BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF039M05

Length=609
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFU52654.1|  beta-1,3-glucanase 21                                   252   4e-78   Solanum tuberosum [potatoes]
ref|XP_006354142.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    253   9e-78   Solanum tuberosum [potatoes]
ref|XP_010316236.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      251   5e-77   Solanum lycopersicum
ref|XP_009631831.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      251   7e-77   
ref|XP_009778460.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      248   6e-76   Nicotiana sylvestris
gb|KDP42112.1|  hypothetical protein JCGZ_01900                         247   1e-75   Jatropha curcas
ref|XP_011025159.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    246   5e-75   Populus euphratica
ref|XP_002304004.2|  hypothetical protein POPTR_0003s21250g             242   1e-74   
emb|CAN72077.1|  hypothetical protein VITISV_020314                     244   2e-74   Vitis vinifera
ref|XP_008354983.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    244   3e-74   
ref|XP_010651369.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    243   3e-74   Vitis vinifera
ref|XP_009375652.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    243   6e-74   Pyrus x bretschneideri [bai li]
ref|XP_008229211.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      241   3e-73   Prunus mume [ume]
ref|XP_007205107.1|  hypothetical protein PRUPE_ppa004732mg             241   4e-73   Prunus persica
ref|XP_011087559.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    238   1e-72   
ref|XP_009364124.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    239   2e-72   Pyrus x bretschneideri [bai li]
ref|XP_011048218.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    239   2e-72   Populus euphratica
ref|XP_002297638.2|  hypothetical protein POPTR_0001s04360g             238   5e-72   
ref|XP_008384395.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    238   5e-72   
ref|XP_011087532.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    238   5e-72   Sesamum indicum [beniseed]
emb|CDP16794.1|  unnamed protein product                                236   4e-71   Coffea canephora [robusta coffee]
ref|XP_010276339.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    234   5e-71   Nelumbo nucifera [Indian lotus]
ref|XP_004504325.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    234   9e-71   Cicer arietinum [garbanzo]
ref|XP_010276332.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    234   1e-70   Nelumbo nucifera [Indian lotus]
ref|XP_008352033.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    233   2e-70   
gb|KJB23365.1|  hypothetical protein B456_004G094500                    233   2e-70   Gossypium raimondii
ref|XP_004294998.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      233   3e-70   Fragaria vesca subsp. vesca
ref|XP_007161273.1|  hypothetical protein PHAVU_001G056400g             233   5e-70   Phaseolus vulgaris [French bean]
gb|KHG18393.1|  hypothetical protein F383_22096                         232   9e-70   Gossypium arboreum [tree cotton]
ref|XP_003524953.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    232   1e-69   Glycine max [soybeans]
gb|KHN12071.1|  Glucan endo-1,3-beta-glucosidase 4                      232   1e-69   Glycine soja [wild soybean]
ref|XP_006601114.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    231   1e-69   Glycine max [soybeans]
ref|XP_010257592.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    231   2e-69   Nelumbo nucifera [Indian lotus]
ref|XP_006495278.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    228   2e-69   
ref|XP_006445640.1|  hypothetical protein CICLE_v10015028mg             229   1e-68   
ref|XP_003531243.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    229   1e-68   Glycine max [soybeans]
ref|XP_006596127.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    229   2e-68   Glycine max [soybeans]
ref|XP_010044948.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      228   2e-68   Eucalyptus grandis [rose gum]
ref|XP_006488904.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    228   4e-68   Citrus sinensis [apfelsine]
ref|XP_007014685.1|  O-Glycosyl hydrolases family 17 protein isof...    227   5e-68   
ref|XP_007159412.1|  hypothetical protein PHAVU_002G236300g             227   7e-68   Phaseolus vulgaris [French bean]
ref|XP_003629715.1|  Glucan endo-1,3-beta-glucosidase                   226   1e-67   Medicago truncatula
ref|XP_010097806.1|  Glucan endo-1,3-beta-glucosidase 4                 225   3e-67   Morus notabilis
gb|KJB66066.1|  hypothetical protein B456_010G126400                    225   3e-67   Gossypium raimondii
gb|AFK37243.1|  unknown                                                 224   6e-67   Medicago truncatula
ref|XP_010673492.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      223   2e-66   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004502208.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    223   2e-66   
ref|XP_004502207.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    221   2e-65   Cicer arietinum [garbanzo]
ref|XP_010673491.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    219   9e-65   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003601614.1|  Glucan endo-1,3-beta-glucosidase                   219   1e-64   Medicago truncatula
gb|KHG04722.1|  hypothetical protein F383_29074                         218   3e-64   Gossypium arboreum [tree cotton]
ref|XP_009413316.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    218   3e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406534.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    217   4e-64   
ref|XP_009406533.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    217   5e-64   
ref|XP_011093510.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    217   6e-64   Sesamum indicum [beniseed]
ref|XP_009406531.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    217   7e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004139073.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    215   2e-63   Cucumis sativus [cucumbers]
ref|XP_002532062.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    214   2e-63   
ref|XP_008450301.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    214   7e-63   Cucumis melo [Oriental melon]
ref|XP_008354986.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    212   3e-62   
gb|EMT26371.1|  Glucan endo-1,3-beta-glucosidase 4                      209   4e-62   
gb|EEC82319.1|  hypothetical protein OsI_26597                          213   4e-62   Oryza sativa Indica Group [Indian rice]
ref|NP_001060087.2|  Os07g0577300                                       212   5e-62   
ref|XP_006658732.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    210   7e-62   
ref|XP_010542461.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    211   9e-62   Tarenaya hassleriana [spider flower]
ref|XP_006828511.1|  hypothetical protein AMTR_s00060p00188740          211   1e-61   
gb|EEE67465.1|  hypothetical protein OsJ_24859                          211   2e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002884972.1|  glycosyl hydrolase family 17 protein               209   6e-61   
gb|EYU27069.1|  hypothetical protein MIMGU_mgv1a004989mg                209   8e-61   Erythranthe guttata [common monkey flower]
dbj|BAC83070.1|  putative elicitor inducible beta-1,3-glucanase         211   1e-60   Oryza sativa Japonica Group [Japonica rice]
dbj|BAH57260.1|  AT3G13560                                              207   1e-60   Arabidopsis thaliana [mouse-ear cress]
emb|CDY59252.1|  BnaA05g36990D                                          206   2e-60   Brassica napus [oilseed rape]
ref|XP_004958122.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    211   2e-60   
ref|XP_008789143.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    207   2e-60   Phoenix dactylifera
ref|XP_008789151.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    206   2e-60   
ref|XP_009388452.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    206   5e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008449819.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    207   5e-60   Cucumis melo [Oriental melon]
tpg|DAA63295.1|  TPA: putative O-Glycosyl hydrolase superfamily p...    206   5e-60   
ref|NP_187965.1|  glucan endo-1,3-beta-glucosidase 4                    207   5e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008449817.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    207   7e-60   Cucumis melo [Oriental melon]
ref|XP_008449814.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    206   8e-60   Cucumis melo [Oriental melon]
gb|EMS53703.1|  Glucan endo-1,3-beta-glucosidase 4                      205   1e-59   Triticum urartu
ref|XP_009146477.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      206   1e-59   Brassica rapa
ref|XP_010236492.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      205   1e-59   Brachypodium distachyon [annual false brome]
ref|XP_004142250.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    206   2e-59   
gb|KGN54064.1|  hypothetical protein Csa_4G280410                       206   2e-59   Cucumis sativus [cucumbers]
emb|CDY23618.1|  BnaC05g39760D                                          202   3e-59   Brassica napus [oilseed rape]
gb|EMS60322.1|  Glucan endo-1,3-beta-glucosidase 4                      207   3e-59   Triticum urartu
ref|XP_002460914.1|  hypothetical protein SORBIDRAFT_02g037380          204   4e-59   Sorghum bicolor [broomcorn]
ref|XP_010552278.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    204   4e-59   Tarenaya hassleriana [spider flower]
ref|XP_010934539.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      204   4e-59   Elaeis guineensis
ref|NP_001149308.1|  glucan endo-1,3-beta-glucosidase 4 precursor       203   7e-59   Zea mays [maize]
dbj|BAJ89950.1|  predicted protein                                      203   7e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006407197.1|  hypothetical protein EUTSA_v10020572mg             203   1e-58   Eutrema salsugineum [saltwater cress]
ref|XP_004162024.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    205   1e-58   
emb|CBI16509.3|  unnamed protein product                                204   1e-58   Vitis vinifera
ref|NP_001131285.1|  putative O-Glycosyl hydrolase superfamily pr...    202   1e-58   Zea mays [maize]
ref|XP_010465199.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      201   6e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010500722.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      201   6e-58   Camelina sativa [gold-of-pleasure]
gb|EPS57592.1|  hypothetical protein M569_17225                         194   6e-58   Genlisea aurea
ref|XP_009762818.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    200   2e-57   Nicotiana sylvestris
gb|KJB66065.1|  hypothetical protein B456_010G126400                    198   3e-57   Gossypium raimondii
gb|EMT28432.1|  Glucan endo-1,3-beta-glucosidase 4                      202   3e-57   
ref|XP_010527795.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      199   3e-57   Tarenaya hassleriana [spider flower]
ref|XP_010528550.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      198   6e-57   Tarenaya hassleriana [spider flower]
ref|XP_006297495.1|  hypothetical protein CARUB_v10013514mg             198   9e-57   Capsella rubella
ref|XP_006599427.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    196   1e-56   Glycine max [soybeans]
ref|XP_006599426.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    196   2e-56   Glycine max [soybeans]
ref|XP_009602434.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    197   2e-56   Nicotiana tomentosiformis
ref|XP_003548935.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    196   4e-56   Glycine max [soybeans]
ref|XP_010653417.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    195   7e-56   Vitis vinifera
gb|KEH40580.1|  glucan endo-1,3-beta-glucosidase-like protein           196   9e-56   Medicago truncatula
emb|CBI26850.3|  unnamed protein product                                195   9e-56   Vitis vinifera
gb|KEH40581.1|  glucan endo-1,3-beta-glucosidase-like protein           195   9e-56   Medicago truncatula
ref|XP_010653375.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    195   1e-55   Vitis vinifera
emb|CDP00829.1|  unnamed protein product                                195   1e-55   Coffea canephora [robusta coffee]
ref|XP_006858991.1|  hypothetical protein AMTR_s00068p00134210          194   4e-55   Amborella trichopoda
ref|XP_004236940.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      194   4e-55   Solanum lycopersicum
ref|XP_009388453.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    192   5e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011070588.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      193   5e-55   Sesamum indicum [beniseed]
ref|XP_006448191.1|  hypothetical protein CICLE_v10014990mg             193   7e-55   Citrus clementina [clementine]
gb|KHN00662.1|  Glucan endo-1,3-beta-glucosidase 3                      192   7e-55   Glycine soja [wild soybean]
ref|XP_003518194.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    192   9e-55   
ref|XP_007151812.1|  hypothetical protein PHAVU_004G077000g             192   2e-54   Phaseolus vulgaris [French bean]
ref|XP_010271297.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      192   2e-54   Nelumbo nucifera [Indian lotus]
ref|XP_011021800.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    192   2e-54   Populus euphratica
gb|AFU52641.1|  beta-1,3-glucanase 6                                    192   2e-54   Solanum tuberosum [potatoes]
ref|XP_011021799.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    191   2e-54   Populus euphratica
ref|XP_007045239.1|  O-Glycosyl hydrolases family 17 protein            191   2e-54   
ref|XP_006378439.1|  hypothetical protein POPTR_0010s11880g             190   3e-54   
gb|KDO64566.1|  hypothetical protein CISIN_1g0108331mg                  191   4e-54   Citrus sinensis [apfelsine]
ref|XP_006355069.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    191   4e-54   Solanum tuberosum [potatoes]
ref|XP_004498268.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    191   4e-54   Cicer arietinum [garbanzo]
ref|XP_007160410.1|  hypothetical protein PHAVU_002G319500g             187   5e-54   Phaseolus vulgaris [French bean]
ref|XP_004297451.2|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      191   6e-54   Fragaria vesca subsp. vesca
ref|XP_006378440.1|  hypothetical protein POPTR_0010s11880g             190   6e-54   
ref|XP_004159096.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    185   7e-54   
ref|XP_002314794.2|  hypothetical protein POPTR_0010s11880g             190   8e-54   Populus trichocarpa [western balsam poplar]
gb|KFK41053.1|  hypothetical protein AALP_AA2G079300                    190   8e-54   Arabis alpina [alpine rockcress]
gb|KJB30775.1|  hypothetical protein B456_005G159100                    189   2e-53   Gossypium raimondii
ref|XP_006372566.1|  glycosyl hydrolase family 17 family protein        189   2e-53   
gb|KJB15377.1|  hypothetical protein B456_002G174100                    187   2e-53   Gossypium raimondii
gb|KHG06295.1|  hypothetical protein F383_32557                         189   2e-53   Gossypium arboreum [tree cotton]
gb|KJB30776.1|  hypothetical protein B456_005G159100                    189   3e-53   Gossypium raimondii
ref|XP_007141916.1|  hypothetical protein PHAVU_008G236700g             189   3e-53   Phaseolus vulgaris [French bean]
ref|XP_010926119.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    189   3e-53   Elaeis guineensis
ref|XP_004288596.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      189   3e-53   Fragaria vesca subsp. vesca
ref|XP_008775310.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    187   4e-53   
ref|XP_011001568.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      188   5e-53   Populus euphratica
ref|XP_010267790.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    188   5e-53   Nelumbo nucifera [Indian lotus]
gb|KJB15376.1|  hypothetical protein B456_002G174100                    187   7e-53   Gossypium raimondii
gb|KHG27056.1|  hypothetical protein F383_08405                         188   7e-53   Gossypium arboreum [tree cotton]
ref|XP_007160409.1|  hypothetical protein PHAVU_002G319500g             187   8e-53   Phaseolus vulgaris [French bean]
ref|XP_008221445.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      187   9e-53   Prunus mume [ume]
ref|XP_008366987.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    187   1e-52   
gb|KHG27055.1|  hypothetical protein F383_08405                         188   1e-52   Gossypium arboreum [tree cotton]
ref|XP_002265396.3|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    187   1e-52   Vitis vinifera
ref|XP_008775304.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    187   1e-52   Phoenix dactylifera
gb|KDP25782.1|  hypothetical protein JCGZ_22504                         187   1e-52   Jatropha curcas
ref|XP_010066584.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    187   2e-52   Eucalyptus grandis [rose gum]
ref|XP_006575486.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    187   2e-52   Glycine max [soybeans]
ref|XP_010553889.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    187   2e-52   Tarenaya hassleriana [spider flower]
ref|XP_003519328.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    187   2e-52   Glycine max [soybeans]
ref|XP_002531922.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    187   2e-52   Ricinus communis
ref|XP_008777063.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    186   2e-52   Phoenix dactylifera
ref|XP_008777062.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    186   2e-52   Phoenix dactylifera
ref|XP_008777061.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    186   2e-52   Phoenix dactylifera
gb|EYU41109.1|  hypothetical protein MIMGU_mgv1a005128mg                186   3e-52   Erythranthe guttata [common monkey flower]
ref|XP_006596503.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    185   3e-52   
ref|XP_006430586.1|  hypothetical protein CICLE_v10011549mg             186   3e-52   Citrus clementina [clementine]
ref|XP_006482110.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    186   3e-52   Citrus sinensis [apfelsine]
ref|XP_006391369.1|  hypothetical protein EUTSA_v10018427mg             186   3e-52   Eutrema salsugineum [saltwater cress]
ref|XP_007215258.1|  hypothetical protein PRUPE_ppa004534mg             186   5e-52   Prunus persica
ref|XP_002305879.1|  glycosyl hydrolase family 17 family protein        185   5e-52   
ref|XP_003544983.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    185   5e-52   Glycine max [soybeans]
ref|XP_002527772.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    186   5e-52   
dbj|BAB01763.1|  beta-1,3-glucanase-like protein                        184   6e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009382992.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    186   7e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010108988.1|  Glucan endo-1,3-beta-glucosidase 2                 185   8e-52   Morus notabilis
ref|XP_008361481.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    185   9e-52   
ref|XP_004140301.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    185   9e-52   Cucumis sativus [cucumbers]
gb|KDP38099.1|  hypothetical protein JCGZ_04742                         185   9e-52   Jatropha curcas
ref|XP_009351539.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      184   1e-51   Pyrus x bretschneideri [bai li]
ref|XP_008460531.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    184   1e-51   Cucumis melo [Oriental melon]
ref|XP_003600716.1|  Glucan endo-1,3-beta-glucosidase                   184   1e-51   
gb|AES70967.2|  glucan endo-1,3-beta-glucosidase-like protein           184   1e-51   Medicago truncatula
ref|XP_004142367.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    184   1e-51   Cucumis sativus [cucumbers]
ref|XP_007032976.1|  Glucan endo-1,3-beta-glucosidase, putative i...    184   2e-51   
ref|XP_002887020.1|  glycosyl hydrolase family 17 protein               184   2e-51   Arabidopsis lyrata subsp. lyrata
ref|XP_011097437.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    184   2e-51   Sesamum indicum [beniseed]
gb|EPS61988.1|  hypothetical protein M569_12804                         182   3e-51   Genlisea aurea
ref|XP_007032975.1|  Glucan endo-1,3-beta-glucosidase, putative i...    183   4e-51   
emb|CDY58676.1|  BnaCnng33550D                                          183   5e-51   Brassica napus [oilseed rape]
ref|XP_010415170.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    183   5e-51   Camelina sativa [gold-of-pleasure]
ref|XP_011007238.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    182   6e-51   Populus euphratica
gb|EPS65983.1|  hypothetical protein M569_08793                         182   7e-51   Genlisea aurea
ref|XP_008452393.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    182   7e-51   Cucumis melo [Oriental melon]
ref|XP_010511554.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    182   7e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010470501.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    182   1e-50   Camelina sativa [gold-of-pleasure]
emb|CDY16440.1|  BnaA02g12440D                                          182   1e-50   Brassica napus [oilseed rape]
ref|XP_010470500.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    182   1e-50   Camelina sativa [gold-of-pleasure]
ref|XP_009127476.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    182   1e-50   Brassica rapa
ref|XP_008802448.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    181   2e-50   Phoenix dactylifera
ref|XP_010681923.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    181   3e-50   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY48807.1|  BnaC02g34070D                                          181   3e-50   Brassica napus [oilseed rape]
ref|XP_004503127.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    180   4e-50   Cicer arietinum [garbanzo]
ref|XP_007163382.1|  hypothetical protein PHAVU_001G230000g             180   4e-50   Phaseolus vulgaris [French bean]
ref|XP_004490818.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    179   4e-50   
gb|KCW69377.1|  hypothetical protein EUGRSUZ_F02860                     179   5e-50   Eucalyptus grandis [rose gum]
ref|XP_009129217.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      180   5e-50   Brassica rapa
gb|EMT05308.1|  Glucan endo-1,3-beta-glucosidase 3                      180   7e-50   
ref|XP_006395868.1|  hypothetical protein EUTSA_v10004013mg             178   7e-50   
ref|XP_004490817.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    179   8e-50   Cicer arietinum [garbanzo]
ref|XP_010062264.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      179   8e-50   Eucalyptus grandis [rose gum]
ref|XP_010670126.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    179   1e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010651370.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    178   1e-49   
gb|KJB10513.1|  hypothetical protein B456_001G204900                    180   1e-49   Gossypium raimondii
gb|EYU45799.1|  hypothetical protein MIMGU_mgv1a004953mg                179   2e-49   Erythranthe guttata [common monkey flower]
gb|KHG17836.1|  hypothetical protein F383_07126                         179   2e-49   Gossypium arboreum [tree cotton]
gb|KJB10512.1|  hypothetical protein B456_001G204900                    180   2e-49   Gossypium raimondii
ref|XP_006395869.1|  hypothetical protein EUTSA_v10004013mg             178   2e-49   
ref|XP_006364623.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    178   2e-49   Solanum tuberosum [potatoes]
ref|NP_001275288.1|  glucan endo-1,3-beta-glucosidase 2-like prec...    178   2e-49   Solanum tuberosum [potatoes]
ref|XP_006293165.1|  hypothetical protein CARUB_v10019481mg             178   2e-49   Capsella rubella
ref|NP_176799.2|  glucan endo-1,3-beta-glucosidase 2                    178   3e-49   Arabidopsis thaliana [mouse-ear cress]
gb|ABI93926.1|  At1g66250                                               178   3e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876767.1|  hypothetical protein ARALYDRAFT_484077             178   3e-49   
ref|XP_003558472.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      177   4e-49   Brachypodium distachyon [annual false brome]
ref|XP_006395867.1|  hypothetical protein EUTSA_v10004013mg             178   4e-49   Eutrema salsugineum [saltwater cress]
gb|EMS47617.1|  Glucan endo-1,3-beta-glucosidase 3                      178   4e-49   Triticum urartu
gb|EPS74061.1|  hypothetical protein M569_00697                         176   6e-49   Genlisea aurea
gb|ACN30650.1|  unknown                                                 177   7e-49   Zea mays [maize]
ref|NP_001077866.1|  glucan endo-1,3-beta-glucosidase 3                 174   8e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009390355.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    177   9e-49   
ref|XP_006855931.1|  hypothetical protein AMTR_s00037p00209440          176   9e-49   
ref|XP_010324460.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    177   9e-49   Solanum lycopersicum
ref|XP_004244387.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    177   9e-49   Solanum lycopersicum
ref|XP_002468258.1|  hypothetical protein SORBIDRAFT_01g042560          177   1e-48   Sorghum bicolor [broomcorn]
ref|NP_001150141.1|  glucan endo-1,3-beta-glucosidase 3 precursor       177   1e-48   
ref|XP_006300850.1|  hypothetical protein CARUB_v10019942mg             178   1e-48   
gb|AAK85402.2|  beta-1,3-glucanase                                      176   1e-48   Camellia sinensis [black tea]
ref|XP_003538392.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    176   2e-48   Glycine max [soybeans]
gb|KHN17951.1|  Glucan endo-1,3-beta-glucosidase 2                      176   2e-48   Glycine soja [wild soybean]
ref|XP_011096055.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      176   3e-48   Sesamum indicum [beniseed]
ref|XP_010686818.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      176   3e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001130376.1|  putative O-Glycosyl hydrolase superfamily pr...    175   3e-48   Zea mays [maize]
ref|NP_001049413.1|  Os03g0221500                                       175   4e-48   
ref|XP_009593892.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      175   4e-48   Nicotiana tomentosiformis
ref|XP_006580439.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    175   4e-48   Glycine max [soybeans]
gb|AIR93909.1|  glucanase                                               174   4e-48   Cicer arietinum [garbanzo]
ref|XP_010424935.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      175   5e-48   Camelina sativa [gold-of-pleasure]
ref|NP_565269.1|  glucan endo-1,3-beta-glucosidase 3                    175   5e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009772723.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      175   5e-48   Nicotiana sylvestris
ref|XP_010513892.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    174   6e-48   Camelina sativa [gold-of-pleasure]
ref|XP_006649652.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    175   6e-48   Oryza brachyantha
ref|XP_006602009.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    173   8e-48   Glycine max [soybeans]
ref|XP_010502143.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    174   8e-48   Camelina sativa [gold-of-pleasure]
ref|XP_011008030.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    175   8e-48   Populus euphratica
ref|XP_004503372.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    174   8e-48   Cicer arietinum [garbanzo]
emb|CDP01635.1|  unnamed protein product                                173   1e-47   Coffea canephora [robusta coffee]
gb|KHN32747.1|  Glucan endo-1,3-beta-glucosidase 3                      173   2e-47   Glycine soja [wild soybean]
ref|XP_003552878.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    173   2e-47   Glycine max [soybeans]
ref|XP_010916186.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    173   2e-47   
ref|NP_172647.2|  O-glycosyl hydrolases family 17 protein               171   2e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011021801.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    172   2e-47   Populus euphratica
gb|KDO78272.1|  hypothetical protein CISIN_1g010394mg                   173   3e-47   Citrus sinensis [apfelsine]
ref|XP_011023920.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    172   3e-47   Populus euphratica
ref|XP_011023912.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    172   3e-47   Populus euphratica
emb|CAN82488.1|  hypothetical protein VITISV_006804                     172   4e-47   Vitis vinifera
ref|XP_006348130.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    173   4e-47   Solanum tuberosum [potatoes]
gb|AAC17632.1|  Similar to glucan endo-1,3-beta-D-glucosidase pre...    171   8e-47   Arabidopsis thaliana [mouse-ear cress]
gb|KHN07542.1|  Glucan endo-1,3-beta-glucosidase 2                      171   8e-47   Glycine soja [wild soybean]
ref|XP_006389594.1|  hypothetical protein POPTR_0021s00450g             172   9e-47   Populus trichocarpa [western balsam poplar]
ref|XP_007211541.1|  hypothetical protein PRUPE_ppa003984mg             172   1e-46   
ref|XP_007026106.1|  O-Glycosyl hydrolases family 17 protein            171   1e-46   Theobroma cacao [chocolate]
ref|XP_008224690.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      172   1e-46   Prunus mume [ume]
ref|XP_004232702.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      171   1e-46   Solanum lycopersicum
ref|NP_001184967.1|  O-glycosyl hydrolases family 17 protein            171   1e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003616282.1|  Glucan endo-1,3-beta-glucosidase                   172   2e-46   
ref|XP_002892658.1|  predicted protein                                  170   2e-46   
gb|KHN35732.1|  Glucan endo-1,3-beta-glucosidase 1                      171   2e-46   
ref|XP_003529639.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    171   2e-46   
ref|XP_010100650.1|  Glucan endo-1,3-beta-glucosidase 3                 170   2e-46   
ref|XP_006584084.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    171   2e-46   
ref|XP_002967282.1|  hypothetical protein SELMODRAFT_87871              169   2e-46   
gb|EYU27773.1|  hypothetical protein MIMGU_mgv1a006342mg                169   2e-46   
ref|XP_003610449.1|  Glucan endo-1,3-beta-glucosidase                   171   3e-46   
ref|XP_009792881.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    170   3e-46   
ref|XP_008365635.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    171   4e-46   
gb|KDP20735.1|  hypothetical protein JCGZ_21206                         170   4e-46   
ref|XP_009359235.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    170   4e-46   
ref|XP_002960438.1|  hypothetical protein SELMODRAFT_75479              168   5e-46   
ref|XP_010052862.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    168   6e-46   
ref|XP_010476119.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    169   7e-46   
ref|XP_010476120.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    169   7e-46   
ref|XP_006467418.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    169   7e-46   
ref|XP_010493346.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      169   7e-46   
gb|KFK43454.1|  hypothetical protein AALP_AA1G127200                    169   8e-46   
ref|XP_009357466.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    169   9e-46   
ref|XP_006600304.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    168   1e-45   
ref|XP_009110702.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      169   1e-45   
gb|KJB57758.1|  hypothetical protein B456_009G179400                    168   1e-45   
ref|XP_002973118.1|  hypothetical protein SELMODRAFT_442025             168   1e-45   
ref|XP_003549783.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    169   1e-45   
ref|XP_010458589.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    168   2e-45   
ref|XP_010546762.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      168   2e-45   
ref|XP_010458588.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    168   2e-45   
gb|KJB57757.1|  hypothetical protein B456_009G179400                    167   2e-45   
ref|XP_010052861.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    168   2e-45   
ref|XP_010458590.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    168   2e-45   
gb|KHG03844.1|  hypothetical protein F383_07460                         168   2e-45   
gb|KJB57756.1|  hypothetical protein B456_009G179400                    168   2e-45   
ref|XP_008384081.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    168   3e-45   
ref|XP_007225735.1|  hypothetical protein PRUPE_ppa005356mg             167   3e-45   
ref|XP_009589694.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    167   3e-45   
emb|CDP04414.1|  unnamed protein product                                171   4e-45   
gb|KJB15378.1|  hypothetical protein B456_002G174100                    166   5e-45   
ref|XP_002976593.1|  hypothetical protein SELMODRAFT_443280             166   6e-45   
ref|XP_008460530.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    166   7e-45   
ref|XP_006417308.1|  hypothetical protein EUTSA_v10006713mg             170   8e-45   
ref|XP_004295275.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    166   8e-45   
ref|XP_011459999.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    166   9e-45   
ref|XP_010244498.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    166   9e-45   
ref|XP_010244497.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    166   9e-45   
gb|KJB22745.1|  hypothetical protein B456_004G064200                    166   1e-44   
emb|CBI23232.3|  unnamed protein product                                169   2e-44   
ref|XP_010278646.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    166   2e-44   
ref|XP_003632942.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      165   2e-44   
ref|XP_010278647.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    165   2e-44   
ref|XP_007153962.1|  hypothetical protein PHAVU_003G079900g             165   3e-44   
emb|CDY31214.1|  BnaC08g15090D                                          164   4e-44   
gb|KHG14816.1|  hypothetical protein F383_17797                         164   4e-44   
ref|XP_010057914.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    165   4e-44   
ref|XP_011046950.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      164   4e-44   
ref|XP_006306488.1|  hypothetical protein CARUB_v10012467mg             167   6e-44   
ref|XP_002518468.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    164   8e-44   
ref|XP_010553447.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    164   9e-44   
ref|XP_010553445.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    164   1e-43   
ref|XP_010094029.1|  Glucan endo-1,3-beta-glucosidase 1                 162   2e-43   
ref|XP_008452394.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    162   2e-43   
ref|XP_004507681.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    162   5e-43   
ref|XP_004486169.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    160   9e-43   
gb|AIR93901.1|  glucanase                                               160   1e-42   
ref|XP_009127478.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    159   1e-42   
ref|XP_010324461.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    158   4e-42   
gb|ACF80565.1|  unknown                                                 158   4e-42   
ref|XP_004158003.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    158   1e-41   
ref|XP_004145115.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    158   1e-41   
gb|AAG51762.1|AC066691_2  beta-1,3-glucanase precursor, putative;...    156   1e-41   
ref|XP_006584862.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    157   1e-41   
ref|XP_003532507.2|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    157   1e-41   
ref|XP_008440948.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      157   2e-41   
ref|XP_010916187.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    155   5e-41   
ref|XP_002312452.2|  glucan endo-1 family protein                       155   5e-41   
gb|KHN21581.1|  Glucan endo-1,3-beta-glucosidase 3                      154   1e-40   
gb|KEH28239.1|  glucan endo-1,3-beta-glucosidase-like protein           155   2e-40   
ref|XP_009792882.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    152   1e-39   
gb|ACF87545.1|  unknown                                                 151   1e-39   
ref|XP_002962275.1|  hypothetical protein SELMODRAFT_76256              144   3e-37   
ref|XP_002965189.1|  hypothetical protein SELMODRAFT_82513              142   2e-36   
ref|XP_006383906.1|  hypothetical protein POPTR_0004s01110g             140   1e-35   
ref|XP_010553446.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   2e-35   
ref|XP_010059559.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    140   2e-35   
ref|XP_010681924.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   3e-35   
gb|KHN16561.1|  Glucan endo-1,3-beta-glucosidase 3                      137   2e-34   
ref|XP_002961242.1|  hypothetical protein SELMODRAFT_402967             137   2e-34   
ref|XP_002969476.1|  hypothetical protein SELMODRAFT_231287             137   2e-34   
ref|XP_001751439.1|  predicted protein                                  136   4e-34   
ref|XP_006584863.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    136   5e-34   
ref|XP_002962313.1|  hypothetical protein SELMODRAFT_438073             135   1e-33   
ref|XP_002965231.1|  hypothetical protein SELMODRAFT_439107             134   3e-33   
ref|XP_010923877.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    134   4e-33   
ref|XP_007147720.1|  hypothetical protein PHAVU_006G149100g             134   5e-33   
ref|XP_007147719.1|  hypothetical protein PHAVU_006G149100g             134   5e-33   
ref|XP_002974888.1|  hypothetical protein SELMODRAFT_102117             133   6e-33   
ref|XP_010923875.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    133   7e-33   
gb|AIK66527.1|  beta-1,3-glucanase                                      125   8e-33   
ref|XP_009397776.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   1e-32   
ref|XP_002963799.1|  hypothetical protein SELMODRAFT_79527              132   1e-32   
ref|XP_001767901.1|  predicted protein                                  131   2e-32   
dbj|BAF01341.1|  putative beta-1,3-glucanase                            125   5e-31   
gb|KJB10702.1|  hypothetical protein B456_001G216900                    127   6e-31   
ref|XP_010467085.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    127   7e-31   
gb|KJB10701.1|  hypothetical protein B456_001G216900                    127   7e-31   
ref|XP_009414127.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    127   8e-31   
ref|XP_010488778.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    127   8e-31   
ref|XP_010448205.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    127   8e-31   
ref|XP_001772420.1|  predicted protein                                  127   1e-30   
ref|XP_007141644.1|  hypothetical protein PHAVU_008G213400g             126   1e-30   
ref|XP_006283767.1|  hypothetical protein CARUB_v10004853mg             126   1e-30   
ref|XP_010412737.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    126   2e-30   
gb|KHG05496.1|  hypothetical protein F383_30989                         126   2e-30   
ref|XP_006853717.1|  hypothetical protein AMTR_s00056p00158530          127   2e-30   
ref|XP_009102359.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     126   2e-30   
emb|CDY18049.1|  BnaC07g04210D                                          126   2e-30   
ref|XP_006396136.1|  hypothetical protein EUTSA_v10002515mg             126   2e-30   
emb|CDY56498.1|  BnaAnng14330D                                          125   3e-30   
gb|ACN39797.1|  unknown                                                 125   3e-30   
gb|AAD26909.1|  putative beta-1,3-glucanase                             125   4e-30   
ref|NP_178637.2|  O-glycosyl hydrolases family 17 protein               125   5e-30   
ref|XP_007049174.1|  O-Glycosyl hydrolases family 17 protein isof...    125   6e-30   
ref|XP_007049173.1|  O-Glycosyl hydrolases family 17 protein isof...    125   8e-30   
ref|XP_007209175.1|  hypothetical protein PRUPE_ppa006239mg             124   8e-30   
ref|XP_002883709.1|  hypothetical protein ARALYDRAFT_480193             124   1e-29   
ref|XP_008245888.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    124   1e-29   
ref|XP_007209174.1|  hypothetical protein PRUPE_ppa006239mg             123   1e-29   
ref|XP_010438690.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    124   1e-29   
ref|XP_001784088.1|  predicted protein                                  124   1e-29   
ref|XP_010252551.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    124   1e-29   
ref|XP_010433433.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    123   2e-29   
ref|XP_009344063.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    122   2e-29   
ref|XP_009344064.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    122   2e-29   
gb|KDO36784.1|  hypothetical protein CISIN_1g009301mg                   123   3e-29   
gb|AAD10386.1|  beta-1,3-glucanase precursor                            122   3e-29   
gb|AES71661.2|  glycoside hydrolase family 17 protein                   122   3e-29   
gb|AFK41861.1|  unknown                                                 122   3e-29   
ref|XP_006447645.1|  hypothetical protein CICLE_v10015086mg             122   3e-29   
ref|XP_006469612.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    123   4e-29   
ref|XP_001780506.1|  predicted protein                                  121   5e-29   
ref|NP_001048260.1|  Os02g0771700                                       122   5e-29   
ref|XP_006297583.1|  hypothetical protein CARUB_v10013604mg             122   5e-29   
ref|XP_002967643.1|  hypothetical protein SELMODRAFT_88150              120   5e-29   
ref|XP_006647977.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    122   6e-29   
ref|XP_003601410.1|  Glucan endo-1,3-beta-glucosidase                   122   6e-29   
gb|KHN44765.1|  Glucan endo-1,3-beta-glucosidase 11                     121   6e-29   
ref|XP_002274828.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     121   7e-29   
ref|XP_010541008.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     122   8e-29   
ref|XP_002964390.1|  hypothetical protein SELMODRAFT_82448              120   8e-29   
ref|XP_008352157.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    121   9e-29   
ref|XP_008374135.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    121   9e-29   
gb|KFK29190.1|  hypothetical protein AALP_AA7G101400                    121   9e-29   
ref|XP_008449478.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     121   1e-28   
dbj|BAD93486.1|  pollen allergen CJP38                                  120   1e-28   
ref|XP_006575581.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    121   1e-28   
ref|XP_006595830.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    121   1e-28   
ref|XP_009128829.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     121   1e-28   
gb|EPS60410.1|  hypothetical protein M569_14393                         120   1e-28   
ref|XP_010557676.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     120   1e-28   
ref|XP_010236896.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    120   1e-28   
emb|CDY06818.1|  BnaC01g09170D                                          120   2e-28   
gb|KFK29497.1|  hypothetical protein AALP_AA7G142000                    121   2e-28   
ref|XP_011081364.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     120   2e-28   
ref|XP_009360206.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    120   2e-28   
ref|XP_006837267.1|  hypothetical protein AMTR_s00112p00108890          120   2e-28   
gb|AIR93910.1|  glucanase                                               120   2e-28   
gb|AFS50099.1|  glucan endo-1,3-beta-glucosidase                        120   2e-28   
dbj|BAC83956.1|  putative beta-1,3-glucanase                            120   2e-28   
ref|XP_004513066.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    120   2e-28   
gb|EEC82125.1|  hypothetical protein OsI_26155                          120   3e-28   
ref|XP_006285688.1|  hypothetical protein CARUB_v10007158mg             120   3e-28   
emb|CDY12009.1|  BnaC03g14350D                                          119   3e-28   
ref|XP_011070401.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    119   3e-28   
emb|CDY62033.1|  BnaC03g77660D                                          120   3e-28   
ref|XP_006580483.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     120   3e-28   
gb|KHM99816.1|  Glucan endo-1,3-beta-glucosidase 13                     119   3e-28   
ref|XP_010909020.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    119   4e-28   
gb|KDO62115.1|  hypothetical protein CISIN_1g0115512mg                  119   4e-28   
emb|CBI28222.3|  unnamed protein product                                118   4e-28   
ref|XP_006413135.1|  hypothetical protein EUTSA_v10026799mg             119   4e-28   
ref|XP_010924450.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     119   4e-28   
ref|NP_001059752.1|  Os07g0510200                                       120   4e-28   
ref|XP_004502047.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    118   5e-28   
gb|KHN16652.1|  Glucan endo-1,3-beta-glucosidase 13                     119   5e-28   
gb|AFU52665.1|  putative PD beta-1,3-glucanase 1                        119   5e-28   
gb|KDO62116.1|  hypothetical protein CISIN_1g0115512mg                  119   5e-28   
gb|KHG29271.1|  hypothetical protein F383_14120                         120   5e-28   
gb|KDO62114.1|  hypothetical protein CISIN_1g0115512mg                  119   5e-28   
ref|XP_004252615.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    119   6e-28   
ref|XP_007039345.1|  Glucan endo-1,3-beta-glucosidase 11 isoform 3      119   6e-28   
ref|XP_002282272.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     118   6e-28   
ref|XP_007039344.1|  Glucan endo-1,3-beta-glucosidase 11 isoform 2      118   6e-28   
gb|KDP30806.1|  hypothetical protein JCGZ_13749                         119   6e-28   
gb|ABK24695.1|  unknown                                                 119   7e-28   
ref|XP_007039348.1|  Glucan endo-1,3-beta-glucosidase 11 isoform 6      118   7e-28   
ref|XP_007039346.1|  Glucan endo-1,3-beta-glucosidase 11 isoform 4      118   7e-28   
ref|XP_007039343.1|  Glucan endo-1,3-beta-glucosidase 11 isoform 1      118   7e-28   
ref|XP_010244978.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 14     118   8e-28   
gb|KHG26459.1|  hypothetical protein F383_04538                         119   8e-28   
ref|XP_006360726.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    118   9e-28   
ref|XP_001761806.1|  predicted protein                                  118   9e-28   
gb|EPS73640.1|  hypothetical protein M569_01113                         119   9e-28   
ref|XP_001759996.1|  predicted protein                                  117   9e-28   
ref|XP_002964439.1|  hypothetical protein SELMODRAFT_230318             117   9e-28   
gb|ABR16583.1|  unknown                                                 118   9e-28   
ref|XP_002525335.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    118   1e-27   
ref|XP_004491103.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    118   1e-27   
ref|XP_010928243.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    118   1e-27   
gb|KJB27173.1|  hypothetical protein B456_004G282300                    118   1e-27   
dbj|BAJ87688.1|  predicted protein                                      118   1e-27   
ref|XP_004491104.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    118   1e-27   
ref|XP_009622831.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     117   1e-27   
emb|CDY14214.1|  BnaA08g13450D                                          118   1e-27   
ref|XP_006401482.1|  hypothetical protein EUTSA_v10013478mg             118   1e-27   
gb|KJB27172.1|  hypothetical protein B456_004G282300                    118   1e-27   
ref|XP_011470886.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    117   1e-27   
ref|XP_010913393.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    118   1e-27   
ref|XP_004309523.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    117   2e-27   
ref|XP_009778930.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     117   2e-27   
ref|XP_008805608.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    118   2e-27   
gb|AAF31288.1|AC006424_17  CDS                                          117   2e-27   



