            S                             F+F  GPL+ +YANS G+ P  +LNPY+WT
Sbjct  82   SGLIYENLGTCLIINSLSASFQRITLFCNRFYFVXGPLSFDYANSIGNKPKFKLNPYSWT  141

Query  381  KVANIIFVDQPVGTGYSYSETSDAY-NTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAG  557
            KVANIIF+D PVGTG+SY++T   Y N +DTLSA  TY FL +WL+DHP F NN LYVAG
Sbjct  142  KVANIIFLDAPVGTGFSYAKTWRGYANMSDTLSAAQTYEFLRKWLMDHPKFFNNQLYVAG  201

Query  558  DSYSGITVPLVVRNIYDG  611
            DSYSGI  P++V+ I DG
Sbjct  202  DSYSGIVXPIIVQKISDG  219



>gb|EPS73196.1| hypothetical protein M569_01551 [Genlisea aurea]
Length=444

 Score =   224 bits (571),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 135/183 (74%), Gaps = 8/183 (4%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++VE LPGF   LPFKL TGY+GVGE++   LFYYFIESE+ P TDPL++W+TGGPGCS 
Sbjct  22   SIVENLPGFSGALPFKLETGYVGVGENE---LFYYFIESERDPVTDPLIIWITGGPGCSA  78

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            LS   +EIGP+T N     G  P L+LNPY+WTK A+I+FVD PVGTG+SYS T   Y T
Sbjct  79   LSGLVYEIGPMTFN-----GSSPVLKLNPYSWTKAASIVFVDSPVGTGFSYSTTPQGYQT  133

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            +DT +AQ  YSFL +WLL HP F+ NPL++AGDSY G    L+   +  G+E+G+EPRL 
Sbjct  134  SDTQTAQDNYSFLKKWLLSHPEFMTNPLFIAGDSYGGKMAILLALLVAQGIEAGVEPRLL  193

Query  642  MKG  650
            ++G
Sbjct  194  LQG  196



>ref|XP_011466208.1| PREDICTED: serine carboxypeptidase-like 18 isoform X3 [Fragaria 
vesca subsp. vesca]
Length=445

 Score =   224 bits (571),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 132/183 (72%), Gaps = 2/183 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V++LPGFP  LPF L TGYIGV E  ++QLFYYF+ESE++P  DPLLLWLTGGP CS 
Sbjct  38   SIVKSLPGFPGSLPFHLETGYIGVDEKDDVQLFYYFVESERNPRDDPLLLWLTGGPTCSA  97

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            LS   FEIGP+  N     G +P   LNPY+WTKV++IIFVD PVGTG+SY  +     +
Sbjct  98   LSGLAFEIGPIKFNMVEYNGSLPTFVLNPYSWTKVSSIIFVDAPVGTGFSYPRSLQW--S  155

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            +D L   H YSFL++WL+ HP F+ NP+Y+AGDSY G+ VP++ + I  G+E G  P +N
Sbjct  156  SDALFVNHIYSFLMKWLIYHPKFITNPIYIAGDSYCGMIVPVIAQEIVKGIEVGDIPAIN  215

Query  642  MKG  650
            +KG
Sbjct  216  LKG  218



>ref|XP_009771129.1| PREDICTED: serine carboxypeptidase-like 13 isoform X2 [Nicotiana 
sylvestris]
Length=437

 Score =   224 bits (570),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 133/184 (72%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H+ VE LPGF   LPF L TGYIGVGE +E+QLFYYF++SE  P  DP+L+WL+GGPGCS
Sbjct  32   HSTVEFLPGFEGPLPFHLETGYIGVGEYEEVQLFYYFLKSESEPTKDPILIWLSGGPGCS  91

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              +A  ++IGPL        G +P L LNP +WTKVANIIF+DQPV +G+SY+ TS  + 
Sbjct  92   SFTALVYQIGPLYFEPNEYNGSLPKLTLNPNSWTKVANIIFLDQPVNSGFSYATTSTTFK  151

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            + D  +  H Y FL +WL+ H  F+ NP+Y+ GDSYSGITVP++ + I +G+E+G +P +
Sbjct  152  STDLQACHHIYQFLRKWLIKHQEFIRNPMYIGGDSYSGITVPVITQLISNGIEAGHKPSI  211

Query  639  NMKG  650
            N+KG
Sbjct  212  NLKG  215



>ref|XP_010656845.1| PREDICTED: serine carboxypeptidase-like 13 [Vitis vinifera]
Length=480

 Score =   224 bits (572),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 137/182 (75%), Gaps = 1/182 (1%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             ++++TLPGFP +LPF L TGY+GVGE++ +QLFYYF++S+++P  DPL+LWLTGGPGCS
Sbjct  33   RSIIKTLPGFPGELPFYLETGYVGVGENESVQLFYYFVKSQRNPVLDPLVLWLTGGPGCS  92

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LSAFF+E GP++ N   + G +P LEL  Y WT+  NII++D PVGTG+SYS T + Y 
Sbjct  93   TLSAFFYESGPVSFNLTYN-GGLPTLELKEYTWTETLNIIYLDAPVGTGFSYSTTQEGYT  151

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            T+D  SA   Y FL +WL+ HP FL N LY+ GDSYSGI VP++V++IY   E G  PRL
Sbjct  152  TDDYKSAAQIYEFLKKWLIQHPEFLKNNLYIGGDSYSGIPVPMIVQDIYYDSERGGSPRL  211

Query  639  NM  644
            N+
Sbjct  212  NL  213



>gb|KCW80986.1| hypothetical protein EUGRSUZ_C02352 [Eucalyptus grandis]
Length=496

 Score =   225 bits (573),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 134/182 (74%), Gaps = 0/182 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            VV+ LPG+   LPF L TGYIGVGES E QLFYYF+ES+++P  DPL+LWLTGGPGCS L
Sbjct  53   VVKNLPGYDGDLPFYLETGYIGVGESNESQLFYYFVESQRTPSQDPLMLWLTGGPGCSVL  112

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTN  464
            SAF +E GPL   Y    G IP L  NPYAWT+  N++FVD P+GTG+SYS T++ Y T+
Sbjct  113  SAFLYEGGPLAFTYEGYNGSIPSLHQNPYAWTQGLNMLFVDAPIGTGFSYSTTAENYYTD  172

Query  465  DTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNM  644
            D  S+  TY FL ++LL HP F+ N LY+ GDSYSGI +P++V+ I+DG   G EP +N+
Sbjct  173  DFKSSNETYEFLQKFLLSHPQFIENMLYIGGDSYSGIPLPIIVQKIFDGNLLGEEPFMNL  232

Query  645  KG  650
            KG
Sbjct  233  KG  234



>ref|XP_009626153.1| PREDICTED: serine carboxypeptidase-like 13 [Nicotiana tomentosiformis]
Length=466

 Score =   224 bits (571),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 135/184 (73%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H+ V+ LPGF  +LPF L TGYIGVGE +E+QLFYYF++SE  P  DP+L+WL+GGPGCS
Sbjct  35   HSTVQFLPGFEGRLPFHLETGYIGVGEYEEVQLFYYFLKSESEPTKDPVLVWLSGGPGCS  94

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              +A  ++IGPL        G +P L LNP +WTKVANIIF+DQPV +G+SY+ TS  + 
Sbjct  95   SFTALVYQIGPLYFEPNKYNGSLPKLTLNPNSWTKVANIIFLDQPVNSGFSYATTSTTFK  154

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            + D  +  H Y FL +WL+ HP F+ NP+Y+ GDSYSGIT+P++ + I +G+E+G +P +
Sbjct  155  STDLQACDHIYLFLRKWLIKHPEFIRNPMYIGGDSYSGITLPVITQLISNGIEAGHKPSI  214

Query  639  NMKG  650
            N+KG
Sbjct  215  NLKG  218



>ref|XP_010277006.1| PREDICTED: serine carboxypeptidase-like 1 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010277007.1| PREDICTED: serine carboxypeptidase-like 1 isoform X1 [Nelumbo 
nucifera]
Length=467

 Score =   224 bits (571),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 132/181 (73%), Gaps = 0/181 (0%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            +++LPGF   LPF+L TGY+ V ES+++ LFYYFI+SE+ P+ DPL+LWLTGGPGCS LS
Sbjct  30   IQSLPGFQGPLPFELETGYVSVDESEDVHLFYYFIKSERDPKHDPLMLWLTGGPGCSALS  89

Query  288  AFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTND  467
               FEIGPL I      G +P L LNPY+WTK ++IIF+D P+GTG+SYS +     T D
Sbjct  90   GLLFEIGPLRIETMKYNGSLPSLALNPYSWTKASSIIFLDSPIGTGFSYSSSFQGSQTGD  149

Query  468  TLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMK  647
              S Q  Y FL +WL+DHP FL+N +Y+ GDSYSG T PLVV +I +G ++G EP +N+K
Sbjct  150  IKSCQQAYQFLRKWLMDHPEFLSNAVYIGGDSYSGKTAPLVVIDILNGNDAGEEPFINIK  209

Query  648  G  650
            G
Sbjct  210  G  210



>ref|XP_010694001.1| PREDICTED: serine carboxypeptidase-like 10 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=453

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 139/184 (76%), Gaps = 2/184 (1%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            V++++PG+P  LPF L TGY+GVG+++ +QLFYYFI+SE++P+TDPL+LWLTGGPGCS L
Sbjct  38   VIKSVPGYPDNLPFYLETGYVGVGDNEGVQLFYYFIKSERNPQTDPLILWLTGGPGCSAL  97

Query  285  SAFFFEIGPLTINYA--NSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            S    EIGPL  N +  N     P  +LNP++WTKVA+IIF+D PVGTG+SY+   + Y 
Sbjct  98   SGLVLEIGPLIFNTSAFNWHSKAPTFQLNPFSWTKVASIIFLDSPVGTGFSYATDPEHYY  157

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            T+D  S++H Y FL +WL+DH  F NNPLY+ GDSYSG+ VP+VV+ I  G +  ++P +
Sbjct  158  TDDITSSEHIYQFLRKWLMDHVGFQNNPLYICGDSYSGMIVPIVVKEISKGNKVHVQPIM  217

Query  639  NMKG  650
            N++G
Sbjct  218  NLQG  221



>ref|XP_009771128.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Nicotiana 
sylvestris]
Length=467

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 133/184 (72%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H+ VE LPGF   LPF L TGYIGVGE +E+QLFYYF++SE  P  DP+L+WL+GGPGCS
Sbjct  32   HSTVEFLPGFEGPLPFHLETGYIGVGEYEEVQLFYYFLKSESEPTKDPILIWLSGGPGCS  91

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              +A  ++IGPL        G +P L LNP +WTKVANIIF+DQPV +G+SY+ TS  + 
Sbjct  92   SFTALVYQIGPLYFEPNEYNGSLPKLTLNPNSWTKVANIIFLDQPVNSGFSYATTSTTFK  151

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            + D  +  H Y FL +WL+ H  F+ NP+Y+ GDSYSGITVP++ + I +G+E+G +P +
Sbjct  152  STDLQACHHIYQFLRKWLIKHQEFIRNPMYIGGDSYSGITVPVITQLISNGIEAGHKPSI  211

Query  639  NMKG  650
            N+KG
Sbjct  212  NLKG  215



>emb|CBI17847.3| unnamed protein product [Vitis vinifera]
Length=530

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 137/182 (75%), Gaps = 1/182 (1%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             ++++TLPGFP +LPF L TGY+GVGE++ +QLFYYF++S+++P  DPL+LWLTGGPGCS
Sbjct  83   RSIIKTLPGFPGELPFYLETGYVGVGENESVQLFYYFVKSQRNPVLDPLVLWLTGGPGCS  142

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LSAFF+E GP++ N   + G +P LEL  Y WT+  NII++D PVGTG+SYS T + Y 
Sbjct  143  TLSAFFYESGPVSFNLTYN-GGLPTLELKEYTWTETLNIIYLDAPVGTGFSYSTTQEGYT  201

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            T+D  SA   Y FL +WL+ HP FL N LY+ GDSYSGI VP++V++IY   E G  PRL
Sbjct  202  TDDYKSAAQIYEFLKKWLIQHPEFLKNNLYIGGDSYSGIPVPMIVQDIYYDSERGGSPRL  261

Query  639  NM  644
            N+
Sbjct  262  NL  263



>ref|XP_010048652.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
 gb|KCW80985.1| hypothetical protein EUGRSUZ_C02352 [Eucalyptus grandis]
Length=495

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 134/182 (74%), Gaps = 0/182 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            VV+ LPG+   LPF L TGYIGVGES E QLFYYF+ES+++P  DPL+LWLTGGPGCS L
Sbjct  53   VVKNLPGYDGDLPFYLETGYIGVGESNESQLFYYFVESQRTPSQDPLMLWLTGGPGCSVL  112

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTN  464
            SAF +E GPL   Y    G IP L  NPYAWT+  N++FVD P+GTG+SYS T++ Y T+
Sbjct  113  SAFLYEGGPLAFTYEGYNGSIPSLHQNPYAWTQGLNMLFVDAPIGTGFSYSTTAENYYTD  172

Query  465  DTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNM  644
            D  S+  TY FL ++LL HP F+ N LY+ GDSYSGI +P++V+ I+DG   G EP +N+
Sbjct  173  DFKSSNETYEFLQKFLLSHPQFIENMLYIGGDSYSGIPLPIIVQKIFDGNLLGEEPFMNL  232

Query  645  KG  650
            KG
Sbjct  233  KG  234



>ref|XP_004289672.1| PREDICTED: serine carboxypeptidase-like 13 [Fragaria vesca subsp. 
vesca]
Length=474

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 131/184 (71%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             ++++ LP F   LPFKL TGY+GVG+S+E+QLFYY +ESE+SPE DPLL+WLTGGP CS
Sbjct  31   QSIIKNLPAFHGDLPFKLETGYVGVGDSEEVQLFYYLVESERSPENDPLLIWLTGGPRCS  90

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
                  +EIGP++    N + D   L LNP +W KVANIIFVD P GTGYSYS TS    
Sbjct  91   SFYGLIYEIGPMSFELTNLSTDPLTLVLNPNSWNKVANIIFVDAPAGTGYSYSTTSHGLI  150

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            ++DTL +   Y FL++W+  HP FL N  YVAGDSYSG  VP++   I DG+E+GI+P L
Sbjct  151  SSDTLHSTRIYEFLLKWITAHPKFLANSFYVAGDSYSGKIVPIIALQITDGIEAGIKPNL  210

Query  639  NMKG  650
            N+KG
Sbjct  211  NLKG  214



>ref|XP_010314600.1| PREDICTED: serine carboxypeptidase-like 11 [Solanum lycopersicum]
Length=463

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 135/183 (74%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++VE LPGF   LPF L TGYIG+G+S+E+QLFYYF++SE  P  DPL+LWLTGGPGCS 
Sbjct  23   SIVEYLPGFDGPLPFYLETGYIGIGKSEEVQLFYYFVKSESDPRKDPLVLWLTGGPGCSS  82

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
             +   +E+GPL        G +P L  +PY+WTK A+I+F++QPV TG+SY+ TS+AY  
Sbjct  83   FTGLAYEVGPLDFGQKAYNGSLPILISSPYSWTKFASILFLEQPVNTGFSYATTSEAYKC  142

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
             D  +  H Y FL +WL++HP F+ NP YV+GDSYSGIT+P++V+ I +G+E G EP +N
Sbjct  143  TDLQACDHVYEFLRKWLVNHPEFILNPFYVSGDSYSGITIPVIVQLISNGIEQGKEPLIN  202