>gb|AFU52654.1| beta-1,3-glucanase 21 [Solanum tuberosum]
Length=443

 Score =   252 bits (644),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N +GAFVGINIGTDV+NLP A DVV LLKARQI H RLF+ADAHML AL+NT IEVI+GV
Sbjct  22   NVIGAFVGINIGTDVTNLPPASDVVALLKARQITHVRLFNADAHMLKALANTSIEVIIGV  81

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
            TN EVLGIG+S S AAAWVN+NVAAY+P TNITAIAVGSEVLT+IPNAAPVLVPAMNYLH
Sbjct  82   TNEEVLGIGESPSTAAAWVNRNVAAYMPGTNITAIAVGSEVLTAIPNAAPVLVPAMNYLH  141

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            KALV++ LN+QVKVSTPQS D+IAK FPPSTA F
Sbjct  142  KALVASRLNNQVKVSTPQSMDVIAKAFPPSTATF  175



>ref|XP_006354142.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Solanum tuberosum]
Length=501

 Score =   253 bits (646),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N +GAFVGINIGTDV+NLP A DVV LLKARQI H RLF+ADAHML+AL+NT IEVI+GV
Sbjct  22   NVIGAFVGINIGTDVTNLPPASDVVALLKARQITHVRLFNADAHMLNALANTSIEVIIGV  81

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
            TN EVLGIG+S S AAAWVN+NVAAY+P TNITAIAVGSEVLT+IPNAAPVLVPAMNYLH
Sbjct  82   TNEEVLGIGESPSTAAAWVNRNVAAYMPGTNITAIAVGSEVLTAIPNAAPVLVPAMNYLH  141

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            KALV++ LN+QVKVSTPQS D+IAK FPPSTA F
Sbjct  142  KALVASRLNNQVKVSTPQSMDVIAKAFPPSTATF  175



>ref|XP_010316236.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Solanum lycopersicum]
 ref|XP_010316237.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Solanum lycopersicum]
Length=501

 Score =   251 bits (641),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N +GAFVG+NIGTDV+NLP A DVV LLKARQI H RLF+ADAHML+AL+NT IEVI+GV
Sbjct  22   NLIGAFVGVNIGTDVTNLPPASDVVALLKARQITHVRLFNADAHMLNALANTSIEVIIGV  81

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
            TN EVLGIG+S S AAAWVN+NVAAY+P TNITAIAVGSEVLT+IPNAAPVLVPA+NYLH
Sbjct  82   TNEEVLGIGESPSTAAAWVNRNVAAYMPGTNITAIAVGSEVLTAIPNAAPVLVPALNYLH  141

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            KALV++ LN+QVKVSTPQS D+IAK FPPSTA F
Sbjct  142  KALVASRLNNQVKVSTPQSMDVIAKAFPPSTATF  175



>ref|XP_009631831.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana tomentosiformis]
 ref|XP_009631832.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana tomentosiformis]
 ref|XP_009631833.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana tomentosiformis]
 ref|XP_009631834.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana tomentosiformis]
 ref|XP_009631835.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana tomentosiformis]
 ref|XP_009631836.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana tomentosiformis]
Length=499

 Score =   251 bits (640),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N +GAFVGINIGTDVSNLP A DVV LLKA QI H RLF+ADAHML+AL+N+ IEV++GV
Sbjct  22   NVIGAFVGINIGTDVSNLPPASDVVALLKANQITHVRLFNADAHMLNALANSSIEVVIGV  81

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
            TN+EVLGIG+S S AAAWVNKNVAAY+PSTNITAIAVGSEVLT+IPNAAPVLVPAMNYLH
Sbjct  82   TNDEVLGIGESPSAAAAWVNKNVAAYIPSTNITAIAVGSEVLTAIPNAAPVLVPAMNYLH  141

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            KALV++ LN+QVKVSTPQS D+IA+ FPPSTA F
Sbjct  142  KALVASQLNNQVKVSTPQSMDVIARAFPPSTATF  175



>ref|XP_009778460.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana sylvestris]
 ref|XP_009778461.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana sylvestris]
 ref|XP_009778462.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana sylvestris]
 ref|XP_009778463.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana sylvestris]
 ref|XP_009778464.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana sylvestris]
 ref|XP_009778465.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana sylvestris]
Length=496

 Score =   248 bits (633),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N  GAFVGINIGTDVSNLP A DVV LLK  QI H RLF+ADAHML+AL+N+ IEVI+GV
Sbjct  19   NVTGAFVGINIGTDVSNLPPASDVVALLKVNQITHVRLFNADAHMLNALANSSIEVIIGV  78

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
            TN+EVLGIG+S S AAAWVNKNVAAY+PSTNITAIAVGSEVLT+IPNAAPVLVPAMNYLH
Sbjct  79   TNDEVLGIGESPSAAAAWVNKNVAAYMPSTNITAIAVGSEVLTAIPNAAPVLVPAMNYLH  138

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            KALV++ LN QVKVSTPQS D+IA+ FPPSTA F
Sbjct  139  KALVASQLNHQVKVSTPQSMDVIARAFPPSTATF  172



>gb|KDP42112.1| hypothetical protein JCGZ_01900 [Jatropha curcas]
Length=496

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = +1

Query  139  VGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTN  318
            +GAFVGINIGTDVSNLP A D+V +LKA QI H RLFDADAHML AL+N+GIEV+VGVTN
Sbjct  22   IGAFVGINIGTDVSNLPPASDIVAILKANQITHVRLFDADAHMLKALANSGIEVMVGVTN  81

Query  319  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  498
             EVLGIG+S + AAAWVNKNV +YLP+TNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA
Sbjct  82   EEVLGIGESPATAAAWVNKNVNSYLPATNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  141

Query  499  LVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            LV++NLN QVKVSTPQS D+I + FPPSTA F
Sbjct  142  LVASNLNFQVKVSTPQSMDVIPRPFPPSTATF  173



>ref|XP_011025159.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011025160.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011025161.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011025162.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
Length=493

 Score =   246 bits (627),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GAFVGINIGTDVSN+PSA DVV +LKA QI H RL+DADAHML AL+++GIEV+VGVTN 
Sbjct  19   GAFVGINIGTDVSNMPSAPDVVAMLKANQITHVRLYDADAHMLKALADSGIEVMVGVTNE  78

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            E+LGIG+S+S+AAAW+N+NVAAYLPSTNITAIAVGSEVLT+IPN  PVLVPAMNYLHKAL
Sbjct  79   EILGIGESASKAAAWINQNVAAYLPSTNITAIAVGSEVLTTIPNVVPVLVPAMNYLHKAL  138

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            V++NLN QVKVSTPQ+ D+I K FPPSTA F
Sbjct  139  VASNLNFQVKVSTPQAMDVIPKPFPPSTATF  169



>ref|XP_002304004.2| hypothetical protein POPTR_0003s21250g [Populus trichocarpa]
 gb|EEE78983.2| hypothetical protein POPTR_0003s21250g [Populus trichocarpa]
Length=412

 Score =   242 bits (618),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GAFVGINIGTDVSN+PSA DVV +LK  QI H RL+DADAHML AL+++GIEV+VGVTN 
Sbjct  19   GAFVGINIGTDVSNMPSAPDVVAILKTNQITHVRLYDADAHMLKALADSGIEVMVGVTNE  78

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            E+LGIG+S+S+AAAW+N+NVAAYLPSTNITAIAVGSEVLT+IPN  PVLVPAMNYLHKAL
Sbjct  79   EILGIGESASKAAAWINQNVAAYLPSTNITAIAVGSEVLTTIPNVVPVLVPAMNYLHKAL  138

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            V++NLN QVKVSTPQ+ D+I + FPPSTA F
Sbjct  139  VASNLNFQVKVSTPQAMDVIPRPFPPSTATF  169



>emb|CAN72077.1| hypothetical protein VITISV_020314 [Vitis vinifera]
Length=473

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N +GAFVG+NIGTDVSNLPSA  +V +LKA QI H RL+DADAHML+AL+NTGIEV+VGV
Sbjct  20   NALGAFVGVNIGTDVSNLPSASVLVGILKAHQITHVRLYDADAHMLNALANTGIEVVVGV  79

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
            TN EVLGIGQS S AA W+N+NVAAY+PSTNITAIAVGSEVLTSIP+AAPVLVPAMNYLH
Sbjct  80   TNEEVLGIGQSPSTAATWINRNVAAYVPSTNITAIAVGSEVLTSIPHAAPVLVPAMNYLH  139

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            KALV++NLN Q+KVS PQS D+I + FPPSTA F
Sbjct  140  KALVASNLNFQIKVSAPQSLDIIPRPFPPSTATF  173



>ref|XP_008354983.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Malus domestica]
 ref|XP_008354984.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Malus domestica]
 ref|XP_008354985.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Malus domestica]
Length=494

 Score =   244 bits (622),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N +G+F+GINIGTDVS+LPS  D V LLKA QI H RL++ADAHML ALSN+GIEV+VGV
Sbjct  20   NVLGSFIGINIGTDVSDLPSETDTVALLKAHQITHVRLYNADAHMLKALSNSGIEVMVGV  79

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
            TN EVLGIG+S+S AAAW+NKNVAAYLPSTNITAIAVGSEV+T+IPNAAPVLV AMNYLH
Sbjct  80   TNEEVLGIGESASAAAAWINKNVAAYLPSTNITAIAVGSEVITTIPNAAPVLVSAMNYLH  139

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            KALV++NLN Q+KVSTPQS D+I K FPPSTA F
Sbjct  140  KALVASNLNFQIKVSTPQSMDIIPKPFPPSTATF  173



>ref|XP_010651369.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Vitis 
vinifera]
Length=494

 Score =   243 bits (621),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N +GAFVG+NIGTDVSNLPSA  +V +LKA QI H RL+DADAHML+AL+NTGIEV+VGV
Sbjct  20   NALGAFVGVNIGTDVSNLPSASVLVGILKAHQITHVRLYDADAHMLNALANTGIEVVVGV  79

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
            TN EVLGIGQS S AA W+N+NVAAY+PSTNITAIAVGSEVLTSIP+AAPVLVPAMNYLH
Sbjct  80   TNEEVLGIGQSPSTAATWINRNVAAYVPSTNITAIAVGSEVLTSIPHAAPVLVPAMNYLH  139

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            KALV++NLN Q+KVS PQS D+I + FPPSTA F
Sbjct  140  KALVASNLNFQIKVSAPQSLDIIPRPFPPSTATF  173



>ref|XP_009375652.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Pyrus x bretschneideri]
 ref|XP_009375659.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Pyrus x bretschneideri]
Length=494

 Score =   243 bits (619),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N +G+F+GINIGTDVS+LPS  D V LLKA QI H RL++ADAHML ALSN+GIEV+VGV
Sbjct  20   NVLGSFIGINIGTDVSDLPSETDTVALLKAHQITHVRLYNADAHMLKALSNSGIEVMVGV  79

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
            TN EVLGIG+S+S AAAW+NKNVAAYLPSTNITAIAVGSEV+T+IPNAAPVLV AMNYLH
Sbjct  80   TNEEVLGIGESASVAAAWINKNVAAYLPSTNITAIAVGSEVITTIPNAAPVLVSAMNYLH  139

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            KALV++NLN Q+KVSTPQS D+I K FPPSTA F
Sbjct  140  KALVASNLNFQIKVSTPQSMDIIPKPFPPSTATF  173



>ref|XP_008229211.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Prunus mume]
 ref|XP_008229885.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Prunus mume]
 ref|XP_008230593.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Prunus mume]
Length=494

 Score =   241 bits (615),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +1

Query  139  VGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTN  318
            +GAF+GINIGTDVS+LPS  D V LLKA QI H RL++AD HML ALSN+GIEV+VGVTN
Sbjct  22   LGAFIGINIGTDVSDLPSETDTVALLKAHQISHVRLYNADTHMLKALSNSGIEVMVGVTN  81

Query  319  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  498
             E+LGIGQS S AAAW+NKNVAAYLPSTNITAIAVGSEVLTSIP+AAPVLV AMN LHKA
Sbjct  82   EEILGIGQSPSTAAAWINKNVAAYLPSTNITAIAVGSEVLTSIPHAAPVLVSAMNSLHKA  141

Query  499  LVSANLNSQVKVSTPQSTDLIAKIFPPSTAHFQL  600
            LV++NLN QVKVSTPQS D+I K FPPSTA F L
Sbjct  142  LVASNLNYQVKVSTPQSMDIIPKPFPPSTAGFNL  175



>ref|XP_007205107.1| hypothetical protein PRUPE_ppa004732mg [Prunus persica]
 gb|EMJ06306.1| hypothetical protein PRUPE_ppa004732mg [Prunus persica]
Length=494

 Score =   241 bits (614),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +1

Query  139  VGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTN  318
            +GAF+GINIGTDVS+LPS  D V LLKA QI H RL++AD HML ALSN+GIEV+VGVTN
Sbjct  22   LGAFIGINIGTDVSDLPSETDTVALLKAHQISHVRLYNADTHMLKALSNSGIEVMVGVTN  81

Query  319  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  498
             E+LGIGQS S AAAW+NKNVAAYLPSTNITAIAVGSEVLTSIP+AAPVLV AMN LHKA
Sbjct  82   EEILGIGQSPSTAAAWINKNVAAYLPSTNITAIAVGSEVLTSIPHAAPVLVSAMNSLHKA  141

Query  499  LVSANLNSQVKVSTPQSTDLIAKIFPPSTAHFQL  600
            LV++NLN QVKVSTPQS D+I K FPPSTA F L
Sbjct  142  LVASNLNYQVKVSTPQSMDVIPKPFPPSTAGFNL  175



>ref|XP_011087559.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Sesamum indicum]
Length=440

 Score =   238 bits (607),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GAFVGINIGTDVSNLPSA D+V +LKA+QI H RLFDADAHML+ALSNTGIEV+V VTN 
Sbjct  22   GAFVGINIGTDVSNLPSAVDIVGILKAQQITHVRLFDADAHMLNALSNTGIEVMVSVTNE  81

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            EVLGIG+  S AAAWVNKNVAAY+PSTNITAIAVGSEVLTSIP+AAP+LVPAMN L+KAL
Sbjct  82   EVLGIGELPSTAAAWVNKNVAAYVPSTNITAIAVGSEVLTSIPHAAPILVPAMNNLYKAL  141

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +++NLN QVK+STP S D+I + FPPSTA F
Sbjct  142  LASNLNYQVKISTPHSMDIIPRSFPPSTATF  172



>ref|XP_009364124.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Pyrus x bretschneideri]
Length=493

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N +GAF+GINIGTDVS+LPS  D V LLKA QI H RL++ADAHML ALSN+ IEV+VGV
Sbjct  20   NVLGAFIGINIGTDVSDLPSETDTVALLKAHQITHVRLYNADAHMLKALSNSRIEVMVGV  79

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
            TN EVL +G+SSS AAAW+NKNVAAYLPSTNITAIAVGSEV+TSIP+AAPVLV AMNYLH
Sbjct  80   TNEEVLSVGESSSAAAAWINKNVAAYLPSTNITAIAVGSEVITSIPHAAPVLVDAMNYLH  139

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            KALV++NLN QVK+STPQS D+I K FPPSTA F
Sbjct  140  KALVASNLNFQVKISTPQSMDIIPKPFPPSTATF  173



>ref|XP_011048218.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011048220.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011048221.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011048222.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011048223.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011048224.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016027.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016028.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016029.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016030.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016031.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016032.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016033.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016034.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
Length=493

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GAFVGIN+GTDVSN+PSA DVV +LKA QI H RL+DADAHML AL+++GI+V+VGV N 
Sbjct  19   GAFVGINLGTDVSNMPSAPDVVSILKANQITHLRLYDADAHMLKALADSGIKVMVGVPNE  78

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            EVLGIG+S+S+AAAW+N+NVAAYLPSTNITAIAVGSEVL+SIPN  PVLVPAMNYLHKAL
Sbjct  79   EVLGIGESASKAAAWINQNVAAYLPSTNITAIAVGSEVLSSIPNLVPVLVPAMNYLHKAL  138

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            V++NLN QVK+STPQ+ D+I + FPPSTA F
Sbjct  139  VASNLNFQVKISTPQAMDIIPRPFPPSTATF  169



>ref|XP_002297638.2| hypothetical protein POPTR_0001s04360g [Populus trichocarpa]
 gb|EEE82443.2| hypothetical protein POPTR_0001s04360g [Populus trichocarpa]
Length=493

 Score =   238 bits (606),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GAFVGIN+GTDVSN+PSA DVV +LKA QI H RL+DADAHML AL+++GIEV+VGVTN 
Sbjct  19   GAFVGINLGTDVSNMPSAPDVVSILKANQITHLRLYDADAHMLKALADSGIEVMVGVTNE  78

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            EVLGIG+S S+AAAW+N+NVAAYLPST+ITAIAVGSEVLTSIPN   VLVPAMNYLHKAL
Sbjct  79   EVLGIGESPSKAAAWINQNVAAYLPSTSITAIAVGSEVLTSIPNLVTVLVPAMNYLHKAL  138

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            V++NLN QVK+STPQ+ D+I + FPPSTA F
Sbjct  139  VASNLNFQVKISTPQAMDIIPRPFPPSTATF  169



>ref|XP_008384395.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Malus domestica]
 ref|XP_008349413.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Malus domestica]
 ref|XP_008349414.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Malus domestica]
Length=494

 Score =   238 bits (606),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GAF+GINIGTDVS+LPS  D V LLKA QI H RL++ADAH+L ALSN+GIEV+VG+TN 
Sbjct  23   GAFIGINIGTDVSDLPSETDTVALLKAHQITHVRLYNADAHILKALSNSGIEVMVGITNE  82

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            EVL +G+SSS AAAW+NKNVAAYLPSTNITAIAVGSEV+TSIP+AAPVLV AMNYLHKAL
Sbjct  83   EVLSVGESSSAAAAWINKNVAAYLPSTNITAIAVGSEVITSIPHAAPVLVDAMNYLHKAL  142

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            V++NLN QVKVSTPQS D+I K FPPSTA F
Sbjct  143  VASNLNFQVKVSTPQSMDIIPKPFPPSTATF  173



>ref|XP_011087532.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Sesamum indicum]
 ref|XP_011087540.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Sesamum indicum]
 ref|XP_011087550.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Sesamum indicum]
Length=499

 Score =   238 bits (607),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GAFVGINIGTDVSNLPSA D+V +LKA+QI H RLFDADAHML+ALSNTGIEV+V VTN 
Sbjct  22   GAFVGINIGTDVSNLPSAVDIVGILKAQQITHVRLFDADAHMLNALSNTGIEVMVSVTNE  81

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            EVLGIG+  S AAAWVNKNVAAY+PSTNITAIAVGSEVLTSIP+AAP+LVPAMN L+KAL
Sbjct  82   EVLGIGELPSTAAAWVNKNVAAYVPSTNITAIAVGSEVLTSIPHAAPILVPAMNNLYKAL  141

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +++NLN QVK+STP S D+I + FPPSTA F
Sbjct  142  LASNLNYQVKISTPHSMDIIPRSFPPSTATF  172



>emb|CDP16794.1| unnamed protein product [Coffea canephora]
Length=503

 Score =   236 bits (601),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GAFVG NIGTD+SNLPSA +VV +LKA QI H RLFDADAHML+AL++TGIEV+V VTN 
Sbjct  26   GAFVGFNIGTDLSNLPSATNVVAILKAHQITHVRLFDADAHMLTALADTGIEVMVSVTNE  85

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            E+LGIGQS S AAAWVNKNVAA++PSTNITAIAVGSEVLT+IPNAA +LVP+MNYL KAL
Sbjct  86   EILGIGQSPSVAAAWVNKNVAAFVPSTNITAIAVGSEVLTTIPNAARILVPSMNYLQKAL  145

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            V++NLN Q+KVSTPQS D+I + FPPSTA F
Sbjct  146  VASNLNDQIKVSTPQSMDVIPRPFPPSTAAF  176



>ref|XP_010276339.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X2 [Nelumbo 
nucifera]
Length=453

 Score =   234 bits (597),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N  GAFVGINIGT V++LPSA DVV +LKA QI H RL+DAD HML+AL+ TG+EV+VGV
Sbjct  21   NASGAFVGINIGTAVTDLPSAADVVAMLKANQITHVRLYDADGHMLNALAGTGVEVMVGV  80

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
            TN EVLGIG+S S AAAWVNKNVA+YLP TNITAIAVGSEVLTSIPNAAPVLV AMNYLH
Sbjct  81   TNEEVLGIGESPSAAAAWVNKNVASYLPETNITAIAVGSEVLTSIPNAAPVLVRAMNYLH  140

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
             AL+++NLN QVKVS+PQS D+I + FPPSTA F
Sbjct  141  HALLASNLNFQVKVSSPQSMDMIPRPFPPSTATF  174



>ref|XP_004504325.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Cicer arietinum]
Length=496

 Score =   234 bits (598),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = +1

Query  139  VGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTN  318
            +GAFVG+NIGTDVS++PSA +VV +LKA QI H RL+DA+AH+L ALSNTGI+VIVGVTN
Sbjct  22   LGAFVGVNIGTDVSDMPSASNVVAILKANQITHVRLYDANAHLLQALSNTGIDVIVGVTN  81

Query  319  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  498
             EVL IG+S S AAAW+NKNV AYLPSTNITAIAVGSEVL++IPN APVLVPAMN LHKA
Sbjct  82   EEVLKIGESPSAAAAWINKNVVAYLPSTNITAIAVGSEVLSTIPNVAPVLVPAMNSLHKA  141

Query  499  LVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            LV+ANLN +VKVSTPQS D+I K FPPSTA F
Sbjct  142  LVAANLNFRVKVSTPQSMDIIPKSFPPSTATF  173



>ref|XP_010276332.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010276333.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010276334.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010276335.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010276336.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010276337.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010276338.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
Length=496

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N  GAFVGINIGT V++LPSA DVV +LKA QI H RL+DAD HML+AL+ TG+EV+VGV
Sbjct  21   NASGAFVGINIGTAVTDLPSAADVVAMLKANQITHVRLYDADGHMLNALAGTGVEVMVGV  80

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
            TN EVLGIG+S S AAAWVNKNVA+YLP TNITAIAVGSEVLTSIPNAAPVLV AMNYLH
Sbjct  81   TNEEVLGIGESPSAAAAWVNKNVASYLPETNITAIAVGSEVLTSIPNAAPVLVRAMNYLH  140

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
             AL+++NLN QVKVS+PQS D+I + FPPSTA F
Sbjct  141  HALLASNLNFQVKVSSPQSMDMIPRPFPPSTATF  174



>ref|XP_008352033.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
4 [Malus domestica]
Length=469

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = +1

Query  151  VGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEVL  330
            +G NIGTDVS+LPS  D V LLKA QI H RL++ADAHML ALSN+GIEV+VGVTN EVL
Sbjct  1    MGDNIGTDVSDLPSETDTVALLKAHQITHVRLYNADAHMLKALSNSGIEVMVGVTNEEVL  60

Query  331  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  510
            GIG+S+S AAAW+NKNVAAYLPSTNITAIAVGSEV+T+IPNAAPVLV AMNYLHKALV++
Sbjct  61   GIGESASAAAAWINKNVAAYLPSTNITAIAVGSEVITTIPNAAPVLVSAMNYLHKALVAS  120

Query  511  NLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            NLN Q+KVSTPQS D+I K FPPSTA F
Sbjct  121  NLNFQIKVSTPQSMDIIPKPFPPSTATF  148



>gb|KJB23365.1| hypothetical protein B456_004G094500 [Gossypium raimondii]
Length=492

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N +GAFVG+NIGTDVS++P A DVV ++KA QI H RL+DAD HML AL+ +GIEV VGV
Sbjct  19   NVLGAFVGVNIGTDVSSMPPASDVVAIVKAHQITHIRLYDADPHMLKALAGSGIEVTVGV  78

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
            TN EVLGIG+S+S AAAW+NKNVAAY+PSTNITAIAVGSEVLTS+P+AAPVLV AMN LH
Sbjct  79   TNEEVLGIGESASAAAAWINKNVAAYMPSTNITAIAVGSEVLTSVPHAAPVLVTAMNNLH  138

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            KALV+A+LN QVKVSTPQS D+I K FPPSTA F
Sbjct  139  KALVAADLNFQVKVSTPQSMDIIPKPFPPSTATF  172



>ref|XP_004294998.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461676.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Fragaria vesca 
subsp. vesca]
Length=494

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N +GAF+G+NIGTDVS+LPSA ++V +L A QI H RL+DADAHML ALSN+GIEV+VG+
Sbjct  20   NGLGAFIGVNIGTDVSDLPSATEMVAILTAHQITHVRLYDADAHMLRALSNSGIEVVVGI  79

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
            TN EVLGIG+S S AAAWVNKNVA YLPSTNITAIAVGSEVLT IP+A+ VLV AMNY+H
Sbjct  80   TNEEVLGIGESPSVAAAWVNKNVAPYLPSTNITAIAVGSEVLTQIPHASSVLVSAMNYIH  139

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHFQ  597
            KALV+ NLN QVKVSTPQS D+I K FPPSTA F 
Sbjct  140  KALVATNLNFQVKVSTPQSMDVIPKAFPPSTATFD  174



>ref|XP_007161273.1| hypothetical protein PHAVU_001G056400g [Phaseolus vulgaris]
 gb|ESW33267.1| hypothetical protein PHAVU_001G056400g [Phaseolus vulgaris]
Length=503

 Score =   233 bits (593),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N VGAFVG+NIGTDV++LPSA ++V +LKA QI H RL+DA+ HML ALS TGIEVIVGV
Sbjct  23   NAVGAFVGVNIGTDVTDLPSASNMVAILKAHQITHVRLYDANEHMLQALSKTGIEVIVGV  82

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
            T+ E+LGIG+S+S AAAW++KNVAAY+PSTNITAI+VGSEVLTS+P  APVLVPAMN+LH
Sbjct  83   TDEEILGIGESASVAAAWISKNVAAYMPSTNITAISVGSEVLTSVPKVAPVLVPAMNHLH  142

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            KALV++NLN +VK+STPQS D+I++ FPPSTA F
Sbjct  143  KALVASNLNFRVKISTPQSMDIISRPFPPSTATF  176



>gb|KHG18393.1| hypothetical protein F383_22096 [Gossypium arboreum]
Length=492

 Score =   232 bits (591),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N +GAFVG+NIGTDVS++P A DVV ++KA QI H RL+DAD HML AL+ +GIEV VGV
Sbjct  19   NVLGAFVGVNIGTDVSSMPPASDVVAIVKAHQITHIRLYDADPHMLKALAGSGIEVTVGV  78

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
            TN EVLGIG+S+S AAAW+NKNVAAY+PSTNITAIAVGSEVLTS+P+AAPVLV AMN LH
Sbjct  79   TNEEVLGIGESASAAAAWINKNVAAYMPSTNITAIAVGSEVLTSVPHAAPVLVTAMNNLH  138

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            KALV+A+LN Q+KVSTPQS D+I K FPPST+ F
Sbjct  139  KALVAADLNFQIKVSTPQSMDIIPKPFPPSTSTF  172



>ref|XP_003524953.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Glycine max]
Length=496

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N +GAFVG+NIGTDVS+LPSA ++V +L+A QI HARL+DA+AH+L ALSNT IEVIVGV
Sbjct  20   NTLGAFVGVNIGTDVSDLPSASNIVGILQANQITHARLYDANAHLLQALSNTSIEVIVGV  79

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
            TN EVL IG+S S AAAW+NKNV AY+PSTNIT IAVGSEVL++IPN APVLVPAMN LH
Sbjct  80   TNEEVLRIGESPSAAAAWINKNVVAYVPSTNITGIAVGSEVLSTIPNVAPVLVPAMNSLH  139

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            KALV+ANLN +VKVSTPQS D+I K FPPSTA F
Sbjct  140  KALVAANLNFRVKVSTPQSMDIIPKPFPPSTATF  173



>gb|KHN12071.1| Glucan endo-1,3-beta-glucosidase 4, partial [Glycine soja]
Length=501

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N  GAFVG+NIGTDV++LPSA +VV +LK+ QI H RL++A+ HML ALSNTGIEVIVGV
Sbjct  23   NAAGAFVGVNIGTDVTDLPSASNVVAILKSHQITHVRLYNANGHMLQALSNTGIEVIVGV  82

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
            T+ E+LGIG+S+S AAAW++KNVAAY+PSTNITAI+VGSEVLTS+PN APVLVPAMN+LH
Sbjct  83   TDEEILGIGESASVAAAWISKNVAAYMPSTNITAISVGSEVLTSVPNVAPVLVPAMNHLH  142

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
             ALV++NLN +VKVSTPQS D+I++ FPPSTA F
Sbjct  143  TALVASNLNFRVKVSTPQSMDVISRPFPPSTATF  176



>ref|XP_006601114.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Glycine max]
Length=498

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N  GAFVG+NIGTDV++LPSA +VV +LK+ QI H RL++A+ HML ALSNTGIEVIVGV
Sbjct  20   NAAGAFVGVNIGTDVTDLPSASNVVAILKSHQITHVRLYNANGHMLQALSNTGIEVIVGV  79

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
            T+ E+LGIG+S+S AAAW++KNVAAY+PSTNITAI+VGSEVLTS+PN APVLVPAMN+LH
Sbjct  80   TDEEILGIGESASVAAAWISKNVAAYMPSTNITAISVGSEVLTSVPNVAPVLVPAMNHLH  139

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
             ALV++NLN +VKVSTPQS D+I++ FPPSTA F
Sbjct  140  TALVASNLNFRVKVSTPQSMDVISRPFPPSTATF  173



>ref|XP_010257592.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Nelumbo nucifera]
 ref|XP_010257593.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Nelumbo nucifera]
 ref|XP_010257594.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Nelumbo nucifera]
 ref|XP_010257595.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Nelumbo nucifera]
 ref|XP_010257598.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Nelumbo nucifera]
Length=514

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GAFVGINIG DV++LPSA DVV +LKA QI H RL+DAD  ML+AL+ TGIEV+VGV N 
Sbjct  40   GAFVGINIGMDVTDLPSASDVVAILKANQITHVRLYDADNRMLNALAGTGIEVMVGVANE  99

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            EVLGIGQS S AAAW+NKNV +YLPSTNITAIAVGSEVLTSIPNAAP+LVPAMNYLH AL
Sbjct  100  EVLGIGQSPSVAAAWINKNVVSYLPSTNITAIAVGSEVLTSIPNAAPILVPAMNYLHNAL  159

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            V++N+N QVKVS+PQS D+I + FPPS A F
Sbjct  160  VASNINFQVKVSSPQSMDMIPRPFPPSDATF  190



>ref|XP_006495278.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like, partial [Citrus 
sinensis]
Length=373

 Score =   228 bits (580),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N +GA+VG+NIGTDVSN+PSA D+V +L+A QI H RL+DAD+HML ALS +GIEVIVGV
Sbjct  20   NVLGAYVGVNIGTDVSNMPSASDIVAILRANQITHVRLYDADSHMLKALSKSGIEVIVGV  79

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
             N EVLGIG+S+S AA W+NKNVAAY+P+TNITAIAVGS+VLTSIPNAA VLV AMN LH
Sbjct  80   LNEEVLGIGESASAAAGWINKNVAAYMPTTNITAIAVGSQVLTSIPNAASVLVSAMNNLH  139

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHFQ  597
            KALV+++LN QVK+STP S D+I + FPPSTA F 
Sbjct  140  KALVASDLNFQVKISTPHSMDIIPRPFPPSTATFN  174



>ref|XP_006445640.1| hypothetical protein CICLE_v10015028mg [Citrus clementina]
 ref|XP_006445641.1| hypothetical protein CICLE_v10015028mg [Citrus clementina]
 gb|ESR58880.1| hypothetical protein CICLE_v10015028mg [Citrus clementina]
 gb|ESR58881.1| hypothetical protein CICLE_v10015028mg [Citrus clementina]
Length=493

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N +GA+VG+NIGTDVSN+PSA D+V +L+A QI H RL+DAD+HML ALS +GIEVIVGV
Sbjct  20   NVLGAYVGVNIGTDVSNMPSASDIVAILRANQITHVRLYDADSHMLKALSKSGIEVIVGV  79

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
             N EVLGIG+S+S AAAW+NKNVAAY+P+TNITAIAVGS+VLTSIPNAA VLV AMN LH
Sbjct  80   LNEEVLGIGESASAAAAWINKNVAAYMPTTNITAIAVGSQVLTSIPNAASVLVSAMNNLH  139

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            KALV+++LN QVK+STP S D+I + FPPSTA F
Sbjct  140  KALVASDLNFQVKISTPHSMDIIPRPFPPSTATF  173



>ref|XP_003531243.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Glycine max]
 gb|KHN47972.1| Glucan endo-1,3-beta-glucosidase 4 [Glycine soja]
Length=496

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = +1

Query  139  VGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTN  318
            +GAFVG+NIGTDVS+LPSA ++V++L+A QI H RL+DA+AH+L ALSNT IEVIVGVTN
Sbjct  22   LGAFVGVNIGTDVSDLPSASNIVDILQANQITHVRLYDANAHLLQALSNTSIEVIVGVTN  81

Query  319  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  498
             EVL IG+S S AA W+NKNV AY+PSTNIT IAVGSEVL++IPN APVLVPAMN LHKA
Sbjct  82   EEVLRIGESPSAAATWINKNVVAYVPSTNITGIAVGSEVLSTIPNVAPVLVPAMNSLHKA  141

Query  499  LVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            LV+ANLN +VKVSTPQS D+I K FPPSTA F
Sbjct  142  LVAANLNFRVKVSTPQSMDIIPKPFPPSTATF  173



>ref|XP_006596127.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Glycine max]
 gb|KHN20600.1| Glucan endo-1,3-beta-glucosidase 4 [Glycine soja]
Length=501

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N  GAFVG+NIGTDV++LPSA +VV +LKA QI H RL++A+ HML ALSNTGIEVIVGV
Sbjct  23   NAAGAFVGVNIGTDVTDLPSASNVVAILKAHQITHVRLYNANEHMLRALSNTGIEVIVGV  82

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
            T+ E+LGIG+S+S AAAW++KNVAAY+PSTNITAI+VGSEVLTS+PN APVLVPAMN+LH
Sbjct  83   TDEEILGIGESASVAAAWISKNVAAYMPSTNITAISVGSEVLTSVPNVAPVLVPAMNHLH  142

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
             ALV++NLN ++KVSTP S D+I++ FPPSTA F
Sbjct  143  TALVASNLNFRIKVSTPLSMDIISRPFPPSTATF  176



>ref|XP_010044948.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Eucalyptus grandis]
 ref|XP_010044949.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Eucalyptus grandis]
 gb|KCW87080.1| hypothetical protein EUGRSUZ_B03614 [Eucalyptus grandis]
Length=495

 Score =   228 bits (582),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GAFVGINIGTDV+NLP A D+V +LK+ +I H RL++ADAHML AL+N+GI V+VGVTN 
Sbjct  23   GAFVGINIGTDVTNLPEASDIVAVLKSNEITHVRLYNADAHMLKALANSGINVMVGVTNE  82

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            EVLGIG+  + AAAW+NKNVAAYLP+TNITAIAVGSEVLT+IP+AAPVLVPAMN LHKAL
Sbjct  83   EVLGIGEYPATAAAWINKNVAAYLPATNITAIAVGSEVLTAIPHAAPVLVPAMNNLHKAL  142

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            V++NLN  VKVSTPQSTD+I K FPPS A F
Sbjct  143  VASNLNFVVKVSTPQSTDVIPKPFPPSAAAF  173



>ref|XP_006488904.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Citrus sinensis]
 ref|XP_006488905.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Citrus sinensis]
 ref|XP_006488906.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X3 
[Citrus sinensis]
 gb|KDO63056.1| hypothetical protein CISIN_1g011131mg [Citrus sinensis]
 gb|KDO63057.1| hypothetical protein CISIN_1g011131mg [Citrus sinensis]
Length=493

 Score =   228 bits (580),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N +GA+VG+NIGTDVSN+PSA D+V +L+A QI H RL+DAD+HML ALS +GIEVIVGV
Sbjct  20   NVLGAYVGVNIGTDVSNMPSASDIVAILRANQITHVRLYDADSHMLKALSKSGIEVIVGV  79

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
             N EVLGIG+S+S AA W+NKNVAAY+P+TNITAIAVGS+VLTSIPNAA VLV AMN LH
Sbjct  80   LNEEVLGIGESASAAAGWINKNVAAYMPTTNITAIAVGSQVLTSIPNAASVLVSAMNNLH  139

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            KALV+++LN QVK+STP S D+I + FPPSTA F
Sbjct  140  KALVASDLNFQVKISTPHSMDIIPRPFPPSTATF  173



>ref|XP_007014685.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 ref|XP_007014686.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOY32304.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOY32305.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
Length=496

 Score =   227 bits (579),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N +GAFVGINIGTDVS++PSA +VV ++KA QI H RL+DAD+HML A +++GIEV VGV
Sbjct  20   NVLGAFVGINIGTDVSSMPSASEVVAVVKAHQITHIRLYDADSHMLKAFADSGIEVTVGV  79

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
            TN EVLGIG+S+S AA W+NKNVA+Y+PSTNITAIAVGSEVLTSIP+AA VLV AMN LH
Sbjct  80   TNEEVLGIGESASAAAVWINKNVASYVPSTNITAIAVGSEVLTSIPHAASVLVTAMNNLH  139

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            KALV++NLN QVKVSTPQS D+I K FPPSTA F
Sbjct  140  KALVASNLNFQVKVSTPQSMDIIPKPFPPSTAAF  173



>ref|XP_007159412.1| hypothetical protein PHAVU_002G236300g [Phaseolus vulgaris]
 ref|XP_007159413.1| hypothetical protein PHAVU_002G236300g [Phaseolus vulgaris]
 gb|ESW31406.1| hypothetical protein PHAVU_002G236300g [Phaseolus vulgaris]
 gb|ESW31407.1| hypothetical protein PHAVU_002G236300g [Phaseolus vulgaris]
Length=492

 Score =   227 bits (578),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +1

Query  139  VGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTN  318
            +GA VG+NIGTDVS++PSA ++V++L+A QI H RL+DA+ H+L ALSNT IEVIVGVTN
Sbjct  22   LGALVGVNIGTDVSDMPSASNIVDILQANQITHVRLYDANVHLLQALSNTSIEVIVGVTN  81

Query  319  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  498
             EVL IG+S S AAAW+NKNV AY+PSTNITAIAVGSEVL++IPN APVLVPAMN LHKA
Sbjct  82   EEVLKIGESPSAAAAWINKNVVAYVPSTNITAIAVGSEVLSTIPNVAPVLVPAMNSLHKA  141

Query  499  LVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            LV+ANLN QVKVSTPQS D+I K FPPS A F
Sbjct  142  LVAANLNFQVKVSTPQSMDIIPKPFPPSAASF  173



>ref|XP_003629715.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AET04191.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=498

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = +1

Query  139  VGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTN  318
            +GAFVG+NIGTDVS++PSA +VV +LKA QI H RL+DA+AH+L ALS T I+V+VGVTN
Sbjct  22   LGAFVGVNIGTDVSDMPSASNVVAILKANQITHVRLYDANAHLLQALSKTNIDVMVGVTN  81

Query  319  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  498
             EVL IG+S S AAAW+NKNV AY+PSTNITAIAVGSEVL++IPN APVLVPAMN LHKA
Sbjct  82   EEVLRIGESPSAAAAWINKNVVAYVPSTNITAIAVGSEVLSTIPNVAPVLVPAMNSLHKA  141

Query  499  LVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            LV+ANLN +VKVSTPQS D+I K FPPSTA F
Sbjct  142  LVAANLNFRVKVSTPQSMDIIPKPFPPSTATF  173



>ref|XP_010097806.1| Glucan endo-1,3-beta-glucosidase 4 [Morus notabilis]
 gb|EXB71433.1| Glucan endo-1,3-beta-glucosidase 4 [Morus notabilis]
Length=494

 Score =   225 bits (574),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N +GAFVGINIGTDVS LPS  D+V +LKA Q  H RL+DA+  +L AL+ +GIEV+VGV
Sbjct  20   NALGAFVGINIGTDVSTLPSEIDIVAILKAHQFTHVRLYDANTRLLKALAGSGIEVMVGV  79

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
             N EVLGIG+S S AAAWVNKNVAAY+P+TNIT IAVGSEVLTSIPNAA VLV AMNYLH
Sbjct  80   ANEEVLGIGESPSVAAAWVNKNVAAYVPTTNITTIAVGSEVLTSIPNAASVLVSAMNYLH  139

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            KALV+ANLN QVKVSTPQS D+I + FPPSTA+F
Sbjct  140  KALVAANLNFQVKVSTPQSMDIIPRSFPPSTANF  173



>gb|KJB66066.1| hypothetical protein B456_010G126400 [Gossypium raimondii]
 gb|KJB66067.1| hypothetical protein B456_010G126400 [Gossypium raimondii]
 gb|KJB66069.1| hypothetical protein B456_010G126400 [Gossypium raimondii]
Length=494

 Score =   225 bits (574),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N +GAF+GINIGTDVS++PSA +VV ++K  +I H RL+DAD+HML AL+++GIEV VGV
Sbjct  20   NVLGAFIGINIGTDVSSMPSASEVVSIIKTHRITHVRLYDADSHMLKALADSGIEVTVGV  79

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
            TN EVLGIG+S+S AAAWVNKNVA+Y+PSTNITAIAVGSEVLTSIP+AAP+LV AMN LH
Sbjct  80   TNEEVLGIGESASAAAAWVNKNVASYVPSTNITAIAVGSEVLTSIPHAAPILVTAMNNLH  139

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            KALV++NLN QVKVS+PQ  D+I + FPP TA F
Sbjct  140  KALVASNLNFQVKVSSPQPLDIIPEPFPPCTAAF  173



>gb|AFK37243.1| unknown [Medicago truncatula]
Length=498

 Score =   224 bits (572),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +1

Query  139  VGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTN  318
            +GAFVG+NIGTDVS++PSA +VV +LKA QI H RL+DA+AH+L ALS T I+V+VGVTN
Sbjct  22   LGAFVGVNIGTDVSDMPSASNVVAILKANQITHVRLYDANAHLLQALSKTNIDVMVGVTN  81

Query  319  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  498
             EVL IG+S S AAAW+NKNV AY+PSTNITAIAVGSEVL++IPN APVLVPAMN LHKA
Sbjct  82   EEVLRIGESPSAAAAWINKNVVAYVPSTNITAIAVGSEVLSTIPNVAPVLVPAMNSLHKA  141

Query  499  LVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            LV+ANLN +VKV TPQS D+I K FPPSTA F
Sbjct  142  LVAANLNFRVKVPTPQSMDIIPKPFPPSTATF  173



>ref|XP_010673492.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Beta vulgaris 
subsp. vulgaris]
Length=492

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = +1

Query  139  VGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTN  318
            +GAF+GI+IGT +S LP A DVV +L   +I H RLFDADAHML AL+NT IEV+VGVTN
Sbjct  21   LGAFIGIDIGTHLSKLPPASDVVAILTDNKITHVRLFDADAHMLRALANTSIEVMVGVTN  80

Query  319  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  498
             EVLGIGQS S AAAWVNKNVAAY+P TNITAIAVGSEVLT+IP+AAP+LVPAMN LHKA
Sbjct  81   EEVLGIGQSPSVAAAWVNKNVAAYVPGTNITAIAVGSEVLTAIPHAAPILVPAMNNLHKA  140

Query  499  LVSANLNSQVKVSTPQSTDLIAKIFPPSTAHFQ  597
            LV++NLN +VKVSTP S D+I++ FPPSTA F 
Sbjct  141  LVASNLNFKVKVSTPHSMDIISRPFPPSTAIFN  173



>ref|XP_004502208.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Cicer arietinum]
Length=478

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +1

Query  139  VGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTN  318
            VGAFVG+NIG+DVS+LPSA +VV +LK+ QI H RL+DA+ HML ALSNTGIEV+VGVT+
Sbjct  4    VGAFVGVNIGSDVSDLPSASNVVTILKSHQITHVRLYDANPHMLQALSNTGIEVLVGVTD  63

Query  319  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  498
             E+L IG S S AA+W+ KNVAAY+P TNIT+IAVGS+VLTSIPN APVLVPAMN+LH A
Sbjct  64   EEILTIGDSPSVAASWITKNVAAYMPHTNITSIAVGSQVLTSIPNVAPVLVPAMNHLHSA  123

Query  499  LVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            LV++NL+ +VKVSTPQS DLI + FPPSTA F
Sbjct  124  LVASNLHFRVKVSTPQSMDLIPRPFPPSTATF  155



>ref|XP_004502207.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Cicer arietinum]
Length=506

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GAFVG+NIG+DVS+LPSA +VV +LK+ QI H RL+DA+ HML ALSNTGIEV+VGVT+ 
Sbjct  33   GAFVGVNIGSDVSDLPSASNVVTILKSHQITHVRLYDANPHMLQALSNTGIEVLVGVTDE  92

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            E+L IG S S AA+W+ KNVAAY+P TNIT+IAVGS+VLTSIPN APVLVPAMN+LH AL
Sbjct  93   EILTIGDSPSVAASWITKNVAAYMPHTNITSIAVGSQVLTSIPNVAPVLVPAMNHLHSAL  152

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            V++NL+ +VKVSTPQS DLI + FPPSTA F
Sbjct  153  VASNLHFRVKVSTPQSMDLIPRPFPPSTATF  183



>ref|XP_010673491.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Beta vulgaris 
subsp. vulgaris]
Length=493

 Score =   219 bits (557),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +1

Query  139  VGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTN  318
            +GAF+GI+IGT +S LP A DVV++L    I H RLFDADAHML AL++T IEV+VGVTN
Sbjct  21   LGAFIGIDIGTHLSKLPQASDVVDILTNNVITHVRLFDADAHMLRALASTSIEVMVGVTN  80

Query  319  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  498
             EVLGIGQS S AAAWVNKNVAAY+P TNITAIAVGSEVLT+IP+AAP+LVPAMN LHKA
Sbjct  81   EEVLGIGQSQSVAAAWVNKNVAAYVPGTNITAIAVGSEVLTAIPHAAPILVPAMNNLHKA  140

Query  499  LVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            LV++ LN +VKVSTP S D+I++ FPPSTA F
Sbjct  141  LVASKLNLKVKVSTPHSMDIISRPFPPSTAIF  172



>ref|XP_003601614.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AES71865.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=498

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 131/154 (85%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N +GAFVG+NIGT V++LPSA ++V +LK+ QI H RL+DA+AHML ALSNTGIE++VGV
Sbjct  20   NVLGAFVGVNIGTHVTDLPSASNIVAILKSHQITHVRLYDANAHMLQALSNTGIELLVGV  79

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
            T+ E+L IG+S S AA W++KNVAAY+P TNIT IAVGSEVLTSIPN A VLVPAMN+LH
Sbjct  80   TDEEILRIGESPSVAATWISKNVAAYMPHTNITTIAVGSEVLTSIPNVARVLVPAMNHLH  139

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
             ALV++NL+ +VK+STPQS DLI K FPPSTA F
Sbjct  140  SALVASNLHFRVKISTPQSMDLIPKPFPPSTATF  173



>gb|KHG04722.1| hypothetical protein F383_29074 [Gossypium arboreum]
Length=495

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N +GAF+GINIGTDVS++PSA +VV ++K  +I H RL+DAD+HML AL+++GIEV VGV
Sbjct  20   NVLGAFIGINIGTDVSSMPSASEVVSIIKTHRITHVRLYDADSHMLKALADSGIEVTVGV  79

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
            TN EVLGIG+S+S AAAWV+KNVA+Y+PSTNITAIAVGSEVLTSIP+AAP+LV AMN LH
Sbjct  80   TNEEVLGIGESASAAAAWVSKNVASYVPSTNITAIAVGSEVLTSIPHAAPILVTAMNNLH  139

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            KALV++NLN QVKVS+PQS D+I + FPPSTA F
Sbjct  140  KALVASNLNFQVKVSSPQSLDIIPEPFPPSTAAF  173



>ref|XP_009413316.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Musa acuminata 
subsp. malaccensis]
Length=495

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GAF+GINIGT +S+LPSA ++V +LK +QIKH RLFDAD  ML+ALSNTGIEV VGV N+
Sbjct  22   GAFIGINIGTQMSSLPSAAEIVSILKTQQIKHVRLFDADHQMLNALSNTGIEVTVGVPND  81

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++L IG+S S+AA W+NKNVAA++P+TNIT IAVG+EVLT+IPNAA VLVPAM +L  AL
Sbjct  82   QLLRIGESRSEAANWINKNVAAFVPATNITCIAVGNEVLTTIPNAALVLVPAMQFLQSAL  141

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHFQL  600
            V+ANLN QVKVS+PQS D+I K FPPSTA F L
Sbjct  142  VAANLNFQVKVSSPQSMDMIPKHFPPSTATFNL  174



>ref|XP_009406534.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X3 
[Musa acuminata subsp. malaccensis]
 ref|XP_009406535.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X3 
[Musa acuminata subsp. malaccensis]
 ref|XP_009406536.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X3 
[Musa acuminata subsp. malaccensis]
 ref|XP_009406537.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X3 
[Musa acuminata subsp. malaccensis]
Length=496

 Score =   217 bits (553),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GAF+GINIGT +S+LPSA ++V +LK ++IKH RLFDAD  ML+AL+NTGIEV+VGV N+
Sbjct  22   GAFIGINIGTQMSSLPSAAEIVSILKTQRIKHVRLFDADHQMLNALANTGIEVLVGVPND  81

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++L IG+S S+AAAW+NKNVAA++P+TNIT IAVG+EVLT+IPNAA VL+PAM +LH AL
Sbjct  82   QLLRIGESQSEAAAWINKNVAAFVPATNITYIAVGNEVLTTIPNAALVLIPAMQFLHSAL  141

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++ANLN QVKVS+PQS D+I K FPPSTA F
Sbjct  142  LAANLNFQVKVSSPQSMDMIPKHFPPSTASF  172



>ref|XP_009406533.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=500

 Score =   217 bits (553),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GAF+GINIGT +S+LPSA ++V +LK ++IKH RLFDAD  ML+AL+NTGIEV+VGV N+
Sbjct  50   GAFIGINIGTQMSSLPSAAEIVSILKTQRIKHVRLFDADHQMLNALANTGIEVLVGVPND  109

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++L IG+S S+AAAW+NKNVAA++P+TNIT IAVG+EVLT+IPNAA VL+PAM +LH AL
Sbjct  110  QLLRIGESQSEAAAWINKNVAAFVPATNITYIAVGNEVLTTIPNAALVLIPAMQFLHSAL  169

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++ANLN QVKVS+PQS D+I K FPPSTA F
Sbjct  170  LAANLNFQVKVSSPQSMDMIPKHFPPSTASF  200



>ref|XP_011093510.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Sesamum indicum]
 ref|XP_011093511.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Sesamum indicum]
 ref|XP_011093512.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Sesamum indicum]
 ref|XP_011093513.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Sesamum indicum]
 ref|XP_011093514.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Sesamum indicum]
 ref|XP_011093515.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Sesamum indicum]
Length=502

 Score =   217 bits (552),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 131/154 (85%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N VG+FVGINIGTDVSNLPSA ++V +L+A  I H RLF+ADA ML+ALSNTGIEV++ V
Sbjct  19   NAVGSFVGINIGTDVSNLPSAVEIVAILRAHSISHVRLFNADARMLNALSNTGIEVMISV  78

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
            TN EV  IG+S S AA W+NKNVAAY+P+TNITAIAVGSEVLTS+PNA+ V+VPAMNYL+
Sbjct  79   TNEEVTTIGESPSAAADWINKNVAAYVPTTNITAIAVGSEVLTSLPNASAVIVPAMNYLN  138

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            KALV++NLN  VKVSTP S  +I++ FPPSTA F
Sbjct  139  KALVASNLNYLVKVSTPHSMGIISRPFPPSTATF  172



>ref|XP_009406531.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009406532.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=524

 Score =   217 bits (553),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GAF+GINIGT +S+LPSA ++V +LK ++IKH RLFDAD  ML+AL+NTGIEV+VGV N+
Sbjct  50   GAFIGINIGTQMSSLPSAAEIVSILKTQRIKHVRLFDADHQMLNALANTGIEVLVGVPND  109

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++L IG+S S+AAAW+NKNVAA++P+TNIT IAVG+EVLT+IPNAA VL+PAM +LH AL
Sbjct  110  QLLRIGESQSEAAAWINKNVAAFVPATNITYIAVGNEVLTTIPNAALVLIPAMQFLHSAL  169

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++ANLN QVKVS+PQS D+I K FPPSTA F
Sbjct  170  LAANLNFQVKVSSPQSMDMIPKHFPPSTASF  200



>ref|XP_004139073.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Cucumis sativus]
 gb|KGN66575.1| hypothetical protein Csa_1G630300 [Cucumis sativus]
Length=495

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N +GAFVG+N+GT VSNLPSA D+V +LK+ QI H RL++AD  +L AL+N+ IEVIVGV
Sbjct  19   NALGAFVGVNLGTGVSNLPSASDIVAILKSHQITHLRLYNADFQLLKALTNSSIEVIVGV  78

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
            TN EVL IG+S + AAAWVNKNVAA+LP TNITAIAVGSEVLT+IP+  PVLVPAM  LH
Sbjct  79   TNEEVLRIGESPAAAAAWVNKNVAAHLPGTNITAIAVGSEVLTTIPHVGPVLVPAMYSLH  138

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHFQ  597
            KALV+ANLN  +KVSTPQS D+I + FPPSTA F 
Sbjct  139  KALVAANLNYLIKVSTPQSMDIIPRAFPPSTASFD  173



>ref|XP_002532062.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF30317.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=436

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 130/163 (80%), Gaps = 4/163 (2%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N  GAF+GINIGTDVSN+P A DVV +LK  QI H RL+DADAHML AL+N+GIEV+VG+
Sbjct  20   NTGGAFIGINIGTDVSNMPPASDVVAILKTNQITHVRLYDADAHMLKALANSGIEVMVGI  79

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
            TN EVLGIG+S + AAAW+NKNVA+YLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH
Sbjct  80   TNEEVLGIGESPAAAAAWINKNVASYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  139

Query  493  KALVSANLNSQVKVS--TPQ--STDLIAKIFPPSTAHFQLLVE  609
            KALV++NLN Q K     P   S DL   + P + +H+  + +
Sbjct  140  KALVASNLNFQSKFQLLNPWTLSPDLSPIVDPNTLSHYNSMFD  182



>ref|XP_008450301.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Cucumis melo]
Length=495

 Score =   214 bits (544),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N +GAFVG+N+GT VSNLPS  D+V +LK+ QI H RL++AD  +L AL+N+ IEVIVGV
Sbjct  19   NALGAFVGVNLGTSVSNLPSPSDIVAILKSHQITHLRLYNADPQLLKALANSSIEVIVGV  78

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
            TN EVL IG+S + AAAWVNKNVAA+LP TNITAIAVGSEVLT+IP+  PVLVPAM  LH
Sbjct  79   TNEEVLRIGESPAAAAAWVNKNVAAHLPGTNITAIAVGSEVLTTIPHVGPVLVPAMYSLH  138

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHFQ  597
            KALV+ANLN  +KVSTPQS D+I + FPPSTA F 
Sbjct  139  KALVAANLNYLIKVSTPQSMDIIPRPFPPSTASFD  173



>ref|XP_008354986.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Malus domestica]
Length=475

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = +1

Query  199  DVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEVLGIGQSSSQAAAWVNKN  378
            D V LLKA QI H RL++ADAHML ALSN+GIEV+VGVTN EVLGIG+S+S AAAW+NKN
Sbjct  23   DTVALLKAHQITHVRLYNADAHMLKALSNSGIEVMVGVTNEEVLGIGESASAAAAWINKN  82

Query  379  VAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSANLNSQVKVSTPQSTDL  558
            VAAYLPSTNITAIAVGSEV+T+IPNAAPVLV AMNYLHKALV++NLN Q+KVSTPQS D+
Sbjct  83   VAAYLPSTNITAIAVGSEVITTIPNAAPVLVSAMNYLHKALVASNLNFQIKVSTPQSMDI  142

Query  559  IAKIFPPSTAHF  594
            I K FPPSTA F
Sbjct  143  IPKPFPPSTATF  154



>gb|EMT26371.1| Glucan endo-1,3-beta-glucosidase 4 [Aegilops tauschii]
Length=390

 Score =   209 bits (533),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N  GAFVGINIGT+VS+LPSA D+V +LKA++I+H RL D++  ML AL+NTGIEV+VGV
Sbjct  51   NASGAFVGINIGTNVSDLPSASDIVSILKAKKIQHVRLVDSNHEMLVALANTGIEVMVGV  110

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
             NNE+L +GQS   AA W+NKNVAAY+P+TNIT IAVG E+LT++PNAA VLVPA+ +L 
Sbjct  111  PNNELLRVGQSRPTAADWINKNVAAYIPATNITYIAVGDEILTTVPNAALVLVPALQFLQ  170

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
             AL++ANLN+QVK+S+P S D+I+K FPPSTA F
Sbjct  171  SALLAANLNTQVKLSSPHSMDMISKAFPPSTATF  204



>gb|EEC82319.1| hypothetical protein OsI_26597 [Oryza sativa Indica Group]
Length=521

 Score =   213 bits (541),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GAFVGIN+GTD+SN PSA D+V +LK ++I+H RL D+D  MLSAL+NTGIEV+VGV N+
Sbjct  51   GAFVGINVGTDISNPPSASDIVSILKEKKIQHVRLLDSDHQMLSALANTGIEVVVGVPND  110

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++L +GQS S AA W+NKNVAAY+P+TNIT IAVG+EVLT+ PNAA VLVPA+ +L  AL
Sbjct  111  QLLRVGQSRSTAADWINKNVAAYIPATNITHIAVGNEVLTTEPNAALVLVPALQFLQSAL  170

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++ANLN+QVK+S+P STD+I+K FPPSTA F
Sbjct  171  LAANLNTQVKISSPHSTDMISKPFPPSTATF  201



>ref|NP_001060087.2| Os07g0577300 [Oryza sativa Japonica Group]
 dbj|BAH01358.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF22001.2| Os07g0577300 [Oryza sativa Japonica Group]
Length=498

 Score =   212 bits (539),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N  GAFVGIN+GTD+SN PSA D V +LK ++I+H RL D+D  MLSAL+NTGIEV+VGV
Sbjct  25   NVSGAFVGINVGTDISNPPSASDTVSILKEKKIQHVRLLDSDHQMLSALANTGIEVVVGV  84