Query  642  MKG  650
            +KG
Sbjct  203  LKG  205



>gb|KDP35359.1| hypothetical protein JCGZ_10343 [Jatropha curcas]
Length=221

 Score =   216 bits (549),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 127/170 (75%), Gaps = 0/170 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            VV +LPGF A+LPF L TGYIGVG+  E QLFYYF+ES+ SP  DPL+LWLTGGPGCS L
Sbjct  41   VVTSLPGFDAELPFYLETGYIGVGKINESQLFYYFVESQGSPTLDPLMLWLTGGPGCSVL  100

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTN  464
             A F+E GPL  +Y N  G +P L LNP+AWT+  NII+VD PVGTG+SYS T + Y  +
Sbjct  101  YALFYENGPLAFDYLNYNGSLPSLLLNPFAWTQRINIIYVDAPVGTGFSYSTTQENYYVD  160

Query  465  DTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGL  614
            D  SA  TY FL +WL +HP +L N L++ GDSYSGI +P++V++I DG+
Sbjct  161  DIKSAAQTYEFLRKWLFEHPQYLTNQLFIGGDSYSGIPLPIIVQHILDGI  210



>ref|NP_174619.1| serine carboxypeptidase-like 18 [Arabidopsis thaliana]
 gb|AAG51208.1|AC051630_5 serine carboxypeptidase, putative; 88458-86107 [Arabidopsis thaliana]
 gb|AEE31604.1| serine carboxypeptidase-like 18 [Arabidopsis thaliana]
Length=446

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 136/183 (74%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +V+  LPGF   LPF L TGYIGVGE +++QLFYYFI+SE +PE DPL++WLTGGP C+ 
Sbjct  27   SVISYLPGFEGLLPFHLETGYIGVGEGEKVQLFYYFIKSENNPEEDPLIIWLTGGPACTA  86

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            LSA  FEIGPLT       G +P L    Y+WTKVA+IIF+DQPVGTGYSYS T  +Y  
Sbjct  87   LSALAFEIGPLTFKTEGYNGGLPSLVSTSYSWTKVASIIFLDQPVGTGYSYSTTPLSYKP  146

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            +DT  A+ TY FL +WL+++P F++NP+YV GDSY+GI VP +V+ I  G E G +P++N
Sbjct  147  SDTGEAKQTYEFLQKWLVENPQFVSNPIYVGGDSYAGIVVPAIVQQISIGNEHGYKPQIN  206

Query  642  MKG  650
            +KG
Sbjct  207  LKG  209



>sp|Q9C7Z9.2|SCP18_ARATH RecName: Full=Serine carboxypeptidase-like 18; Flags: Precursor 
[Arabidopsis thaliana]
Length=464

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 136/183 (74%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +V+  LPGF   LPF L TGYIGVGE +++QLFYYFI+SE +PE DPL++WLTGGP C+ 
Sbjct  27   SVISYLPGFEGLLPFHLETGYIGVGEGEKVQLFYYFIKSENNPEEDPLIIWLTGGPACTA  86

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            LSA  FEIGPLT       G +P L    Y+WTKVA+IIF+DQPVGTGYSYS T  +Y  
Sbjct  87   LSALAFEIGPLTFKTEGYNGGLPSLVSTSYSWTKVASIIFLDQPVGTGYSYSTTPLSYKP  146

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            +DT  A+ TY FL +WL+++P F++NP+YV GDSY+GI VP +V+ I  G E G +P++N
Sbjct  147  SDTGEAKQTYEFLQKWLVENPQFVSNPIYVGGDSYAGIVVPAIVQQISIGNEHGYKPQIN  206

Query  642  MKG  650
            +KG
Sbjct  207  LKG  209



>ref|XP_002510077.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF52264.1| serine carboxypeptidase, putative [Ricinus communis]
Length=468

 Score =   223 bits (567),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 137/184 (74%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            ++ ++ LPGF   LPF L TGYIGV ES+++QLFYYF++S+++ + DPLLLWLTGGPGCS
Sbjct  27   YSTIKYLPGFQGPLPFSLETGYIGVDESEDVQLFYYFVKSQRNAKEDPLLLWLTGGPGCS  86

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            GLS   +EIGPLT       G +P L LNP++WT+VA+IIF+D PVGTG+SY++T  A  
Sbjct  87   GLSGLLYEIGPLTFEVVEYNGSLPTLILNPHSWTQVASIIFIDIPVGTGFSYAQTQLAAY  146

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            + D       + FL +WL DHP FL NP+Y+AGDSYSGIT+P +V++I +G E G EP +
Sbjct  147  STDLTQVHQAHLFLRKWLRDHPEFLANPVYIAGDSYSGITLPAIVQHISNGNEKGTEPLI  206

Query  639  NMKG  650
            N++G
Sbjct  207  NLQG  210



>ref|XP_010321496.1| PREDICTED: serine carboxypeptidase-like 13 isoform X2 [Solanum 
lycopersicum]
Length=454

 Score =   222 bits (565),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 137/181 (76%), Gaps = 0/181 (0%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            V+ LPGF   LPF+L TGYIGVGE+ E+QLFYYFI+S+ + + DPL+ W TGGPGCS LS
Sbjct  24   VKYLPGFEGPLPFQLETGYIGVGEANEVQLFYYFIKSQSNYKIDPLVYWFTGGPGCSPLS  83

Query  288  AFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTND  467
            A  +E+GP+T++     G +P L LNPYA+TKVAN+IFVD PVG+G+SY+ T  A  ++D
Sbjct  84   AILYELGPITVDIRAYNGSLPTLSLNPYAYTKVANMIFVDLPVGSGFSYATTQKAIYSDD  143

Query  468  TLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMK  647
              +A H Y F+ +WL++H  +LNNP YV GDSYSGITVP+V + I +G + GI+P +N+K
Sbjct  144  LQAADHAYEFIRKWLIEHKEYLNNPFYVGGDSYSGITVPIVTQVISNGNDMGIKPWINLK  203

Query  648  G  650
            G
Sbjct  204  G  204



>ref|XP_004288266.1| PREDICTED: serine carboxypeptidase-like 2 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=485

 Score =   223 bits (567),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 132/183 (72%), Gaps = 2/183 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V++LPGFP  LPF L TGYIGV E  ++QLFYYF+ESE++P  DPLLLWLTGGP CS 
Sbjct  38   SIVKSLPGFPGSLPFHLETGYIGVDEKDDVQLFYYFVESERNPRDDPLLLWLTGGPTCSA  97

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            LS   FEIGP+  N     G +P   LNPY+WTKV++IIFVD PVGTG+SY  +     +
Sbjct  98   LSGLAFEIGPIKFNMVEYNGSLPTFVLNPYSWTKVSSIIFVDAPVGTGFSYPRSLQW--S  155

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            +D L   H YSFL++WL+ HP F+ NP+Y+AGDSY G+ VP++ + I  G+E G  P +N
Sbjct  156  SDALFVNHIYSFLMKWLIYHPKFITNPIYIAGDSYCGMIVPVIAQEIVKGIEVGDIPAIN  215

Query  642  MKG  650
            +KG
Sbjct  216  LKG  218



>ref|XP_011466202.1| PREDICTED: serine carboxypeptidase-like 2 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=532

 Score =   224 bits (570),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 132/183 (72%), Gaps = 2/183 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V++LPGFP  LPF L TGYIGV E  ++QLFYYF+ESE++P  DPLLLWLTGGP CS 
Sbjct  38   SIVKSLPGFPGSLPFHLETGYIGVDEKDDVQLFYYFVESERNPRDDPLLLWLTGGPTCSA  97

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            LS   FEIGP+  N     G +P   LNPY+WTKV++IIFVD PVGTG+SY  +     +
Sbjct  98   LSGLAFEIGPIKFNMVEYNGSLPTFVLNPYSWTKVSSIIFVDAPVGTGFSYPRSLQW--S  155

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            +D L   H YSFL++WL+ HP F+ NP+Y+AGDSY G+ VP++ + I  G+E G  P +N
Sbjct  156  SDALFVNHIYSFLMKWLIYHPKFITNPIYIAGDSYCGMIVPVIAQEIVKGIEVGDIPAIN  215

Query  642  MKG  650
            +KG
Sbjct  216  LKG  218



>ref|XP_009343188.1| PREDICTED: serine carboxypeptidase-like 18 [Pyrus x bretschneideri]
Length=447

 Score =   221 bits (564),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 133/184 (72%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             ++++ LPGF   LPFKL TGY+ VG+  E+Q+FYYFIESE+SPE DPLLLW+TGGP CS
Sbjct  31   QSIIKNLPGFSGDLPFKLETGYVSVGKFDELQMFYYFIESERSPENDPLLLWITGGPRCS  90

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
                  +EIGP++  + +   D   L  NPYAWTK+ANIIF+D P GTG+SYS T + Y 
Sbjct  91   SFYGLVYEIGPISFQFGDLNKDPLTLVTNPYAWTKLANIIFLDAPAGTGFSYSTTLEGYI  150

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            ++DTL A   Y FL +WL+ HP FL NPLY++GDS+SG  VP++V++I DG   G EP L
Sbjct  151  SSDTLHATRAYEFLKRWLVTHPQFLANPLYISGDSFSGKIVPIIVQHITDGNFIGTEPPL  210

Query  639  NMKG  650
            N+KG
Sbjct  211  NLKG  214



>ref|XP_010046975.1| PREDICTED: serine carboxypeptidase-like 17 [Eucalyptus grandis]
 gb|KCW78695.1| hypothetical protein EUGRSUZ_C00147 [Eucalyptus grandis]
Length=504

 Score =   223 bits (568),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 134/184 (73%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              VV TLPG+  +LPF L TGY+GVGE +E QLFYYF+ES++SP  DPL+LWLTGGPGCS
Sbjct  60   QKVVTTLPGYDGELPFYLETGYVGVGELEESQLFYYFVESQRSPALDPLMLWLTGGPGCS  119

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LSAFF+E GP+  +Y    G +P + +NP+ WT+  NII+VD P+GTG+SYS T++ Y 
Sbjct  120  VLSAFFYESGPVEFSYVGYNGSLPSMHVNPHTWTQGLNIIYVDAPIGTGFSYSTTAENYY  179

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             +D  ++   Y FL +WL+ HP FL N LY+ GDSYSGI +P+VV+ IYDG   G  P L
Sbjct  180  IDDYRASYEIYQFLRKWLIQHPQFLKNILYIGGDSYSGIPLPMVVKLIYDGNGDGAVPYL  239

Query  639  NMKG  650
            N+KG
Sbjct  240  NLKG  243



>ref|XP_006415270.1| hypothetical protein EUTSA_v10009366mg [Eutrema salsugineum]
 gb|ESQ33623.1| hypothetical protein EUTSA_v10009366mg [Eutrema salsugineum]
Length=440

 Score =   221 bits (563),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 132/183 (72%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +V+  LPGF   LPF L TGYIGVGE +++QLFYYFI+SEK+PE DPLLLWLTGGP C+ 
Sbjct  28   SVISYLPGFEGPLPFHLETGYIGVGEEEKVQLFYYFIKSEKNPEEDPLLLWLTGGPACTA  87

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            LSA  FE GPLT       G +P L    Y+WTKVANIIF+DQPVGTG+SYS T  A   
Sbjct  88   LSALAFENGPLTFKTEGYNGSLPSLISTSYSWTKVANIIFLDQPVGTGFSYSTTPLAEKP  147

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            +DT   + TY FL +WL++ P F++NP YV+GDSY+GI VP +V+ I  G E G +P +N
Sbjct  148  SDTREVKQTYEFLQKWLVERPEFVSNPFYVSGDSYAGIVVPAIVQQISIGNEHGYKPLIN  207

Query  642  MKG  650
            +KG
Sbjct  208  LKG  210



>gb|KJB58678.1| hypothetical protein B456_009G221000 [Gossypium raimondii]
Length=398

 Score =   219 bits (559),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 131/183 (72%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            + V+ LPGF   LPF+L TGY+GVG+S+E QLFYYF++SE  PE DPLL WLTGGPGCS 
Sbjct  19   SAVKFLPGFEGPLPFELETGYVGVGDSEEAQLFYYFVKSEGKPEDDPLLFWLTGGPGCSA  78

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
             S   FEIGPL        G +P L  NPYAWTKV+NIIF+D PVGTG+SY+  + A  T
Sbjct  79   FSGLVFEIGPLKFKVDVYNGSLPTLVYNPYAWTKVSNIIFIDSPVGTGFSYATNNRAAQT  138

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
             D     H + FL +WL+ HP F++NP+YV+GDSYSGI VP++ + I +G E GI+P ++
Sbjct  139  GDLKQVHHLHQFLRKWLMAHPDFISNPVYVSGDSYSGIPVPVLAQEISNGNEEGIKPVIH  198

Query  642  MKG  650
            ++G
Sbjct  199  LQG  201



>gb|KDP41601.1| hypothetical protein JCGZ_16008 [Jatropha curcas]
Length=478

 Score =   222 bits (565),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 135/181 (75%), Gaps = 0/181 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            ++ VE LPGF  +LPF+L TGY+GV E++E+QLFYYFI+SE + + DPLLLWLTGGPGCS
Sbjct  26   YSTVEYLPGFEGELPFQLETGYVGVDEAEEVQLFYYFIKSEGNVKEDPLLLWLTGGPGCS  85

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LS   +EIGPLT       G +P L LNP++WTK A+IIFVD PVGTG+SY++T  AY+
Sbjct  86   ALSGLLYEIGPLTFEVVEYNGSLPKLILNPHSWTKAASIIFVDMPVGTGFSYAKTQPAYH  145

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            ++D +       FL +WL DHP FL +P+Y+AGDSYSGI +P +V+ I +G E G+EP +
Sbjct  146  SSDLIQVHQADQFLRKWLRDHPEFLPSPVYIAGDSYSGIPLPAIVQQISNGNEEGMEPLI  205

Query  639  N  641
            N
Sbjct  206  N  206



>ref|XP_006433653.1| hypothetical protein CICLE_v10001059mg [Citrus clementina]
 gb|ESR46893.1| hypothetical protein CICLE_v10001059mg [Citrus clementina]
Length=467

 Score =   221 bits (564),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 131/184 (71%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             +  + LPGF   LPF+L TGY+GVGES++ QLFYYF++SEK+P+ DPLLLWLTGGPGCS
Sbjct  24   RSTAKFLPGFQGPLPFELETGYVGVGESEDAQLFYYFVKSEKNPKEDPLLLWLTGGPGCS  83

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              SA  +EIGP+  N     G +P L LNPY+WTK A+I+FVD PVGTG+SY  T  A  
Sbjct  84   AFSALVYEIGPINFNILEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGFSYVRTPLASQ  143

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            T D         FL +WL+DHP FL+NP YV GDSYSGITVP +V+ I +  E GI+P +
Sbjct  144  TGDFKQVHQVDQFLRKWLMDHPEFLSNPFYVGGDSYSGITVPPLVQQISNENEEGIKPLI  203

Query  639  NMKG  650
            N++G
Sbjct  204  NLQG  207



>ref|XP_009761854.1| PREDICTED: serine carboxypeptidase-like 18 [Nicotiana sylvestris]
Length=429