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
             N+++L +GQS S AA W+NKNVAAY+P+TNIT IAVG+EVLT+ PNAA VLVPA+ +L 
Sbjct  85   PNDQLLRVGQSRSTAADWINKNVAAYIPATNITHIAVGNEVLTTEPNAALVLVPALQFLQ  144

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
             AL++ANLN+QVK+S+P STD+I+K FPPSTA F
Sbjct  145  SALLAANLNTQVKISSPHSTDMISKPFPPSTATF  178



>ref|XP_006658732.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Oryza brachyantha]
Length=457

 Score =   210 bits (535),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N  G+FVGIN+GTD+S  PSA D+V +LK ++I+H RL D+D  ML+AL+NTGIEV+VGV
Sbjct  29   NVSGSFVGINVGTDISKPPSASDIVSILKEKKIQHVRLLDSDHQMLTALANTGIEVMVGV  88

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
             N+++L +GQS S AA W+NKNVAAY+P+TNIT IAVG+EVLT++PNAA VL+PA+ +L 
Sbjct  89   PNDQLLRVGQSRSTAADWINKNVAAYIPATNITYIAVGNEVLTTVPNAALVLIPALQFLQ  148

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
             AL++ANLN+QVK+S+P STD+I+K FPPSTA F
Sbjct  149  SALLAANLNTQVKISSPHSTDMISKPFPPSTATF  182



>ref|XP_010542461.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Tarenaya 
hassleriana]
 ref|XP_010542462.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Tarenaya 
hassleriana]
Length=509

 Score =   211 bits (538),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GAFVG+NIGTD++N+PS  D V LLK+ QI H RLFDA++HML AL+ +GIEV V VTN+
Sbjct  23   GAFVGVNIGTDITNMPSPSDAVVLLKSHQITHIRLFDANSHMLKALAGSGIEVTVSVTND  82

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            E+LGIG+  S AA+WVNKNVA+Y+PSTNITAIAVGSEVLT+IP+ AP LV A+N +HKAL
Sbjct  83   ELLGIGRYPSSAASWVNKNVASYVPSTNITAIAVGSEVLTTIPHVAPALVSALNNIHKAL  142

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHFQ  597
            V+ANLN +VKVS+P S D+I K FPPSTA F 
Sbjct  143  VAANLNFRVKVSSPMSMDIIPKPFPPSTATFN  174



>ref|XP_006828511.1| hypothetical protein AMTR_s00060p00188740 [Amborella trichopoda]
 gb|ERM95927.1| hypothetical protein AMTR_s00060p00188740 [Amborella trichopoda]
Length=526

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 126/153 (82%), Gaps = 0/153 (0%)
 Frame = +1

Query  136  FVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVT  315
            F GAFVG+N+GTDV+N+PS   VV LLK +QI  ARL+DAD  ML+AL+NTGI V+V V 
Sbjct  47   FAGAFVGVNVGTDVTNMPSPTQVVALLKKQQIHDARLYDADRAMLTALANTGIRVVVSVP  106

Query  316  NNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHK  495
            NN++L +GQS++ AA WV +NVAAYLP+TNIT IAVGSEVLTSIPNAA VLVPAMN+LH 
Sbjct  107  NNQLLAVGQSNATAANWVARNVAAYLPATNITGIAVGSEVLTSIPNAALVLVPAMNFLHS  166

Query  496  ALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ALV+ANL+ QVKVSTP S+D+I   FPPS A F
Sbjct  167  ALVAANLDRQVKVSTPHSSDIILDSFPPSQAFF  199



>gb|EEE67465.1| hypothetical protein OsJ_24859 [Oryza sativa Japonica Group]
Length=555

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GAFVGIN+GTD+SN PSA D V +LK ++I+H RL D+D  MLSAL+NTGIEV+VGV N+
Sbjct  85   GAFVGINVGTDISNPPSASDTVSILKEKKIQHVRLLDSDHQMLSALANTGIEVVVGVPND  144

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++L +GQS S AA W+NKNVAAY+P+TNIT IAVG+EVLT+ PNAA VLVPA+ +L  AL
Sbjct  145  QLLRVGQSRSTAADWINKNVAAYIPATNITHIAVGNEVLTTEPNAALVLVPALQFLQSAL  204

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++ANLN+QVK+S+P STD+I+K FPPSTA F
Sbjct  205  LAANLNTQVKISSPHSTDMISKPFPPSTATF  235



>ref|XP_002884972.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61231.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=501

 Score =   209 bits (532),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            A++G+NIGTD++N+PS  D+V LLK++QI H RL+DA++HML A +NT IEV+VGVTNNE
Sbjct  24   AYIGVNIGTDLTNMPSPSDIVTLLKSQQITHVRLYDANSHMLKAFANTSIEVMVGVTNNE  83

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +L IG+  S AAAWVNKNVAAY+PSTNITAIAVGSEVLT+IP+ AP+L  A+N +HKALV
Sbjct  84   ILRIGRFPSAAAAWVNKNVAAYIPSTNITAIAVGSEVLTTIPHVAPILASALNNIHKALV  143

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NLN +VKVS+P S D++ K FPPST+ F
Sbjct  144  ASNLNFKVKVSSPMSMDIMPKPFPPSTSTF  173



>gb|EYU27069.1| hypothetical protein MIMGU_mgv1a004989mg [Erythranthe guttata]
Length=501

 Score =   209 bits (531),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N VGA++G+NIGTDV+NLP   ++V +L+A QI H RLFD+DA +L+ALS TGI+V V V
Sbjct  19   NSVGAYIGVNIGTDVTNLPPPVEIVAILRAHQITHVRLFDSDARILNALSATGIQVHVSV  78

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
            TN EVLGIG+S+S AA W++KN+AAYLPSTNITAI+VGSEVLTS+PNAAP+L  AM+ LH
Sbjct  79   TNQEVLGIGESTSAAATWISKNIAAYLPSTNITAISVGSEVLTSLPNAAPILFSAMSNLH  138

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            KALV++NLN +VK+STP + D+I   FPPSTA+F
Sbjct  139  KALVASNLNDRVKISTPFAMDVIPNPFPPSTANF  172



>dbj|BAC83070.1| putative elicitor inducible beta-1,3-glucanase [Oryza sativa 
Japonica Group]
Length=666

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N  GAFVGIN+GTD+SN PSA D V +LK ++I+H RL D+D  MLSAL+NTGIEV+VGV
Sbjct  19   NVSGAFVGINVGTDISNPPSASDTVSILKEKKIQHVRLLDSDHQMLSALANTGIEVVVGV  78

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
             N+++L +GQS S AA W+NKNVAAY+P+TNIT IAVG+EVLT+ PNAA VLVPA+ +L 
Sbjct  79   PNDQLLRVGQSRSTAADWINKNVAAYIPATNITHIAVGNEVLTTEPNAALVLVPALQFLQ  138

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
             AL++ANLN+QVK+S+P STD+I+K FPPSTA F
Sbjct  139  SALLAANLNTQVKISSPHSTDMISKPFPPSTATF  172



>dbj|BAH57260.1| AT3G13560 [Arabidopsis thaliana]
Length=452

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGTD++N+P   D+V LLK++QI H RL+DA++HML A +NT IEV+VGVTN E
Sbjct  24   AFIGVNIGTDLTNMPPPSDIVTLLKSQQITHVRLYDANSHMLKAFANTSIEVMVGVTNEE  83

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +L IG+  S AAAWVNKNVAAY+PSTNITAIAVGSEVLT+IP+ AP+L  A+N +HKALV
Sbjct  84   ILKIGRFPSAAAAWVNKNVAAYIPSTNITAIAVGSEVLTTIPHVAPILASALNNIHKALV  143

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NLN +VKVS+P S D++ K FPPST+ F
Sbjct  144  ASNLNFKVKVSSPMSMDIMPKPFPPSTSTF  173



>emb|CDY59252.1| BnaA05g36990D [Brassica napus]
Length=408

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGTD++N+PS  D+V LLK+ QI H RL+DA++HML ALSNT I+V VGVTN E
Sbjct  24   AFIGVNIGTDLTNMPSPSDIVSLLKSHQITHVRLYDANSHMLKALSNTTIQVTVGVTNQE  83

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +L IG+  S AA+WVNKNVAAY+PSTNITAIAVGSEVLT  P+ AP+L  A+N +HKALV
Sbjct  84   ILKIGRFPSSAASWVNKNVAAYVPSTNITAIAVGSEVLTESPHVAPILASALNNIHKALV  143

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            + NLN QVKVSTP S D++ K FPPST+ F
Sbjct  144  ATNLNFQVKVSTPMSMDVMPKPFPPSTSTF  173



>ref|XP_004958122.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Setaria italica]
Length=653

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N  GAFVGI IG D+SNLPSA D+V +LKA++I+H RL D+D  ML+AL+NTGIEV+VGV
Sbjct  19   NVSGAFVGITIGNDMSNLPSATDIVAILKAKKIQHVRLIDSDHQMLTALANTGIEVMVGV  78

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
             N+++L +GQS S AA W+NKNVAAY+P+TNIT IAVG EVLT+IPNAA VL+PA+ +L 
Sbjct  79   PNDQLLRVGQSRSTAADWINKNVAAYVPATNITYIAVGDEVLTNIPNAALVLIPALQFLQ  138

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
             AL++ANLN+QVK+S+P S D+I+K FPPSTA F
Sbjct  139  SALLAANLNTQVKISSPHSMDMISKAFPPSTATF  172



>ref|XP_008789143.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Phoenix 
dactylifera]
Length=486

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N  G FVGI IGTD+SNLPSA D+V +LKA+ IKH RLFD D  ML+AL+NTGIEV+VGV
Sbjct  14   NVSGVFVGITIGTDMSNLPSASDIVSILKAQHIKHVRLFDTDHQMLNALANTGIEVMVGV  73

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
             N+++L +GQS + AA W+NKNVA+++P+TNIT IAVG+EVL++IPNA+ VLVPAM +L 
Sbjct  74   PNDQLLSVGQSRTVAADWINKNVASFVPATNITYIAVGNEVLSTIPNASLVLVPAMKFLQ  133

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
             ALV+ANLN QVKVS+PQS D++ K FPP TA F
Sbjct  134  SALVAANLNFQVKVSSPQSMDVMPKSFPPFTATF  167



>ref|XP_008789151.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X2 [Phoenix 
dactylifera]
Length=460

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N  G FVGI IGTD+SNLPSA D+V +LKA+ IKH RLFD D  ML+AL+NTGIEV+VGV
Sbjct  14   NVSGVFVGITIGTDMSNLPSASDIVSILKAQHIKHVRLFDTDHQMLNALANTGIEVMVGV  73

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
             N+++L +GQS + AA W+NKNVA+++P+TNIT IAVG+EVL++IPNA+ VLVPAM +L 
Sbjct  74   PNDQLLSVGQSRTVAADWINKNVASFVPATNITYIAVGNEVLSTIPNASLVLVPAMKFLQ  133

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
             ALV+ANLN QVKVS+PQS D++ K FPP TA F
Sbjct  134  SALVAANLNFQVKVSSPQSMDVMPKSFPPFTATF  167



>ref|XP_009388452.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=494

 Score =   206 bits (525),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N  G +VGINIG  VSNLPSA D+V +LK +QIKH RLFDA+  ML AL+NTGI+V++GV
Sbjct  19   NASGVYVGINIGNMVSNLPSAADIVSILKTQQIKHVRLFDANHQMLGALANTGIDVMLGV  78

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
             N+++L IG S S+AA W+NKNVAA++P TNIT IAVG+E+LTSIPNAA VLVPAM +L 
Sbjct  79   PNDQLLRIGNSRSEAADWINKNVAAFVPETNITYIAVGNEILTSIPNAALVLVPAMQFLQ  138

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
             ALV++NLNSQVKVS+P S D+I K FPPSTA F
Sbjct  139  SALVASNLNSQVKVSSPLSMDMIPKSFPPSTATF  172



>ref|XP_008449819.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X3 [Cucumis 
melo]
Length=498

 Score =   207 bits (526),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 121/151 (80%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GAFVGINIGT VS+LP A DVV +LK  +  H RL+DA+A +L A +N+  EV+VGVTN 
Sbjct  19   GAFVGINIGTHVSSLPPASDVVSMLKQYEFTHVRLYDANAQLLKAFANSSTEVMVGVTNE  78

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            EVL IG+S S AAAWVNKNV  Y P+TNITAIAVGSEVLTSIPNAA VL+ AM YLHKAL
Sbjct  79   EVLKIGKSPSAAAAWVNKNVVLYTPATNITAIAVGSEVLTSIPNAARVLIRAMKYLHKAL  138

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            V+ANLN Q+KVSTPQS D+I   FPPSTA F
Sbjct  139  VAANLNLQIKVSTPQSMDVILTSFPPSTATF  169



>tpg|DAA63295.1| TPA: putative O-Glycosyl hydrolase superfamily protein isoform 
1 [Zea mays]
 tpg|DAA63296.1| TPA: putative O-Glycosyl hydrolase superfamily protein isoform 
2 [Zea mays]
Length=494

 Score =   206 bits (525),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 128/156 (82%), Gaps = 0/156 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N  GAFVGI IG D+SN+P A D+V +LKA++I+H RL D+D  ML+AL+NTGIEV+VGV
Sbjct  19   NVSGAFVGITIGNDMSNIPPATDIVSILKAKKIQHVRLLDSDHQMLNALANTGIEVMVGV  78

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
             N+++L +GQS S AA W+NKNV AY+P+TNIT IAVG+EVLT+IPNAA VLVPA+ +L 
Sbjct  79   PNDQLLRVGQSRSTAADWINKNVGAYIPATNITYIAVGNEVLTTIPNAALVLVPALQFLQ  138

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHFQL  600
             AL++ANLN+QVK+S+P S D+I+K FPPS A F L
Sbjct  139  SALLAANLNTQVKISSPHSMDVISKAFPPSAATFNL  174



>ref|NP_187965.1| glucan endo-1,3-beta-glucosidase 4 [Arabidopsis thaliana]
 ref|NP_974302.1| glucan endo-1,3-beta-glucosidase 4 [Arabidopsis thaliana]
 ref|NP_974303.1| glucan endo-1,3-beta-glucosidase 4 [Arabidopsis thaliana]
 sp|Q94CD8.1|E134_ARATH RecName: Full=Glucan endo-1,3-beta-glucosidase 4; AltName: Full=(1->3)-beta-glucan 
endohydrolase 4; Short=(1->3)-beta-glucanase 
4; AltName: Full=Beta-1,3-endoglucanase 4; Short=Beta-1,3-glucanase 
4; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK59446.1| putative glucan endo-1,3-beta-glucosidase precursor [Arabidopsis 
thaliana]
 gb|AAL34291.1| putative glucan endo-1,3-beta-glucosidase precursor [Arabidopsis 
thaliana]
 dbj|BAH19959.1| AT3G13560 [Arabidopsis thaliana]
 gb|AEE75372.1| glucan endo-1,3-beta-glucosidase 4 [Arabidopsis thaliana]
 gb|AEE75373.1| glucan endo-1,3-beta-glucosidase 4 [Arabidopsis thaliana]
 gb|AEE75374.1| glucan endo-1,3-beta-glucosidase 4 [Arabidopsis thaliana]
Length=505

 Score =   207 bits (526),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGTD++N+P   D+V LLK++QI H RL+DA++HML A +NT IEV+VGVTN E
Sbjct  24   AFIGVNIGTDLTNMPPPSDIVTLLKSQQITHVRLYDANSHMLKAFANTSIEVMVGVTNEE  83

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +L IG+  S AAAWVNKNVAAY+PSTNITAIAVGSEVLT+IP+ AP+L  A+N +HKALV
Sbjct  84   ILKIGRFPSAAAAWVNKNVAAYIPSTNITAIAVGSEVLTTIPHVAPILASALNNIHKALV  143

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NLN +VKVS+P S D++ K FPPST+ F
Sbjct  144  ASNLNFKVKVSSPMSMDIMPKPFPPSTSTF  173



>ref|XP_008449817.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X2 [Cucumis 
melo]
Length=522

 Score =   207 bits (526),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 121/151 (80%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GAFVGINIGT VS+LP A DVV +LK  +  H RL+DA+A +L A +N+  EV+VGVTN 
Sbjct  43   GAFVGINIGTHVSSLPPASDVVSMLKQYEFTHVRLYDANAQLLKAFANSSTEVMVGVTNE  102

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            EVL IG+S S AAAWVNKNV  Y P+TNITAIAVGSEVLTSIPNAA VL+ AM YLHKAL
Sbjct  103  EVLKIGKSPSAAAAWVNKNVVLYTPATNITAIAVGSEVLTSIPNAARVLIRAMKYLHKAL  162

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            V+ANLN Q+KVSTPQS D+I   FPPSTA F
Sbjct  163  VAANLNLQIKVSTPQSMDVILTSFPPSTATF  193



>ref|XP_008449814.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Cucumis 
melo]
 ref|XP_008449815.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Cucumis 
melo]
 ref|XP_008449816.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Cucumis 
melo]
Length=525

 Score =   206 bits (525),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 121/151 (80%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GAFVGINIGT VS+LP A DVV +LK  +  H RL+DA+A +L A +N+  EV+VGVTN 
Sbjct  46   GAFVGINIGTHVSSLPPASDVVSMLKQYEFTHVRLYDANAQLLKAFANSSTEVMVGVTNE  105

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            EVL IG+S S AAAWVNKNV  Y P+TNITAIAVGSEVLTSIPNAA VL+ AM YLHKAL
Sbjct  106  EVLKIGKSPSAAAAWVNKNVVLYTPATNITAIAVGSEVLTSIPNAARVLIRAMKYLHKAL  165

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            V+ANLN Q+KVSTPQS D+I   FPPSTA F
Sbjct  166  VAANLNLQIKVSTPQSMDVILTSFPPSTATF  196



>gb|EMS53703.1| Glucan endo-1,3-beta-glucosidase 4 [Triticum urartu]
Length=477

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N  GAFVGINIGT VS+LPSA D++  LKA +I+H RL D+D  ML AL+NTGIEV+VGV
Sbjct  19   NASGAFVGINIGTGVSDLPSASDIISTLKAMKIQHVRLVDSDHQMLVALANTGIEVMVGV  78

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
             N+++L +GQS   AA WVNKNVAAY P+TNIT IAVG EVLTSIPNAA VLVPA+ +L 
Sbjct  79   PNDQLLRVGQSRPAAADWVNKNVAAYTPATNITYIAVGDEVLTSIPNAALVLVPALQFLQ  138

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
             AL++ANLN+QVK+S+P S D+I K FPPSTA F
Sbjct  139  SALLAANLNTQVKLSSPHSMDMIPKAFPPSTATF  172



>ref|XP_009146477.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Brassica rapa]
 ref|XP_009146478.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Brassica rapa]
Length=502

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGTD++N+PS  D+V LLK+ QI H RL+DA++HML ALSNT I+V VGVTN E
Sbjct  25   AFIGVNIGTDLTNMPSPSDIVSLLKSHQITHVRLYDANSHMLKALSNTTIQVTVGVTNQE  84

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +L IG+  S AA+WVNKNVAAY+PSTNITAIAVGSEVLT  P+ AP+L  A+N +HKALV
Sbjct  85   ILKIGRFPSSAASWVNKNVAAYVPSTNITAIAVGSEVLTESPHVAPILASALNNIHKALV  144

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            + NLN QVKVSTP S D++ K FPPST+ F
Sbjct  145  ATNLNFQVKVSTPMSMDVMPKPFPPSTSTF  174



>ref|XP_010236492.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Brachypodium distachyon]
Length=501

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 128/154 (83%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N  GAFVG+++GT VS+LPS  D+V +LKA++I+H RL D+D  ML AL+NTGIEV+VGV
Sbjct  28   NASGAFVGVHVGTGVSDLPSPSDIVSILKAKRIQHVRLVDSDHKMLVALANTGIEVMVGV  87

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
             N+++L +GQS S AA W+NKNVAAY+P+TNIT IAVG EVLT+IPNAA VLVPA+ +L 
Sbjct  88   PNDQLLRVGQSRSTAADWINKNVAAYIPATNITYIAVGDEVLTTIPNAALVLVPALQFLQ  147

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
             AL++ANLN+QVK+S+P S D+I+K FPPSTA F
Sbjct  148  SALLAANLNTQVKISSPHSMDMISKAFPPSTATF  181



>ref|XP_004142250.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Cucumis sativus]
Length=535

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 121/151 (80%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GAFVGINIGT VS+LP A DVV +LK  +  H RL+DA+A +L A +N+  EV+VGVTN 
Sbjct  46   GAFVGINIGTHVSSLPPASDVVSMLKQFEFTHVRLYDANAQLLKAFANSSTEVMVGVTNE  105

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            EVL IG+S S AAAWVNKNV  Y P+TNITAIAVGSEVLTSIPNAA VL+ AM YLHKAL
Sbjct  106  EVLKIGKSPSAAAAWVNKNVVLYTPATNITAIAVGSEVLTSIPNAARVLLRAMKYLHKAL  165

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            V+ANLN Q+KVSTPQS D+I   FPPSTA F
Sbjct  166  VAANLNLQIKVSTPQSMDVILTSFPPSTATF  196



>gb|KGN54064.1| hypothetical protein Csa_4G280410 [Cucumis sativus]
Length=526

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 121/151 (80%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GAFVGINIGT VS+LP A DVV +LK  +  H RL+DA+A +L A +N+  EV+VGVTN 
Sbjct  46   GAFVGINIGTHVSSLPPASDVVSMLKQFEFTHVRLYDANAQLLKAFANSSTEVMVGVTNE  105

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            EVL IG+S S AAAWVNKNV  Y P+TNITAIAVGSEVLTSIPNAA VL+ AM YLHKAL
Sbjct  106  EVLKIGKSPSAAAAWVNKNVVLYTPATNITAIAVGSEVLTSIPNAARVLLRAMKYLHKAL  165

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            V+ANLN Q+KVSTPQS D+I   FPPSTA F
Sbjct  166  VAANLNLQIKVSTPQSMDVILTSFPPSTATF  196



>emb|CDY23618.1| BnaC05g39760D [Brassica napus]
Length=421

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 122/150 (81%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGTD++N+PS  D+V LLK+ QI H RL+DA++HML A +NT I+V VGVTN E
Sbjct  38   AFIGVNIGTDLTNMPSPSDIVSLLKSHQITHVRLYDANSHMLKAFANTTIQVTVGVTNQE  97

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +L IG+  S AA+W+NKNVAAY+PSTNITAIAVGSEVLT  P+ AP+L  A+N +HKALV
Sbjct  98   ILKIGRFPSSAASWINKNVAAYVPSTNITAIAVGSEVLTQSPHVAPILASALNNIHKALV  157

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            + NLN QVKVSTP S D++ K FPPST+ F
Sbjct  158  AMNLNFQVKVSTPMSMDVMPKPFPPSTSTF  187



>gb|EMS60322.1| Glucan endo-1,3-beta-glucosidase 4 [Triticum urartu]
Length=627

 Score =   207 bits (527),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 128/154 (83%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N  GAFVGINIGT+VS+LPSA D+V +LKA++I+H RL D++  ML AL+NTGIEV+VGV
Sbjct  95   NASGAFVGINIGTNVSDLPSASDIVSILKAKKIQHVRLVDSNHEMLVALANTGIEVMVGV  154

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
             NNE+L +GQS   AA W+NKNVAAY+P+TNIT IAVG E+LT++PNAA VLVPA+ +L 
Sbjct  155  PNNELLRVGQSRPTAADWINKNVAAYIPATNITYIAVGDEILTTVPNAALVLVPALQFLQ  214

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
             AL++ANLN+QVK+S+P S D+I+K FPPS A F
Sbjct  215  SALLAANLNTQVKLSSPHSMDMISKAFPPSAATF  248



>ref|XP_002460914.1| hypothetical protein SORBIDRAFT_02g037380 [Sorghum bicolor]
 gb|EER97435.1| hypothetical protein SORBIDRAFT_02g037380 [Sorghum bicolor]
Length=494

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N  GAFVGI IG D+SN+P A D+V +LKA++ +H RL D+D  ML+AL+NTGIEV+VGV
Sbjct  19   NVSGAFVGITIGNDMSNMPPATDIVSILKAKKTQHVRLLDSDHQMLTALANTGIEVMVGV  78

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
             N+++L +GQS S AA W+NKNVAAY P+TNIT IAVG+EVLT+IPNAA VLVPA+ +L 
Sbjct  79   PNDQLLRVGQSRSTAADWINKNVAAYTPATNITYIAVGNEVLTTIPNAALVLVPALQFLQ  138

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
             AL++ANLN+QVK+S+P S D+I+K FPPS A F
Sbjct  139  SALLAANLNTQVKISSPHSMDVISKAFPPSAATF  172



>ref|XP_010552278.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Tarenaya 
hassleriana]
Length=507

 Score =   204 bits (520),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GAFVG+N+GTD++ +PS  DVV LLK+ QI H RL++AD+HML AL+N+ IEV+VGVTN+
Sbjct  23   GAFVGVNLGTDITKMPSPSDVVSLLKSHQITHIRLYNADSHMLKALANSNIEVMVGVTND  82

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            E++ IG++ S AA+W+++NV +Y+PSTNITAI++GSEVLT+IP+ APVLV A+N +HKAL
Sbjct  83   ELISIGRNPSSAASWISENVVSYVPSTNITAISIGSEVLTTIPHVAPVLVLALNNVHKAL  142

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHFQ  597
            V+ANLN +VKVSTP S D+I K FPPSTA F 
Sbjct  143  VAANLNFKVKVSTPMSMDIIPKPFPPSTATFD  174



>ref|XP_010934539.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Elaeis guineensis]
 ref|XP_010934546.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Elaeis guineensis]
 ref|XP_010934552.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Elaeis guineensis]
Length=492

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N  G +VGI IGTD+SNLPSA D+V +LKA++IKH RLFD D  ML+AL+NTGIEV+VGV
Sbjct  20   NVSGVYVGITIGTDMSNLPSASDIVSILKAQRIKHVRLFDTDHQMLNALANTGIEVMVGV  79

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
             N+++L IGQS + AA W+NKNVAA++P+TNIT IAVG+EVL++IPNA+ VLVPAM +L 
Sbjct  80   PNDQLLSIGQSRTVAADWINKNVAAFVPATNITYIAVGNEVLSTIPNASFVLVPAMKFLQ  139

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHFQ  597
             ALV+ANLN  VKVS+PQS D++ K FPP TA F 
Sbjct  140  SALVAANLNFLVKVSSPQSMDVMPKSFPPFTATFN  174



>ref|NP_001149308.1| glucan endo-1,3-beta-glucosidase 4 precursor [Zea mays]
 gb|ACG34964.1| glucan endo-1,3-beta-glucosidase 4 precursor [Zea mays]
Length=494

 Score =   203 bits (517),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 127/156 (81%), Gaps = 0/156 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N  GAFVGI IG D+SN+P A  +V +LKA++I+H RL D+D  ML+AL+NTGIEV+VGV
Sbjct  19   NVSGAFVGITIGNDMSNIPPATGIVSILKAKKIQHVRLLDSDHQMLNALANTGIEVMVGV  78

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
             N+++L +GQS S AA W+NKNV AY+P+TNIT IAVG+EVLT+IPNAA VLVPA+ +L 
Sbjct  79   PNDQLLRVGQSRSTAADWINKNVGAYIPATNITYIAVGNEVLTTIPNAALVLVPALQFLQ  138

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHFQL  600
             AL++ANLN+QVK+S+P S D+I+K FPPS A F L
Sbjct  139  SALLAANLNTQVKISSPHSMDVISKAFPPSAATFNL  174



>dbj|BAJ89950.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=496

 Score =   203 bits (517),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N  GAFVGINIGT VS+L S  D+V +LKA++I+H RL D++  ML AL+NTGIEV+VGV
Sbjct  25   NTSGAFVGINIGTRVSDLTSPSDIVSILKAKKIQHVRLVDSNHEMLVALANTGIEVMVGV  84

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
             NN +L +GQS S AA W+NKNVAAY+P+TNIT IAVG E+LT++PNAA VLVPA+ +L 
Sbjct  85   PNNHLLRVGQSRSTAADWINKNVAAYIPATNITYIAVGDEILTTVPNAALVLVPALQFLQ  144

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
             AL++ANLN+QVK+S+P S D+I+K FPPSTA F
Sbjct  145  SALLAANLNTQVKISSPHSMDMISKAFPPSTATF  178



>ref|XP_006407197.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
 ref|XP_006407198.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
 ref|XP_006407199.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
 gb|ESQ48650.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
 gb|ESQ48651.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
 gb|ESQ48652.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
Length=500

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGT ++N+PS  D+V LLK+RQI H RL+DA++HML A +NT IEV+VGVTN E
Sbjct  21   AFIGVNIGTGLTNMPSPSDIVTLLKSRQITHVRLYDANSHMLKAFANTSIEVMVGVTNEE  80

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +L IG+  S AA+WVNKNVAAY+PSTNITAIAVGSEVLT  P+ AP+L  A+N +HKALV
Sbjct  81   ILKIGRYPSAAASWVNKNVAAYVPSTNITAIAVGSEVLTITPHVAPILASALNNIHKALV  140

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NLN +VKVS+P S D++ K FPPST+ F
Sbjct  141  ASNLNFKVKVSSPMSMDIMPKPFPPSTSTF  170



>ref|XP_004162024.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
4-like [Cucumis sativus]
Length=623

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 121/151 (80%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GAFVGINIGT VS+LP A DVV +LK  +  H RL+DA+A +L A +N+  EV+VGVTN 
Sbjct  134  GAFVGINIGTHVSSLPPASDVVSMLKQFEFTHVRLYDANAQLLKAFANSSTEVMVGVTNE  193

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            EVL IG+S S AAAWVNKNV  Y P+TNITAIAVGSEVLTSIPNAA VL+ AM YLHKAL
Sbjct  194  EVLKIGKSPSAAAAWVNKNVVLYTPATNITAIAVGSEVLTSIPNAARVLLRAMKYLHKAL  253

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            V+ANLN Q+KVSTPQS D+I   FPPSTA F
Sbjct  254  VAANLNLQIKVSTPQSMDVILTSFPPSTATF  284



>emb|CBI16509.3| unnamed protein product [Vitis vinifera]
Length=528

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N +GAFVG+NIGTDVSNLPSA  +V +LKA QI H RL+DADAHML+AL+NTGIEV+VGV
Sbjct  20   NALGAFVGVNIGTDVSNLPSASVLVGILKAHQITHVRLYDADAHMLNALANTGIEVVVGV  79

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
            TN EVLGIGQS S AA W+N+NVAAY+PSTNITAIAVGSEVLTSIP+AAPVLVPAMNYLH
Sbjct  80   TNEEVLGIGQSPSTAATWINRNVAAYVPSTNITAIAVGSEVLTSIPHAAPVLVPAMNYLH  139

Query  493  KALV  504
            KAL+
Sbjct  140  KALM  143



>ref|NP_001131285.1| putative O-Glycosyl hydrolase superfamily protein isoform 1 precursor 
[Zea mays]
 gb|ACF79625.1| unknown [Zea mays]
 gb|ACL53366.1| unknown [Zea mays]
 tpg|DAA41198.1| TPA: putative O-Glycosyl hydrolase superfamily protein isoform 
1 [Zea mays]
 tpg|DAA41199.1| TPA: putative O-Glycosyl hydrolase superfamily protein isoform 
2 [Zea mays]
Length=492

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N  GAFVGI IG D+SN+P A D+V +LKA++I+H RL D+D  ML+AL+NTGIEV+VGV
Sbjct  19   NVSGAFVGITIGNDMSNIPPATDIVSILKAKKIQHVRLLDSDHQMLTALANTGIEVMVGV  78

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
             N+++L +GQS S AA W+NKNV AY+P+TNIT IAVG+EVLT+IPNAA VL+PA+ +L 
Sbjct  79   PNDQLLRVGQSRSTAADWINKNVNAYIPATNITYIAVGNEVLTTIPNAALVLIPALQFLQ  138

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
             AL++ANL++QVK+S+P S D+I+K FPPS A F
Sbjct  139  SALLAANLDTQVKISSPHSMDVISKAFPPSAATF  172



>ref|XP_010465199.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Camelina sativa]
 ref|XP_010465200.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Camelina sativa]
Length=507

 Score =   201 bits (512),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGTDV+N+PS  D+V LL ++QI H RL+DA++HML A +NT IEV+VGVTN E
Sbjct  24   AFIGVNIGTDVTNMPSPSDIVALLNSQQITHVRLYDANSHMLKAFANTSIEVMVGVTNGE  83

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +L IG+  S AAAWVNKNVAAY+PSTNITAIAVGSEVL++ P+ AP+L  A++ +HKALV
Sbjct  84   ILKIGRFPSAAAAWVNKNVAAYVPSTNITAIAVGSEVLSAAPHVAPILASALHNIHKALV  143

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NLN +VKVS+P S D++ K FPPST+ F
Sbjct  144  ASNLNFKVKVSSPMSMDIMPKPFPPSTSTF  173



>ref|XP_010500722.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Camelina sativa]
 ref|XP_010500729.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Camelina sativa]
Length=507

 Score =   201 bits (512),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGTDV+N+PS  D+V LL ++QI H RL+DA++HML A +NT IEV+VGVTN E
Sbjct  24   AFIGVNIGTDVTNMPSPSDIVALLNSQQITHVRLYDANSHMLKAFANTSIEVMVGVTNGE  83

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +L IG+  S AAAWVNKNVAAY+PSTNITAIAVGSEVL++ P+ AP+L  A++ +HKALV
Sbjct  84   ILKIGRFPSAAAAWVNKNVAAYVPSTNITAIAVGSEVLSAAPHVAPILASALHNIHKALV  143

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NLN +VKVS+P S D++ K FPPST+ F
Sbjct  144  ASNLNFKVKVSSPMSMDIMPKPFPPSTSTF  173



>gb|EPS57592.1| hypothetical protein M569_17225, partial [Genlisea aurea]
Length=237

 Score =   194 bits (492),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 117/151 (77%), Gaps = 0/151 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AFVGINIGTD+SN PS  D+V LL++  I H RLFD+D H+L ALS TGIEV + V N E
Sbjct  1    AFVGINIGTDISNPPSPADMVSLLRSHHITHVRLFDSDPHILRALSGTGIEVAITVKNEE  60

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            ++GIG+  S+AA W+N+NV  +LPSTNITA+ VG+EVLTS P+ APVLVPAM  LH+ALV
Sbjct  61   LVGIGEIPSRAADWINRNVVPHLPSTNITAVCVGTEVLTSAPHVAPVLVPAMANLHRALV  120

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHFQ  597
            S++LN  VKVSTP S D++   FPPS+A F 
Sbjct  121  SSDLNFLVKVSTPHSMDVVPAPFPPSSAAFN  151



>ref|XP_009762818.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Nicotiana 
sylvestris]
Length=508

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AFVG+NIGTDVS++PS   VV LLKA+QI+H RLFDAD  ML AL+NTGI V V V N++
Sbjct  31   AFVGVNIGTDVSDMPSPAKVVALLKAQQIRHVRLFDADQAMLLALANTGIHVTVSVPNDQ  90

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS+S AA WV++N+  + P+TNITAIA+GSEVLTS+PNAAPVLV AM ++H ALV
Sbjct  91   LLGIGQSNSTAANWVSRNILTHFPATNITAIAIGSEVLTSLPNAAPVLVSAMRFIHSALV  150

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +ANL+S++KVSTP S+ ++   FPPS A F
Sbjct  151  AANLDSKIKVSTPHSSSIVLDSFPPSQAFF  180



>gb|KJB66065.1| hypothetical protein B456_010G126400 [Gossypium raimondii]
 gb|KJB66068.1| hypothetical protein B456_010G126400 [Gossypium raimondii]
Length=458

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = +1

Query  184  LPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEVLGIGQSSSQAAA  363
            +PSA +VV ++K  +I H RL+DAD+HML AL+++GIEV VGVTN EVLGIG+S+S AAA
Sbjct  1    MPSASEVVSIIKTHRITHVRLYDADSHMLKALADSGIEVTVGVTNEEVLGIGESASAAAA  60

Query  364  WVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSANLNSQVKVSTP  543
            WVNKNVA+Y+PSTNITAIAVGSEVLTSIP+AAP+LV AMN LHKALV++NLN QVKVS+P
Sbjct  61   WVNKNVASYVPSTNITAIAVGSEVLTSIPHAAPILVTAMNNLHKALVASNLNFQVKVSSP  120

Query  544  QSTDLIAKIFPPSTAHF  594
            Q  D+I + FPP TA F
Sbjct  121  QPLDIIPEPFPPCTAAF  137



>gb|EMT28432.1| Glucan endo-1,3-beta-glucosidase 4 [Aegilops tauschii]
Length=695

 Score =   202 bits (515),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 123/154 (80%), Gaps = 0/154 (0%)
 Frame = +1

Query  133  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGV  312
            N  GAFVGINIGT VS+LPSA D+V  LK  +I+H RL D+D  ML AL+NTGIEV+VGV
Sbjct  19   NASGAFVGINIGTGVSDLPSASDIVSTLKTMKIQHVRLVDSDHQMLVALANTGIEVMVGV  78

Query  313  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  492
             N+++L +GQS   A  WVNKNVAAY+P+TNIT IAVG EVLTS+PNAA VLVPA+ +L 
Sbjct  79   PNDQLLRVGQSRPAAVDWVNKNVAAYIPATNITYIAVGDEVLTSLPNAALVLVPALQFLQ  138

Query  493  KALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
             AL++ANLN+QVK+S+P S D+I K FPPSTA F
Sbjct  139  SALLAANLNTQVKLSSPHSMDMIPKAFPPSTATF  172



>ref|XP_010527795.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Tarenaya hassleriana]
Length=499

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AFVG+NIGTD++++PS   VV LLK + I+H RL+DAD  ML AL+NTGIEVIV V N++
Sbjct  21   AFVGVNIGTDLTDMPSPTQVVALLKTQNIRHVRLYDADRAMLLALANTGIEVIVSVPNDQ  80

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV +NVAAY+P+TNITA+AVGSEVLT++PNAAPVLV A+ YL  ALV
Sbjct  81   LLGIGQSNATAANWVTRNVAAYVPATNITAVAVGSEVLTTVPNAAPVLVSALKYLQSALV  140

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +ANL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  141  AANLDRQIKVSTPHSSSIILDSFPPSQAFF  170



>ref|XP_010528550.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 [Tarenaya hassleriana]
Length=500

 Score =   198 bits (504),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 124/152 (82%), Gaps = 0/152 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GAF+G+NIGTD+S++P    VV LLKA+QIKH RL+D+D  ML ALSNTGI+V+V V N+
Sbjct  26   GAFIGVNIGTDLSDMPHPTQVVALLKAQQIKHIRLYDSDPGMLIALSNTGIKVVVSVPND  85

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++LGIGQS+S AA WV +NV A+ P+TNITAIAVGSEVLT++PNAAP+LV A+  +H AL
Sbjct  86   QLLGIGQSNSTAANWVKRNVIAHYPATNITAIAVGSEVLTTLPNAAPILVNAIKNIHSAL  145

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHFQ  597
            +SANL+ ++KVSTP STDLI   FPPS A F 
Sbjct  146  LSANLDGRIKVSTPLSTDLILDPFPPSQAFFN  177



>ref|XP_006297495.1| hypothetical protein CARUB_v10013514mg [Capsella rubella]
 gb|EOA30393.1| hypothetical protein CARUB_v10013514mg [Capsella rubella]
Length=499

 Score =   198 bits (503),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGTD++N+PS  +VVELL ++QI H RL+DA++HML A +N+ IEV+VGVTN E
Sbjct  24   AFIGVNIGTDLTNMPSPSEVVELLNSQQITHVRLYDANSHMLKAFANSSIEVMVGVTNEE  83

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +L IG+  S AAAWVNKNVAAY+PSTNITAIAVGSEVLT+ P+ AP+L  A++ +HKALV
Sbjct  84   ILKIGRFPSAAAAWVNKNVAAYIPSTNITAIAVGSEVLTTNPHVAPILASALHNIHKALV  143

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NLN +VKVS+P S  ++ K FPPST+ F
Sbjct  144  ASNLNFKVKVSSPMSMGIMPKPFPPSTSTF  173



>ref|XP_006599427.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X4 
[Glycine max]
Length=424

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGTDV+N+PS  +VV LLKA+ I+H RL+DAD  ML AL+NTGI VIV V N++
Sbjct  21   AFIGVNIGTDVTNMPSPTEVVALLKAQGIQHVRLYDADRAMLRALANTGIRVIVSVPNDQ  80

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLTS+PNAAPVLV A+ ++  ALV
Sbjct  81   ILGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLTSLPNAAPVLVSALKFIQAALV  140

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +ANL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  141  AANLDQQIKVSTPHSSSVILDSFPPSQAFF  170



>ref|XP_006599426.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X3 
[Glycine max]
Length=445

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGTDV+N+PS  +VV LLKA+ I+H RL+DAD  ML AL+NTGI VIV V N++
Sbjct  21   AFIGVNIGTDVTNMPSPTEVVALLKAQGIQHVRLYDADRAMLRALANTGIRVIVSVPNDQ  80

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLTS+PNAAPVLV A+ ++  ALV
Sbjct  81   ILGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLTSLPNAAPVLVSALKFIQAALV  140

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +ANL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  141  AANLDQQIKVSTPHSSSVILDSFPPSQAFF  170



>ref|XP_009602434.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Nicotiana 
tomentosiformis]
Length=512

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AFVG+NIGTDVS++PS   VV LLKA+QI+H RLFDAD  ML AL+NTGI V V V N++
Sbjct  31   AFVGVNIGTDVSDMPSPSKVVALLKAQQIRHVRLFDADQAMLLALANTGIRVTVSVPNDQ  90

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS+S AA WV++N+  + P+TNITAIA+GSEVLT++PNAAPVLV AM +++ ALV
Sbjct  91   LLGIGQSNSTAANWVSRNILTHFPATNITAIAIGSEVLTTLPNAAPVLVSAMRFIYSALV  150

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +ANL+S++KVSTP S+ ++   FPPS A F
Sbjct  151  AANLDSKIKVSTPHSSSIVLDSFPPSQAFF  180



>ref|XP_003548935.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X1 
[Glycine max]
Length=496

 Score =   196 bits (498),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGTDV+N+PS  +VV LLKA+ I+H RL+DAD  ML AL+NTGI VIV V N++
Sbjct  21   AFIGVNIGTDVTNMPSPTEVVALLKAQGIQHVRLYDADRAMLRALANTGIRVIVSVPNDQ  80

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLTS+PNAAPVLV A+ ++  ALV
Sbjct  81   ILGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLTSLPNAAPVLVSALKFIQAALV  140

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +ANL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  141  AANLDQQIKVSTPHSSSVILDSFPPSQAFF  170



>ref|XP_010653417.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X2 [Vitis 
vinifera]
Length=480

 Score =   195 bits (496),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGTD+SN+P+   VV LLK++QI+H RL+DAD  ML AL+NTGI V V V N++
Sbjct  3    AFIGVNIGTDLSNMPNPTQVVALLKSQQIRHVRLYDADRAMLLALANTGIRVTVSVPNDQ  62

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+ ++H ALV
Sbjct  63   LLGIGQSNATAANWVARNVLAHIPATNITAIAVGSEVLTTLPNAAPVLVSALKFIHSALV  122

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +ANL+SQ+KVSTP S+ ++   FPPS A F
Sbjct  123  AANLDSQIKVSTPHSSSILLDSFPPSQAFF  152



>gb|KEH40580.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=506

 Score =   196 bits (497),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 122/150 (81%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            A++G+NIGTDV+N+PS  + V LLKA+ I+H RLFDAD  ML AL+ TGI+VIV V N+E
Sbjct  22   AYIGVNIGTDVTNMPSPTETVALLKAQNIQHVRLFDADKSMLLALAKTGIQVIVSVPNDE  81

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV +NV A++PSTNITAIAVGSEVLTS+PNAAPVLV A+ ++  ALV
Sbjct  82   LLGIGQSNATAANWVARNVIAHVPSTNITAIAVGSEVLTSLPNAAPVLVSALQFIQSALV  141

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +ANL+ Q+KVSTP ST +I   FPPS A F
Sbjct  142  AANLDDQIKVSTPLSTSIILDSFPPSQAFF  171



>emb|CBI26850.3| unnamed protein product [Vitis vinifera]
Length=498

 Score =   195 bits (496),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGTD+SN+P+   VV LLK++QI+H RL+DAD  ML AL+NTGI V V V N++
Sbjct  21   AFIGVNIGTDLSNMPNPTQVVALLKSQQIRHVRLYDADRAMLLALANTGIRVTVSVPNDQ  80

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+ ++H ALV
Sbjct  81   LLGIGQSNATAANWVARNVLAHIPATNITAIAVGSEVLTTLPNAAPVLVSALKFIHSALV  140

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +ANL+SQ+KVSTP S+ ++   FPPS A F
Sbjct  141  AANLDSQIKVSTPHSSSILLDSFPPSQAFF  170



>gb|KEH40581.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=498

 Score =   195 bits (496),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 122/150 (81%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            A++G+NIGTDV+N+PS  + V LLKA+ I+H RLFDAD  ML AL+ TGI+VIV V N+E
Sbjct  22   AYIGVNIGTDVTNMPSPTETVALLKAQNIQHVRLFDADKSMLLALAKTGIQVIVSVPNDE  81

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV +NV A++PSTNITAIAVGSEVLTS+PNAAPVLV A+ ++  ALV
Sbjct  82   LLGIGQSNATAANWVARNVIAHVPSTNITAIAVGSEVLTSLPNAAPVLVSALQFIQSALV  141

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +ANL+ Q+KVSTP ST +I   FPPS A F
Sbjct  142  AANLDDQIKVSTPLSTSIILDSFPPSQAFF  171



>ref|XP_010653375.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X1 [Vitis 
vinifera]
Length=512

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGTD+SN+P+   VV LLK++QI+H RL+DAD  ML AL+NTGI V V V N++
Sbjct  35   AFIGVNIGTDLSNMPNPTQVVALLKSQQIRHVRLYDADRAMLLALANTGIRVTVSVPNDQ  94

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+ ++H ALV
Sbjct  95   LLGIGQSNATAANWVARNVLAHIPATNITAIAVGSEVLTTLPNAAPVLVSALKFIHSALV  154

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +ANL+SQ+KVSTP S+ ++   FPPS A F
Sbjct  155  AANLDSQIKVSTPHSSSILLDSFPPSQAFF  184



>emb|CDP00829.1| unnamed protein product [Coffea canephora]
Length=507

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
             F+G+NIGTD+S++P    VV LLKA+QI+H RL+DAD  ML AL+NTGI V V V N++
Sbjct  30   GFIGVNIGTDLSDMPDPTQVVALLKAQQIRHVRLYDADRAMLLALANTGIRVTVSVPNDQ  89

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV++NV A++P+TNITAIAVGSEVLT++PNAAPVLV AMN++  ALV
Sbjct  90   LLGIGQSNATAANWVSRNVIAHIPATNITAIAVGSEVLTTLPNAAPVLVAAMNFIQSALV  149

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHFQLLVE  609
            ++NL SQ+KVSTP S+ +I   FPPS A F   +E
Sbjct  150  ASNLASQIKVSTPHSSSIILDSFPPSQAFFNRTLE  184



>ref|XP_006858991.1| hypothetical protein AMTR_s00068p00134210 [Amborella trichopoda]
 gb|ERN20458.1| hypothetical protein AMTR_s00068p00134210 [Amborella trichopoda]
Length=506

 Score =   194 bits (492),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 121/151 (80%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            G FVG+NIG D+S+ PSA+D+  LL++  + H RLFDAD  +L+AL+ TGI+V VG+ N 
Sbjct  23   GGFVGVNIGMDLSSSPSAEDIAALLRSEGVTHVRLFDADRKLLAALAGTGIQVTVGIPNT  82

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            E+L IGQS S AAAWVN NVAA LP TNITAIAVGSEVLTS+PNAA +LVPA+  +H AL
Sbjct  83   ELLRIGQSPSAAAAWVNLNVAAQLPDTNITAIAVGSEVLTSLPNAALILVPALTNIHAAL  142

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            V++ L+SQ+KVS+PQ+ D++ + FPPSTA F
Sbjct  143  VASALDSQIKVSSPQAMDIVVQFFPPSTASF  173



>ref|XP_004236940.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Solanum lycopersicum]
Length=505

 Score =   194 bits (492),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AFVG+NIGTDVS++PS   VV LLKA+QI+H RLFDAD  ML AL++T I VIV V N++
Sbjct  28   AFVGVNIGTDVSDMPSPAQVVALLKAQQIRHVRLFDADQAMLLALAHTEIRVIVSVPNDQ  87

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS+S AA WV++N+ +++P+TNITAIA+GSEVLT++PNAAP+LV AM ++H ALV
Sbjct  88   LLGIGQSNSTAANWVSRNILSHVPATNITAIAIGSEVLTTLPNAAPLLVSAMKFIHSALV  147

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +ANL++++KVSTP S+ +I   FPPS A F
Sbjct  148  AANLDTKIKVSTPHSSFIILDSFPPSQAFF  177



>ref|XP_009388453.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=463

 Score =   192 bits (489),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = +1

Query  175  VSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEVLGIGQSSSQ  354
            VSNLPSA D+V +LK +QIKH RLFDA+  ML AL+NTGI+V++GV N+++L IG S S+
Sbjct  2    VSNLPSAADIVSILKTQQIKHVRLFDANHQMLGALANTGIDVMLGVPNDQLLRIGNSRSE  61

Query  355  AAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSANLNSQVKV  534
            AA W+NKNVAA++P TNIT IAVG+E+LTSIPNAA VLVPAM +L  ALV++NLNSQVKV
Sbjct  62   AADWINKNVAAFVPETNITYIAVGNEILTSIPNAALVLVPAMQFLQSALVASNLNSQVKV  121

Query  535  STPQSTDLIAKIFPPSTAHF  594
            S+P S D+I K FPPSTA F
Sbjct  122  SSPLSMDMIPKSFPPSTATF  141



>ref|XP_011070588.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Sesamum indicum]
Length=499

 Score =   193 bits (491),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AFVG+NIGT +S++P    VV LLKA+QI+H RL+D D  ML AL+N+GI VIV V N++
Sbjct  22   AFVGVNIGTALSDMPDPTQVVALLKAQQIRHVRLYDTDQAMLRALANSGIRVIVSVPNDQ  81

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV++N+ A++P+TNI+AIAVGSEVLT++PNAAPVLV AMN++H ALV
Sbjct  82   LLGIGQSNATAANWVSRNILAHVPATNISAIAVGSEVLTTLPNAAPVLVSAMNFIHSALV  141

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +ANL+S +KVSTP S+ +I   FPPS A F
Sbjct  142  AANLDSHIKVSTPHSSSIILDSFPPSQAFF  171



>ref|XP_006448191.1| hypothetical protein CICLE_v10014990mg [Citrus clementina]
 ref|XP_006469226.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Citrus sinensis]
 gb|ESR61431.1| hypothetical protein CICLE_v10014990mg [Citrus clementina]
Length=499

 Score =   193 bits (490),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 122/150 (81%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGTD+S++PS   VV LLKA+ I+H RL+DAD  ML AL+NTGI+V + V N++
Sbjct  22   AFIGVNIGTDLSDMPSPTQVVALLKAQNIRHIRLYDADRAMLLALANTGIQVTISVPNDQ  81

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV +NVAA++P+TNITAIAVGSEVLT +PNA PVLV A+ ++H ALV
Sbjct  82   LLGIGQSNATAANWVARNVAAHVPTTNITAIAVGSEVLTVLPNAGPVLVSALKFIHSALV  141

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +ANL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  142  AANLDDQIKVSTPHSSSIILDSFPPSQAFF  171



>gb|KHN00662.1| Glucan endo-1,3-beta-glucosidase 3 [Glycine soja]
Length=483

 Score =   192 bits (489),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 121/150 (81%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGTD +N+PS  +VV LLKA+ I+H RL+DAD  ML  L+NTGI VIV V N++
Sbjct  8    AFIGVNIGTDATNMPSPTEVVALLKAQGIQHVRLYDADRAMLRTLANTGIRVIVSVPNDQ  67

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLTS+PNAAPVLV A+ ++  ALV
Sbjct  68   ILGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLTSLPNAAPVLVSALKFIQAALV  127

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +ANL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  128  AANLDQQIKVSTPHSSSVILDSFPPSQAFF  157



>ref|XP_003518194.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Glycine max]
Length=496

 Score =   192 bits (489),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 121/150 (81%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGTD +N+PS  +VV LLKA+ I+H RL+DAD  ML  L+NTGI VIV V N++
Sbjct  21   AFIGVNIGTDATNMPSPTEVVALLKAQGIQHVRLYDADRAMLRTLANTGIRVIVSVPNDQ  80

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLTS+PNAAPVLV A+ ++  ALV
Sbjct  81   ILGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLTSLPNAAPVLVSALKFIQAALV  140

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +ANL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  141  AANLDQQIKVSTPHSSSVILDSFPPSQAFF  170



>ref|XP_007151812.1| hypothetical protein PHAVU_004G077000g [Phaseolus vulgaris]
 gb|ESW23806.1| hypothetical protein PHAVU_004G077000g [Phaseolus vulgaris]
Length=495

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 122/150 (81%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGTDV+N+PS  +VV LLKA+ I+H RL+DAD  ML AL+NTGI VIV V N++
Sbjct  20   AFIGVNIGTDVTNMPSPTEVVTLLKAQGIQHVRLYDADRAMLRALANTGIRVIVSVPNDQ  79

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLTS+ NAAPVLV A+ +L  ALV
Sbjct  80   LLGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLTSLTNAAPVLVSALKFLQAALV  139

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +ANL+ Q+KVSTP S+ ++   FPPS A F
Sbjct  140  AANLDQQIKVSTPHSSSVMVNSFPPSQAFF  169



>ref|XP_010271297.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 [Nelumbo nucifera]
Length=495

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 121/150 (81%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGT +S++P+   VV LLKA+QI+H RL+DAD  ML AL+NTGI+V V V N E
Sbjct  21   AFIGVNIGTALSDMPNPTQVVALLKAQQIRHVRLYDADRAMLLALANTGIQVTVSVPNEE  80

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LG+GQS++ AA WV +NV A++P+TNITAIAVGSEVLT++PNAAPVLV AM ++H ALV
Sbjct  81   LLGVGQSNATAANWVARNVVAHVPATNITAIAVGSEVLTTLPNAAPVLVSAMKFIHSALV  140

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL+ Q+KVSTP S+  I   FPPS A F
Sbjct  141  ASNLDDQIKVSTPHSSSFILDSFPPSQAFF  170



>ref|XP_011021800.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X2 
[Populus euphratica]
Length=498

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 121/150 (81%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGT VS++PS   VV LLKA+ I+H RL+DAD  ML AL+NTGI V V V N +
Sbjct  21   AFIGVNIGTAVSDMPSPTQVVALLKAQNIRHVRLYDADRAMLRALANTGIRVTVSVPNEQ  80

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSE+LT++PNAAPVLV A+ ++H ALV
Sbjct  81   LLGIGQSNATAANWVARNVIAHVPATNITAIAVGSEILTTLPNAAPVLVSALKFIHSALV  140

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL+ Q+KVSTPQS+ +I   FPPS A F
Sbjct  141  ASNLDGQIKVSTPQSSSIILDSFPPSQAFF  170



>gb|AFU52641.1| beta-1,3-glucanase 6 [Solanum tuberosum]
Length=501

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AFVG+NIGTDVS++PS   VV LLKA+QI+H RLFDAD  ML AL++T I V V V N++
Sbjct  24   AFVGVNIGTDVSDMPSPAQVVALLKAQQIRHVRLFDADQAMLLALAHTEIRVTVSVPNDQ  83

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS+S AA WV++N+ +++P+TNITAIA+GSEVLT++PNAAP+LV AM ++H ALV
Sbjct  84   LLGIGQSNSTAANWVSRNILSHVPATNITAIAIGSEVLTTLPNAAPLLVSAMKFIHSALV  143

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +ANL++++KVSTP S+ +I   FPPS A F
Sbjct  144  AANLDTKIKVSTPHSSFIILDSFPPSQAFF  173



>ref|XP_011021799.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X1 
[Populus euphratica]
Length=499

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 121/150 (81%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGT VS++PS   VV LLKA+ I+H RL+DAD  ML AL+NTGI V V V N +
Sbjct  22   AFIGVNIGTAVSDMPSPTQVVALLKAQNIRHVRLYDADRAMLRALANTGIRVTVSVPNEQ  81

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSE+LT++PNAAPVLV A+ ++H ALV
Sbjct  82   LLGIGQSNATAANWVARNVIAHVPATNITAIAVGSEILTTLPNAAPVLVSALKFIHSALV  141

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL+ Q+KVSTPQS+ +I   FPPS A F
Sbjct  142  ASNLDGQIKVSTPQSSSIILDSFPPSQAFF  171



>ref|XP_007045239.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY01071.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=498

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AFVG+NIGTD+S++PS   VV LLKA+ IK+ RL+DAD  ML AL+NTGI+V V V N++
Sbjct  21   AFVGVNIGTDLSDMPSPTQVVALLKAQSIKYVRLYDADRAMLLALANTGIQVTVSVPNDQ  80

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+ ++H ALV
Sbjct  81   LLGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLTALPNAAPVLVSALKFIHSALV  140

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  141  ASNLDGQIKVSTPHSSSIILDSFPPSQAFF  170



>ref|XP_006378439.1| hypothetical protein POPTR_0010s11880g [Populus trichocarpa]
 gb|ERP56236.1| hypothetical protein POPTR_0010s11880g [Populus trichocarpa]
Length=424

 Score =   190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 121/150 (81%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGT +S++PS   VV LLKA+ I+H RL+DAD  ML AL+NTGI V V V N +
Sbjct  4    AFIGVNIGTALSDMPSPTQVVALLKAQNIRHVRLYDADRAMLHALANTGIRVTVSVPNEQ  63

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSE+LT++PNAAPVLV A+ ++H ALV
Sbjct  64   LLGIGQSNATAANWVARNVIAHVPATNITAIAVGSEILTTLPNAAPVLVSALKFIHSALV  123

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL+ Q+KVSTPQS+ +I   FPPS A F
Sbjct  124  ASNLDGQIKVSTPQSSSIILDSFPPSQAFF  153



>gb|KDO64566.1| hypothetical protein CISIN_1g0108331mg, partial [Citrus sinensis]
Length=478

 Score =   191 bits (484),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 122/150 (81%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGTD+S++PS   VV LLKA+ I+H RL+DAD  ML AL+NTGI+V + V N++
Sbjct  1    AFIGVNIGTDLSDMPSPTQVVALLKAQNIRHIRLYDADRAMLLALANTGIQVTISVPNDQ  60

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV ++VAA++P+TNITAIAVGSEVLT +PNA PVLV A+ ++H ALV
Sbjct  61   LLGIGQSNATAANWVARHVAAHVPTTNITAIAVGSEVLTVLPNAGPVLVSALKFIHSALV  120

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +ANL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  121  AANLDDQIKVSTPHSSSIILDSFPPSQAFF  150



>ref|XP_006355069.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Solanum tuberosum]
Length=505

 Score =   191 bits (485),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AFVG+NIGTDVS++PS   VV LLKA+QI+H RLFDAD  ML AL++T I V V V N++
Sbjct  28   AFVGVNIGTDVSDMPSPVQVVALLKAQQIRHVRLFDADQAMLLALAHTEIRVTVSVPNDQ  87

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS+S AA WV++N+ +++P+TNITAIA+GSEVLT++PNAAP+LV AM ++H ALV
Sbjct  88   LLGIGQSNSTAANWVSRNILSHVPATNITAIAIGSEVLTTLPNAAPLLVSAMKFIHSALV  147

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +ANL++++KVSTP S+ +I   FPPS A F
Sbjct  148  AANLDTKIKVSTPHSSFIILDSFPPSQAFF  177



>ref|XP_004498268.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Cicer arietinum]
Length=496

 Score =   191 bits (485),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 121/150 (81%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            A++G+NIGTDV+N+PS  + V LLKA+ I+H RL+DAD  ML AL+ TGI+VIV V N+E
Sbjct  20   AYIGVNIGTDVTNMPSPTETVSLLKAQSIQHVRLYDADRSMLLALAKTGIQVIVSVPNDE  79

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV +NV A++PSTNITAIAVGSEVLTS+PN APVLV A+ ++H ALV
Sbjct  80   LLGIGQSNATAANWVTRNVIAHVPSTNITAIAVGSEVLTSLPNVAPVLVSALQFIHSALV  139

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +ANL+ Q+KVSTP ++ +I    PPS A F
Sbjct  140  AANLDQQIKVSTPLASSIILDXXPPSQAFF  169



>ref|XP_007160410.1| hypothetical protein PHAVU_002G319500g [Phaseolus vulgaris]
 gb|ESW32404.1| hypothetical protein PHAVU_002G319500g [Phaseolus vulgaris]
Length=352

 Score =   187 bits (475),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 120/150 (80%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIG D+S++P   ++V LLKA+ I+H RL+DAD  +L AL+ TGI V V V N++
Sbjct  23   AFIGVNIGLDISDIPGPTEIVALLKAQSIQHVRLYDADRALLRALAKTGIRVTVSVPNDQ  82

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV +NV A++PSTNITAI VGSEVLT++PNAAP+LV A+N++H ALV
Sbjct  83   LLGIGQSNATAANWVTRNVIAHIPSTNITAICVGSEVLTTLPNAAPILVSAINFIHSALV  142

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +ANL+ Q+KVS+P S+ +I   FPPS A F
Sbjct  143  AANLDQQIKVSSPHSSSIILDSFPPSQAFF  172



>ref|XP_004297451.2| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Fragaria vesca 
subsp. vesca]
Length=505

 Score =   191 bits (484),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AFVG+N+GTD+S++PS   VV LLKA+ I+H RL+DAD  ML AL+NTGI+V V V N++
Sbjct  27   AFVGVNLGTDLSDMPSPTVVVALLKAQNIRHIRLYDADRAMLLALANTGIQVTVSVPNDQ  86

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA W+ +NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+ ++H ALV
Sbjct  87   LLGIGQSNATAANWITRNVIAHVPATNITAIAVGSEVLTALPNAAPVLVSALKFIHSALV  146

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  147  ASNLDRQIKVSTPHSSSIILDSFPPSQAFF  176



>ref|XP_006378440.1| hypothetical protein POPTR_0010s11880g [Populus trichocarpa]
 gb|ERP56237.1| hypothetical protein POPTR_0010s11880g [Populus trichocarpa]
Length=481

 Score =   190 bits (482),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 121/150 (81%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGT +S++PS   VV LLKA+ I+H RL+DAD  ML AL+NTGI V V V N +
Sbjct  4    AFIGVNIGTALSDMPSPTQVVALLKAQNIRHVRLYDADRAMLHALANTGIRVTVSVPNEQ  63

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSE+LT++PNAAPVLV A+ ++H ALV
Sbjct  64   LLGIGQSNATAANWVARNVIAHVPATNITAIAVGSEILTTLPNAAPVLVSALKFIHSALV  123

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL+ Q+KVSTPQS+ +I   FPPS A F
Sbjct  124  ASNLDGQIKVSTPQSSSIILDSFPPSQAFF  153



>ref|XP_004159096.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Cucumis sativus]
Length=299

 Score =   185 bits (470),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 121/151 (80%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
             AF+G+N+GTD+S++PS   VV LLKA+ I+H RL+DAD  ML AL+NTGI+V V V N+
Sbjct  20   AAFIGVNLGTDLSDMPSPTQVVALLKAQNIEHIRLYDADRAMLFALANTGIQVTVSVPND  79

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++L IG S++ AA WV++NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+ ++  AL
Sbjct  80   QLLAIGMSNATAANWVSRNVIAHVPATNITAIAVGSEVLTTLPNAAPVLVSALKFIQSAL  139

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            V++NL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  140  VASNLDRQIKVSTPHSSSIILDSFPPSQAFF  170



>ref|XP_002314794.2| hypothetical protein POPTR_0010s11880g [Populus trichocarpa]
 gb|EEF00965.2| hypothetical protein POPTR_0010s11880g [Populus trichocarpa]
Length=498

 Score =   190 bits (483),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 121/150 (81%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGT +S++PS   VV LLKA+ I+H RL+DAD  ML AL+NTGI V V V N +
Sbjct  21   AFIGVNIGTALSDMPSPTQVVALLKAQNIRHVRLYDADRAMLHALANTGIRVTVSVPNEQ  80

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSE+LT++PNAAPVLV A+ ++H ALV
Sbjct  81   LLGIGQSNATAANWVARNVIAHVPATNITAIAVGSEILTTLPNAAPVLVSALKFIHSALV  140

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL+ Q+KVSTPQS+ +I   FPPS A F
Sbjct  141  ASNLDGQIKVSTPQSSSIILDSFPPSQAFF  170



>gb|KFK41053.1| hypothetical protein AALP_AA2G079300 [Arabis alpina]
Length=498

 Score =   190 bits (483),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 121/151 (80%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GAF+G+NIGTD+S++P    VV LLKA+QI+H RL+DAD  ML AL+NTGI+VI+ + N+
Sbjct  24   GAFIGVNIGTDLSDMPHPTQVVALLKAQQIRHIRLYDADPGMLIALANTGIKVIISIPND  83

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++LGIGQS+S AA WV +NV A+ P+T ITAI+VGSEVLTS+PNAAPVLV A+  +H AL
Sbjct  84   QLLGIGQSNSTAANWVKRNVIAHYPATTITAISVGSEVLTSLPNAAPVLVSAIKNIHSAL  143

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +S+NL+  +KVSTP ST LI   FPPS A F
Sbjct  144  LSSNLDRLIKVSTPLSTSLILDPFPPSQAFF  174



>gb|KJB30775.1| hypothetical protein B456_005G159100 [Gossypium raimondii]
Length=465

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            A++G+NIGTD+S++P+  +VV LLKA++I+H RL+DAD  ML AL+ TGI+V V V N++
Sbjct  21   AYIGVNIGTDLSDMPTPTEVVALLKAQRIRHVRLYDADQAMLLALAKTGIQVTVSVPNDQ  80