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 135/180 (75%), Gaps = 0/180 (0%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            V+ LPGF   LPF+L TGYIGVG+S+++QLFYYFI+SE +PE+DPLLLW+TGGPGCS LS
Sbjct  29   VKLLPGFKGPLPFELETGYIGVGDSEDVQLFYYFIKSESNPESDPLLLWITGGPGCSALS  88

Query  288  AFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTND  467
               ++IGP+T       G +P ++LNPY+WTKVA+IIF+D PVGTG+SY+ T  A  +++
Sbjct  89   GLIYDIGPITFEPVEYNGSVPTMKLNPYSWTKVASIIFLDLPVGTGFSYARTPAALQSSN  148

Query  468  TLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMK  647
              ++   Y FL +W LDHP FL NPLYV GDSYSG+ VP++ + I    + GI+P +++K
Sbjct  149  LQASDQAYEFLYKWFLDHPEFLKNPLYVGGDSYSGMLVPIITQIIATKNKMGIKPFMDLK  208



>ref|XP_003633199.2| PREDICTED: serine carboxypeptidase-like 13 isoform X2 [Vitis 
vinifera]
Length=461

 Score =   221 bits (563),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 134/184 (73%), Gaps = 5/184 (3%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             +V++TLPGF  +LPF L TGY+GVGE++E+QLFYYF++S+++P  DPL+LWL+GGPGCS
Sbjct  28   RSVIKTLPGFSGELPFYLETGYVGVGENEEVQLFYYFVKSQRNPVFDPLMLWLSGGPGCS  87

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             L+AFF+E GPLT N     G +P+L L    WTK  NIIFVD PVG+G+SYS+T + Y 
Sbjct  88   TLTAFFYENGPLTFNIQEYEGGLPNLYLKENTWTKTLNIIFVDAPVGSGFSYSKTQEGYI  147

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
              D   A  TY FL +WL+DHP FL N LYV GDSYSGI VP+VV+ IY G      P L
Sbjct  148  MEDLKYAAQTYEFLKKWLVDHPEFLKNELYVGGDSYSGIPVPMVVQEIYYG-----SPSL  202

Query  639  NMKG  650
            N++G
Sbjct  203  NLQG  206



>ref|XP_004289772.1| PREDICTED: serine carboxypeptidase-like 18 [Fragaria vesca subsp. 
vesca]
Length=484

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 129/182 (71%), Gaps = 0/182 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +  TLPG+   LPF L TGY+ VG+  ++Q FYYFIES++ P  DPLLLWLTGGPGCSG 
Sbjct  39   ITTTLPGYNGTLPFSLETGYVSVGDLDQLQFFYYFIESQRDPVKDPLLLWLTGGPGCSGF  98

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTN  464
            S   +EIGPLT +Y    G  P    NP++WT++ANIIF+D PVGTG+SYS T + YN++
Sbjct  99   SGLVYEIGPLTFDYIAFNGSFPTFVDNPFSWTQIANIIFIDAPVGTGFSYSTTQEGYNSS  158

Query  465  DTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNM  644
            DT S++  Y FL +W+L HP FL NPLY+ GDSYSGI VP V   + DG  +G+ P + +
Sbjct  159  DTESSEAVYQFLRKWMLKHPKFLYNPLYITGDSYSGIIVPQVTLKVSDGNRNGVRPPMKL  218

Query  645  KG  650
            +G
Sbjct  219  QG  220



>ref|XP_006415268.1| hypothetical protein EUTSA_v10007570mg [Eutrema salsugineum]
 gb|ESQ33621.1| hypothetical protein EUTSA_v10007570mg [Eutrema salsugineum]
Length=464

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 133/183 (73%), Gaps = 1/183 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +V+  LPGF   LPF L TGYIGVGE +++QLFYYFI+SE +PE DPLL+WLTGGP C+ 
Sbjct  28   SVISHLPGFEGPLPFHLETGYIGVGEEEKVQLFYYFIKSENNPEEDPLLIWLTGGPACTA  87

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            LSA  FEIGPLT       G +P L    Y+WTKVANIIF+DQPVGTG+SYS T   Y  
Sbjct  88   LSALAFEIGPLTFKTEGYNGSLPSLISTSYSWTKVANIIFLDQPVGTGFSYSTTRLTYKP  147

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            +DT  A+ TY FL +WL+++P F++NPLYV GDSY+GI VP +V+ I  G E   +P +N
Sbjct  148  SDTGEAKQTYQFLQKWLVEYPEFVSNPLYVGGDSYAGIVVPAIVQQISKGNEHSYKP-MN  206

Query  642  MKG  650
            +KG
Sbjct  207  LKG  209



>gb|KCW55082.1| hypothetical protein EUGRSUZ_I01044 [Eucalyptus grandis]
Length=415

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 131/182 (72%), Gaps = 0/182 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +VE LPG+  +LPFKL TGY+ VG+  EI+LFYYFIESE++P  DPLLLWLTGGPGCSG 
Sbjct  40   IVEYLPGYSGRLPFKLETGYVSVGDIDEIELFYYFIESERNPVKDPLLLWLTGGPGCSGF  99

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTN  464
            S   FEIGPLT +YA+  G  P L  NP +WT++ANIIF+D PVGTG++YS T + Y T+
Sbjct  100  SGLVFEIGPLTFDYASFNGSSPTLLSNPESWTQIANIIFLDAPVGTGFAYSTTQEGYYTS  159

Query  465  DTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNM  644
            D  SA+  Y FL +W+  HP F  NPLY+AGDSYSG  VP V      G+ +G +P L +
Sbjct  160  DIKSAKDIYKFLRKWIQGHPKFSKNPLYIAGDSYSGKIVPQVTLLASKGITAGEKPTLYL  219

Query  645  KG  650
            +G
Sbjct  220  QG  221



>ref|XP_010321495.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Solanum 
lycopersicum]
Length=457

 Score =   220 bits (560),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 136/180 (76%), Gaps = 0/180 (0%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            V+ LPGF   LPF+L TGYIGVGE+ E+QLFYYFI+S+ + + DPL+ W TGGPGCS LS
Sbjct  24   VKYLPGFEGPLPFQLETGYIGVGEANEVQLFYYFIKSQSNYKIDPLVYWFTGGPGCSPLS  83

Query  288  AFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTND  467
            A  +E+GP+T++     G +P L LNPYA+TKVAN+IFVD PVG+G+SY+ T  A  ++D
Sbjct  84   AILYELGPITVDIRAYNGSLPTLSLNPYAYTKVANMIFVDLPVGSGFSYATTQKAIYSDD  143

Query  468  TLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMK  647
              +A H Y F+ +WL++H  +LNNP YV GDSYSGITVP+V + I +G + GI+P +N+K
Sbjct  144  LQAADHAYEFIRKWLIEHKEYLNNPFYVGGDSYSGITVPIVTQVISNGNDMGIKPWINLK  203



>ref|XP_002268517.1| PREDICTED: serine carboxypeptidase-like 17 [Vitis vinifera]
 emb|CBI17849.3| unnamed protein product [Vitis vinifera]
Length=472

 Score =   220 bits (560),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 135/183 (74%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++++TLPG+  +LPF L TGY+GVGE++E+QLFY F++S+++P  DPL++WLTGGPGCS 
Sbjct  28   SIIKTLPGYSGELPFYLETGYVGVGENEEVQLFYMFVKSQRNPVLDPLVMWLTGGPGCST  87

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
             SAFF+  GPL+ +Y N TG +P L LN Y WT   NII+VD PVG G+SYS T + Y +
Sbjct  88   FSAFFYGNGPLSFDYKNYTGGLPSLLLNEYTWTSGLNIIYVDTPVGAGFSYSRTQEGYYS  147

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            +D  S+ HTY FL +WLLDHP FL N LYV GDSYSGI +P++   IY G   G   ++N
Sbjct  148  DDYKSSTHTYEFLNKWLLDHPEFLKNNLYVGGDSYSGIVLPMITEKIYYGNGIGTFLQMN  207

Query  642  MKG  650
            ++G
Sbjct  208  LQG  210



>ref|XP_007018461.1| Serine carboxypeptidase-like 7, putative [Theobroma cacao]
 gb|EOY15686.1| Serine carboxypeptidase-like 7, putative [Theobroma cacao]
Length=473

 Score =   220 bits (561),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 136/185 (74%), Gaps = 1/185 (1%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H+ V+ LPGF   LPF+L TGY+GVG+S+++QLFYYF++SE++PE DPLLLWLTGGPGCS
Sbjct  27   HSAVKFLPGFEGPLPFELETGYVGVGDSEDVQLFYYFVKSERNPEEDPLLLWLTGGPGCS  86

Query  279  GLSAFFFEIGPLTINY-ANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  455
              S   FEIGPL         G +P L LNPY+WTKV+NIIFVD PVGTG+SY+  + A 
Sbjct  87   AFSGLVFEIGPLNFKADVEYNGSLPTLVLNPYSWTKVSNIIFVDSPVGTGFSYARNNLAA  146

Query  456  NTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPR  635
             T D   A   + FL +WL DHP F+++P+YV+GDSYSGI +P++ + I +G E GI P 
Sbjct  147  LTGDFKQANQLHQFLRKWLKDHPDFISSPVYVSGDSYSGIPIPVLAQEILNGNEEGIRPI  206

Query  636  LNMKG  650
            ++++G
Sbjct  207  ISLQG  211



>ref|XP_008338878.1| PREDICTED: serine carboxypeptidase-like 1 [Malus domestica]
Length=475

 Score =   220 bits (561),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 138/184 (75%), Gaps = 2/184 (1%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            ++  LPGFP  LPFKL TGY+GVG   ++QLFYYFIESE SPE DPL+LWLTGGPGCS  
Sbjct  22   IITALPGFPGNLPFKLETGYVGVGNMDDVQLFYYFIESEGSPEYDPLVLWLTGGPGCSAF  81

Query  285  SAFFFE-IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY-N  458
            S   +E +GPL+ +YANS G+ P  +LNPY+WTKVANIIF+D PVG G+SY++T   Y N
Sbjct  82   SGLIYENLGPLSFDYANSIGNKPXFKLNPYSWTKVANIIFLDAPVGXGFSYAKTWXGYXN  141

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             +DTLSA  TY FL +WL+DHP F NN L VAGDSYSGI VP++V+ I DG      P +
Sbjct  142  MSDTLSAAQTYEFLRKWLMDHPKFFNNQLXVAGDSYSGIVVPIIVQXISDGNHDDNVPPI  201

Query  639  NMKG  650
            N+KG
Sbjct  202  NIKG  205



>gb|KDO81474.1| hypothetical protein CISIN_1g012236mg [Citrus sinensis]
Length=467

 Score =   220 bits (560),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 131/184 (71%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             + V+ LPGF   L F+L TGY+GVGES++ QLFYYF++SEK+P+ DPLLLWLTGGPGCS
Sbjct  24   RSTVKFLPGFQGPLSFELETGYVGVGESEDAQLFYYFVKSEKNPKEDPLLLWLTGGPGCS  83

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              SA  +EIGP+  N     G +P L LNPY+WTK A+I+FVD PVGTG+SY  T  A  
Sbjct  84   AFSALVYEIGPINFNILEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGFSYVRTPLASQ  143

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            T D         FL +WL+DHP FL+NP YV GDSYSGITVP +V+ I +  E GI+P +
Sbjct  144  TGDFKQVHQVDQFLRKWLMDHPEFLSNPFYVGGDSYSGITVPPLVQQISNENEEGIKPLI  203

Query  639  NMKG  650
            N++G
Sbjct  204  NLQG  207



>ref|XP_009600999.1| PREDICTED: serine carboxypeptidase-like 7 isoform X1 [Nicotiana 
tomentosiformis]
Length=465

 Score =   220 bits (560),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 134/181 (74%), Gaps = 0/181 (0%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            V+ LPGF   LPF+L TGYIGV +S++ QLFYYFI+SE +PE+DP+LLW+TGGPGCS LS
Sbjct  29   VKLLPGFKGPLPFELETGYIGVDDSEDTQLFYYFIKSESNPESDPILLWITGGPGCSALS  88

Query  288  AFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTND  467
               +EIGP+T       G +P + LNPY+WTKVA+IIF+D PVGTG+SY+ T  A  +++
Sbjct  89   GLIYEIGPITFEPVEYNGSLPTMILNPYSWTKVASIIFLDLPVGTGFSYARTPAALQSSN  148

Query  468  TLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMK  647
              ++   Y FL +W LDHP FL NPLYVAGDSYSG+ VP++ + I    E GI+P +++K
Sbjct  149  LQASDQAYEFLYRWFLDHPEFLKNPLYVAGDSYSGMLVPIITQIIETKNEMGIKPFMDLK  208

Query  648  G  650
            G
Sbjct  209  G  209



>ref|XP_004513965.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X2 [Cicer 
arietinum]
Length=402

 Score =   218 bits (555),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 136/183 (74%), Gaps = 1/183 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V+ LPGF   LPFKL TGYIGVGE  ++Q+FYYF+ES+++P  DP+LLW  GGPGCSG
Sbjct  59   SIVKNLPGFDGDLPFKLETGYIGVGEGAKVQIFYYFVESQRNPFIDPILLWFVGGPGCSG  118

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            LSAFFFE GPL ++  N + ++P L+LNPYAWT + N+I++D PVGTG+SYSET + Y +
Sbjct  119  LSAFFFENGPLKMD-PNYSENLPKLKLNPYAWTHMLNMIYIDMPVGTGFSYSETQEGYYS  177

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            N TL   HTYSFL +W ++H  F +NP Y+ G SYSG+T   +V+ +Y+G  +   P + 
Sbjct  178  NATLWVDHTYSFLQKWFIEHSKFSSNPFYIGGGSYSGLTTGPLVQKVYEGYIAKQVPLIK  237

Query  642  MKG  650
            +KG
Sbjct  238  IKG  240



>ref|XP_009601001.1| PREDICTED: serine carboxypeptidase-like 7 isoform X2 [Nicotiana 
tomentosiformis]
Length=464

 Score =   219 bits (559),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 134/181 (74%), Gaps = 0/181 (0%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            V+ LPGF   LPF+L TGYIGV +S++ QLFYYFI+SE +PE+DP+LLW+TGGPGCS LS
Sbjct  29   VKLLPGFKGPLPFELETGYIGVDDSEDTQLFYYFIKSESNPESDPILLWITGGPGCSALS  88

Query  288  AFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTND  467
               +EIGP+T       G +P + LNPY+WTKVA+IIF+D PVGTG+SY+ T  A  +++
Sbjct  89   GLIYEIGPITFEPVEYNGSLPTMILNPYSWTKVASIIFLDLPVGTGFSYARTPAALQSSN  148

Query  468  TLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMK  647
              ++   Y FL +W LDHP FL NPLYVAGDSYSG+ VP++ + I    E GI+P +++K
Sbjct  149  LQASDQAYEFLYRWFLDHPEFLKNPLYVAGDSYSGMLVPIITQIIETKNEMGIKPFMDLK  208

Query  648  G  650
            G
Sbjct  209  G  209



>gb|KJB58677.1| hypothetical protein B456_009G221000 [Gossypium raimondii]
Length=455

 Score =   219 bits (558),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 131/183 (72%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            + V+ LPGF   LPF+L TGY+GVG+S+E QLFYYF++SE  PE DPLL WLTGGPGCS 
Sbjct  19   SAVKFLPGFEGPLPFELETGYVGVGDSEEAQLFYYFVKSEGKPEDDPLLFWLTGGPGCSA  78

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
             S   FEIGPL        G +P L  NPYAWTKV+NIIF+D PVGTG+SY+  + A  T
Sbjct  79   FSGLVFEIGPLKFKVDVYNGSLPTLVYNPYAWTKVSNIIFIDSPVGTGFSYATNNRAAQT  138

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
             D     H + FL +WL+ HP F++NP+YV+GDSYSGI VP++ + I +G E GI+P ++
Sbjct  139  GDLKQVHHLHQFLRKWLMAHPDFISNPVYVSGDSYSGIPVPVLAQEISNGNEEGIKPVIH  198

Query  642  MKG  650
            ++G
Sbjct  199  LQG  201



>ref|XP_010694008.1| PREDICTED: serine carboxypeptidase-like 7 isoform X5 [Beta vulgaris 
subsp. vulgaris]
Length=413

 Score =   218 bits (555),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 135/186 (73%), Gaps = 6/186 (3%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +V+++PG+P  LPF L TGY+GVG+ +E++LFYYFI+SE+ PE DPL+LWLTGGPGCS  
Sbjct  34   IVKSIPGYPGDLPFYLETGYVGVGKDEEVKLFYYFIKSERDPERDPLMLWLTGGPGCSAF  93

Query  285  SAFFFEIGPLTINYANSTGDI----PDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDA  452
            S    EIGPL  N  NS  D     P  +LNP +WTKVA+IIF+D PVGTG+SY+   + 
Sbjct  94   SGLVIEIGPLIFN--NSACDWHSKSPTFQLNPSSWTKVASIIFLDSPVGTGFSYATNPEG  151

Query  453  YNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEP  632
            Y ++D  S++H Y FL +WL DH  F N+PLY+AGDSY G  VP+VV+ I+ G + G +P
Sbjct  152  YYSDDITSSRHIYQFLTKWLADHAGFHNHPLYIAGDSYCGRIVPVVVQEIFQGNKVGFQP  211

Query  633  RLNMKG  650
             +N++G
Sbjct  212  FMNLQG  217



>gb|KCW68631.1| hypothetical protein EUGRSUZ_F02236 [Eucalyptus grandis]
Length=461

 Score =   219 bits (559),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 128/178 (72%), Gaps = 0/178 (0%)
 Frame = +3

Query  117  LPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLSAFF  296
            LPGF   LPF L TGY+ VGES+EIQLFYYF ESE++ + D L LWLTGGPGCS LS   
Sbjct  44   LPGFEGPLPFHLETGYVAVGESEEIQLFYYFAESERNSKEDALFLWLTGGPGCSALSGLI  103

Query  297  FEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLS  476
            +EIGPL  N       +P+  LNPY+WTK ++IIFVD PVGTG+SY+E   AY T D   
Sbjct  104  YEIGPLNFNIKAYDRSLPEFVLNPYSWTKASSIIFVDSPVGTGFSYAENPLAYETGDFRQ  163

Query  477  AQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKG  650
             QH + FL +WL+ HP F++NP+Y+ GDSYSG+T+P++V+ I DG + G  P +N++G
Sbjct  164  VQHLHQFLRRWLISHPEFISNPVYIGGDSYSGLTLPILVQEIMDGNDEGKSPAINIQG  221



>gb|KDO81473.1| hypothetical protein CISIN_1g012205mg [Citrus sinensis]
Length=388

 Score =   217 bits (553),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 130/184 (71%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            ++ V+ LPGF   LPF+L TGY+GVGES + QLFYYF++SEK+P  DPLLLWLTGGPGCS
Sbjct  25   YSTVKFLPGFQGPLPFELETGYVGVGESGDAQLFYYFVKSEKNPREDPLLLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              S   +EIGP+  N     G +P L LNPY+WTK A+I+FVD PVGTGYSY++T  A  
Sbjct  85   AFSGLAYEIGPINFNVVEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGYSYAKTPLASQ  144

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
              D    Q    FL +WLLDHP  L+NP+Y+ GDSYSG+ VP +V+ I +  E  I+P +
Sbjct  145  AGDFKQVQQVDQFLRKWLLDHPELLSNPVYIGGDSYSGLVVPALVQQISNENEEDIKPLI  204

Query  639  NMKG  650
            N++G
Sbjct  205  NLQG  208



>ref|XP_011006039.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
17 [Populus euphratica]
Length=325

 Score =   215 bits (548),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 130/184 (71%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H +V+ LPGF   LP  L TGY+GV E++++QLFYYFI+S+++PE DPLLLWLTGGPGCS
Sbjct  22   HYIVKFLPGFQGPLPLHLETGYVGVDEAEDVQLFYYFIKSQRNPEEDPLLLWLTGGPGCS  81

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              S   FEIGP+        G +P   LNPY+WT+V+++IF+D PVGTG+SY  T  A  
Sbjct  82   AFSGLAFEIGPINFEEKEYNGSLPTWVLNPYSWTQVSSVIFLDLPVGTGFSYGRTPLALQ  141

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             +D+        FL +W+ DH  FL+NP+Y+AGDSYSGI VP VV+ I +G   GI+PR+
Sbjct  142  RSDSKQVSQAEQFLRKWIKDHQXFLSNPVYIAGDSYSGIIVPAVVQKISNGNSDGIKPRI  201

Query  639  NMKG  650
            N+KG
Sbjct  202  NLKG  205



>ref|XP_010048542.1| PREDICTED: serine carboxypeptidase-like 13 [Eucalyptus grandis]
 gb|KCW80817.1| hypothetical protein EUGRSUZ_C02185 [Eucalyptus grandis]
Length=471

 Score =   219 bits (559),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 129/182 (71%), Gaps = 0/182 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +V+ LPG+   LPF L TGY+GVGE + +QLFYYF+ES++SP  DPLLLW+ GGPGCS L
Sbjct  28   IVKNLPGYSGDLPFTLETGYVGVGEDEVVQLFYYFVESDRSPSQDPLLLWIDGGPGCSSL  87

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTN  464
            + FFF+ GPL    +   G +P L  NPY+WT+  NIIF+D PVGTG+SYS T+D YN +
Sbjct  88   AGFFFQNGPLNFQTSGYNGSLPSLHPNPYSWTQGMNIIFLDAPVGTGFSYSTTTDGYNVD  147

Query  465  DTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNM  644
            D     H+Y FL +W ++H  FL N  Y+ G SYSG+ VP++V  I DG E+G EP +N+
Sbjct  148  DYSFVAHSYEFLQKWFVNHTQFLENQFYIGGSSYSGMAVPMLVETIVDGNEAGNEPTINV  207

Query  645  KG  650
            KG
Sbjct  208  KG  209



>emb|CDP17658.1| unnamed protein product [Coffea canephora]
Length=457

 Score =   219 bits (557),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 140/183 (77%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +VV+ LPGF + LPF L TGYIGVGES+++QLFYYF++SE +P+ DPLL+WLTGGPGCS 
Sbjct  33   SVVKFLPGFESPLPFVLETGYIGVGESEDVQLFYYFVKSESNPQIDPLLIWLTGGPGCSS  92

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            +S   +EIGP+        G +P L  NPY+WTK+A+IIF+D PVGTG+SY+ T+ A  +
Sbjct  93   ISGLAYEIGPVKFQRVLYDGTLPKLMTNPYSWTKLASIIFLDSPVGTGFSYARTAKASQS  152

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            +D  +++HTY FL +WL D+P +++N  Y+ GDSY+GI VP++ + + +G ++GIEP ++
Sbjct  153  SDLQASEHTYEFLRKWLHDNPEYMSNSFYIGGDSYAGINVPILAQLVSNGNDAGIEPHIH  212

Query  642  MKG  650
            +KG
Sbjct  213  LKG  215



>ref|XP_003593859.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES64110.1| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=469

 Score =   219 bits (558),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 135/183 (74%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V+ LPGF   LPF L TGY+GVGE +++Q+FYYFIESEK+P+ DPL+LWLTGGPGCS 
Sbjct  32   SIVKFLPGFQGPLPFALETGYVGVGEKEDVQVFYYFIESEKNPKDDPLILWLTGGPGCSA  91

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            LS    EIGPL +      G +P+L L  ++WTKV++IIFVD PV TG++Y+ T      
Sbjct  92   LSGLMLEIGPLELKKEEYNGSLPNLILRQHSWTKVSSIIFVDLPVSTGFTYATTESGTKR  151

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            +D++    TY FL +WL+DHP F +N +Y+AGDSYSGI +P++V+ I +G E G++P +N
Sbjct  152  SDSILVHQTYQFLRKWLVDHPKFQSNEVYIAGDSYSGIPIPVIVQKIAEGNEKGVQPWIN  211

Query  642  MKG  650
            ++G
Sbjct  212  LQG  214



>ref|XP_010040884.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
Length=456

 Score =   219 bits (557),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 132/184 (72%), Gaps = 1/184 (1%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             +++++LPGFP  LPFKL TGYIGV E  ++QLFYYFIESE+SP+ DPL+LWLTGGPGCS
Sbjct  22   QSIIKSLPGFPGDLPFKLETGYIGVREFDDVQLFYYFIESERSPKDDPLMLWLTGGPGCS  81

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LS   +EIGPL  NY NS+G+ P   LNPY+WTKVANI F          YS T + Y 
Sbjct  82   SLSGLIYEIGPLNFNYKNSSGNRPTFLLNPYSWTKVANISFWTN-CRRWILYSTTQEGYY  140

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            + D  SA  TY F V+WL+ HP F++NPLY+ GDSYSG+T+P++V  I +G E G  P L
Sbjct  141  SADLRSAAETYQFCVRWLVGHPQFMSNPLYIGGDSYSGMTLPIIVTEIVNGNEVGHLPPL  200

Query  639  NMKG  650
            N+KG
Sbjct  201  NIKG  204



>ref|XP_010061646.1| PREDICTED: serine carboxypeptidase-like 2 [Eucalyptus grandis]
 gb|KCW68630.1| hypothetical protein EUGRSUZ_F02236 [Eucalyptus grandis]
Length=477

 Score =   219 bits (558),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 128/178 (72%), Gaps = 0/178 (0%)
 Frame = +3

Query  117  LPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLSAFF  296
            LPGF   LPF L TGY+ VGES+EIQLFYYF ESE++ + D L LWLTGGPGCS LS   
Sbjct  44   LPGFEGPLPFHLETGYVAVGESEEIQLFYYFAESERNSKEDALFLWLTGGPGCSALSGLI  103

Query  297  FEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLS  476
            +EIGPL  N       +P+  LNPY+WTK ++IIFVD PVGTG+SY+E   AY T D   
Sbjct  104  YEIGPLNFNIKAYDRSLPEFVLNPYSWTKASSIIFVDSPVGTGFSYAENPLAYETGDFRQ  163

Query  477  AQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKG  650
             QH + FL +WL+ HP F++NP+Y+ GDSYSG+T+P++V+ I DG + G  P +N++G
Sbjct  164  VQHLHQFLRRWLISHPEFISNPVYIGGDSYSGLTLPILVQEIMDGNDEGKSPAINIQG  221



>ref|XP_006594522.1| PREDICTED: serine carboxypeptidase-like 12-like [Glycine max]
Length=469

 Score =   219 bits (557),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 134/183 (73%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V+ LPGF   LPF L TGY+GVGES+++Q FYYFIESE +P+ DPL+LWLTGGPGCS 
Sbjct  32   SIVKFLPGFKGPLPFVLETGYVGVGESEDVQAFYYFIESENNPKKDPLMLWLTGGPGCSA  91

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            LS   FEIGPLT  Y    G +P+L L P++WTKV++IIFVD PV TG++Y+ T  A   
Sbjct  92   LSGLVFEIGPLTFKYEEYNGSLPNLVLRPHSWTKVSSIIFVDLPVSTGFTYATTEFAAQR  151

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            +D +     + FL +WL+DHP F +N +Y+ GDSYSGI +P++V+ I  G E G++P +N
Sbjct  152  SDWILVHQVHQFLRKWLIDHPNFSSNEVYIGGDSYSGIPIPVIVQEISRGNEKGLQPWIN  211

Query  642  MKG  650
            ++G
Sbjct  212  LQG  214



>ref|XP_010028347.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
 gb|KCW55081.1| hypothetical protein EUGRSUZ_I01044 [Eucalyptus grandis]
Length=487

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 131/182 (72%), Gaps = 0/182 (0%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +VE LPG+  +LPFKL TGY+ VG+  EI+LFYYFIESE++P  DPLLLWLTGGPGCSG 
Sbjct  40   IVEYLPGYSGRLPFKLETGYVSVGDIDEIELFYYFIESERNPVKDPLLLWLTGGPGCSGF  99

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTN  464
            S   FEIGPLT +YA+  G  P L  NP +WT++ANIIF+D PVGTG++YS T + Y T+
Sbjct  100  SGLVFEIGPLTFDYASFNGSSPTLLSNPESWTQIANIIFLDAPVGTGFAYSTTQEGYYTS  159

Query  465  DTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNM  644
            D  SA+  Y FL +W+  HP F  NPLY+AGDSYSG  VP V      G+ +G +P L +
Sbjct  160  DIKSAKDIYKFLRKWIQGHPKFSKNPLYIAGDSYSGKIVPQVTLLASKGITAGEKPTLYL  219

Query  645  KG  650
            +G
Sbjct  220  QG  221



>ref|XP_010694004.1| PREDICTED: serine carboxypeptidase-like 7 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=451

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 135/186 (73%), Gaps = 6/186 (3%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +V+++PG+P  LPF L TGY+GVG+ +E++LFYYFI+SE+ PE DPL+LWLTGGPGCS  
Sbjct  34   IVKSIPGYPGDLPFYLETGYVGVGKDEEVKLFYYFIKSERDPERDPLMLWLTGGPGCSAF  93

Query  285  SAFFFEIGPLTINYANSTGDI----PDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDA  452
            S    EIGPL  N  NS  D     P  +LNP +WTKVA+IIF+D PVGTG+SY+   + 
Sbjct  94   SGLVIEIGPLIFN--NSACDWHSKSPTFQLNPSSWTKVASIIFLDSPVGTGFSYATNPEG  151

Query  453  YNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEP  632
            Y ++D  S++H Y FL +WL DH  F N+PLY+AGDSY G  VP+VV+ I+ G + G +P
Sbjct  152  YYSDDITSSRHIYQFLTKWLADHAGFHNHPLYIAGDSYCGRIVPVVVQEIFQGNKVGFQP  211

Query  633  RLNMKG  650
             +N++G
Sbjct  212  FMNLQG  217



>gb|KJB73513.1| hypothetical protein B456_011G236800 [Gossypium raimondii]
Length=347

 Score =   215 bits (548),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 124/181 (69%), Gaps = 3/181 (2%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            + +LPGF A LPFKL TGYIGVG+   ++ FYYFI+SE+ P  DPL+LWLTGGPGCS LS
Sbjct  30   IRSLPGFSASLPFKLETGYIGVGD---VEFFYYFIQSERDPSKDPLILWLTGGPGCSALS  86

Query  288  AFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTND  467
              FFEIGPL  N     G +P   LNPY+WTKVANIIF+D PVGTG+SYS T   + T D
Sbjct  87   GLFFEIGPLQFNMVEYNGSLPTFVLNPYSWTKVANIIFLDAPVGTGFSYSTTLQGFETGD  146

Query  468  TLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMK  647
               A   Y+FL +WL  H  F+ N LY+ GDSY+G  VP++V  I DG+E    P  N+K
Sbjct  147  KRFANDGYNFLRKWLQSHLKFITNSLYITGDSYAGKIVPIIVHAISDGIEDESVPAFNLK  206