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV +N+ A++P+TNITAIAVGSEVLT++PNAAP+LV A+ ++H ALV
Sbjct  81   LLGIGQSNATAANWVARNIVAHVPATNITAIAVGSEVLTALPNAAPILVSALKFIHSALV  140

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  141  ASNLDDQIKVSTPHSSSIILDSFPPSQAFF  170



>ref|XP_006372566.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|ERP50363.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
Length=481

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 119/150 (79%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGTD+S++P    VV LLKA+QI H RL+DAD  ML AL+NTGI+V+V V N++
Sbjct  7    AFIGVNIGTDLSDMPHPTQVVALLKAQQIWHVRLYDADRGMLVALANTGIQVMVSVPNDQ  66

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS+S AA WV+ N+ A+ P+TNITAI VGSEV T+IPNAAPVLV AM Y+  ALV
Sbjct  67   LLGIGQSNSTAANWVSHNIVAHYPATNITAICVGSEVFTTIPNAAPVLVNAMKYIQSALV  126

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  127  ASNLDRQIKVSTPLSSSIILDSFPPSQAFF  156



>gb|KJB15377.1| hypothetical protein B456_002G174100 [Gossypium raimondii]
Length=439

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 121/150 (81%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGTD+S++PS   VV LLKA+ + H RL+DAD  ML AL+NTGI+V + V N +
Sbjct  21   AFIGVNIGTDLSDMPSPTQVVALLKAQNVWHVRLYDADRAMLLALANTGIQVTISVPNEQ  80

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+  +H ALV
Sbjct  81   LLGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLTALPNAAPVLVSALKLIHSALV  140

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL+SQ+KVSTP S+ +I   FPPS A F
Sbjct  141  ASNLDSQIKVSTPHSSSIILDSFPPSQAFF  170



>gb|KHG06295.1| hypothetical protein F383_32557 [Gossypium arboreum]
Length=497

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            A++G+NIGTD+S++P+  +VV LLKA++I+H RL+DAD  ML AL+ TGI+V V V N++
Sbjct  21   AYIGVNIGTDLSDMPTPTEVVALLKAQRIRHVRLYDADQAMLLALAKTGIQVTVSVPNDQ  80

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV +N+ A++P+TNITAIAVGSEVLT++PNAAP+LV A+ ++H ALV
Sbjct  81   LLGIGQSNATAANWVARNIVAHVPATNITAIAVGSEVLTALPNAAPILVSALKFIHSALV  140

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  141  ASNLDDQIKVSTPHSSSIILDSFPPSQAFF  170



>gb|KJB30776.1| hypothetical protein B456_005G159100 [Gossypium raimondii]
Length=497

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            A++G+NIGTD+S++P+  +VV LLKA++I+H RL+DAD  ML AL+ TGI+V V V N++
Sbjct  21   AYIGVNIGTDLSDMPTPTEVVALLKAQRIRHVRLYDADQAMLLALAKTGIQVTVSVPNDQ  80

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV +N+ A++P+TNITAIAVGSEVLT++PNAAP+LV A+ ++H ALV
Sbjct  81   LLGIGQSNATAANWVARNIVAHVPATNITAIAVGSEVLTALPNAAPILVSALKFIHSALV  140

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  141  ASNLDDQIKVSTPHSSSIILDSFPPSQAFF  170



>ref|XP_007141916.1| hypothetical protein PHAVU_008G236700g [Phaseolus vulgaris]
 gb|ESW13910.1| hypothetical protein PHAVU_008G236700g [Phaseolus vulgaris]
Length=498

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 119/150 (79%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGTD+S++P    VV LLKA+QI+H RL+DAD  ML AL+ TGIEV+V V N E
Sbjct  21   AFIGVNIGTDLSDMPHPTQVVALLKAQQIRHVRLYDADQAMLLALAKTGIEVVVTVPNEE  80

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +L IGQS+S AA WV++NV A+ P+TNITAI VGS+VLTS+PNAA VLV A+ Y+H ALV
Sbjct  81   LLAIGQSNSTAANWVSRNVVAHYPATNITAICVGSDVLTSLPNAAKVLVSAIKYIHSALV  140

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL+ QVKVSTP S+ +I   FPPS A F
Sbjct  141  ASNLDRQVKVSTPLSSSIILDSFPPSQAFF  170



>ref|XP_010926119.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Elaeis guineensis]
Length=501

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 125/156 (80%), Gaps = 0/156 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GA++G+N+GT +S++PS   VV LLK+++I+H RL+DAD  ML+AL+N+GI V V V N 
Sbjct  22   GAYIGVNVGTALSDMPSPTQVVALLKSQEIRHVRLYDADPAMLAALANSGIRVTVSVPNE  81

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++L +GQS++ AA WV++NV A++P+ NITA+AVGSEVLT++PNAAP+LVPA+ Y+H AL
Sbjct  82   QLLAVGQSNATAANWVSRNVVAHVPAVNITAVAVGSEVLTALPNAAPLLVPAVRYVHSAL  141

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHFQLLVE  609
            V+ANL+ Q+KVSTP S+ +I   FPPS A F   +E
Sbjct  142  VAANLDRQIKVSTPHSSSIILDSFPPSQAFFNRSLE  177



>ref|XP_004288596.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 [Fragaria vesca 
subsp. vesca]
Length=504

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = +1

Query  148  FVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEV  327
            F+G+NIGT +S++P    VV LLKA+QI+H RL+DAD  ML AL+NTGI+VI+ V N+++
Sbjct  31   FIGVNIGTSLSDMPHPTQVVALLKAQQIRHVRLYDADRAMLVALANTGIQVIISVPNDQI  90

Query  328  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  507
            LGIGQS+S AA WV++NV A+ P+TNITAI+VGSEVLT++PN A +LV A+ Y+H ALV+
Sbjct  91   LGIGQSNSTAANWVSQNVVAHYPATNITAISVGSEVLTAVPNTAKILVSALKYIHSALVA  150

Query  508  ANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +NL+SQ+KVSTP S+ +I   FPPS A F
Sbjct  151  SNLDSQIKVSTPLSSSIILDSFPPSQAFF  179



>ref|XP_008775310.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X2 
[Phoenix dactylifera]
Length=445

 Score =   187 bits (475),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 123/151 (81%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GA++G+N+GT +S++PS   VV LLK++QI+H RL+DAD  +L+AL+NTGI V V V N+
Sbjct  19   GAYIGVNLGTALSDMPSPTQVVALLKSQQIRHVRLYDADPAILAALANTGIRVTVSVPND  78

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++L +GQS++ AA WV++NV  ++P+ NITA+AVGSEVLT++PNAAP++VPA+ Y+H AL
Sbjct  79   QLLAVGQSNATAANWVSRNVVGHVPAVNITAVAVGSEVLTALPNAAPLVVPALRYVHSAL  138

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            V+ANL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  139  VAANLDRQIKVSTPHSSSIILDSFPPSQAFF  169



>ref|XP_011001568.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 [Populus euphratica]
Length=503

 Score =   188 bits (478),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 118/150 (79%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGTD+S++P    VV LLKA+QI H RL+DAD  ML AL+NTGI+V+V V N +
Sbjct  29   AFIGVNIGTDLSDMPHPTQVVALLKAQQIWHVRLYDADRGMLVALANTGIQVMVSVPNEQ  88

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS+S AA WV+ N+ A+ P+TNITAI VGSEV T+IPNAAPVLV AM Y+  ALV
Sbjct  89   LLGIGQSNSTAANWVSHNIVAHYPATNITAICVGSEVFTTIPNAAPVLVNAMKYIQSALV  148

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  149  ASNLDRQIKVSTPLSSSIILDSFPPSQAFF  178



>ref|XP_010267790.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Nelumbo nucifera]
Length=495

 Score =   188 bits (477),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 122/150 (81%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGT +S++P    VV LL+A+QI+H RL+DAD  ML AL+NTGI V V V N++
Sbjct  20   AFIGVNIGTALSDMPDPTQVVALLRAQQIRHVRLYDADRAMLLALANTGIRVTVSVPNDQ  79

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LG+GQS++ AA WV +NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+ ++H ALV
Sbjct  80   LLGVGQSNATAANWVARNVVAHVPATNITAIAVGSEVLTTLPNAAPVLVSALKFIHSALV  139

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL++Q+KVSTP S+ +I   FPPS A F
Sbjct  140  ASNLDNQIKVSTPHSSSIILDSFPPSQAFF  169



>gb|KJB15376.1| hypothetical protein B456_002G174100 [Gossypium raimondii]
Length=498

 Score =   187 bits (476),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 121/150 (81%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGTD+S++PS   VV LLKA+ + H RL+DAD  ML AL+NTGI+V + V N +
Sbjct  21   AFIGVNIGTDLSDMPSPTQVVALLKAQNVWHVRLYDADRAMLLALANTGIQVTISVPNEQ  80

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+  +H ALV
Sbjct  81   LLGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLTALPNAAPVLVSALKLIHSALV  140

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL+SQ+KVSTP S+ +I   FPPS A F
Sbjct  141  ASNLDSQIKVSTPHSSSIILDSFPPSQAFF  170



>gb|KHG27056.1| hypothetical protein F383_08405 [Gossypium arboreum]
Length=509

 Score =   188 bits (477),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 121/150 (81%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGTD+S++PS   VV LLKA+ + H RL+DAD  ML AL+NTGI+V + V N +
Sbjct  21   AFIGVNIGTDLSDMPSPTQVVALLKAQNVWHVRLYDADRAMLLALANTGIQVTISVPNEQ  80

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+  +H ALV
Sbjct  81   LLGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLTALPNAAPVLVSALKLIHSALV  140

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL+SQ+KVSTP S+ +I   FPPS A F
Sbjct  141  ASNLDSQIKVSTPHSSSIILDSFPPSQAFF  170



>ref|XP_007160409.1| hypothetical protein PHAVU_002G319500g [Phaseolus vulgaris]
 gb|ESW32403.1| hypothetical protein PHAVU_002G319500g [Phaseolus vulgaris]
Length=498

 Score =   187 bits (476),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 120/150 (80%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIG D+S++P   ++V LLKA+ I+H RL+DAD  +L AL+ TGI V V V N++
Sbjct  23   AFIGVNIGLDISDIPGPTEIVALLKAQSIQHVRLYDADRALLRALAKTGIRVTVSVPNDQ  82

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV +NV A++PSTNITAI VGSEVLT++PNAAP+LV A+N++H ALV
Sbjct  83   LLGIGQSNATAANWVTRNVIAHIPSTNITAICVGSEVLTTLPNAAPILVSAINFIHSALV  142

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +ANL+ Q+KVS+P S+ +I   FPPS A F
Sbjct  143  AANLDQQIKVSSPHSSSIILDSFPPSQAFF  172



>ref|XP_008221445.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Prunus mume]
Length=513

 Score =   187 bits (476),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+N+GTD+S++PS   VV LLKA+ I+H RL+DAD  ML AL+NTGI+V V V N++
Sbjct  36   AFIGVNLGTDLSDMPSPTQVVALLKAQNIRHIRLYDADRAMLLALANTGIQVTVSVPNDQ  95

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA W+ +NV A++P+TNIT+IAVGSEVL+++PNAAPVLV A+ ++H ALV
Sbjct  96   LLGIGQSNATAANWIARNVIAHVPATNITSIAVGSEVLSALPNAAPVLVSALKFIHSALV  155

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  156  ASNLDRQIKVSTPHSSAIILDSFPPSQAFF  185



>ref|XP_008366987.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Malus domestica]
Length=498

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+N+GTD+S +PS   VV LLKA+ I+H RL+DAD  ML AL+NTGI+V+V V N++
Sbjct  21   AFIGVNLGTDLSAMPSPTQVVALLKAQNIRHIRLYDADRTMLLALANTGIQVMVSVPNDQ  80

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            ++GIGQS++ AA WV +NV A++P+TNITAIAVGSEVL+++PNAAPVLV A+ ++H ALV
Sbjct  81   LIGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLSALPNAAPVLVSALKFIHSALV  140

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL+ Q++VSTP S+ +I   FPPS A F
Sbjct  141  ASNLDRQIRVSTPHSSSIILDSFPPSQAFF  170



>gb|KHG27055.1| hypothetical protein F383_08405 [Gossypium arboreum]
Length=556

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 122/153 (80%), Gaps = 0/153 (0%)
 Frame = +1

Query  136  FVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVT  315
            +  AF+G+NIGTD+S++PS   VV LLKA+ + H RL+DAD  ML AL+NTGI+V + V 
Sbjct  65   YAEAFIGVNIGTDLSDMPSPTQVVALLKAQNVWHVRLYDADRAMLLALANTGIQVTISVP  124

Query  316  NNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHK  495
            N ++LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+  +H 
Sbjct  125  NEQLLGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLTALPNAAPVLVSALKLIHS  184

Query  496  ALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ALV++NL+SQ+KVSTP S+ +I   FPPS A F
Sbjct  185  ALVASNLDSQIKVSTPHSSSIILDSFPPSQAFF  217



>ref|XP_002265396.3| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Vitis vinifera]
 emb|CBI33479.3| unnamed protein product [Vitis vinifera]
Length=494

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 121/150 (81%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGTD+S++P    VV LLKA+QI+H RLF+A+  ML+AL+NTGI V V + N +
Sbjct  20   AFIGVNIGTDLSDMPHPTQVVALLKAQQIRHVRLFNAEPAMLTALANTGIRVTVAIPNEQ  79

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            VLG+GQS+S AA WV++N+ A+ P+TNIT IA+GSEVLT++PNAAPVLV A+ ++H AL+
Sbjct  80   VLGVGQSNSTAANWVSRNIVAHYPATNITTIAIGSEVLTTLPNAAPVLVNALKFIHSALL  139

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  140  ASNLDRQIKVSTPLSSSIILDSFPPSQAFF  169



>ref|XP_008775304.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X1 
[Phoenix dactylifera]
Length=497

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 123/151 (81%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GA++G+N+GT +S++PS   VV LLK++QI+H RL+DAD  +L+AL+NTGI V V V N+
Sbjct  19   GAYIGVNLGTALSDMPSPTQVVALLKSQQIRHVRLYDADPAILAALANTGIRVTVSVPND  78

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++L +GQS++ AA WV++NV  ++P+ NITA+AVGSEVLT++PNAAP++VPA+ Y+H AL
Sbjct  79   QLLAVGQSNATAANWVSRNVVGHVPAVNITAVAVGSEVLTALPNAAPLVVPALRYVHSAL  138

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            V+ANL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  139  VAANLDRQIKVSTPHSSSIILDSFPPSQAFF  169



>gb|KDP25782.1| hypothetical protein JCGZ_22504 [Jatropha curcas]
Length=500

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = +1

Query  148  FVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEV  327
            F+G+NIGT++S++P    +V LLKA+QI+H RL+DAD  ML AL+N+GI+V+V V N ++
Sbjct  25   FIGVNIGTELSDMPHPTQIVALLKAQQIRHVRLYDADRGMLIALANSGIQVMVSVPNEQL  84

Query  328  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  507
            LGIGQS+S AA WV+ NV A+ P+TNITAI+VGSE+LT++PNAAPVLV A+ Y+H ALV+
Sbjct  85   LGIGQSNSTAANWVSHNVVAHYPATNITAISVGSEILTTLPNAAPVLVNALKYIHSALVA  144

Query  508  ANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +NL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  145  SNLDRQIKVSTPLSSSIILDSFPPSQAFF  173



>ref|XP_010066584.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Eucalyptus 
grandis]
 gb|KCW64517.1| hypothetical protein EUGRSUZ_G02118 [Eucalyptus grandis]
Length=499

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 120/151 (79%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            G F+G+NIGTD+SN+PS   VV LLKA+ I+H RL+D D  ML AL+N+GI V V V N+
Sbjct  21   GPFIGVNIGTDLSNMPSPTQVVALLKAQNIRHVRLYDTDHAMLLALANSGIRVTVSVPND  80

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++LGIGQS++ AA WV +N+ A++P+TNIT IAVGSEVLT++ NAAPVLV AM ++H AL
Sbjct  81   QLLGIGQSNATAAYWVARNIVAHVPATNITVIAVGSEVLTTLQNAAPVLVSAMKFIHSAL  140

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            V++NL+S++KVSTP S+ +I   FPPS A F
Sbjct  141  VASNLDSRIKVSTPHSSSIIIDSFPPSQAFF  171



>ref|XP_006575486.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X2 
[Glycine max]
Length=505

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 118/149 (79%), Gaps = 0/149 (0%)
 Frame = +1

Query  148  FVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEV  327
            F+G+NIGTD+S++P    VV LLKA+QI+H RL+DAD  ML AL+ TGI+V+V V N E+
Sbjct  30   FIGVNIGTDLSDMPHPTQVVALLKAQQIRHVRLYDADQAMLLALAKTGIQVVVTVPNEEI  89

Query  328  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  507
            L IGQS+S AA WV++NV A+ P+TNITAI VGSEVLT++PNAA VLV A+ Y+H ALV+
Sbjct  90   LAIGQSNSTAANWVSRNVVAHYPATNITAICVGSEVLTTLPNAAKVLVSAIKYIHSALVA  149

Query  508  ANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +NL+ QVKVSTP S+ +I   FPPS A F
Sbjct  150  SNLDRQVKVSTPLSSSIILDSFPPSQAFF  178



>ref|XP_010553889.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Tarenaya 
hassleriana]
Length=500

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 121/151 (80%), Gaps = 0/151 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGTD+S++P    VV LLKA+QI+H RL+D D  ML+AL+NTGI+V+V V N++
Sbjct  27   AFIGVNIGTDLSDMPHPTQVVALLKAQQIRHIRLYDTDPGMLTALANTGIKVVVSVPNDQ  86

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS+S AA WV +N+ A+ P+TNITAIAVGS+VLT++PN +PVLV A+  +H AL+
Sbjct  87   LLGIGQSNSTAANWVKRNIIAHYPATNITAIAVGSDVLTTLPNVSPVLVNAIKNIHSALL  146

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHFQ  597
            S+NL+ ++KVSTP ST LI   FPPS A F 
Sbjct  147  SSNLDGRIKVSTPLSTSLILDPFPPSQAFFN  177



>ref|XP_003519328.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X1 
[Glycine max]
 gb|KHN41067.1| Glucan endo-1,3-beta-glucosidase 2 [Glycine soja]
Length=498

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 118/149 (79%), Gaps = 0/149 (0%)
 Frame = +1

Query  148  FVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEV  327
            F+G+NIGTD+S++P    VV LLKA+QI+H RL+DAD  ML AL+ TGI+V+V V N E+
Sbjct  23   FIGVNIGTDLSDMPHPTQVVALLKAQQIRHVRLYDADQAMLLALAKTGIQVVVTVPNEEI  82

Query  328  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  507
            L IGQS+S AA WV++NV A+ P+TNITAI VGSEVLT++PNAA VLV A+ Y+H ALV+
Sbjct  83   LAIGQSNSTAANWVSRNVVAHYPATNITAICVGSEVLTTLPNAAKVLVSAIKYIHSALVA  142

Query  508  ANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +NL+ QVKVSTP S+ +I   FPPS A F
Sbjct  143  SNLDRQVKVSTPLSSSIILDSFPPSQAFF  171



>ref|XP_002531922.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF30466.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=508

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = +1

Query  148  FVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEV  327
            F+G+NIGTD+S++P    VV LLKA+QI+H RL++AD  ML AL+N+GI+V+V V N ++
Sbjct  33   FIGVNIGTDLSDMPHPTQVVALLKAQQIRHIRLYNADRGMLVALANSGIQVMVSVPNEQL  92

Query  328  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  507
            LGIGQS+S AA WV++NV A+ P+TNITAI+VGSE+L ++PNAAPVLV AM ++H ALV+
Sbjct  93   LGIGQSNSTAANWVSRNVVAHYPATNITAISVGSEILNTLPNAAPVLVNAMKFIHSALVA  152

Query  508  ANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +NL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  153  SNLDRQIKVSTPLSSSIILDSFPPSQAFF  181



>ref|XP_008777063.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X3 
[Phoenix dactylifera]
Length=504

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 123/153 (80%), Gaps = 1/153 (1%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GAFVG+NI TDV NL SA+ +V +L+A+QIKH RLFDAD  ML+AL+NTGIEV++G+ N+
Sbjct  22   GAFVGVNIRTDVFNLQSAEGIVSVLQAQQIKHVRLFDADHQMLNALANTGIEVMIGIPND  81

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++  IG S   AA W+NKN+A +LP+T+IT IAVG+EVLT+ P+AA +L+PAM +LH AL
Sbjct  82   QLPVIGNSQEAAADWINKNIADFLPATDITCIAVGNEVLTTTPDAA-LLLPAMQFLHSAL  140

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHFQL  600
            ++A+L+ QVKVS+P S  +I K FPPSTA F L
Sbjct  141  LAADLHYQVKVSSPHSMLMIPKSFPPSTATFNL  173



>ref|XP_008777062.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Phoenix dactylifera]
Length=505

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 123/153 (80%), Gaps = 1/153 (1%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GAFVG+NI TDV NL SA+ +V +L+A+QIKH RLFDAD  ML+AL+NTGIEV++G+ N+
Sbjct  25   GAFVGVNIRTDVFNLQSAEGIVSVLQAQQIKHVRLFDADHQMLNALANTGIEVMIGIPND  84

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++  IG S   AA W+NKN+A +LP+T+IT IAVG+EVLT+ P+AA +L+PAM +LH AL
Sbjct  85   QLPVIGNSQEAAADWINKNIADFLPATDITCIAVGNEVLTTTPDAA-LLLPAMQFLHSAL  143

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHFQL  600
            ++A+L+ QVKVS+P S  +I K FPPSTA F L
Sbjct  144  LAADLHYQVKVSSPHSMLMIPKSFPPSTATFNL  176



>ref|XP_008777061.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Phoenix dactylifera]
Length=507

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 123/153 (80%), Gaps = 1/153 (1%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GAFVG+NI TDV NL SA+ +V +L+A+QIKH RLFDAD  ML+AL+NTGIEV++G+ N+
Sbjct  25   GAFVGVNIRTDVFNLQSAEGIVSVLQAQQIKHVRLFDADHQMLNALANTGIEVMIGIPND  84

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++  IG S   AA W+NKN+A +LP+T+IT IAVG+EVLT+ P+AA +L+PAM +LH AL
Sbjct  85   QLPVIGNSQEAAADWINKNIADFLPATDITCIAVGNEVLTTTPDAA-LLLPAMQFLHSAL  143

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHFQL  600
            ++A+L+ QVKVS+P S  +I K FPPSTA F L
Sbjct  144  LAADLHYQVKVSSPHSMLMIPKSFPPSTATFNL  176



>gb|EYU41109.1| hypothetical protein MIMGU_mgv1a005128mg [Erythranthe guttata]
Length=496

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 121/150 (81%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGT +S++PS   VV LLK++QI+H RL+D+D  ML AL+NTGI V V V N++
Sbjct  21   AFIGVNIGTSLSDMPSPTQVVSLLKSQQIRHVRLYDSDRAMLLALANTGIRVTVSVPNDQ  80

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +L IGQS+  AA WV++N+ ++ P+TNIT+I+VG+EVL+++PNAAPVL+PAM +LH ALV
Sbjct  81   LLAIGQSNLTAANWVSRNILSHYPATNITSISVGTEVLSTLPNAAPVLLPAMKFLHSALV  140

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +ANL SQ+K+STP S+ +I   FPPS A F
Sbjct  141  AANLQSQIKLSTPHSSSIILDSFPPSQAFF  170



>ref|XP_006596503.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X2 
[Glycine max]
Length=448

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = +1

Query  148  FVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEV  327
            F+G+NIGTD+S++P    VV LLKA+QI+H RL+DAD  ML AL+ TGI+V V V N E+
Sbjct  23   FIGVNIGTDLSDMPHPTQVVALLKAQQIRHVRLYDADQAMLLALAKTGIQVAVTVPNEEI  82

Query  328  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  507
            L IGQS+S AA WV++NV A+ P+TNITAI VGSEVLT++PNAA VLV A+ Y+H ALV+
Sbjct  83   LAIGQSNSTAANWVSRNVVAHYPATNITAICVGSEVLTTLPNAAKVLVSAIKYIHSALVA  142

Query  508  ANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +NL+ QVKVSTP S+ +I   FPPS A F
Sbjct  143  SNLDRQVKVSTPLSSSIILDSFPPSQAFF  171



>ref|XP_006430586.1| hypothetical protein CICLE_v10011549mg [Citrus clementina]
 gb|ESR43826.1| hypothetical protein CICLE_v10011549mg [Citrus clementina]
Length=497

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 119/150 (79%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G NIGT++S++P    VV LLKA+QI+H RL+DAD  ML AL+NTGI+V V V N +
Sbjct  21   AFIGANIGTELSDMPHPTQVVALLKAQQIRHVRLYDADRGMLVALANTGIKVAVSVPNEQ  80

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS+S AA WV++N+ A+ P+TNIT I VGSEVLT++PNAAPVLV A+ ++H ALV
Sbjct  81   LLGIGQSNSTAANWVSRNIVAHYPATNITTICVGSEVLTTLPNAAPVLVNALKFIHSALV  140

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL+ Q+KVSTP S+ LI   FPPS A F
Sbjct  141  ASNLDHQIKVSTPLSSSLILDSFPPSQAFF  170



>ref|XP_006482110.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Citrus sinensis]
 gb|KDO50803.1| hypothetical protein CISIN_1g010931mg [Citrus sinensis]
Length=497

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 119/150 (79%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G NIGT++S++P    VV LLKA+QI+H RL+DAD  ML AL+NTGI+V V V N +
Sbjct  21   AFIGANIGTELSDMPHPTQVVALLKAQQIRHVRLYDADRGMLVALANTGIKVAVSVPNEQ  80

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS+S AA WV++N+ A+ P+TNIT I VGSEVLT++PNAAPVLV A+ ++H ALV
Sbjct  81   LLGIGQSNSTAANWVSRNIVAHYPATNITTICVGSEVLTTLPNAAPVLVNALKFIHSALV  140

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL+ Q+KVSTP S+ LI   FPPS A F
Sbjct  141  ASNLDHQIKVSTPLSSSLILDSFPPSQAFF  170



>ref|XP_006391369.1| hypothetical protein EUTSA_v10018427mg [Eutrema salsugineum]
 gb|ESQ28655.1| hypothetical protein EUTSA_v10018427mg [Eutrema salsugineum]
Length=506

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 120/151 (79%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GAF+G+NIGTD+S++P    VV LLKA+QI+H RL+DAD  ML AL+NT I+VI+ + N+
Sbjct  32   GAFIGVNIGTDLSDMPHPTQVVALLKAQQIRHVRLYDADPGMLIALANTKIKVIISIPND  91

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++LGIGQS+S AA WV +NV A+ P+T ITAI+VGSEVLTS+PNAAP+LV A+  +H AL
Sbjct  92   QLLGIGQSNSTAANWVKRNVIAHYPATTITAISVGSEVLTSLPNAAPILVNAIKNVHSAL  151

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +S+NL+  +KVSTP ST LI   FPPS A F
Sbjct  152  LSSNLDRLIKVSTPLSTSLILDPFPPSQAFF  182



>ref|XP_007215258.1| hypothetical protein PRUPE_ppa004534mg [Prunus persica]
 ref|XP_008227924.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Prunus mume]
 gb|EMJ16457.1| hypothetical protein PRUPE_ppa004534mg [Prunus persica]
Length=504

 Score =   186 bits (471),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 120/149 (81%), Gaps = 0/149 (0%)
 Frame = +1

Query  148  FVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEV  327
            F+G+NIGTD+S++P    VV LLKA+QI+H RL+DAD  ML AL+NTGI+V++ V N ++
Sbjct  30   FIGVNIGTDLSDMPHPTQVVALLKAQQIRHVRLYDADRAMLVALANTGIQVMISVPNEQI  89

Query  328  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  507
            LGIGQS+S AA WV++NV A+ P+TNITAIAVGS+VLT++PNAA +LV A+ Y+  ALV+
Sbjct  90   LGIGQSNSTAANWVSQNVVAHYPATNITAIAVGSDVLTTLPNAAKILVNALKYIQSALVA  149

Query  508  ANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +NL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  150  SNLDRQIKVSTPLSSSIILDSFPPSQAFF  178



>ref|XP_002305879.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|EEE86390.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
Length=491

 Score =   185 bits (470),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 118/150 (79%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGTD+S++P    VV LLKA+QI+H RL+DAD  ML AL+NTGI+V+V V N +
Sbjct  15   AFIGVNIGTDLSDMPHPTQVVALLKAQQIRHVRLYDADRGMLVALANTGIQVMVSVPNEQ  74

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS+S AA WV+ NV A+ P+TNITAI VGSEV T++PNAA VLV AM ++  ALV
Sbjct  75   LLGIGQSNSTAANWVSHNVVAHYPATNITAICVGSEVFTAVPNAASVLVNAMKFIQSALV  134

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  135  ASNLDRQIKVSTPLSSSIILDSFPPSQAFF  164



>ref|XP_003544983.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X1 
[Glycine max]
 gb|KHN39465.1| Glucan endo-1,3-beta-glucosidase 2 [Glycine soja]
Length=498

 Score =   185 bits (470),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = +1

Query  148  FVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEV  327
            F+G+NIGTD+S++P    VV LLKA+QI+H RL+DAD  ML AL+ TGI+V V V N E+
Sbjct  23   FIGVNIGTDLSDMPHPTQVVALLKAQQIRHVRLYDADQAMLLALAKTGIQVAVTVPNEEI  82

Query  328  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  507
            L IGQS+S AA WV++NV A+ P+TNITAI VGSEVLT++PNAA VLV A+ Y+H ALV+
Sbjct  83   LAIGQSNSTAANWVSRNVVAHYPATNITAICVGSEVLTTLPNAAKVLVSAIKYIHSALVA  142

Query  508  ANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +NL+ QVKVSTP S+ +I   FPPS A F
Sbjct  143  SNLDRQVKVSTPLSSSIILDSFPPSQAFF  171



>ref|XP_002527772.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF34582.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=533

 Score =   186 bits (472),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 120/150 (80%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            +F+G+N+GT +S++PS   VV LLKA+ I+H RL+DAD  ML AL+NTGI V V V N +
Sbjct  21   SFIGVNVGTALSDMPSPTQVVALLKAQNIRHVRLYDADRAMLLALANTGIRVTVSVPNEQ  80

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+ ++H ALV
Sbjct  81   LLGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLTTLPNAAPVLVSALKFIHSALV  140

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  141  ASNLDGQIKVSTPHSSSIILDSFPPSQAFF  170



>dbj|BAB01763.1| beta-1,3-glucanase-like protein [Arabidopsis thaliana]
Length=469

 Score =   184 bits (468),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = +1

Query  184  LPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEVLGIGQSSSQAAA  363
            +P   D+V LLK++QI H RL+DA++HML A +NT IEV+VGVTN E+L IG+  S AAA
Sbjct  1    MPPPSDIVTLLKSQQITHVRLYDANSHMLKAFANTSIEVMVGVTNEEILKIGRFPSAAAA  60

Query  364  WVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSANLNSQVKVSTP  543
            WVNKNVAAY+PSTNITAIAVGSEVLT+IP+ AP+L  A+N +HKALV++NLN +VKVS+P
Sbjct  61   WVNKNVAAYIPSTNITAIAVGSEVLTTIPHVAPILASALNNIHKALVASNLNFKVKVSSP  120

Query  544  QSTDLIAKIFPPSTAHF  594
             S D++ K FPPST+ F
Sbjct  121  MSMDIMPKPFPPSTSTF  137



>ref|XP_009382992.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Musa acuminata 
subsp. malaccensis]
Length=580

 Score =   186 bits (473),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 122/156 (78%), Gaps = 0/156 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GA++G+N+GT +SN+PS   V  LLK++QI++ RL+DAD  ML+AL+NTGI V V V N 
Sbjct  102  GAYIGVNVGTALSNMPSPTMVAALLKSQQIRNVRLYDADPAMLAALTNTGIRVTVSVPNE  161

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++L +GQS++ AA WV +NV A++P+ NITAIAVGSEVLT++PNAAP+LVPA+ Y+H AL
Sbjct  162  QLLAVGQSNATAANWVARNVVAHVPAVNITAIAVGSEVLTALPNAAPLLVPALRYIHSAL  221

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHFQLLVE  609
            V+ANL+  +KVSTP S+ LI   FPPS A F   +E
Sbjct  222  VAANLDGVIKVSTPHSSSLILDSFPPSQAFFNRTLE  257



>ref|XP_010108988.1| Glucan endo-1,3-beta-glucosidase 2 [Morus notabilis]
 gb|EXC20628.1| Glucan endo-1,3-beta-glucosidase 2 [Morus notabilis]
Length=497

 Score =   185 bits (469),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 121/150 (81%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGT++S++P    VV LLKA+QI+H RL+DAD  ML AL+N+GI+VIV + N +
Sbjct  21   AFIGVNIGTELSDMPHPTQVVALLKAQQIRHVRLYDADRGMLIALANSGIQVIVSIPNEQ  80