Query  648  G  650
            G
Sbjct  207  G  207



>emb|CBI17848.3| unnamed protein product [Vitis vinifera]
Length=563

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 134/184 (73%), Gaps = 5/184 (3%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             +V++TLPGF  +LPF L TGY+GVGE++E+QLFYYF++S+++P  DPL+LWL+GGPGCS
Sbjct  130  RSVIKTLPGFSGELPFYLETGYVGVGENEEVQLFYYFVKSQRNPVFDPLMLWLSGGPGCS  189

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             L+AFF+E GPLT N     G +P+L L    WTK  NIIFVD PVG+G+SYS+T + Y 
Sbjct  190  TLTAFFYENGPLTFNIQEYEGGLPNLYLKENTWTKTLNIIFVDAPVGSGFSYSKTQEGYI  249

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
              D   A  TY FL +WL+DHP FL N LYV GDSYSGI VP+VV+ IY G      P L
Sbjct  250  MEDLKYAAQTYEFLKKWLVDHPEFLKNELYVGGDSYSGIPVPMVVQEIYYG-----SPSL  304

Query  639  NMKG  650
            N++G
Sbjct  305  NLQG  308


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 50/73 (68%), Gaps = 4/73 (5%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTG----YIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGP  269
            ++V TL GFP +L F L TG    Y+GVG+++E+QL Y F   E++P  +PL+ WLTGGP
Sbjct  15   SIVTTLLGFPEELSFYLETGFVCRYVGVGKNEEVQLLYLFFRLERNPSVNPLMFWLTGGP  74

Query  270  GCSGLSAFFFEIG  308
             CS  S+FF+  G
Sbjct  75   SCSTFSSFFYSNG  87



>ref|XP_006840207.1| hypothetical protein AMTR_s00089p00129670 [Amborella trichopoda]
 gb|ERN01882.1| hypothetical protein AMTR_s00089p00129670 [Amborella trichopoda]
Length=331

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 128/183 (70%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            A VE LPGF    PF   +GYI V E  E +LFYYFI+SE +P  DPL+LWLTGGPGCSG
Sbjct  33   ARVEFLPGFEGAFPFDFFSGYISVDEVNEYRLFYYFIKSENNPSKDPLILWLTGGPGCSG  92

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
             S   FE GPL        G +P L+ NPY+WTKVAN+I+VD P+GTG+SYS++   Y T
Sbjct  93   FSGLVFETGPLRFKVEEYNGTLPALQFNPYSWTKVANVIYVDSPIGTGFSYSKSPPDYAT  152

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            +D+ + +  + FL  W +++P FL+NPLY+AGDSYSGITVP++   I +G++SG  P  N
Sbjct  153  SDSKTVKDLHKFLTNWFIEYPEFLSNPLYIAGDSYSGITVPVLTYEIANGIDSGYRPVFN  212

Query  642  MKG  650
            +KG
Sbjct  213  LKG  215



>ref|XP_010694003.1| PREDICTED: serine carboxypeptidase-like 7 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=472

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 135/186 (73%), Gaps = 6/186 (3%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +V+++PG+P  LPF L TGY+GVG+ +E++LFYYFI+SE+ PE DPL+LWLTGGPGCS  
Sbjct  34   IVKSIPGYPGDLPFYLETGYVGVGKDEEVKLFYYFIKSERDPERDPLMLWLTGGPGCSAF  93

Query  285  SAFFFEIGPLTINYANSTGDI----PDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDA  452
            S    EIGPL  N  NS  D     P  +LNP +WTKVA+IIF+D PVGTG+SY+   + 
Sbjct  94   SGLVIEIGPLIFN--NSACDWHSKSPTFQLNPSSWTKVASIIFLDSPVGTGFSYATNPEG  151

Query  453  YNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEP  632
            Y ++D  S++H Y FL +WL DH  F N+PLY+AGDSY G  VP+VV+ I+ G + G +P
Sbjct  152  YYSDDITSSRHIYQFLTKWLADHAGFHNHPLYIAGDSYCGRIVPVVVQEIFQGNKVGFQP  211

Query  633  RLNMKG  650
             +N++G
Sbjct  212  FMNLQG  217



>ref|XP_004163543.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
18-like [Cucumis sativus]
Length=466

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 137/209 (66%), Gaps = 9/209 (4%)
 Frame = +3

Query  24   FVVMASTFKIlastflllflaptflHAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFY  203
            F+++ S F+I+              H  V+ LPGFP +LPF+L TGY+GVG+ +E+QLFY
Sbjct  9    FILLVSVFQIIFGAAS---------HWTVDFLPGFPGRLPFELETGYVGVGDMEEVQLFY  59

Query  204  YFIESEKSPETDPLLLWLTGGPGCSGLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTK  383
            YF++SE +P+TDPLL WLTGGPGCS L+   FE+GP+        G +P + LNPY+WTK
Sbjct  60   YFVKSEGNPKTDPLLFWLTGGPGCSALTGLAFELGPINFKIEEYNGSLPQIILNPYSWTK  119

Query  384  VANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDS  563
             ++I+FVD PVGTG+SY  T  + N  D     H+  F  +WL+ HP FL+NP YV GDS
Sbjct  120  KSSILFVDLPVGTGFSYGTTPQSLNIGDFTQVHHSIQFFKKWLIRHPEFLSNPFYVGGDS  179

Query  564  YSGITVPLVVRNIYDGLESGIEPRLNMKG  650
            YSGI +P++   I  G E+   P +N++G
Sbjct  180  YSGIVIPVIAEEILKGRENNHAPYINLQG  208



>gb|KHG24307.1| Serine carboxypeptidase-like 18 [Gossypium arboreum]
Length=446

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 125/181 (69%), Gaps = 3/181 (2%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            + +LPGF A LPFKL TGYIGVG+   ++ FYYFI+SE+ P  DPL+LWLTGGPGCS LS
Sbjct  12   IRSLPGFSASLPFKLETGYIGVGD---LEFFYYFIQSERDPSKDPLILWLTGGPGCSALS  68

Query  288  AFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTND  467
              FFEIGPL  N     G +P   LNPY+WTKVANIIF+D PVGTG+SYS T   + T D
Sbjct  69   GLFFEIGPLQFNMVEHNGSLPTFALNPYSWTKVANIIFLDAPVGTGFSYSTTLQGFETGD  128

Query  468  TLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMK  647
               A   Y+FL +WL  HP F+ N LY+AGDSY+G  VP++V  I DG+     P  N+K
Sbjct  129  KRFANDGYNFLRKWLQSHPKFITNSLYIAGDSYAGKIVPIIVHAISDGIVDENFPAFNLK  188

Query  648  G  650
            G
Sbjct  189  G  189



>emb|CDP06920.1| unnamed protein product [Coffea canephora]
Length=298

 Score =   213 bits (542),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 136/183 (74%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V+ LPGF   LPF+L TGYIGVGES+++QLFY FI+SE +PE+DPL+LWL GGPGCS 
Sbjct  34   SIVKFLPGFQGPLPFELETGYIGVGESEDVQLFYAFIKSESNPESDPLILWLDGGPGCSS  93

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
              A FF  GP+ +   +  G +P+L LNPY WTKV +II++D PVGTG+SY++T+ A  +
Sbjct  94   FIALFFGTGPVIVEPLSFDGTLPNLILNPYTWTKVVSIIYLDSPVGTGFSYAKTAKASQS  153

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            +D  ++   Y F+ +WL DHP + +NP YV+G SY GI VP++ + I +G E GIEPR++
Sbjct  154  SDFQASDQAYEFIRKWLHDHPEYKSNPFYVSGISYGGIPVPILTQLISNGNEDGIEPRID  213

Query  642  MKG  650
            +KG
Sbjct  214  LKG  216



>ref|XP_010936153.1| PREDICTED: serine carboxypeptidase-like 18 isoform X3 [Elaeis 
guineensis]
Length=438

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 125/181 (69%), Gaps = 0/181 (0%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            +  LPGF   LPF L TGY+ V E  + QLFYYFI+SE  PE DPL++WLTGGPGCS  S
Sbjct  40   ITHLPGFHGTLPFYLETGYVKVDEVNDAQLFYYFIKSESKPEEDPLMVWLTGGPGCSAFS  99

Query  288  AFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTND  467
               +EIGPL  + A  T  +P L  NPY+WTKV NIIF+D PVGTG+SYS    +Y T D
Sbjct  100  GLVYEIGPLKFDVAGYTEGLPTLVYNPYSWTKVCNIIFLDSPVGTGFSYSSVEKSYETGD  159

Query  468  TLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMK  647
            T +AQ  ++FL +WL+DHP FL+NPLY+ GDSYSGI VP+V + I  G   G E   N+K
Sbjct  160  TKAAQQVHTFLRKWLIDHPEFLSNPLYIGGDSYSGIVVPVVAQEIAKGDRDGDELLYNLK  219

Query  648  G  650
            G
Sbjct  220  G  220



>gb|KDP41600.1| hypothetical protein JCGZ_16007 [Jatropha curcas]
Length=472

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 131/184 (71%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H+ VE LPGF   LPF+L TGYIGVGES+++QLFYYF+ S+ + E DPLLLWLTGGPGCS
Sbjct  29   HSKVEFLPGFNGPLPFELETGYIGVGESEDVQLFYYFVRSQGNAEKDPLLLWLTGGPGCS  88

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LS F +EIGPL        G +P L LNP +WTKVA+IIF+D PVGTG+SY  T  A  
Sbjct  89   ALSGFIYEIGPLYFEVVEYNGSLPTLFLNPNSWTKVASIIFIDSPVGTGFSYPRTPLASV  148

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            + D +    T  FL +WL DHP FL+NP+YV GDSYSGI +P VV+ I  G E G +P +
Sbjct  149  SGDFIQINQTEQFLRKWLNDHPEFLSNPVYVGGDSYSGIPLPGVVQKISIGNEEGRKPFI  208

Query  639  NMKG  650
            N+KG
Sbjct  209  NLKG  212



>gb|KDO81472.1| hypothetical protein CISIN_1g012205mg [Citrus sinensis]
Length=414

 Score =   216 bits (551),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 130/184 (71%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            ++ V+ LPGF   LPF+L TGY+GVGES + QLFYYF++SEK+P  DPLLLWLTGGPGCS
Sbjct  25   YSTVKFLPGFQGPLPFELETGYVGVGESGDAQLFYYFVKSEKNPREDPLLLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              S   +EIGP+  N     G +P L LNPY+WTK A+I+FVD PVGTGYSY++T  A  
Sbjct  85   AFSGLAYEIGPINFNVVEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGYSYAKTPLASQ  144

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
              D    Q    FL +WLLDHP  L+NP+Y+ GDSYSG+ VP +V+ I +  E  I+P +
Sbjct  145  AGDFKQVQQVDQFLRKWLLDHPELLSNPVYIGGDSYSGLVVPALVQQISNENEEDIKPLI  204

Query  639  NMKG  650
            N++G
Sbjct  205  NLQG  208



>ref|XP_004513964.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X1 [Cicer 
arietinum]
Length=487

 Score =   218 bits (555),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 136/183 (74%), Gaps = 1/183 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V+ LPGF   LPFKL TGYIGVGE  ++Q+FYYF+ES+++P  DP+LLW  GGPGCSG
Sbjct  59   SIVKNLPGFDGDLPFKLETGYIGVGEGAKVQIFYYFVESQRNPFIDPILLWFVGGPGCSG  118

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            LSAFFFE GPL ++  N + ++P L+LNPYAWT + N+I++D PVGTG+SYSET + Y +
Sbjct  119  LSAFFFENGPLKMD-PNYSENLPKLKLNPYAWTHMLNMIYIDMPVGTGFSYSETQEGYYS  177

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            N TL   HTYSFL +W ++H  F +NP Y+ G SYSG+T   +V+ +Y+G  +   P + 
Sbjct  178  NATLWVDHTYSFLQKWFIEHSKFSSNPFYIGGGSYSGLTTGPLVQKVYEGYIAKQVPLIK  237

Query  642  MKG  650
            +KG
Sbjct  238  IKG  240



>ref|XP_009114926.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
18 [Brassica rapa]
Length=468

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 133/183 (73%), Gaps = 1/183 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +V+  LPGF   LPF L TGYIGVGE +++QLFYYFI+SE  PE DPLL+WLTGGP C+ 
Sbjct  31   SVISHLPGFEGPLPFHLETGYIGVGEEEKVQLFYYFIKSENKPEEDPLLIWLTGGPACTA  90

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            LSA  FEIGPLT       G +P L    Y+WTKVA+IIF+DQPVGTG+SYS T  A   
Sbjct  91   LSALAFEIGPLTFKTEGYNGGLPSLVSTSYSWTKVASIIFLDQPVGTGFSYSTTPLADKP  150

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            +DT  A+ TY FL +WL++HP F++NPLYV GDSY+GI VP +V+ I  G E+  +P +N
Sbjct  151  SDTGEAKQTYEFLQKWLVEHPEFVSNPLYVGGDSYAGIVVPAIVQQISIGNENSNKP-MN  209

Query  642  MKG  650
            +KG
Sbjct  210  LKG  212



>ref|XP_007047573.1| Serine carboxypeptidase-like 2, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007047574.1| Serine carboxypeptidase-like 18, putative isoform 1 [Theobroma 
cacao]
 gb|EOX91730.1| Serine carboxypeptidase-like 2, putative isoform 1 [Theobroma 
cacao]
 gb|EOX91731.1| Serine carboxypeptidase-like 18, putative isoform 1 [Theobroma 
cacao]
Length=476

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 126/183 (69%), Gaps = 3/183 (2%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            + +  LPGF A LPFKL TGYIGVG+   ++ F+YFIESE++P  DPL LWLTGGPGCS 
Sbjct  39   STIRALPGFSASLPFKLETGYIGVGD---VEFFFYFIESERNPAEDPLFLWLTGGPGCSA  95

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            LS  FFEIGPL  N     G +P   LNPY+WTKVA+IIF+D PVGTG+SYS T   + T
Sbjct  96   LSGLFFEIGPLQFNMVEYNGSLPTFALNPYSWTKVASIIFLDAPVGTGFSYSRTLQGFKT  155

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
             D   A   Y+FL +WL  H  F+ NP Y+ GDSYSG+ VP++ + I DG+E    P +N
Sbjct  156  GDKQYADDAYNFLRKWLDSHRKFITNPFYIGGDSYSGMIVPIIAQAISDGIEDKGVPSIN  215

Query  642  MKG  650
            +KG
Sbjct  216  LKG  218



>emb|CDP18838.1| unnamed protein product [Coffea canephora]
Length=417

 Score =   216 bits (550),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 136/183 (74%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V+ LPGF   LPF+L TGYIGVGES+++QLFY FI+SE +P++DPL+LWL GGPGCS 
Sbjct  34   SIVKFLPGFEGPLPFELETGYIGVGESEDVQLFYAFIKSESNPQSDPLILWLDGGPGCSS  93

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
              A FF  GP+T    +  G +P L LNPY WTKV +IIF+D PVGTG+SY++T+ A  +
Sbjct  94   FIALFFGTGPVTFEPLSFEGTLPKLVLNPYTWTKVVSIIFLDSPVGTGFSYAKTARASQS  153

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            +D L++   Y F+ +WL DHP + +NP YV+G SY GI VP++ + I +G E GIEPR++
Sbjct  154  SDFLASDQAYEFIRKWLHDHPEYKSNPFYVSGISYGGIPVPILTQLISNGNEDGIEPRID  213

Query  642  MKG  650
            +KG
Sbjct  214  LKG  216



>ref|XP_010936152.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Elaeis 
guineensis]
Length=452

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 125/181 (69%), Gaps = 0/181 (0%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            +  LPGF   LPF L TGY+ V E  + QLFYYFI+SE  PE DPL++WLTGGPGCS  S
Sbjct  40   ITHLPGFHGTLPFYLETGYVKVDEVNDAQLFYYFIKSESKPEEDPLMVWLTGGPGCSAFS  99

Query  288  AFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTND  467
               +EIGPL  + A  T  +P L  NPY+WTKV NIIF+D PVGTG+SYS    +Y T D
Sbjct  100  GLVYEIGPLKFDVAGYTEGLPTLVYNPYSWTKVCNIIFLDSPVGTGFSYSSVEKSYETGD  159

Query  468  TLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMK  647
            T +AQ  ++FL +WL+DHP FL+NPLY+ GDSYSGI VP+V + I  G   G E   N+K
Sbjct  160  TKAAQQVHTFLRKWLIDHPEFLSNPLYIGGDSYSGIVVPVVAQEIAKGDRDGDELLYNLK  219

Query  648  G  650
            G
Sbjct  220  G  220



>ref|XP_006415267.1| hypothetical protein EUTSA_v10007571mg [Eutrema salsugineum]
 gb|ESQ33620.1| hypothetical protein EUTSA_v10007571mg [Eutrema salsugineum]
Length=464

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 133/183 (73%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +V+  LPGF   LPF L TGYI VGE ++++LFYYFI+SE +PE DPLL+WL+GGPGC+ 
Sbjct  27   SVISYLPGFEGPLPFHLETGYIAVGEEEKVKLFYYFIKSENNPEEDPLLIWLSGGPGCTS  86

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            LSA  FEIGPLT     + G +  L    Y+WTKVA+IIF+DQPVGTG+SYS T  A   
Sbjct  87   LSALAFEIGPLTFKTEGNNGGLTSLVSTSYSWTKVASIIFLDQPVGTGFSYSTTPLADKP  146

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            +DT  A+ TY FL +WL+DHP F++NP YV GDSY+G+ VP +V+ I  G E G +P +N
Sbjct  147  SDTGEAKQTYEFLRKWLVDHPEFVSNPFYVGGDSYAGVVVPAIVQQISIGNEHGYKPLIN  206

Query  642  MKG  650
            +KG
Sbjct  207  LKG  209



>ref|XP_009784016.1| PREDICTED: serine carboxypeptidase-like 11 isoform X1 [Nicotiana 
sylvestris]
Length=474

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 131/183 (72%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++VE LPGF   LPF L TGYIGVG+S+E+QLFYYF++SE  P  DPLLLWLTGGPGCS 
Sbjct  31   SIVEFLPGFDGPLPFYLETGYIGVGKSEEVQLFYYFVKSESDPRKDPLLLWLTGGPGCSS  90

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
             +   +E+GPL        G +P L   PY+WTK A+I+F++QPV TG+SY+ TS A   
Sbjct  91   FTGVAYEVGPLAFGQKAYNGSLPILVSTPYSWTKFASILFLEQPVNTGFSYATTSAASKC  150

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
             D  +  H Y FL +W  +H  F++NP YV+GDSYSGITVP++V+ I DG+E+G +P +N
Sbjct  151  TDLQACDHVYEFLCKWFNNHQEFISNPFYVSGDSYSGITVPVIVQLISDGIEAGKKPLIN  210

Query  642  MKG  650
            +KG
Sbjct  211  LKG  213



>gb|KDO81471.1| hypothetical protein CISIN_1g012205mg [Citrus sinensis]
Length=468

 Score =   217 bits (553),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 130/184 (71%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            ++ V+ LPGF   LPF+L TGY+GVGES + QLFYYF++SEK+P  DPLLLWLTGGPGCS
Sbjct  25   YSTVKFLPGFQGPLPFELETGYVGVGESGDAQLFYYFVKSEKNPREDPLLLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              S   +EIGP+  N     G +P L LNPY+WTK A+I+FVD PVGTGYSY++T  A  
Sbjct  85   AFSGLAYEIGPINFNVVEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGYSYAKTPLASQ  144

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
              D    Q    FL +WLLDHP  L+NP+Y+ GDSYSG+ VP +V+ I +  E  I+P +
Sbjct  145  AGDFKQVQQVDQFLRKWLLDHPELLSNPVYIGGDSYSGLVVPALVQQISNENEEDIKPLI  204

Query  639  NMKG  650
            N++G
Sbjct  205  NLQG  208



>ref|XP_009612197.1| PREDICTED: serine carboxypeptidase-like 11 isoform X1 [Nicotiana 
tomentosiformis]
Length=474

 Score =   217 bits (553),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 132/183 (72%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            + VE LPGF   LPF L TGYIGVG+S+E+QLFYYF++SE +P+ DPLLLWLTGGPGCS 
Sbjct  31   STVEFLPGFDGALPFYLETGYIGVGKSEEVQLFYYFVKSESNPKKDPLLLWLTGGPGCSS  90

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
             +   +E+GPL        G +P L   PY+WTK A+I+F++QPV TG+SY+ TS A   
Sbjct  91   FTGVAYEVGPLAFGQKAYNGSLPILVSTPYSWTKFASILFLEQPVNTGFSYATTSAASKC  150

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
             D  +    Y FL++W  +HP F++NP YV+GDSYSGITVP++V+ I DG+E+G  P +N
Sbjct  151  TDLQACDQVYEFLLKWFNNHPEFISNPFYVSGDSYSGITVPVIVQLISDGIEAGKNPLIN  210

Query  642  MKG  650
            +KG
Sbjct  211  LKG  213



>ref|XP_007159376.1| hypothetical protein PHAVU_002G233100g [Phaseolus vulgaris]
 gb|ESW31370.1| hypothetical protein PHAVU_002G233100g [Phaseolus vulgaris]
Length=480

 Score =   217 bits (553),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 132/183 (72%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            + V+ LPGF   LPF L TGY+GVGES+++Q FYYFIESE +P+ DPLLLWLTGGPGCS 
Sbjct  43   STVKFLPGFEGPLPFVLETGYVGVGESEDVQAFYYFIESENNPKEDPLLLWLTGGPGCSA  102

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            LS   FEIGPL   +    G +P+L    Y+WTKV+NIIFVD PV TG++Y+ T  A   
Sbjct  103  LSGLVFEIGPLGFKHEEYNGTLPNLFYRSYSWTKVSNIIFVDLPVFTGFTYATTESAAQR  162

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            +D +     + FL +WL+DHPTFL+N +Y+ GDSYSGI +P++V+ I  G E G++P +N
Sbjct  163  SDWMLVHQVHQFLRKWLIDHPTFLSNEVYIGGDSYSGIPIPVIVQEISQGNEKGVQPWIN  222

Query  642  MKG  650
            ++G
Sbjct  223  LQG  225



>ref|XP_010694006.1| PREDICTED: serine carboxypeptidase-like 7 isoform X3 [Beta vulgaris 
subsp. vulgaris]
Length=436

 Score =   216 bits (550),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 134/185 (72%), Gaps = 6/185 (3%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +V+++PG+P  LPF L TGY+GVG+ +E++LFYYFI+SE+ PE DPL+LWLTGGPGCS  
Sbjct  34   IVKSIPGYPGDLPFYLETGYVGVGKDEEVKLFYYFIKSERDPERDPLMLWLTGGPGCSAF  93

Query  285  SAFFFEIGPLTINYANSTGDI----PDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDA  452
            S    EIGPL  N  NS  D     P  +LNP +WTKVA+IIF+D PVGTG+SY+   + 
Sbjct  94   SGLVIEIGPLIFN--NSACDWHSKSPTFQLNPSSWTKVASIIFLDSPVGTGFSYATNPEG  151

Query  453  YNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEP  632
            Y ++D  S++H Y FL +WL DH  F N+PLY+AGDSY G  VP+VV+ I+ G + G +P
Sbjct  152  YYSDDITSSRHIYQFLTKWLADHAGFHNHPLYIAGDSYCGRIVPVVVQEIFQGNKVGFQP  211

Query  633  RLNMK  647
             +N++
Sbjct  212  FMNLQ  216



>ref|XP_006433654.1| hypothetical protein CICLE_v10001055mg [Citrus clementina]
 gb|ESR46894.1| hypothetical protein CICLE_v10001055mg [Citrus clementina]
Length=468

 Score =   217 bits (552),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 130/184 (71%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            ++ V+ LPGF   LPF+L TGY+GVGES + QLFYYF++SEK+P  DPLLLWLTGGPGCS
Sbjct  25   YSTVKFLPGFQGPLPFELETGYVGVGESGDAQLFYYFVKSEKNPREDPLLLWLTGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              S   +EIGP+  N     G +P L LNPY+WTK A+I+FVD PVGTGYSY++T  A  
Sbjct  85   AFSGLAYEIGPINFNVVEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGYSYAKTPLASQ  144

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
              D    Q    FL +WLLDHP  L+NP+Y+ GDSYSG+ VP +V+ I +  E  I+P +
Sbjct  145  AGDFKQVQQVDQFLRKWLLDHPELLSNPVYIGGDSYSGLVVPALVQQISNENEEDIKPLI  204

Query  639  NMKG  650
            N++G
Sbjct  205  NLQG  208



>ref|XP_010694000.1| PREDICTED: serine carboxypeptidase-like 7 [Beta vulgaris subsp. 
vulgaris]
Length=451

 Score =   216 bits (551),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 135/186 (73%), Gaps = 6/186 (3%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +V+++PG+P  LPF L TGY+GVG+ +E++LFYYFI+SE+ PE DPL+LWLTGGPGCS  
Sbjct  34   IVKSIPGYPGDLPFYLETGYVGVGKDEEVKLFYYFIKSERDPERDPLMLWLTGGPGCSAF  93

Query  285  SAFFFEIGPLTINYANSTGDI----PDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDA  452
            S    EIGPL  N  NS  D     P  +LNP +WTKVA+IIF+D PVGTG+SY+   + 
Sbjct  94   SGLVIEIGPLMFN--NSACDWHSKSPTFQLNPSSWTKVASIIFLDSPVGTGFSYATNPEG  151

Query  453  YNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEP  632
            Y ++D  +++H Y FL +WL DH  F N+ LYVAGDSYSG  VP+VV+ I+ G + G +P
Sbjct  152  YYSDDITASRHIYQFLTKWLADHAEFHNHSLYVAGDSYSGRIVPVVVQEIFQGNKVGFQP  211

Query  633  RLNMKG  650
             +N++G
Sbjct  212  FMNLQG  217



>ref|XP_010936150.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Elaeis 
guineensis]
 ref|XP_010936151.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Elaeis 
guineensis]
Length=476

 Score =   217 bits (552),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 125/181 (69%), Gaps = 0/181 (0%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            +  LPGF   LPF L TGY+ V E  + QLFYYFI+SE  PE DPL++WLTGGPGCS  S
Sbjct  40   ITHLPGFHGTLPFYLETGYVKVDEVNDAQLFYYFIKSESKPEEDPLMVWLTGGPGCSAFS  99

Query  288  AFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTND  467
               +EIGPL  + A  T  +P L  NPY+WTKV NIIF+D PVGTG+SYS    +Y T D
Sbjct  100  GLVYEIGPLKFDVAGYTEGLPTLVYNPYSWTKVCNIIFLDSPVGTGFSYSSVEKSYETGD  159

Query  468  TLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMK  647
            T +AQ  ++FL +WL+DHP FL+NPLY+ GDSYSGI VP+V + I  G   G E   N+K
Sbjct  160  TKAAQQVHTFLRKWLIDHPEFLSNPLYIGGDSYSGIVVPVVAQEIAKGDRDGDELLYNLK  219

Query  648  G  650
            G
Sbjct  220  G  220



>ref|XP_011006024.1| PREDICTED: serine carboxypeptidase-like 3 isoform X2 [Populus 
euphratica]
Length=463

 Score =   216 bits (551),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 130/184 (71%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             ++V+ LPG    LPF L TGY+GV E++++QLFYYFI+S+++P+ DPLLLWLTGGPGCS
Sbjct  22   RSIVKFLPGLKGPLPFHLETGYVGVDEAEDVQLFYYFIKSQRNPKDDPLLLWLTGGPGCS  81

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
                  FEIGP++       G +P L LNPY+WT+V++IIF+D P GTG+SY+ T  A  
Sbjct  82   AFCGLVFEIGPISFEVKEYNGSLPTLVLNPYSWTQVSSIIFLDLPAGTGFSYARTPLALQ  141

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             +D     H   FL +WL+DH  FL NP+Y+AGDSYSG  VP +V+NI +G   GIEP L
Sbjct  142  RSDFKQVSHAEQFLRKWLMDHQEFLANPIYIAGDSYSGKIVPAIVQNISNGNNDGIEPLL  201

Query  639  NMKG  650
            N+KG
Sbjct  202  NVKG  205



>ref|XP_010555479.1| PREDICTED: serine carboxypeptidase-like 7 [Tarenaya hassleriana]
Length=461

 Score =   216 bits (551),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 136/184 (74%), Gaps = 1/184 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVG-ESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            +VV++LPGF   LPF+L TGY+GVG E++E+QLFYYF++SE +PE DPLL+WL+GGPGC+
Sbjct  26   SVVKSLPGFEGPLPFELETGYVGVGGEAEEVQLFYYFVKSETNPEEDPLLVWLSGGPGCT  85

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LS   +EIGPL     +  G +P L    Y+WTK+A+IIF+DQPVGTG+SYS T  A  
Sbjct  86   SLSGLAYEIGPLAFKVDDYDGGVPSLASTSYSWTKIASIIFLDQPVGTGFSYSRTPPANT  145

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             +DT  A+  + F+ +WL+DHP F++NP YV GDSYSGI VP +V+ +  G E G+ P +
Sbjct  146  PSDTRQAEQVHEFVRKWLVDHPEFVSNPFYVGGDSYSGIIVPAIVQQVSKGNEQGLVPLI  205

Query  639  NMKG  650
            N++G
Sbjct  206  NIEG  209



>ref|XP_010461188.1| PREDICTED: serine carboxypeptidase-like 18 [Camelina sativa]
Length=464

 Score =   216 bits (550),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 132/183 (72%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +VV  LPGF   LPF L TGYIGVGE + +QL+YYFI+SE +PE DP++LWLTGGP CS 
Sbjct  27   SVVSYLPGFDGLLPFHLETGYIGVGEEENVQLYYYFIKSENNPEEDPVILWLTGGPACSV  86

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            LSA  FEIGPLT       G +P L    Y+WTKVA+IIF+DQP G G+SYS    A+  
Sbjct  87   LSALAFEIGPLTFKTEGYNGGLPSLVSTSYSWTKVASIIFLDQPAGAGFSYSTNPLAHKP  146

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            +DT  A+H Y FL +WL+++P F++NPLYV GDSY+G+ VP +V++I  G E G  PR+N
Sbjct  147  SDTGEAKHAYEFLQKWLVENPEFVSNPLYVGGDSYAGMVVPAIVQHISIGNEHGYNPRIN  206

Query  642  MKG  650
            +KG
Sbjct  207  LKG  209



>ref|XP_010320198.1| PREDICTED: serine carboxypeptidase-like 17 [Solanum lycopersicum]
Length=476