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS+S AA WV++N+ A+ P+TNITAI VGSEVLT++PNAA VLV A+ Y++ ALV
Sbjct  81   LLGIGQSNSTAANWVSQNIVAHYPATNITAICVGSEVLTTLPNAAKVLVNALKYINSALV  140

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  141  ASNLDRQIKVSTPLSSSIILDSFPPSQAFF  170



>ref|XP_008361481.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Malus domestica]
Length=504

 Score =   185 bits (469),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 119/149 (80%), Gaps = 0/149 (0%)
 Frame = +1

Query  148  FVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEV  327
            F+G+NIGTD+S++P    VV LLKA+Q +H RL+DAD  ML AL+NTGI+V++ V N ++
Sbjct  30   FIGVNIGTDLSDMPHPTQVVALLKAQQJRHVRLYDADRAMLVALANTGIKVMISVPNEQI  89

Query  328  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  507
            LGIGQS++ AA WV++NV A+ P+TNITAIAVGSEVLT++PNAA +LV A+ Y+  ALV+
Sbjct  90   LGIGQSNATAANWVSQNVVAHYPATNITAIAVGSEVLTTLPNAAKILVNALKYIQSALVA  149

Query  508  ANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +NL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  150  SNLDRQIKVSTPLSSSIILDSFPPSQAFF  178



>ref|XP_004140301.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Cucumis sativus]
 ref|XP_004155734.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Cucumis sativus]
 gb|KGN51058.1| Glucan endo-1,3-beta-glucosidase [Cucumis sativus]
Length=503

 Score =   185 bits (469),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 119/149 (80%), Gaps = 0/149 (0%)
 Frame = +1

Query  148  FVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEV  327
            FVG+NIGT++S +P    V  LLKA+QI+H RL+DAD  ML AL+NTGI+V+V + N ++
Sbjct  29   FVGVNIGTELSVMPHPTQVAALLKAQQIRHVRLYDADGGMLMALANTGIQVMVTIPNEQI  88

Query  328  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  507
            LGIGQS+S AA WVN+NV A+ P+TNITAI+VGS+VLT++PNAA +LV A+ Y+H ALV+
Sbjct  89   LGIGQSNSTAANWVNRNVLAHYPATNITAISVGSDVLTTLPNAAKILVNALKYIHSALVA  148

Query  508  ANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +NL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  149  SNLDHQIKVSTPLSSSIILDSFPPSQAFF  177



>gb|KDP38099.1| hypothetical protein JCGZ_04742 [Jatropha curcas]
Length=498

 Score =   185 bits (469),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 120/150 (80%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGT +S++P+   VV LLKA+ I+H RL+DAD  ML AL+NTGI V V V N +
Sbjct  21   AFIGVNIGTALSDMPNPTQVVALLKAQNIRHVRLYDADRAMLLALANTGIRVTVSVPNEQ  80

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV++NV A++P+TNIT IAVGSEVLT++PNAAPVL+ A+ ++H ALV
Sbjct  81   LLGIGQSNATAANWVSRNVIAHVPATNITGIAVGSEVLTTLPNAAPVLLSALKFIHSALV  140

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  141  ASNLDDQIKVSTPHSSSIILDSFPPSQAFF  170



>ref|XP_009351539.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Pyrus x bretschneideri]
Length=498

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 120/150 (80%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            A +G+N+GTDVS++PS   V  LLKA+ I+H RL+DAD  ML AL+NTGI+V + V N +
Sbjct  21   AVIGVNLGTDVSDMPSPTQVAALLKAQNIRHIRLYDADRAMLLALANTGIQVTISVPNEQ  80

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVL+++PNAAPVLV A+ ++H ALV
Sbjct  81   LLGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLSALPNAAPVLVSALKFIHSALV  140

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  141  ASNLDRQIKVSTPHSSSIILDSFPPSQAFF  170



>ref|XP_008460531.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 isoform X2 [Cucumis 
melo]
Length=481

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 119/153 (78%), Gaps = 0/153 (0%)
 Frame = +1

Query  136  FVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVT  315
            F   FVG+NIGT++S +P    V  LLKA+QI+H RL+DAD  ML AL+NTGI+V+V + 
Sbjct  3    FADVFVGVNIGTELSVMPHPTQVAALLKAQQIRHVRLYDADGGMLMALANTGIQVMVTIP  62

Query  316  NNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHK  495
            N ++LGIGQS+S AA WVN+NV A+ P+TNITAI+VG +VLT++PNAA +LV A+ Y+H 
Sbjct  63   NEQILGIGQSNSTAANWVNRNVLAHYPATNITAISVGFDVLTTLPNAAKILVNALKYVHS  122

Query  496  ALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ALV++NL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  123  ALVASNLDHQIKVSTPLSSSIILDSFPPSQAFF  155



>ref|XP_003600716.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
Length=504

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 118/149 (79%), Gaps = 0/149 (0%)
 Frame = +1

Query  148  FVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEV  327
            F+G+NIGTD+S++P    VV LLKA+QI+H RL++AD  ML+ALS +GI+V++ V N E+
Sbjct  23   FIGVNIGTDLSDMPHPTQVVALLKAQQIRHIRLYNADQAMLTALSKSGIQVVISVPNEEL  82

Query  328  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  507
            L IGQS+S A+ WV++NV AY P+TNITAI VGSEVLT++PN A VLV A+NY+H ALV+
Sbjct  83   LAIGQSNSTASNWVSRNVLAYYPATNITAICVGSEVLTTLPNVAKVLVNALNYIHSALVA  142

Query  508  ANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +NL+ Q+KVSTP  + +I   FPPS A F
Sbjct  143  SNLDRQIKVSTPLPSTMILDSFPPSQAFF  171



>gb|AES70967.2| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=491

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 118/149 (79%), Gaps = 0/149 (0%)
 Frame = +1

Query  148  FVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEV  327
            F+G+NIGTD+S++P    VV LLKA+QI+H RL++AD  ML+ALS +GI+V++ V N E+
Sbjct  23   FIGVNIGTDLSDMPHPTQVVALLKAQQIRHIRLYNADQAMLTALSKSGIQVVISVPNEEL  82

Query  328  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  507
            L IGQS+S A+ WV++NV AY P+TNITAI VGSEVLT++PN A VLV A+NY+H ALV+
Sbjct  83   LAIGQSNSTASNWVSRNVLAYYPATNITAICVGSEVLTTLPNVAKVLVNALNYIHSALVA  142

Query  508  ANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +NL+ Q+KVSTP  + +I   FPPS A F
Sbjct  143  SNLDRQIKVSTPLPSTMILDSFPPSQAFF  171



>ref|XP_004142367.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Cucumis sativus]
 gb|KGN52361.1| hypothetical protein Csa_5G628660 [Cucumis sativus]
Length=500

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 121/150 (81%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+N+GTD+S++PS   VV LLKA+ I+H RL+DAD  ML AL+NTGI+V V V N++
Sbjct  21   AFIGVNLGTDLSDMPSPTQVVALLKAQNIEHIRLYDADRAMLLALANTGIQVTVSVPNDQ  80

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +L IG S++ AA WV++NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+ ++  ALV
Sbjct  81   LLAIGMSNATAANWVSRNVIAHVPATNITAIAVGSEVLTTLPNAAPVLVSALKFIQSALV  140

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  141  ASNLDRQIKVSTPHSSSIILDSFPPSQAFF  170



>ref|XP_007032976.1| Glucan endo-1,3-beta-glucosidase, putative isoform 2, partial 
[Theobroma cacao]
 gb|EOY03902.1| Glucan endo-1,3-beta-glucosidase, putative isoform 2, partial 
[Theobroma cacao]
Length=481

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = +1

Query  148  FVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEV  327
            ++G+NIGTD+S++P    VV LLKA+QI+H RL++AD  ML AL+N+GI V+V + N ++
Sbjct  23   YIGVNIGTDLSDMPHPTQVVALLKAQQIRHVRLYNADKGMLVALANSGIRVMVSIPNEQL  82

Query  328  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  507
            LGIGQS+S AA WV++N+ A+ P+TNITAI VGSEVLT++PNAAP+LV A+ ++H ALV+
Sbjct  83   LGIGQSNSTAANWVSRNIVAHYPATNITAICVGSEVLTTLPNAAPLLVNAIKFVHSALVA  142

Query  508  ANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +NL++Q+KVSTP S+ +I   FPPS A F
Sbjct  143  SNLDNQIKVSTPLSSSIILDSFPPSQAFF  171



>ref|XP_002887020.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63279.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=503

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 120/152 (79%), Gaps = 0/152 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            G+++G+NIGTD+S++P    VV LLKA+QI+H RL+DAD  ML AL+NTGI+VI+ + N+
Sbjct  26   GSYIGVNIGTDLSDMPHPTQVVSLLKAQQIRHIRLYDADPGMLIALANTGIKVIISIPND  85

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++LGIGQS+S AA WV +NV A+ P+T ITAI+VGSEVLTS+ NAAPVLV A+  +H AL
Sbjct  86   QLLGIGQSNSTAANWVKRNVIAHYPATTITAISVGSEVLTSLSNAAPVLVSAIKNVHAAL  145

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHFQ  597
            +S+NL+  +KVSTP ST LI   FPPS A F 
Sbjct  146  LSSNLDRLIKVSTPLSTSLILDPFPPSQAFFN  177



>ref|XP_011097437.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Sesamum indicum]
Length=496

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 117/150 (78%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGTD+S++P    VV LLK +QI+H RL++AD  ML AL+NTGI V + V N +
Sbjct  23   AFIGVNIGTDLSDMPHPTQVVALLKTQQIRHIRLYNADRGMLLALANTGIRVTISVPNEQ  82

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS+S AA WV++NV A+ P+TNIT I VGSEVLTS+PN APVLV A+ Y+H ALV
Sbjct  83   LLGIGQSNSTAANWVSQNVVAHYPATNITTICVGSEVLTSLPNVAPVLVNALKYIHSALV  142

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL+ Q+KVSTP ++ +I   FPPS A F
Sbjct  143  ASNLDRQIKVSTPLASSIILDSFPPSQAFF  172



>gb|EPS61988.1| hypothetical protein M569_12804, partial [Genlisea aurea]
Length=418

 Score =   182 bits (461),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 120/150 (80%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGTD+S++P    VV LLK++QI+H RL++AD  ML AL+ TGI+V V V N+E
Sbjct  1    AFIGVNIGTDLSDMPHPTQVVALLKSQQIRHVRLYNADRGMLVALAGTGIKVAVSVPNDE  60

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LG+GQS+S AA WV++NV A+ P+TNITA+ VGSEVLTS+PN APVLV A+ ++H ALV
Sbjct  61   LLGVGQSNSTAANWVSQNVVAHYPATNITAVCVGSEVLTSLPNLAPVLVDALKFIHSALV  120

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL+ Q+KVS+P ++ +I   FPPS A F
Sbjct  121  ASNLDGQIKVSSPLASSVILDSFPPSQAFF  150



>ref|XP_007032975.1| Glucan endo-1,3-beta-glucosidase, putative isoform 1 [Theobroma 
cacao]
 gb|EOY03901.1| Glucan endo-1,3-beta-glucosidase, putative isoform 1 [Theobroma 
cacao]
Length=498

 Score =   183 bits (464),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = +1

Query  148  FVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEV  327
            ++G+NIGTD+S++P    VV LLKA+QI+H RL++AD  ML AL+N+GI V+V + N ++
Sbjct  23   YIGVNIGTDLSDMPHPTQVVALLKAQQIRHVRLYNADKGMLVALANSGIRVMVSIPNEQL  82

Query  328  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  507
            LGIGQS+S AA WV++N+ A+ P+TNITAI VGSEVLT++PNAAP+LV A+ ++H ALV+
Sbjct  83   LGIGQSNSTAANWVSRNIVAHYPATNITAICVGSEVLTTLPNAAPLLVNAIKFVHSALVA  142

Query  508  ANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +NL++Q+KVSTP S+ +I   FPPS A F
Sbjct  143  SNLDNQIKVSTPLSSSIILDSFPPSQAFF  171



>emb|CDY58676.1| BnaCnng33550D [Brassica napus]
Length=504

 Score =   183 bits (464),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 119/151 (79%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GA++G+NIGTD+S++P    VV LLKA+QI+H RL+DAD  ML AL+N+GI+VI+ + N+
Sbjct  29   GAYIGVNIGTDLSDMPHPTQVVALLKAQQIRHIRLYDADPGMLIALANSGIKVIITIPND  88

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++LGIGQS+S AA WV +NV A+ P+T ITAI+VGSEVLTS+ NAAPVLV A+  +H AL
Sbjct  89   QLLGIGQSNSTAANWVKRNVIAHYPATTITAISVGSEVLTSLSNAAPVLVSAIKNVHSAL  148

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +SANL   +KVSTP ST LI   FPPS A F
Sbjct  149  LSANLERLIKVSTPLSTSLILDPFPPSQAFF  179



>ref|XP_010415170.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Camelina 
sativa]
Length=512

 Score =   183 bits (464),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 119/151 (79%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GA++G+NIGTD+S++P    VV LLKA+QI+H RL+DAD  ML AL+NT I+VI+ V N+
Sbjct  35   GAYIGVNIGTDLSDMPHPTQVVALLKAQQIRHIRLYDADPGMLIALANTKIKVIISVPND  94

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++LGIGQS+S AA WV +NV A+ P+T ITAI+VGSEVLTS+ NAAPVLV A+  +H AL
Sbjct  95   QLLGIGQSNSTAANWVKRNVIAHYPATTITAISVGSEVLTSLSNAAPVLVSAIKNVHAAL  154

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +SANL+  +KVSTP ST LI   FPPS A F
Sbjct  155  LSANLDRLIKVSTPLSTSLILDPFPPSQAFF  185



>ref|XP_011007238.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X1 
[Populus euphratica]
 ref|XP_011007239.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X2 
[Populus euphratica]
Length=505

 Score =   182 bits (463),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 117/150 (78%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGTD+S++P    VV LLKA+QI H RL+DAD  ML AL+NTGI+V+V V N +
Sbjct  29   AFIGVNIGTDLSDMPHPTQVVALLKAQQIWHVRLYDADRGMLVALANTGIQVMVSVPNEQ  88

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS+S AA WV+ N+ A+ P+TNITAI VGSEV T++PNAA VLV AM ++  ALV
Sbjct  89   LLGIGQSNSTAANWVSHNIVAHYPATNITAICVGSEVFTAVPNAASVLVNAMKFIQSALV  148

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  149  ASNLDRQIKVSTPLSSSIILDSFPPSQAFF  178



>gb|EPS65983.1| hypothetical protein M569_08793, partial [Genlisea aurea]
Length=459

 Score =   182 bits (461),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 119/150 (79%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGT++S +P    VV LLKA+ ++H R++ AD  ML AL+ TGI V+V V N+E
Sbjct  1    AFLGVNIGTELSEMPDPTQVVALLKAQHLQHVRIYGADRGMLMALAKTGIRVVVSVPNDE  60

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS+S AA WV+KNV AY P+TNITAIAVGSEVLT++PNAAP+LV A++++  AL 
Sbjct  61   LLGIGQSNSTAANWVSKNVLAYYPATNITAIAVGSEVLTALPNAAPILVSAVSFISSALR  120

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +ANL+S++KVSTP S+ +I   FPPS A F
Sbjct  121  AANLDSRIKVSTPHSSSVILDSFPPSQAFF  150



>ref|XP_008452393.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X1 [Cucumis 
melo]
Length=500

 Score =   182 bits (463),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 121/150 (81%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+N+GTD+S++PS   VV LLKA+ I+H RL+DAD  ML AL+NTGI+V V V N++
Sbjct  21   AFIGVNLGTDLSDMPSPTQVVALLKAQNIEHIRLYDADRAMLLALANTGIQVTVSVPNDQ  80

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +L IG S++ AA WV++NV A++P+TNITAIAVGS+VLT++PNAAPVLV A+ ++  ALV
Sbjct  81   LLAIGMSNATAANWVSRNVIAHVPATNITAIAVGSDVLTTLPNAAPVLVSALKFIQSALV  140

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  141  ASNLDRQIKVSTPHSSSIILDSFPPSQAFF  170



>ref|XP_010511554.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 isoform X1 [Camelina 
sativa]
 ref|XP_010511555.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 isoform X2 [Camelina 
sativa]
Length=512

 Score =   182 bits (463),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 119/151 (79%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GA++G+NIGTD+S++P    VV LLKA+QI+H RL+DAD  ML AL+NT I+VI+ V N+
Sbjct  35   GAYIGVNIGTDLSDMPHPTQVVALLKAQQIRHIRLYDADPGMLIALANTKIKVIISVPND  94

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++LGIGQS+S AA WV +NV A+ P+T ITAI+VGSEVLTS+ NAAP+LV A+  +H AL
Sbjct  95   QLLGIGQSNSTAANWVKRNVIAHYPATTITAISVGSEVLTSLSNAAPILVSAIKNVHAAL  154

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +SANL+  +KVSTP ST LI   FPPS A F
Sbjct  155  LSANLDRLIKVSTPLSTSLILDPFPPSQAFF  185



>ref|XP_010470501.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X2 
[Camelina sativa]
Length=510

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 119/151 (79%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GA++G+NIGTD+S++P    VV LLKA+QI+H RL+DAD  ML AL+NT I+VI+ V N+
Sbjct  35   GAYIGVNIGTDLSDMPHPTQVVALLKAQQIRHIRLYDADPGMLIALANTKIKVIISVPND  94

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++LGIGQS+S AA WV +NV A+ P+T ITAI+VGSEVLTS+ NAAPVLV A+  +H AL
Sbjct  95   QLLGIGQSNSTAANWVKRNVIAHSPATTITAISVGSEVLTSLSNAAPVLVSAIKNVHAAL  154

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +SANL+  +KVSTP ST LI   FPPS A F
Sbjct  155  LSANLDRLIKVSTPLSTSLILDPFPPSQAFF  185



>emb|CDY16440.1| BnaA02g12440D [Brassica napus]
Length=504

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 119/152 (78%), Gaps = 0/152 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GA++G+NIGTD+S++P    VV LLK +QI+H RL+DAD  ML AL+N+GI+VI+ + N+
Sbjct  28   GAYIGVNIGTDLSDMPHPTQVVALLKVQQIRHIRLYDADPGMLIALANSGIKVIITIPND  87

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++LGIGQS+S AA WV +NV A+ P+T ITAI+VGSEVLTS+ NAAPVLV A+  +H AL
Sbjct  88   QLLGIGQSNSTAANWVKRNVIAHYPATTITAISVGSEVLTSLSNAAPVLVSAIKNVHSAL  147

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHFQ  597
            +SANL+  +KVSTP ST LI   FPPS A F 
Sbjct  148  LSANLDRLIKVSTPLSTSLILDPFPPSQAFFN  179



>ref|XP_010470500.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X1 
[Camelina sativa]
Length=512

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 119/151 (79%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GA++G+NIGTD+S++P    VV LLKA+QI+H RL+DAD  ML AL+NT I+VI+ V N+
Sbjct  35   GAYIGVNIGTDLSDMPHPTQVVALLKAQQIRHIRLYDADPGMLIALANTKIKVIISVPND  94

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++LGIGQS+S AA WV +NV A+ P+T ITAI+VGSEVLTS+ NAAPVLV A+  +H AL
Sbjct  95   QLLGIGQSNSTAANWVKRNVIAHSPATTITAISVGSEVLTSLSNAAPVLVSAIKNVHAAL  154

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +SANL+  +KVSTP ST LI   FPPS A F
Sbjct  155  LSANLDRLIKVSTPLSTSLILDPFPPSQAFF  185



>ref|XP_009127476.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 isoform X1 [Brassica 
rapa]
Length=505

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 119/152 (78%), Gaps = 0/152 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GA++G+NIGTD+S++P    VV LLK +QI+H RL+DAD  ML AL+N+GI+VI+ + N+
Sbjct  29   GAYIGVNIGTDLSDMPHPTQVVALLKVQQIRHIRLYDADPGMLIALANSGIKVIITIPND  88

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++LGIGQS+S AA WV +NV A+ P+T ITAI+VGSEVLTS+ NAAPVLV A+  +H AL
Sbjct  89   QLLGIGQSNSTAANWVKRNVIAHYPATTITAISVGSEVLTSLSNAAPVLVSAIKNVHSAL  148

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHFQ  597
            +SANL+  +KVSTP ST LI   FPPS A F 
Sbjct  149  LSANLDRLIKVSTPLSTSLILDPFPPSQAFFN  180



>ref|XP_008802448.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Phoenix dactylifera]
Length=500

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 123/156 (79%), Gaps = 0/156 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GA++G+NIGT +S++PS   VV LLK+++I+H R++DAD  ML+AL+N+GI V V V N 
Sbjct  22   GAYIGVNIGTALSDMPSPTQVVALLKSQKIQHVRMYDADPAMLAALANSGIRVTVSVPNE  81

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++L +GQS++ AA WV++NV A++P+ NITA+AVGSEVLT++PNAA +LV A+ Y+H AL
Sbjct  82   QLLAVGQSNATAANWVSRNVVAHVPAVNITAVAVGSEVLTALPNAATLLVSALRYVHSAL  141

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHFQLLVE  609
            V+ANL+ Q+KVSTP S+ +I   FPPS A F   +E
Sbjct  142  VAANLDRQIKVSTPHSSSIILDSFPPSQAFFNRSLE  177



>ref|XP_010681923.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=503

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 118/150 (79%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            A +G+NIG D+S+ PS   VV LL+A+ I+  RLFDAD  ML AL+NTGI+VIV V N +
Sbjct  26   ASLGVNIGLDLSDAPSPTQVVSLLRAQSIQQIRLFDADRAMLRALANTGIQVIVSVPNEQ  85

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV +N+ +++P+TNITAIAVGSEVLT +PNA P+LV AM Y+H ALV
Sbjct  86   LLGIGQSNTTAANWVARNIVSHVPATNITAIAVGSEVLTVLPNAGPILVSAMQYIHSALV  145

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL+S++KVSTP ++ +I   FPPS A F
Sbjct  146  ASNLDSKIKVSTPHASSIILDSFPPSQAFF  175



>emb|CDY48807.1| BnaC02g34070D [Brassica napus]
Length=497

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 118/150 (79%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            + VG+NIGT+V+++PS   VV LLK++ I   RL+DAD  ML A ++TGI++I+ V N++
Sbjct  21   SLVGVNIGTEVTDMPSPTQVVTLLKSQNINRVRLYDADRSMLLAFAHTGIQLIISVPNDQ  80

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGI QS++ AA WV +NVAAY P+TNITAIAVGSEVLTS+PNAAPVLV A+ Y+  ALV
Sbjct  81   LLGISQSNATAANWVTRNVAAYYPATNITAIAVGSEVLTSLPNAAPVLVSALKYIQAALV  140

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +ANL+ Q+KVSTP ++ +I   FPPS A F
Sbjct  141  TANLDRQIKVSTPHASTIILDSFPPSQAFF  170



>ref|XP_004503127.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Cicer arietinum]
Length=498

 Score =   180 bits (457),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 116/149 (78%), Gaps = 0/149 (0%)
 Frame = +1

Query  148  FVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEV  327
            F+G+NIGTD+S++P    VV LLK++QI+H RL++AD  ML+ALS +GI+V++ V N+E+
Sbjct  22   FIGVNIGTDLSDMPHPTQVVALLKSQQIRHIRLYNADLAMLTALSKSGIQVVISVPNDEL  81

Query  328  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  507
            L IGQS+S A  WV+ NV AY PSTNITAI VGSEVLT++PNAA +LV A+NY+H ALV+
Sbjct  82   LSIGQSNSTATKWVHNNVLAYYPSTNITAICVGSEVLTTLPNAAKLLVNALNYIHSALVA  141

Query  508  ANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
              L+ Q+KVSTP  + +I   FPPS A F
Sbjct  142  LKLDRQIKVSTPLPSTVILDSFPPSQAFF  170



>ref|XP_007163382.1| hypothetical protein PHAVU_001G230000g [Phaseolus vulgaris]
 gb|ESW35376.1| hypothetical protein PHAVU_001G230000g [Phaseolus vulgaris]
Length=498

 Score =   180 bits (457),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = +1

Query  148  FVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEV  327
            F+G+NIG D+S++P    VV LLKA+QI+H RL+DAD  ML AL+NTGI+V V V N E+
Sbjct  22   FIGVNIGRDLSDMPHPTQVVALLKAQQIRHVRLYDADQAMLIALANTGIKVAVSVPNEEI  81

Query  328  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  507
            L IGQS++ AA WV++NV A+ P+TNIT+I VGSEVLT++PNAA VLV A+ ++H AL++
Sbjct  82   LAIGQSNTTAAKWVSRNVVAHYPATNITSICVGSEVLTALPNAAKVLVSALKFIHSALLA  141

Query  508  ANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +NL+ Q+K+STP S+ +I   FPPS A F
Sbjct  142  SNLDHQIKISTPLSSSMIFDSFPPSQAFF  170



>ref|XP_004490818.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X2 
[Cicer arietinum]
Length=448

 Score =   179 bits (454),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = +1

Query  148  FVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEV  327
            F+G+NIGT++S++P    VV LLKA+QI+H RL+DAD  ML AL+ +GI+V++ V N E+
Sbjct  23   FIGVNIGTELSDMPHPTQVVALLKAQQIRHVRLYDADQAMLIALAKSGIQVVITVPNEEL  82

Query  328  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  507
            L IGQS++ AA WV++NV A+ P+TNITAI VGSEVLT++PN A VLV A+ Y+H ALV+
Sbjct  83   LAIGQSNASAANWVSRNVVAHYPATNITAICVGSEVLTTLPNVAKVLVNAIKYIHSALVA  142

Query  508  ANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +NL+ QVKVSTP S+ +I   FPPS A F
Sbjct  143  SNLDRQVKVSTPLSSSIILDSFPPSQAFF  171



>gb|KCW69377.1| hypothetical protein EUGRSUZ_F02860 [Eucalyptus grandis]
Length=451

 Score =   179 bits (454),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 119/149 (80%), Gaps = 0/149 (0%)
 Frame = +1

Query  148  FVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEV  327
            F+G+NIGTD+S++P    VV LLKA+ I+H RL++ D  +L+AL+NTGI+VIV V N ++
Sbjct  26   FIGVNIGTDLSDMPHPTQVVALLKAQNIRHIRLYNTDRGILAALANTGIQVIVSVPNEQL  85

Query  328  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  507
            LGIGQS+S AA WV++N+  + P+TNIT I+VGSEVLT++PNAAP+LV A+ ++H ALV+
Sbjct  86   LGIGQSNSTAANWVSQNIIVHYPATNITGISVGSEVLTALPNAAPILVNALKFIHSALVA  145

Query  508  ANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +NL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  146  SNLDRQIKVSTPLSSSVILDSFPPSQAFF  174



>ref|XP_009129217.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Brassica rapa]
 emb|CDY09427.1| BnaA02g25830D [Brassica napus]
Length=497

 Score =   180 bits (456),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 118/150 (79%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            + +G+NIGT+V+++PS   VV LLK++ I   RL+DAD  ML A ++TGI++I+ V N++
Sbjct  21   SLIGVNIGTEVTDMPSPTQVVTLLKSQNINRVRLYDADRSMLLAFAHTGIQLIISVPNDQ  80

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGI QS++ AA WV +NVAAY P+TNITAIAVGSEVLTS+PNAAPVLV A+ Y+  ALV
Sbjct  81   LLGISQSNATAANWVTRNVAAYYPATNITAIAVGSEVLTSLPNAAPVLVSALKYIQAALV  140

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +ANL+ Q+KVSTP ++ +I   FPPS A F
Sbjct  141  TANLDRQIKVSTPHASTIILDSFPPSQAFF  170



>gb|EMT05308.1| Glucan endo-1,3-beta-glucosidase 3 [Aegilops tauschii]
Length=500

 Score =   180 bits (456),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 118/151 (78%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GA++G+NIGT +S++P+A  +  LL+++ I+H RL+DAD  MLSAL+NTGI VI+ V N 
Sbjct  23   GAYIGVNIGTAMSSVPAATQITTLLRSQNIRHIRLYDADPGMLSALANTGIRVIISVPNE  82

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++L IG S++ AA WV +NVAA+ PS NITAIAVGSEVL+++PNAAP+++PAM YL  AL
Sbjct  83   QLLAIGNSNATAAKWVARNVAAHYPSVNITAIAVGSEVLSTLPNAAPLIMPAMRYLQNAL  142

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            V+A L+  +K+STP S+ +I   FPPS A F
Sbjct  143  VAAALDKYIKISTPHSSSIILDSFPPSQAFF  173



>ref|XP_006395868.1| hypothetical protein EUTSA_v10004013mg [Eutrema salsugineum]
 gb|ESQ33154.1| hypothetical protein EUTSA_v10004013mg [Eutrema salsugineum]
Length=422

 Score =   178 bits (452),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 116/150 (77%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            + +G+NIGT+V+N+PS   VV LLK++ I   RL+DAD  ML A ++TGI+VI+ V N++
Sbjct  4    SLIGVNIGTEVTNMPSPTQVVTLLKSQNINRVRLYDADRSMLLAFAHTGIQVIISVPNDQ  63

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGI QS++ AA WV +NVAAY P+TNIT IAVGSEVLT++PNAA VLV A+ Y+  AL+
Sbjct  64   LLGISQSNATAANWVTRNVAAYYPATNITTIAVGSEVLTTLPNAASVLVSALKYIQSALI  123

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +ANL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  124  TANLDRQIKVSTPHSSTIILDSFPPSQAFF  153



>ref|XP_004490817.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X1 
[Cicer arietinum]
Length=498

 Score =   179 bits (455),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = +1

Query  148  FVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEV  327
            F+G+NIGT++S++P    VV LLKA+QI+H RL+DAD  ML AL+ +GI+V++ V N E+
Sbjct  23   FIGVNIGTELSDMPHPTQVVALLKAQQIRHVRLYDADQAMLIALAKSGIQVVITVPNEEL  82

Query  328  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  507
            L IGQS++ AA WV++NV A+ P+TNITAI VGSEVLT++PN A VLV A+ Y+H ALV+
Sbjct  83   LAIGQSNASAANWVSRNVVAHYPATNITAICVGSEVLTTLPNVAKVLVNAIKYIHSALVA  142

Query  508  ANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +NL+ QVKVSTP S+ +I   FPPS A F
Sbjct  143  SNLDRQVKVSTPLSSSIILDSFPPSQAFF  171



>ref|XP_010062264.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 [Eucalyptus grandis]
 gb|KCW69376.1| hypothetical protein EUGRSUZ_F02860 [Eucalyptus grandis]
Length=499

 Score =   179 bits (455),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 119/149 (80%), Gaps = 0/149 (0%)
 Frame = +1

Query  148  FVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEV  327
            F+G+NIGTD+S++P    VV LLKA+ I+H RL++ D  +L+AL+NTGI+VIV V N ++
Sbjct  26   FIGVNIGTDLSDMPHPTQVVALLKAQNIRHIRLYNTDRGILAALANTGIQVIVSVPNEQL  85

Query  328  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  507
            LGIGQS+S AA WV++N+  + P+TNIT I+VGSEVLT++PNAAP+LV A+ ++H ALV+
Sbjct  86   LGIGQSNSTAANWVSQNIIVHYPATNITGISVGSEVLTALPNAAPILVNALKFIHSALVA  145

Query  508  ANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +NL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  146  SNLDRQIKVSTPLSSSVILDSFPPSQAFF  174



>ref|XP_010670126.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Beta vulgaris 
subsp. vulgaris]
Length=502

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 116/150 (77%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGTD+S++P    VV LLK++ I+H RL+DAD  ML AL+NTGI+V + V N +
Sbjct  23   AFLGVNIGTDLSDMPHPTQVVALLKSQHIRHVRLYDADKGMLVALANTGIQVAITVPNEQ  82

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS+S AA WV++ V A+ P+TNIT I VGSEVL++IPNAAP+LV A+ ++  ALV
Sbjct  83   LLGIGQSNSTAAKWVSQYVVAHYPATNITTICVGSEVLSTIPNAAPILVNALRFIQSALV  142

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL  Q+KVSTP ST +I   FPPS A F
Sbjct  143  ASNLERQIKVSTPLSTSVILDSFPPSQAFF  172



>ref|XP_010651370.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X2 [Vitis 
vinifera]
Length=431

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +1

Query  265  MLSALSNTGIEVIVGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTS  444
            ML+AL+NTGIEV+VGVTN EVLGIGQS S AA W+N+NVAAY+PSTNITAIAVGSEVLTS
Sbjct  1    MLNALANTGIEVVVGVTNEEVLGIGQSPSTAATWINRNVAAYVPSTNITAIAVGSEVLTS  60

Query  445  IPNAAPVLVPAMNYLHKALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            IP+AAPVLVPAMNYLHKALV++NLN Q+KVS PQS D+I + FPPSTA F
Sbjct  61   IPHAAPVLVPAMNYLHKALVASNLNFQIKVSAPQSLDIIPRPFPPSTATF  110



>gb|KJB10513.1| hypothetical protein B456_001G204900 [Gossypium raimondii]
Length=550

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 119/149 (80%), Gaps = 0/149 (0%)
 Frame = +1