 Score =   216 bits (551),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 136/189 (72%), Gaps = 8/189 (4%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            V+ LPGF   LPF+L TGYIGVG+S ++QLFYYF++SE +P++DPL+LWLTGGPGCS LS
Sbjct  38   VKFLPGFQGPLPFELETGYIGVGDSDDVQLFYYFVKSESNPKSDPLILWLTGGPGCSALS  97

Query  288  AFFFEIGPLT---INY-----ANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSET  443
               FEIGP+T   + Y     A   G  P L LNP+ WTKVA+ IF+D PV TG+SY+ T
Sbjct  98   GLLFEIGPITFEPVEYGDFKPAEYNGSFPSLVLNPHTWTKVASFIFLDLPVCTGFSYART  157

Query  444  SDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESG  623
            S A  ++D L++ H Y FL +W  DHP F  NP YVAGDSY+GI +P++ + I +G E G
Sbjct  158  SVARQSDDLLASDHAYQFLHKWFNDHPEFFRNPFYVAGDSYAGIGIPIISQLIANGNEKG  217

Query  624  IEPRLNMKG  650
            +EP +++KG
Sbjct  218  LEPFIDLKG  226



>gb|KJB73514.1| hypothetical protein B456_011G236800 [Gossypium raimondii]
Length=424

 Score =   215 bits (547),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 124/181 (69%), Gaps = 3/181 (2%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            + +LPGF A LPFKL TGYIGVG+   ++ FYYFI+SE+ P  DPL+LWLTGGPGCS LS
Sbjct  30   IRSLPGFSASLPFKLETGYIGVGD---VEFFYYFIQSERDPSKDPLILWLTGGPGCSALS  86

Query  288  AFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTND  467
              FFEIGPL  N     G +P   LNPY+WTKVANIIF+D PVGTG+SYS T   + T D
Sbjct  87   GLFFEIGPLQFNMVEYNGSLPTFVLNPYSWTKVANIIFLDAPVGTGFSYSTTLQGFETGD  146

Query  468  TLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMK  647
               A   Y+FL +WL  H  F+ N LY+ GDSY+G  VP++V  I DG+E    P  N+K
Sbjct  147  KRFANDGYNFLRKWLQSHLKFITNSLYITGDSYAGKIVPIIVHAISDGIEDESVPAFNLK  206

Query  648  G  650
            G
Sbjct  207  G  207



>ref|XP_006472317.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X3 [Citrus 
sinensis]
Length=463

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 129/184 (70%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             + V+ LPGF   L F+L TGY+GVGES++ QLFYYF++SEK+P+ DPLLLWLTGGPGCS
Sbjct  24   RSTVKFLPGFQGPLSFELETGYVGVGESEDAQLFYYFVKSEKNPKEDPLLLWLTGGPGCS  83

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              SA  +EIGP+  N     G +P L LNPY+WTK A+I+FVD PVGTG+SY  T  A  
Sbjct  84   AFSALVYEIGPINFNILEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGFSYVRTPLASQ  143

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            T D         FL +WL+DHP FL+N  YV GDSYSGITVP + + I +  E GI+P +
Sbjct  144  TGDFKQVHQVDQFLRKWLMDHPEFLSNTFYVGGDSYSGITVPPLAQQISNENEEGIKPLI  203

Query  639  NMKG  650
            N++G
Sbjct  204  NLQG  207



>ref|XP_010694009.1| PREDICTED: serine carboxypeptidase-like 7 [Beta vulgaris subsp. 
vulgaris]
Length=451

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 133/186 (72%), Gaps = 6/186 (3%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            +V+++PG+P  LPF L TGY+GVG+ +E++LFYYFI+SE+ PE DPL+LWLTGGPGCS  
Sbjct  34   IVKSIPGYPGDLPFYLETGYVGVGKDEEVKLFYYFIKSERDPERDPLMLWLTGGPGCSAF  93

Query  285  SAFFFEIGPLTINYANSTGDI----PDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDA  452
            S    EIGPL  N  NS  D     P  +LNP +WTKVA+IIF+D PVGTG+SY+   + 
Sbjct  94   SGLVLEIGPLIFN--NSACDWHSKSPTFQLNPSSWTKVASIIFLDSPVGTGFSYATNPEG  151

Query  453  YNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEP  632
            Y ++D  S++H Y FL +WL DH  F NNPLY+AG SY G  VP+VV  I+ G + G +P
Sbjct  152  YYSDDITSSRHIYQFLTKWLADHAGFHNNPLYIAGVSYCGKIVPVVVHEIFQGNKVGFQP  211

Query  633  RLNMKG  650
             +N++G
Sbjct  212  FMNLQG  217



>ref|XP_011006023.1| PREDICTED: serine carboxypeptidase-like 3 isoform X1 [Populus 
euphratica]
Length=487

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 130/184 (71%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             ++V+ LPG    LPF L TGY+GV E++++QLFYYFI+S+++P+ DPLLLWLTGGPGCS
Sbjct  22   RSIVKFLPGLKGPLPFHLETGYVGVDEAEDVQLFYYFIKSQRNPKDDPLLLWLTGGPGCS  81

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
                  FEIGP++       G +P L LNPY+WT+V++IIF+D P GTG+SY+ T  A  
Sbjct  82   AFCGLVFEIGPISFEVKEYNGSLPTLVLNPYSWTQVSSIIFLDLPAGTGFSYARTPLALQ  141

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             +D     H   FL +WL+DH  FL NP+Y+AGDSYSG  VP +V+NI +G   GIEP L
Sbjct  142  RSDFKQVSHAEQFLRKWLMDHQEFLANPIYIAGDSYSGKIVPAIVQNISNGNNDGIEPLL  201

Query  639  NMKG  650
            N+KG
Sbjct  202  NVKG  205



>ref|XP_010314652.1| PREDICTED: serine carboxypeptidase-like 11 [Solanum lycopersicum]
Length=677

 Score =   220 bits (560),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 136/183 (74%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++VE LPGF   LPF L TGYIGVG+S+E+QLFYYF++SE  P+ DP+LLWLTGGPGCS 
Sbjct  22   SIVEFLPGFDGPLPFYLQTGYIGVGKSEEVQLFYYFVKSESDPKKDPILLWLTGGPGCSS  81

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
             S   +EIGPL        G +P L  +P++WTK A+I+F++QPV TG+S++ TS+AY  
Sbjct  82   FSGLAYEIGPLEFGQKAYNGSLPILVSSPHSWTKFASILFLEQPVNTGFSHAITSEAYKC  141

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
             D  +  H Y FL +W ++H  F++NP YV+GDSYSGIT+P++V+ I +G+E+G EP +N
Sbjct  142  TDLQACDHVYEFLRKWFVNHSEFISNPFYVSGDSYSGITIPIIVQLISNGIEAGKEPLIN  201

Query  642  MKG  650
            +KG
Sbjct  202  LKG  204


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 41/78 (53%), Gaps = 7/78 (9%)
 Frame = +3

Query  162  YIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLSAFFFEIG---PLTINYAN  332
            YIGV +S+E+QLFYYF++SE  PE       L  G G + L      IG   PL      
Sbjct  457  YIGVAKSEEVQLFYYFVKSEIRPEERSD---LAMGSGRTRL-LILHRIGVRSPLAFGQKA  512

Query  333  STGDIPDLELNPYAWTKV  386
              G +P L   PY+WTKV
Sbjct  513  YNGSLPFLVSRPYSWTKV  530



>gb|KDP44534.1| hypothetical protein JCGZ_16367 [Jatropha curcas]
Length=465

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 132/182 (73%), Gaps = 3/182 (2%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            ++ TLPGF   LPFKL TGY  VG+   I+ FYYF+ SE +P  DPLLL+L GGPGCSGL
Sbjct  27   IITTLPGFSGDLPFKLETGYTSVGD---IEFFYYFVHSENNPAADPLLLYLNGGPGCSGL  83

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTN  464
            + FF++IGPL  +  N TG +P L   P AW+K +NI+F+D PVGTG+SY+ T+DA+NT 
Sbjct  84   NGFFYQIGPLKFDIHNYTGGLPKLVYEPAAWSKTSNILFLDSPVGTGFSYATTADAWNTT  143

Query  465  DTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNM  644
            DT SA+  Y FL +WL+DHP F  NP+Y+  DSY+GI +P++  +I  G  +G+EP +N+
Sbjct  144  DTKSAEQAYKFLRKWLIDHPAFRTNPVYLGSDSYAGIVLPILALDIIKGNTAGLEPFVNL  203

Query  645  KG  650
            KG
Sbjct  204  KG  205



>ref|XP_006472315.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X1 [Citrus 
sinensis]
Length=487

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 129/184 (70%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             + V+ LPGF   L F+L TGY+GVGES++ QLFYYF++SEK+P+ DPLLLWLTGGPGCS
Sbjct  24   RSTVKFLPGFQGPLSFELETGYVGVGESEDAQLFYYFVKSEKNPKEDPLLLWLTGGPGCS  83

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              SA  +EIGP+  N     G +P L LNPY+WTK A+I+FVD PVGTG+SY  T  A  
Sbjct  84   AFSALVYEIGPINFNILEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGFSYVRTPLASQ  143

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            T D         FL +WL+DHP FL+N  YV GDSYSGITVP + + I +  E GI+P +
Sbjct  144  TGDFKQVHQVDQFLRKWLMDHPEFLSNTFYVGGDSYSGITVPPLAQQISNENEEGIKPLI  203

Query  639  NMKG  650
            N++G
Sbjct  204  NLQG  207



>gb|KJB48748.1| hypothetical protein B456_008G084200 [Gossypium raimondii]
Length=455

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 132/183 (72%), Gaps = 5/183 (3%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +VV++LPGF A LPFKL TGY    E  +++ FYYFIESE++P  DPL+LWLTGGPGCS 
Sbjct  26   SVVDSLPGFTAPLPFKLETGYT---EVDDLEFFYYFIESERNPAEDPLVLWLTGGPGCSS  82

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            LS FF EIGPL  N     G +P   LN YAWTKV++IIF+D PVGTG+SYS T+  + T
Sbjct  83   LSGFFLEIGPLRFNMVEYNGSLPTFFLNQYAWTKVSSIIFLDAPVGTGFSYSRTAQGFKT  142

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
             D   A   Y+FL +WL  HP F++NPLY+AGDSYSG+ VP++ + I D +E+  +P LN
Sbjct  143  GDMKHAISCYNFLRKWLQSHPKFISNPLYIAGDSYSGMIVPIITQAISDDIEA--KPVLN  200

Query  642  MKG  650
            +KG
Sbjct  201  LKG  203



>gb|KJB48749.1| hypothetical protein B456_008G084200 [Gossypium raimondii]
Length=455

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 132/183 (72%), Gaps = 5/183 (3%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +VV++LPGF A LPFKL TGY    E  +++ FYYFIESE++P  DPL+LWLTGGPGCS 
Sbjct  26   SVVDSLPGFTAPLPFKLETGYT---EVDDLEFFYYFIESERNPAEDPLVLWLTGGPGCSS  82

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            LS FF EIGPL  N     G +P   LN YAWTKV++IIF+D PVGTG+SYS T+  + T
Sbjct  83   LSGFFLEIGPLRFNMVEYNGSLPTFFLNQYAWTKVSSIIFLDAPVGTGFSYSRTAQGFKT  142

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
             D   A   Y+FL +WL  HP F++NPLY+AGDSYSG+ VP++ + I D +E+  +P LN
Sbjct  143  GDMKHAISCYNFLRKWLQSHPKFISNPLYIAGDSYSGMIVPIITQAISDDIEA--KPVLN  200

Query  642  MKG  650
            +KG
Sbjct  201  LKG  203



>ref|XP_003593858.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES64109.1| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=469

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 135/184 (73%), Gaps = 1/184 (1%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V+ LPGF   LPF L TGY+GVGE +++Q+FYYFIESEK+P+ DPL+LWLTGGPGCS 
Sbjct  31   SIVKFLPGFQGPLPFVLETGYVGVGEKEDVQVFYYFIESEKNPKDDPLILWLTGGPGCSA  90

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDA-YN  458
            LS    EIGPL        G +P+L L P++WTKV++IIFVD PV TG++Y+ T ++   
Sbjct  91   LSGLMLEIGPLEFKKEEYNGSLPNLILKPHSWTKVSSIIFVDLPVSTGFTYATTEESGAK  150

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             +D +    TY FL +WL+DHP F +N +Y+AGDSYSGI +P+VV+ I  G E G++P +
Sbjct  151  RSDWILVHQTYQFLRKWLVDHPKFQSNEVYIAGDSYSGIPIPVVVQEIAQGNEKGVQPWI  210

Query  639  NMKG  650
            N++G
Sbjct  211  NLQG  214



>ref|XP_008790305.1| PREDICTED: serine carboxypeptidase-like 18 [Phoenix dactylifera]
Length=884

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 129/181 (71%), Gaps = 0/181 (0%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            V  LPGF   LPF L TGY  V E  + QLFYYFI+SE +PE DPLLLWL+GGPGCS  S
Sbjct  448  VSRLPGFRGALPFYLETGYATVDEVNDSQLFYYFIKSEGNPEEDPLLLWLSGGPGCSSFS  507

Query  288  AFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTND  467
            A  FEIGP+    A   G +P L LNPY+WTKV+NIIF+D P+GTG+S+S ++  Y   D
Sbjct  508  ALAFEIGPVQFEIAEHNGSLPTLVLNPYSWTKVSNIIFLDSPIGTGFSFSRSTKGYEVGD  567

Query  468  TLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMK  647
             +S++  Y+FL +W  DHP FL+NPLY+AGDSY G  VP+V + I  G+E+G +P LN+K
Sbjct  568  VISSKQIYTFLRKWFKDHPRFLSNPLYIAGDSYGGKIVPVVAQEISQGIETGQQPLLNLK  627

Query  648  G  650
            G
Sbjct  628  G  628


 Score =   216 bits (549),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 125/181 (69%), Gaps = 0/181 (0%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            +  LPGF   LPF L TGY+ V E  + QLFYYFI+SE+ PE DPL++WLTGGPGCSGLS
Sbjct  40   ITHLPGFHGTLPFHLETGYVKVDEVNDAQLFYYFIKSERKPEEDPLIVWLTGGPGCSGLS  99

Query  288  AFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTND  467
            A  FEIGPL  + A  T  +P L  NPY WTKV NII +D PVGTG+SYS    +Y T D
Sbjct  100  ALVFEIGPLKFDVAGYTEGLPTLVYNPYTWTKVCNIIILDSPVGTGFSYSSVGKSYETGD  159

Query  468  TLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMK  647
            T + +  ++FL +W +DHP FL+NPLY+ GDSYSGI VP+  + I  G + G +   N+K
Sbjct  160  TKAVRQVHTFLRKWFIDHPEFLSNPLYIGGDSYSGIVVPVAAQEIAKGDQDGDKLSYNLK  219

Query  648  G  650
            G
Sbjct  220  G  220



>ref|XP_006472316.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X2 [Citrus 
sinensis]
Length=467

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 129/184 (70%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             + V+ LPGF   L F+L TGY+GVGES++ QLFYYF++SEK+P+ DPLLLWLTGGPGCS
Sbjct  24   RSTVKFLPGFQGPLSFELETGYVGVGESEDAQLFYYFVKSEKNPKEDPLLLWLTGGPGCS  83

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
              SA  +EIGP+  N     G +P L LNPY+WTK A+I+FVD PVGTG+SY  T  A  
Sbjct  84   AFSALVYEIGPINFNILEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGFSYVRTPLASQ  143

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            T D         FL +WL+DHP FL+N  YV GDSYSGITVP + + I +  E GI+P +
Sbjct  144  TGDFKQVHQVDQFLRKWLMDHPEFLSNTFYVGGDSYSGITVPPLAQQISNENEEGIKPLI  203

Query  639  NMKG  650
            N++G
Sbjct  204  NLQG  207



>gb|KJB73512.1| hypothetical protein B456_011G236800 [Gossypium raimondii]
Length=466

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 124/181 (69%), Gaps = 3/181 (2%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            + +LPGF A LPFKL TGYIGVG+   ++ FYYFI+SE+ P  DPL+LWLTGGPGCS LS
Sbjct  30   IRSLPGFSASLPFKLETGYIGVGD---VEFFYYFIQSERDPSKDPLILWLTGGPGCSALS  86

Query  288  AFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTND  467
              FFEIGPL  N     G +P   LNPY+WTKVANIIF+D PVGTG+SYS T   + T D
Sbjct  87   GLFFEIGPLQFNMVEYNGSLPTFVLNPYSWTKVANIIFLDAPVGTGFSYSTTLQGFETGD  146

Query  468  TLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMK  647
               A   Y+FL +WL  H  F+ N LY+ GDSY+G  VP++V  I DG+E    P  N+K
Sbjct  147  KRFANDGYNFLRKWLQSHLKFITNSLYITGDSYAGKIVPIIVHAISDGIEDESVPAFNLK  206

Query  648  G  650
            G
Sbjct  207  G  207



>gb|KFK44962.1| hypothetical protein AALP_AA1G326200 [Arabis alpina]
Length=463

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 132/183 (72%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +V+  LPGF   LPF L TGYIGVGE + ++LFYYFI+SE +PE DPLL+WLTGGPGCS 
Sbjct  28   SVISYLPGFEGPLPFHLETGYIGVGEGERVKLFYYFIKSENNPEKDPLLIWLTGGPGCSS  87

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            LSA  FEIGPL++      G +P L   PY+WTK ANIIF+DQPVGTG+SYS T  A   
Sbjct  88   LSALAFEIGPLSLKNEGYNGGLPSLISTPYSWTKEANIIFLDQPVGTGFSYSTTPLADKP  147

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            +DT  A+  Y FL +WL+ +P F +NP Y+ GDS+SG+ VP++V+ I +G E   +P +N
Sbjct  148  SDTGEAKQAYEFLQKWLVKYPEFASNPFYIGGDSHSGMVVPVIVQLISNGNEHSYKPLIN  207

Query  642  MKG  650
            +KG
Sbjct  208  LKG  210



>emb|CDP21040.1| unnamed protein product [Coffea canephora]
Length=493

 Score =   215 bits (548),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 131/181 (72%), Gaps = 0/181 (0%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            V+ LPGF   LPF+L TGYIGV ES+++QLFYYF++SE SPETDPL+LWLTGG  C+  S
Sbjct  46   VKFLPGFEGPLPFELETGYIGVDESEDVQLFYYFVKSESSPETDPLVLWLTGGNCCTSFS  105

Query  288  AFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTND  467
               FEIGP+        G +P L  NPY+WTKVA+IIFVD PV +G+SY+ T+ A  +  
Sbjct  106  GLAFEIGPIKFEQVLYHGTLPKLLSNPYSWTKVASIIFVDLPVASGFSYARTAKASQSTV  165

Query  468  TLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMK  647
              +    Y FL +WL+DHP F+++P+Y+ GDSYSGITVP+V + I DG E GIEP +++K
Sbjct  166  LQACNQAYEFLRKWLVDHPEFISSPVYIGGDSYSGITVPIVTQIISDGNEVGIEPHIDLK  225

Query  648  G  650
            G
Sbjct  226  G  226



>ref|XP_007018464.1| Serine carboxypeptidase-like 2, putative [Theobroma cacao]
 gb|EOY15689.1| Serine carboxypeptidase-like 2, putative [Theobroma cacao]
Length=406

 Score =   213 bits (542),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 132/184 (72%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
            H++V+ LPGF   LPF+L TGY+GVGES ++QLFYYFI+SE++P  DPLLLWLTGGPGCS
Sbjct  26   HSLVKFLPGFEGPLPFELETGYVGVGESDDVQLFYYFIKSERNPGEDPLLLWLTGGPGCS  85

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
            GLS   +EIGPL        G +P L LNPY+WTK+++IIFVD  VGTG+ Y+    A  
Sbjct  86   GLSGLVYEIGPLNFKVVEYNGSLPTLVLNPYSWTKISSIIFVDSSVGTGFFYATNQHAAQ  145

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
            ++D     H +  L + L+DHP FL+NP+Y+AGDS +GI +P++ + I  G E GI P +
Sbjct  146  SSDFKQVHHLHQLLQKCLMDHPEFLSNPVYIAGDSDAGIILPVIFQEILYGNEEGIRPLI  205

Query  639  NMKG  650
            +++G
Sbjct  206  DLQG  209



>ref|XP_008237699.1| PREDICTED: serine carboxypeptidase-like 2 [Prunus mume]
Length=449

 Score =   214 bits (544),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 133/182 (73%), Gaps = 2/182 (1%)
 Frame = +3

Query  105  VVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGL  284
            V+++LPGFP  LPFKL TGYIGV E +++QLFYYF+E E++P  DPL+LWLTGGP CSGL
Sbjct  18   VIKSLPGFPGFLPFKLETGYIGVDEKEDVQLFYYFVECERNPRDDPLMLWLTGGPTCSGL  77

Query  285  SAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTN  464
            S   FEIGP+  N     G +P   +NPY+WTKV++IIFVD P+GTG+SYS +S    ++
Sbjct  78   SGLAFEIGPMKFNMVEYNGSLPTFVINPYSWTKVSSIIFVDAPIGTGFSYSRSSKG--SS  135

Query  465  DTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNM  644
            D L   H Y FL +WLL HP F++NP+Y+AGDS+ G+ VP+V   I  G+E+G  P +N 
Sbjct  136  DILFINHIYGFLKKWLLSHPEFISNPIYIAGDSFPGMIVPVVAEEIAKGIEAGSIPEINF  195

Query  645  KG  650
            KG
Sbjct  196  KG  197



>ref|XP_004163541.1| PREDICTED: serine carboxypeptidase-like 19-like [Cucumis sativus]
Length=467

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 129/181 (71%), Gaps = 1/181 (1%)
 Frame = +3

Query  108  VETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSGLS  287
            V+ LPGF   LPF L TGY+GVGE +EIQLFYYF++SE +P+ DPL++WLTGGPGCS +S
Sbjct  30   VKFLPGFSGPLPFSLETGYVGVGEREEIQLFYYFVKSEGNPQKDPLIVWLTGGPGCSSIS  89

Query  288  AFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTND  467
             F FE GPL        G +P L LNPY+WTK  +IIF+D PVG+G+SY +T  A+NT D
Sbjct  90   GFAFENGPLNFKIEEYNGSLPQLHLNPYSWTKNCSIIFLDSPVGSGFSYGKTLQAFNTGD  149

Query  468  TLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMK  647
                 H + FL +WL++HP F++NP YV+GDSYSGITVP +   I +G    I P +N++
Sbjct  150  VTQVHHIHQFLRKWLVEHPEFISNPFYVSGDSYSGITVPAITYEILEG-NKHILPPINLQ  208

Query  648  G  650
            G
Sbjct  209  G  209



>ref|XP_006415266.1| hypothetical protein EUTSA_v10007559mg [Eutrema salsugineum]
 gb|ESQ33619.1| hypothetical protein EUTSA_v10007559mg [Eutrema salsugineum]
Length=465

 Score =   214 bits (545),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 133/183 (73%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            +V+  LPGF   LPF L TGYIGVGE +++QLFYYF++SE +PE DPLL+WL+GGP CS 
Sbjct  28   SVISHLPGFEGPLPFHLETGYIGVGEGEKVQLFYYFVKSENNPEEDPLLIWLSGGPACSS  87

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            +SA  FEIGPLT N   ++G +P L    Y+WTK+A+IIF+DQPVGTG+SYS        
Sbjct  88   ISALAFEIGPLTFNTEGNSGGLPSLVSTSYSWTKIASIIFLDQPVGTGFSYSTNPLVDKP  147

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            +DT  A+ TY FL +WL++HP F++N  YV GDSY+G+ VP +V+ I  G E G +P +N
Sbjct  148  SDTGEAKQTYEFLQKWLVEHPEFVSNHFYVGGDSYAGVIVPAIVQQISIGNEHGYKPLIN  207

Query  642  MKG  650
            +KG
Sbjct  208  LKG  210



>emb|CBI24085.3| unnamed protein product [Vitis vinifera]
Length=455

 Score =   214 bits (544),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 131/184 (71%), Gaps = 0/184 (0%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
              +V +LPGF   LPF L TGY+GVGES+E+QLFYYF+ES+ SP  DPL+L++ GGPGCS
Sbjct  25   QTIVTSLPGFSGTLPFTLETGYVGVGESEEVQLFYYFVESQSSPSQDPLMLYIAGGPGCS  84

Query  279  GLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYN  458
             LS+ F+E GP+ +NY    G +P L L+  AWT+  N+I++D PVGTG+SYS TS  Y 
Sbjct  85   SLSSLFYENGPIYLNYQYYDGGVPSLNLSADAWTQGLNMIYIDAPVGTGFSYSNTSQGYY  144

Query  459  TNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRL  638
             +D  +A  TY FL +WL+ HP FL N LY+AG SYSGI VP++V  I +G   G+ P +
Sbjct  145  VDDAENAAQTYEFLRKWLVQHPDFLGNELYIAGVSYSGIPVPMIVNEIIEGNILGLSPGM  204

Query  639  NMKG  650
            N+KG
Sbjct  205  NIKG  208



>ref|XP_007138067.1| hypothetical protein PHAVU_009G177800g [Phaseolus vulgaris]
 gb|ESW10061.1| hypothetical protein PHAVU_009G177800g [Phaseolus vulgaris]
Length=495

 Score =   215 bits (547),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 132/183 (72%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            + V+ LPGFP  LPF L TGY+GVGES+++Q FYYFIESE +P+ DPL+LWL+GGPGCS 
Sbjct  56   STVKFLPGFPGSLPFVLETGYVGVGESEDVQTFYYFIESENNPKDDPLMLWLSGGPGCSS  115

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            L+  F +IGP+ + +    G  P+L     +WTKV++IIFVD PV TG++Y+ T  A   
Sbjct  116  LAGLFLQIGPVALKHEEYNGSTPNLISRTQSWTKVSSIIFVDLPVNTGFTYARTELAAER  175

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            +DTL     + FL +WL+DHP FL+N +Y+AGDSYSGI VP +V+ I  G E G++P +N
Sbjct  176  SDTLLVHQAHQFLRKWLVDHPKFLSNEVYIAGDSYSGIPVPAIVQEIAQGNEKGVQPWIN  235

Query  642  MKG  650
            ++G
Sbjct  236  LQG  238



>ref|XP_010656846.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Vitis 
vinifera]
Length=474

 Score =   214 bits (546),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 135/197 (69%), Gaps = 18/197 (9%)
 Frame = +3

Query  99   HAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCS  278
             +V++TLPGF  +LPF L TGY+GVGE++E+QLFYYF++S+++P  DPL+LWL+GGPGCS
Sbjct  28   RSVIKTLPGFSGELPFYLETGYVGVGENEEVQLFYYFVKSQRNPVFDPLMLWLSGGPGCS  87

Query  279  GLSAFFFE-------------IGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVG  419
             L+AFF+E             IGPLT N     G +P+L L    WTK  NIIFVD PVG
Sbjct  88   TLTAFFYENECTFKQNVRTFCIGPLTFNIQEYEGGLPNLYLKENTWTKTLNIIFVDAPVG  147

Query  420  TGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRN  599
            +G+SYS+T + Y   D   A  TY FL +WL+DHP FL N LYV GDSYSGI VP+VV+ 
Sbjct  148  SGFSYSKTQEGYIMEDLKYAAQTYEFLKKWLVDHPEFLKNELYVGGDSYSGIPVPMVVQE  207

Query  600  IYDGLESGIEPRLNMKG  650
            IY G      P LN++G
Sbjct  208  IYYG-----SPSLNLQG  219



>ref|XP_003593861.1| Serine carboxypeptidase family protein [Medicago truncatula]
 gb|AES64112.1| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=465

 Score =   214 bits (545),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 93/183 (51%), Positives = 132/183 (72%), Gaps = 0/183 (0%)
 Frame = +3

Query  102  AVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFYYFIESEKSPETDPLLLWLTGGPGCSG  281
            ++V+ LPGF   LPF L TGY+GVGE +++Q+FYYFIESE++P+ DPLLLWLTGGPGCS 
Sbjct  35   SIVKFLPGFQGPLPFVLKTGYVGVGEQEDVQVFYYFIESERNPKEDPLLLWLTGGPGCSA  94

Query  282  LSAFFFEIGPLTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNT  461
            LS   +EIGP+        G +P+L L P +WTKV++IIF D PV TG++Y+ T      
Sbjct  95   LSGLVYEIGPIMFKKEYYNGSVPNLILRPASWTKVSSIIFADLPVSTGFTYATTESGAKR  154

Query  462  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  641
            +D +     + FL +WL++HP F +N +Y+AGDSYSGIT+P +V+ I  G E G++P++N
Sbjct  155  SDLIQVNQAHEFLRKWLVEHPKFQSNEIYIAGDSYSGITIPAIVQEIAQGNEKGLQPKIN  214

Query  642  MKG  650
            ++G
Sbjct  215  LQG  217



>ref|XP_008452662.1| PREDICTED: serine carboxypeptidase-like 13 [Cucumis melo]
Length=464

 Score =   214 bits (545),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 100/209 (48%), Positives = 142/209 (68%), Gaps = 11/209 (5%)
 Frame = +3

Query  24   FVVMASTFKIlastflllflaptflHAVVETLPGFPAKLPFKLHTGYIGVGESQEIQLFY  203
            ++++ S F+I+++            H  VE LPGFP +LPF+L TGY+GVG+ +E+QLFY
Sbjct  9    YILLVSVFQIISAAAS---------HWTVEFLPGFPGRLPFELETGYVGVGDLEEVQLFY  59

Query  204  YFIESEKSPETDPLLLWLTGGPGCSGLSAFFFEIGPLTINYANSTGDIPDLELNPYAWTK  383
            YF++SE +P+TDPLL WLTGGPGCS L+A  FE+GP+        G +P++ LNPY+WTK
Sbjct  60   YFVKSEGNPKTDPLLFWLTGGPGCSALTALAFEVGPINFKIKEYDGSLPEVILNPYSWTK  119

Query  384  VANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDS  563
             ++I+FVD PVGTG+SY  T  +  T D     H+  FL +WL+ HP FL+NP YV GDS
Sbjct  120  KSSILFVDLPVGTGFSYGTTPQSIKTGDFSQVHHSVQFLKKWLIRHPEFLSNPFYVGGDS  179

Query  564  YSGITVPLVVRNIYDGLESGIEPRLNMKG  650
            YSGI +P++ + I +  E+   P +N +G
Sbjct  180  YSGIVIPVIAQEILE--ENKHAPYINQQG  206



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1001432574250