Query  148  FVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEV  327
            ++G+NIGTD+S +P    VV LLKA+QI+H RL+DAD  ML AL+N+GI V+V + N ++
Sbjct  124  YIGVNIGTDLSIMPHPTQVVALLKAQQIRHIRLYDADRGMLVALANSGIRVMVSIPNEQL  183

Query  328  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  507
            LGIGQS+S AA WV++N+ A+ P+TNITAI VGSEVLT++PNAA +LV AM ++H ALV+
Sbjct  184  LGIGQSNSTAANWVSRNIVAHYPATNITAICVGSEVLTTLPNAARILVNAMKFIHSALVA  243

Query  508  ANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +NL++Q+KVS+P ++ +I   FPPS A F
Sbjct  244  SNLDNQIKVSSPLASSIILDSFPPSQAFF  272



>gb|EYU45799.1| hypothetical protein MIMGU_mgv1a004953mg [Erythranthe guttata]
Length=503

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 116/150 (77%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGTD+S++P    VV LLKA+QI+H RL++AD  ML AL+NTGI V + + N++
Sbjct  29   AFIGVNIGTDLSDMPHPTQVVALLKAQQIRHVRLYNADRGMLLALANTGIRVAISIPNDQ  88

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS+S AA WV++NVAA+ P+TNIT I VGSEV TS+PN  PVLV A+ Y+  ALV
Sbjct  89   ILGIGQSNSTAANWVSQNVAAHYPATNITTICVGSEVPTSLPNVGPVLVAALKYIQSALV  148

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL+ ++KVSTP  + +I   FPPS A F
Sbjct  149  ASNLDRRIKVSTPLPSLMILDSFPPSQAFF  178



>gb|KHG17836.1| hypothetical protein F383_07126 [Gossypium arboreum]
Length=519

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 119/149 (80%), Gaps = 0/149 (0%)
 Frame = +1

Query  148  FVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEV  327
            ++G+NIGTD+S +P    VV LLKA+QI+H RL+DAD  ML AL+N+GI V+V + N ++
Sbjct  11   YIGVNIGTDLSIMPHPTQVVALLKAQQIRHIRLYDADRGMLVALANSGIRVMVSIPNEQL  70

Query  328  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  507
            LGIGQS+S AA WV++N+ A+ P+TNITAI VGSEVLT++PNAA +LV AM ++H ALV+
Sbjct  71   LGIGQSNSTAANWVSRNIVAHYPATNITAICVGSEVLTTLPNAARILVNAMKFVHSALVA  130

Query  508  ANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +NL++Q+KVS+P ++ +I   FPPS A F
Sbjct  131  SNLDNQIKVSSPLASSIILDSFPPSQAFF  159



>gb|KJB10512.1| hypothetical protein B456_001G204900 [Gossypium raimondii]
Length=599

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 119/149 (80%), Gaps = 0/149 (0%)
 Frame = +1

Query  148  FVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEV  327
            ++G+NIGTD+S +P    VV LLKA+QI+H RL+DAD  ML AL+N+GI V+V + N ++
Sbjct  124  YIGVNIGTDLSIMPHPTQVVALLKAQQIRHIRLYDADRGMLVALANSGIRVMVSIPNEQL  183

Query  328  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  507
            LGIGQS+S AA WV++N+ A+ P+TNITAI VGSEVLT++PNAA +LV AM ++H ALV+
Sbjct  184  LGIGQSNSTAANWVSRNIVAHYPATNITAICVGSEVLTTLPNAARILVNAMKFIHSALVA  243

Query  508  ANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +NL++Q+KVS+P ++ +I   FPPS A F
Sbjct  244  SNLDNQIKVSSPLASSIILDSFPPSQAFF  272



>ref|XP_006395869.1| hypothetical protein EUTSA_v10004013mg [Eutrema salsugineum]
 gb|ESQ33155.1| hypothetical protein EUTSA_v10004013mg [Eutrema salsugineum]
Length=483

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 116/150 (77%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            + +G+NIGT+V+N+PS   VV LLK++ I   RL+DAD  ML A ++TGI+VI+ V N++
Sbjct  4    SLIGVNIGTEVTNMPSPTQVVTLLKSQNINRVRLYDADRSMLLAFAHTGIQVIISVPNDQ  63

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGI QS++ AA WV +NVAAY P+TNIT IAVGSEVLT++PNAA VLV A+ Y+  AL+
Sbjct  64   LLGISQSNATAANWVTRNVAAYYPATNITTIAVGSEVLTTLPNAASVLVSALKYIQSALI  123

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +ANL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  124  TANLDRQIKVSTPHSSTIILDSFPPSQAFF  153



>ref|XP_006364623.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X1 
[Solanum tuberosum]
Length=499

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 120/154 (78%), Gaps = 0/154 (0%)
 Frame = +1

Query  148  FVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEV  327
            F+G+NIGT++S++P    VV LLKA+QI+H RLF+AD  ML AL+NTGI+V V V N ++
Sbjct  25   FIGVNIGTELSDMPHPTQVVALLKAQQIRHVRLFNADRGMLLALANTGIKVAVSVPNEQI  84

Query  328  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  507
            LG+GQS++ AA WV +NV ++ P+TNIT I VGSEVL+++PNAAP+LV A+ ++H AL++
Sbjct  85   LGVGQSNTTAANWVTQNVISHYPATNITTICVGSEVLSALPNAAPILVNALKFIHSALLA  144

Query  508  ANLNSQVKVSTPQSTDLIAKIFPPSTAHFQLLVE  609
            +NL+ Q+KVSTP ++ +I   FPPS A F   V+
Sbjct  145  SNLDRQIKVSTPLASTIILDSFPPSQAFFNHTVK  178



>ref|NP_001275288.1| glucan endo-1,3-beta-glucosidase 2-like precursor [Solanum tuberosum]
 gb|AFU52636.1| beta-1,3-glucanase 1 [Solanum tuberosum]
Length=498

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 120/154 (78%), Gaps = 0/154 (0%)
 Frame = +1

Query  148  FVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEV  327
            F+G+NIGT++S++P    VV LLKA+QI+H RLF+AD  ML AL+NTGI+V V V N ++
Sbjct  25   FIGVNIGTELSDMPHPTQVVALLKAQQIRHVRLFNADRGMLLALANTGIKVAVSVPNEQI  84

Query  328  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  507
            LG+GQS++ AA WV +NV ++ P+TNIT I VGSEVL+++PNAAP+LV A+ ++H AL++
Sbjct  85   LGVGQSNTTAANWVTQNVISHYPATNITTICVGSEVLSALPNAAPILVNALKFIHSALLA  144

Query  508  ANLNSQVKVSTPQSTDLIAKIFPPSTAHFQLLVE  609
            +NL+ Q+KVSTP ++ +I   FPPS A F   V+
Sbjct  145  SNLDRQIKVSTPLASTIILDSFPPSQAFFNHTVK  178



>ref|XP_006293165.1| hypothetical protein CARUB_v10019481mg [Capsella rubella]
 gb|EOA26063.1| hypothetical protein CARUB_v10019481mg [Capsella rubella]
Length=500

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 116/150 (77%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            + +G+NIGT+V+N+PS   VV LLK++ I   RL+DAD  ML A ++TG++VI+ V N++
Sbjct  21   SLIGVNIGTEVTNMPSPTQVVALLKSQNINRVRLYDADRSMLLAFAHTGVQVIISVPNDQ  80

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGI QS++ AA WV +NVAAY P+TNIT IAVGSEVLTS+PNAA VLV A+ Y+  ALV
Sbjct  81   LLGISQSNATAANWVTRNVAAYYPATNITTIAVGSEVLTSLPNAASVLVSALKYIQAALV  140

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +ANL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  141  TANLDRQIKVSTPHSSTIILDSFPPSQAFF  170



>ref|NP_176799.2| glucan endo-1,3-beta-glucosidase 2 [Arabidopsis thaliana]
 sp|Q9C7U5.2|E132_ARATH RecName: Full=Glucan endo-1,3-beta-glucosidase 2; AltName: Full=(1->3)-beta-glucan 
endohydrolase 2; Short=(1->3)-beta-glucanase 
2; AltName: Full=Beta-1,3-endoglucanase 2; Short=Beta-1,3-glucanase 
2; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE34485.1| glucan endo-1,3-beta-glucosidase 2 [Arabidopsis thaliana]
Length=505

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 120/152 (79%), Gaps = 0/152 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            G+++G+NIGTD+S++P    VV LLKA++I+H RL++AD  +L AL+NTGI+VI+ + N+
Sbjct  29   GSYIGVNIGTDLSDMPHPTQVVALLKAQEIRHIRLYNADPGLLIALANTGIKVIISIPND  88

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++LGIGQS+S AA WV +NV A+ P+T ITA++VGSEVLTS+ NAAPVLV A+  +H AL
Sbjct  89   QLLGIGQSNSTAANWVKRNVIAHYPATMITAVSVGSEVLTSLSNAAPVLVSAIKNVHAAL  148

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHFQ  597
            +SANL+  +KVSTP ST LI   FPPS A F 
Sbjct  149  LSANLDKLIKVSTPLSTSLILDPFPPSQAFFN  180



>gb|ABI93926.1| At1g66250 [Arabidopsis thaliana]
Length=505

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 120/152 (79%), Gaps = 0/152 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            G+++G+NIGTD+S++P    VV LLKA++I+H RL++AD  +L AL+NTGI+VI+ + N+
Sbjct  29   GSYIGVNIGTDLSDMPHPTQVVALLKAQEIRHIRLYNADPGLLIALANTGIKVIISIPND  88

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++LGIGQS+S AA WV +NV A+ P+T ITA++VGSEVLTS+ NAAPVLV A+  +H AL
Sbjct  89   QLLGIGQSNSTAANWVKRNVIAHYPATMITAVSVGSEVLTSLSNAAPVLVSAIKNVHAAL  148

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHFQ  597
            +SANL+  +KVSTP ST LI   FPPS A F 
Sbjct  149  LSANLDKLIKVSTPLSTSLILDPFPPSQAFFN  180



>ref|XP_002876767.1| hypothetical protein ARALYDRAFT_484077 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53026.1| hypothetical protein ARALYDRAFT_484077 [Arabidopsis lyrata subsp. 
lyrata]
Length=500

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 116/150 (77%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            + +G+NIGT+V+N+PS   VV LLK++ I   RL+DAD  ML A ++TG++VI+ V N++
Sbjct  21   SLIGVNIGTEVTNMPSPTQVVALLKSQNINRVRLYDADRSMLLAFAHTGVQVIISVPNDQ  80

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGI QS++ AA WV +NVAAY P+TNIT IAVGSEVLTS+PNAA VLV A+ Y+  AL+
Sbjct  81   LLGISQSNATAANWVTRNVAAYYPATNITTIAVGSEVLTSLPNAASVLVSALKYIQAALI  140

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +ANL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  141  TANLDRQIKVSTPHSSTIILDSFPPSQAFF  170



>ref|XP_003558472.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Brachypodium distachyon]
Length=498

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 119/151 (79%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GA++G+NIGT +S++P+   +  LL+++ I+H RL+DAD  MLSAL+NTGI VIV V N 
Sbjct  22   GAYIGVNIGTAMSSVPAPTQITTLLRSQNIRHIRLYDADPAMLSALANTGIRVIVSVPNE  81

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++LGIG S++ AA WV +NVAA+ PS NITAIAVGSEVL+++PNAAP+++PA+ +L  AL
Sbjct  82   QLLGIGNSNATAAKWVARNVAAHYPSVNITAIAVGSEVLSTLPNAAPLIMPAVRFLQNAL  141

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            V+A+L+  +KVSTP S+ +I   FPPS A F
Sbjct  142  VAASLDRFIKVSTPHSSSIILDSFPPSQAFF  172



>ref|XP_006395867.1| hypothetical protein EUTSA_v10004013mg [Eutrema salsugineum]
 gb|ESQ33153.1| hypothetical protein EUTSA_v10004013mg [Eutrema salsugineum]
Length=516

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 116/150 (77%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            + +G+NIGT+V+N+PS   VV LLK++ I   RL+DAD  ML A ++TGI+VI+ V N++
Sbjct  37   SLIGVNIGTEVTNMPSPTQVVTLLKSQNINRVRLYDADRSMLLAFAHTGIQVIISVPNDQ  96

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGI QS++ AA WV +NVAAY P+TNIT IAVGSEVLT++PNAA VLV A+ Y+  AL+
Sbjct  97   LLGISQSNATAANWVTRNVAAYYPATNITTIAVGSEVLTTLPNAASVLVSALKYIQSALI  156

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +ANL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  157  TANLDRQIKVSTPHSSTIILDSFPPSQAFF  186



>gb|EMS47617.1| Glucan endo-1,3-beta-glucosidase 3 [Triticum urartu]
Length=529

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 118/153 (77%), Gaps = 0/153 (0%)
 Frame = +1

Query  136  FVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVT  315
            F  A++G+NIGT +S++P+A  +  LL+++ I+H RL+DAD  MLSAL+NTGI VI+ V 
Sbjct  50   FDWAYIGVNIGTAMSSVPAATQITTLLRSQNIRHIRLYDADPGMLSALANTGIRVIISVP  109

Query  316  NNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHK  495
            N ++L IG S++ AA WV +NVAA+ PS NITAIAVGSEVL+++PNAAP+++PAM YL  
Sbjct  110  NEQLLAIGNSNATAAKWVARNVAAHYPSVNITAIAVGSEVLSTLPNAAPLIMPAMRYLQN  169

Query  496  ALVSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ALV+A L+  +K+STP S+ +I   FPPS A F
Sbjct  170  ALVAAALDKYIKISTPHSSSIILDSFPPSQAFF  202



>gb|EPS74061.1| hypothetical protein M569_00697, partial [Genlisea aurea]
Length=430

 Score =   176 bits (446),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 114/149 (77%), Gaps = 0/149 (0%)
 Frame = +1

Query  148  FVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEV  327
            FVG+NIGTDVS+L S  D+V  LK ++I H RL+DADA +L AL+ T I+VIVGV NN++
Sbjct  6    FVGVNIGTDVSSLLSPSDLVSFLKLQKITHIRLYDADAQILRALAKTDIQVIVGVPNNQL  65

Query  328  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  507
            L +G S++ AA+WV +NVAAY P T ITAIAVG EVLT++P + P+LVPAM  L+ ALV+
Sbjct  66   LAVGSSNATAASWVGRNVAAYYPETLITAIAVGDEVLTTVPTSVPLLVPAMESLYSALVA  125

Query  508  ANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ANL+  VK+S+P S  ++   FPPS A+F
Sbjct  126  ANLHDVVKISSPSSASIVLDPFPPSQAYF  154



>gb|ACN30650.1| unknown [Zea mays]
 gb|ACN31599.1| unknown [Zea mays]
 gb|ACR36210.1| unknown [Zea mays]
 gb|AFW89170.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=501

 Score =   177 bits (449),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 116/151 (77%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GA++G+NIGT +S++P+   +  LL+++ I+H RL+DAD  ML+ALSNTGI VIV V N 
Sbjct  23   GAYIGVNIGTAMSSVPAPTQITTLLRSQNIRHVRLYDADPAMLAALSNTGIRVIVSVPNE  82

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++L IG S++ AA WV +NVAA+ P+ NITAIAVGSEVL++ PNAAP+L+PAM YL  AL
Sbjct  83   QLLAIGNSNATAANWVARNVAAHFPAVNITAIAVGSEVLSAQPNAAPLLMPAMRYLQNAL  142

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            V+A L+  +K+STP S+ +I   FPPS A F
Sbjct  143  VAAALDRYIKISTPHSSSIILDSFPPSQAFF  173



>ref|NP_001077866.1| glucan endo-1,3-beta-glucosidase 3 [Arabidopsis thaliana]
 gb|AEC05476.1| glucan endo-1,3-beta-glucosidase 3 [Arabidopsis thaliana]
Length=391

 Score =   174 bits (442),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 115/150 (77%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            + +G+NIGT+V+N+PS   VV LLK++ I   RL+DAD  ML A ++TG++VI+ V N++
Sbjct  21   SLIGVNIGTEVTNMPSPTQVVALLKSQNINRVRLYDADRSMLLAFAHTGVQVIISVPNDQ  80

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGI QS++ AA WV +NVAAY P+TNIT IAVGSEVLTS+ NAA VLV A+ Y+  ALV
Sbjct  81   LLGISQSNATAANWVTRNVAAYYPATNITTIAVGSEVLTSLTNAASVLVSALKYIQAALV  140

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +ANL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  141  TANLDRQIKVSTPHSSTIILDSFPPSQAFF  170



>ref|XP_009390355.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Musa acuminata 
subsp. malaccensis]
Length=501

 Score =   177 bits (448),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 117/156 (75%), Gaps = 0/156 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            G ++G+N+GT +S++PS   V  LLK ++I H RL+DAD  ML+AL+NTGI V V V N 
Sbjct  21   GPYIGVNVGTALSDMPSPTQVAALLKTQKIDHVRLYDADPAMLAALANTGIRVTVSVPNE  80

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++L +GQS++ AA WV +NV A++P+ NITAIAVGSEVLT++PNAA +LVPA+ Y+H AL
Sbjct  81   QLLAVGQSNATAANWVARNVVAHVPAVNITAIAVGSEVLTALPNAATLLVPALRYIHSAL  140

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHFQLLVE  609
            V+ANL+  +KVSTP ++ +I   FPPS A F    E
Sbjct  141  VAANLDGLIKVSTPHASSVILDSFPPSQAFFNRTFE  176



>ref|XP_006855931.1| hypothetical protein AMTR_s00037p00209440 [Amborella trichopoda]
 gb|ERN17398.1| hypothetical protein AMTR_s00037p00209440 [Amborella trichopoda]
Length=478

 Score =   176 bits (447),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 116/150 (77%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AFVG+NIGTDVS++ S  D+V LL+ ++I   RL+D D  +L AL+ T I+V+VGV NN+
Sbjct  31   AFVGVNIGTDVSDVLSPSDLVSLLQRQKITQVRLYDVDKDILKALARTSIQVMVGVPNNQ  90

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +L I QS++ AAAWV +NVAA+LP T+I AIAVG EVLTS+P+AAP+L+PA+  +H ALV
Sbjct  91   LLAIAQSNATAAAWVQRNVAAHLPDTDIIAIAVGDEVLTSLPSAAPLLLPAIKSIHSALV  150

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            SA L+S+V VSTP S D+I   FPPS A F
Sbjct  151  SAALDSKVYVSTPHSADIIVDPFPPSQAFF  180



>ref|XP_010324460.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X1 
[Solanum lycopersicum]
Length=501

 Score =   177 bits (448),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 118/149 (79%), Gaps = 0/149 (0%)
 Frame = +1

Query  148  FVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEV  327
            F+G+NIGT++S++P    VV LLKA+QI+H RLF+AD  ML AL+NTGI+V V V N ++
Sbjct  25   FIGVNIGTELSDMPHPTQVVALLKAQQIRHVRLFNADRGMLLALANTGIKVAVSVPNEQI  84

Query  328  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  507
            LG+GQS++ AA WV +N+ ++ P+TNIT I VGSEVL+++PNAAP+LV A+ ++H AL++
Sbjct  85   LGVGQSNTTAANWVTQNIISHYPATNITTICVGSEVLSALPNAAPILVNALKFVHSALLA  144

Query  508  ANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +NL+ Q+KVSTP ++ +I   FPPS A F
Sbjct  145  SNLDRQIKVSTPLASTIILDSFPPSQAFF  173



>ref|XP_004244387.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X2 
[Solanum lycopersicum]
Length=500

 Score =   177 bits (448),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 118/149 (79%), Gaps = 0/149 (0%)
 Frame = +1

Query  148  FVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEV  327
            F+G+NIGT++S++P    VV LLKA+QI+H RLF+AD  ML AL+NTGI+V V V N ++
Sbjct  25   FIGVNIGTELSDMPHPTQVVALLKAQQIRHVRLFNADRGMLLALANTGIKVAVSVPNEQI  84

Query  328  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  507
            LG+GQS++ AA WV +N+ ++ P+TNIT I VGSEVL+++PNAAP+LV A+ ++H AL++
Sbjct  85   LGVGQSNTTAANWVTQNIISHYPATNITTICVGSEVLSALPNAAPILVNALKFVHSALLA  144

Query  508  ANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +NL+ Q+KVSTP ++ +I   FPPS A F
Sbjct  145  SNLDRQIKVSTPLASTIILDSFPPSQAFF  173



>ref|XP_002468258.1| hypothetical protein SORBIDRAFT_01g042560 [Sorghum bicolor]
 gb|EER95256.1| hypothetical protein SORBIDRAFT_01g042560 [Sorghum bicolor]
Length=502

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 116/151 (77%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GA++G+NIGT +S++P+   +  LL+++ I+H RL+DAD  ML+ALSNTGI VIV V N 
Sbjct  23   GAYIGVNIGTAMSSVPAPTQITTLLRSQNIRHVRLYDADPAMLAALSNTGIRVIVSVPNE  82

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++L IG S++ AA WV +NVAA+ P+ NITAIAVGSEVL++ PNAAP+L+PAM YL  AL
Sbjct  83   QLLAIGNSNATAANWVARNVAAHFPAVNITAIAVGSEVLSAQPNAAPLLMPAMRYLQNAL  142

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            V+A L+  +K+STP S+ +I   FPPS A F
Sbjct  143  VAAALDRYIKISTPHSSSIILDSFPPSQAFF  173



>ref|NP_001150141.1| glucan endo-1,3-beta-glucosidase 3 precursor [Zea mays]
 gb|ACG38014.1| glucan endo-1,3-beta-glucosidase 3 precursor [Zea mays]
Length=501

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 116/151 (77%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GA++G+NIGT +S++P+   +  LL+++ I+H RL+DAD  ML+ALSNTGI VIV V N 
Sbjct  23   GAYIGVNIGTAMSSVPAPTQITTLLRSQNIRHVRLYDADPAMLAALSNTGIRVIVSVPNE  82

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++L IG S++ AA WV +NVAA+ P+ NITAIAVGSEVL++ PNAAP+L+PAM YL  AL
Sbjct  83   QLLAIGNSNATAANWVARNVAAHFPAVNITAIAVGSEVLSAQPNAAPLLMPAMRYLQNAL  142

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            V+A L+  +K+STP S+ +I   FPPS A F
Sbjct  143  VAAALDRYIKISTPHSSSIILDSFPPSQAFF  173



>ref|XP_006300850.1| hypothetical protein CARUB_v10019942mg, partial [Capsella rubella]
 gb|EOA33748.1| hypothetical protein CARUB_v10019942mg, partial [Capsella rubella]
Length=641

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 118/152 (78%), Gaps = 0/152 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GA++G+NIGTD+S++P    VV LLKA+QI+H RL+DAD  ML AL+N+ I+VI+ + N+
Sbjct  163  GAYIGVNIGTDLSDMPHPTQVVALLKAQQIRHIRLYDADPGMLVALANSAIKVIISIPND  222

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++LGIGQS+S AA WV +NV A+ P+T I AI+VGS+VLTS+ NAAPVLV A+  +H AL
Sbjct  223  QLLGIGQSNSTAANWVKRNVIAHYPATTIIAISVGSDVLTSLSNAAPVLVSAIKNVHAAL  282

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHFQ  597
            +SANL+  +KVSTP ST LI   FPPS A F 
Sbjct  283  LSANLDRLIKVSTPLSTALILDPFPPSQAFFN  314



>gb|AAK85402.2| beta-1,3-glucanase [Camellia sinensis]
Length=495

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 117/150 (78%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            A++G+NIGTD++++P    VV LLKA+QI+H RL++AD  ML AL+NT I+V + V N +
Sbjct  20   AYIGVNIGTDLADMPHPTQVVALLKAQQIRHVRLYNADRGMLLALANTDIKVAISVPNEQ  79

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS+S AA WV++NV A+ P+TNIT I VGSEVLT++PNAA VLV A+ Y+  ALV
Sbjct  80   LLGIGQSNSTAANWVSQNVVAHYPATNITTICVGSEVLTTLPNAAHVLVSALKYIQSALV  139

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ++NL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  140  ASNLDRQIKVSTPLSSSIILDSFPPSQAFF  169



>ref|XP_003538392.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Glycine max]
Length=498

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 113/149 (76%), Gaps = 0/149 (0%)
 Frame = +1

Query  148  FVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEV  327
            F+G+NIG D+S++P    VV LLKA+QI+H RL+DAD  ML AL+NT I+V V V N E+
Sbjct  22   FIGVNIGRDLSDMPHPTQVVALLKAQQIRHVRLYDADQAMLIALANTRIQVAVSVPNQEI  81

Query  328  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  507
            L IGQS++ AA WV+ NV A+ P+TNIT I VGSEVLT++P AA VLV A+ +LH ALV+
Sbjct  82   LAIGQSNTTAAKWVSHNVIAHYPATNITTICVGSEVLTTLPYAAKVLVSALKFLHSALVA  141

Query  508  ANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +NL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  142  SNLDHQIKVSTPLSSSMILDSFPPSQAFF  170



>gb|KHN17951.1| Glucan endo-1,3-beta-glucosidase 2 [Glycine soja]
Length=498

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 113/149 (76%), Gaps = 0/149 (0%)
 Frame = +1

Query  148  FVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEV  327
            F+G+NIG D+S++P    VV LLKA+QI+H RL+DAD  ML AL+NT I+V V V N E+
Sbjct  22   FIGVNIGRDLSDMPHPTQVVALLKAQQIRHVRLYDADQAMLIALANTRIQVAVSVPNQEI  81

Query  328  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  507
            L IGQS++ AA WV+ NV A+ P+TNIT I VGSEVLT++P AA VLV A+ +LH ALV+
Sbjct  82   LAIGQSNTTAAKWVSHNVIAHYPATNITTICVGSEVLTTLPYAAKVLVSALKFLHSALVA  141

Query  508  ANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +NL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  142  SNLDHQIKVSTPLSSSMILDSFPPSQAFF  170



>ref|XP_011096055.1| PREDICTED: glucan endo-1,3-beta-glucosidase 1 [Sesamum indicum]
Length=515

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 114/151 (75%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            G FVG+NIGTDVSNL SA D+V  L+ ++I H RL+DADA +L AL+ T I VIV V NN
Sbjct  33   GPFVGVNIGTDVSNLLSAADLVAFLQLQKINHVRLYDADAQILKALAKTKIRVIVSVPNN  92

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++L IG S++ AA W+ +NVAAY P T IT IAVG EVLT+IP++AP+L+ A+  L+ AL
Sbjct  93   QLLAIGSSNATAATWIGRNVAAYYPDTLITGIAVGDEVLTTIPSSAPLLMSAIESLYSAL  152

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            V+ANL++Q+K+STP S  +I   FPPS A F
Sbjct  153  VAANLHTQIKISTPSSASIILDPFPPSQAFF  183



>ref|XP_010686818.1| PREDICTED: glucan endo-1,3-beta-glucosidase 1 [Beta vulgaris 
subsp. vulgaris]
Length=519

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 114/149 (77%), Gaps = 0/149 (0%)
 Frame = +1

Query  148  FVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEV  327
            +VG+NIGTD+SN+ S  D+V  L+ ++I H RL+DAD  +L AL++T I VI+GV NN++
Sbjct  40   YVGVNIGTDISNILSPSDLVSFLQVQKINHVRLYDADPDLLKALAHTKIRVIIGVPNNQL  99

Query  328  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  507
            + IG S++ AAAWV++NV A+ P T I AIAVG EVLT++P+ AP+L+PA+  LH ALV+
Sbjct  100  IAIGSSNATAAAWVDRNVVAFFPETTIIAIAVGDEVLTTMPSTAPLLLPALESLHSALVA  159

Query  508  ANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +NL++Q+KVSTP S  LI   FPPS A F
Sbjct  160  SNLHTQIKVSTPHSASLILDPFPPSQAFF  188



>ref|NP_001130376.1| putative O-Glycosyl hydrolase superfamily protein precursor [Zea 
mays]
 gb|ACF78568.1| unknown [Zea mays]
 gb|ACR36311.1| unknown [Zea mays]
 tpg|DAA44125.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=502

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 116/151 (77%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GA++G+NIGT +S++P+   +  LL+++ I+H RL+DAD  ML+ALSNTGI VIV V N 
Sbjct  23   GAYIGVNIGTAMSSVPAPTQITTLLRSQNIRHVRLYDADPAMLAALSNTGIRVIVSVPNE  82

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++L IG S++ AA WV +NVAA+ P+ NITAIAVGSEVL++ P+AAP+L+PAM YL  AL
Sbjct  83   QLLAIGNSNATAANWVARNVAAHFPAVNITAIAVGSEVLSAQPSAAPLLMPAMRYLQNAL  142

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            V+A L+  +KVSTP S+ +I   FPPS A F
Sbjct  143  VAAALDRYIKVSTPHSSSIILDSFPPSQAFF  173



>ref|NP_001049413.1| Os03g0221500 [Oryza sativa Japonica Group]
 gb|AAN05325.1| Putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 gb|ABF94701.1| Glucan endo-1,3-beta-glucosidase 3 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11327.1| Os03g0221500 [Oryza sativa Japonica Group]
 gb|EAY89076.1| hypothetical protein OsI_10562 [Oryza sativa Indica Group]
 gb|EAZ26099.1| hypothetical protein OsJ_09957 [Oryza sativa Japonica Group]
 dbj|BAG95914.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99718.1| unnamed protein product [Oryza sativa Japonica Group]
Length=504

 Score =   175 bits (443),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 117/151 (77%), Gaps = 0/151 (0%)
 Frame = +1

Query  142  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNN  321
            GA++G+NIGT ++++P+   +  LL+++ I+H RL+DAD  ML+AL+NTGI VIV V N 
Sbjct  23   GAYIGVNIGTAMTSVPAPTQITTLLRSQNIRHVRLYDADPAMLAALANTGIRVIVSVPNE  82

Query  322  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  501
            ++L IG S++ AA WV +NVAA+ PS NITAIAVGSEVL+++PNAAP+L+PA+ YL  AL
Sbjct  83   QLLAIGNSNATAANWVARNVAAHYPSVNITAIAVGSEVLSTLPNAAPLLMPAIRYLQNAL  142

Query  502  VSANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            V+A L+  +K+STP S+ +I   FPPS A F
Sbjct  143  VAAALDRYIKISTPHSSSIILDSFPPSQAFF  173



>ref|XP_009593892.1| PREDICTED: glucan endo-1,3-beta-glucosidase 1 [Nicotiana tomentosiformis]
Length=525

 Score =   175 bits (444),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 113/149 (76%), Gaps = 0/149 (0%)
 Frame = +1

Query  148  FVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNEV  327
            +VG+NIGTDVSN  S  D+V  L+ ++I H RLFDAD  ML AL+ T I VI+ V NN++
Sbjct  43   YVGVNIGTDVSNFLSPSDLVAFLQLQKITHIRLFDADPDMLKALAKTKIRVIISVPNNQI  102

Query  328  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  507
            L IG S++ AAAW+ +NVAAY P T ITAIAVG E+LT++P++AP+L+PA+  L+ ALV+
Sbjct  103  LAIGSSNTTAAAWIGRNVAAYYPETLITAIAVGDEILTTVPSSAPLLMPAIESLYSALVA  162

Query  508  ANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            ANL++Q+K+STP S  +I   FPPS A F
Sbjct  163  ANLHTQIKISTPNSASIILDPFPPSQAFF  191



>ref|XP_006580439.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Glycine max]
Length=494

 Score =   175 bits (443),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 122/150 (81%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIG+D+S++P   ++V LLKA+ I+H RL+DAD  +L AL+NTGI V V V N++
Sbjct  20   AFIGVNIGSDISDMPGPTEIVALLKAQSIQHVRLYDADQALLLALANTGIRVTVSVPNDQ  79

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV +NV A++P+TNITAI VGSEVLT++PNAAP+LV A+N++H ALV
Sbjct  80   LLGIGQSNATAANWVTRNVIAHVPATNITAICVGSEVLTTLPNAAPILVSAINFIHSALV  139

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +ANL+ Q+KVS+P S+ +I   FPPS A F
Sbjct  140  AANLDRQIKVSSPHSSSIILDSFPPSQAFF  169



>gb|AIR93909.1| glucanase [Cicer arietinum]
Length=454

 Score =   174 bits (441),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 122/150 (81%), Gaps = 0/150 (0%)
 Frame = +1

Query  145  AFVGINIGTDVSNLPSAKDVVELLKARQIKHARLFDADAHMLSALSNTGIEVIVGVTNNE  324
            AF+G+NIGTD+S++P+  + V LLKA+ I+H RLFDAD  +L AL+NTGI V + V N++
Sbjct  25   AFIGVNIGTDLSDMPTPTETVALLKAQSIQHVRLFDADRALLLALANTGIRVTISVPNDQ  84

Query  325  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  504
            +LGIGQS++ AA WV++NV A++P+TNIT+IAVGSEVLT++ NAAP+LV AM ++H ALV
Sbjct  85   ILGIGQSNATAANWVSRNVIAHVPATNITSIAVGSEVLTTLSNAAPILVSAMKFIHSALV  144

Query  505  SANLNSQVKVSTPQSTDLIAKIFPPSTAHF  594
            +ANL+ Q+KVSTP S+ +I   FPPS A F
Sbjct  145  AANLDGQIKVSTPHSSSIILDSFPPSQAFF  174



Lambda      K        H        a         alpha
   0.316    0.129    0.362    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 829366762230