BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF039J05

Length=247
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CBI20727.3|  unnamed protein product                                157   2e-42   Vitis vinifera
gb|KDP34024.1|  hypothetical protein JCGZ_07595                         157   3e-42   Jatropha curcas
ref|XP_002280069.2|  PREDICTED: LRR receptor-like serine/threonin...    157   3e-42   Vitis vinifera
ref|XP_002516144.1|  erecta, putative                                   157   3e-42   Ricinus communis
ref|XP_007012431.1|  Leucine-rich receptor-like protein kinase fa...    156   5e-42   
ref|XP_009605434.1|  PREDICTED: LRR receptor-like serine/threonin...    156   9e-42   Nicotiana tomentosiformis
ref|XP_010474472.1|  PREDICTED: LRR receptor-like serine/threonin...    155   9e-42   Camelina sativa [gold-of-pleasure]
ref|XP_009802873.1|  PREDICTED: LRR receptor-like serine/threonin...    155   9e-42   Nicotiana sylvestris
ref|XP_008452789.1|  PREDICTED: LRR receptor-like serine/threonin...    155   1e-41   Cucumis melo [Oriental melon]
ref|NP_180201.1|  LRR receptor-like serine/threonine-protein kina...    155   1e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004141340.1|  PREDICTED: LRR receptor-like serine/threonin...    155   1e-41   Cucumis sativus [cucumbers]
ref|XP_006296065.1|  hypothetical protein CARUB_v10025215mg             155   1e-41   Capsella rubella
ref|XP_002880777.1|  hypothetical protein ARALYDRAFT_481491             155   1e-41   
ref|XP_010429655.1|  PREDICTED: LRR receptor-like serine/threonin...    155   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010417421.1|  PREDICTED: LRR receptor-like serine/threonin...    155   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_004245043.1|  PREDICTED: LRR receptor-like serine/threonin...    155   2e-41   Solanum lycopersicum
ref|XP_009117015.1|  PREDICTED: LRR receptor-like serine/threonin...    155   2e-41   Brassica rapa
gb|AGL91677.1|  erecta leucine-rich-repeat receptor-like kinase         155   2e-41   Brassica napus [oilseed rape]
ref|XP_006353850.1|  PREDICTED: LRR receptor-like serine/threonin...    155   2e-41   Solanum tuberosum [potatoes]
gb|EYU20292.1|  hypothetical protein MIMGU_mgv1a026417mg                155   2e-41   Erythranthe guttata [common monkey flower]
gb|EYU32328.1|  hypothetical protein MIMGU_mgv1a000790mg                155   2e-41   Erythranthe guttata [common monkey flower]
gb|KJB07391.1|  hypothetical protein B456_001G019800                    155   2e-41   Gossypium raimondii
ref|XP_007225368.1|  hypothetical protein PRUPE_ppa000847mg             154   3e-41   
ref|XP_008220575.1|  PREDICTED: LRR receptor-like serine/threonin...    154   3e-41   Prunus mume [ume]
ref|XP_011081595.1|  PREDICTED: LRR receptor-like serine/threonin...    154   3e-41   Sesamum indicum [beniseed]
ref|XP_008220576.1|  PREDICTED: LRR receptor-like serine/threonin...    154   3e-41   Prunus mume [ume]
gb|KJB65469.1|  hypothetical protein B456_010G096300                    154   4e-41   Gossypium raimondii
gb|KJB65470.1|  hypothetical protein B456_010G096300                    154   4e-41   Gossypium raimondii
ref|XP_011069519.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...    154   4e-41   Sesamum indicum [beniseed]
gb|KJB65473.1|  hypothetical protein B456_010G096300                    154   5e-41   Gossypium raimondii
gb|KJB65471.1|  hypothetical protein B456_010G096300                    154   5e-41   Gossypium raimondii
gb|KJB65472.1|  hypothetical protein B456_010G096300                    154   5e-41   Gossypium raimondii
ref|XP_010261893.1|  PREDICTED: LRR receptor-like serine/threonin...    153   6e-41   Nelumbo nucifera [Indian lotus]
emb|CDP13474.1|  unnamed protein product                                153   7e-41   Coffea canephora [robusta coffee]
gb|KFK32516.1|  hypothetical protein AALP_AA6G252800                    153   7e-41   Arabis alpina [alpine rockcress]
ref|XP_006474503.1|  PREDICTED: LRR receptor-like serine/threonin...    153   8e-41   Citrus sinensis [apfelsine]
ref|XP_007161048.1|  hypothetical protein PHAVU_001G038400g             151   1e-40   Phaseolus vulgaris [French bean]
ref|XP_009337156.1|  PREDICTED: LRR receptor-like serine/threonin...    152   1e-40   Pyrus x bretschneideri [bai li]
ref|XP_008393446.1|  PREDICTED: LRR receptor-like serine/threonin...    152   1e-40   
ref|XP_007161049.1|  hypothetical protein PHAVU_001G038400g             152   2e-40   Phaseolus vulgaris [French bean]
ref|XP_004303459.1|  PREDICTED: LRR receptor-like serine/threonin...    152   2e-40   Fragaria vesca subsp. vesca
ref|XP_006452987.1|  hypothetical protein CICLE_v100073971mg            149   3e-40   
ref|XP_010669304.1|  PREDICTED: LRR receptor-like serine/threonin...    151   3e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009362801.1|  PREDICTED: LRR receptor-like serine/threonin...    151   4e-40   Pyrus x bretschneideri [bai li]
ref|XP_008393579.1|  PREDICTED: LRR receptor-like serine/threonin...    151   4e-40   Malus domestica [apple tree]
gb|KHN37058.1|  LRR receptor-like serine/threonine-protein kinase...    150   5e-40   Glycine soja [wild soybean]
ref|XP_010917192.1|  PREDICTED: LRR receptor-like serine/threonin...    150   6e-40   Elaeis guineensis
ref|XP_009408412.1|  PREDICTED: LRR receptor-like serine/threonin...    150   6e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004498861.1|  PREDICTED: LRR receptor-like serine/threonin...    150   7e-40   
ref|XP_004498860.1|  PREDICTED: LRR receptor-like serine/threonin...    150   7e-40   Cicer arietinum [garbanzo]
ref|XP_004498859.1|  PREDICTED: LRR receptor-like serine/threonin...    150   7e-40   Cicer arietinum [garbanzo]
ref|XP_006581305.1|  PREDICTED: LRR receptor-like serine/threonin...    150   7e-40   Glycine max [soybeans]
ref|XP_006408746.1|  hypothetical protein EUTSA_v10001898mg             150   8e-40   Eutrema salsugineum [saltwater cress]
ref|XP_006578096.1|  PREDICTED: LRR receptor-like serine/threonin...    150   9e-40   Glycine max [soybeans]
ref|XP_003522304.1|  PREDICTED: LRR receptor-like serine/threonin...    150   9e-40   
ref|XP_003544548.1|  PREDICTED: LRR receptor-like serine/threonin...    150   9e-40   Glycine max [soybeans]
ref|XP_010098375.1|  LRR receptor-like serine/threonine-protein k...    150   1e-39   
ref|XP_010526027.1|  PREDICTED: LRR receptor-like serine/threonin...    150   1e-39   Tarenaya hassleriana [spider flower]
ref|XP_008786642.1|  PREDICTED: LRR receptor-like serine/threonin...    149   2e-39   
ref|XP_008786640.1|  PREDICTED: LRR receptor-like serine/threonin...    149   2e-39   Phoenix dactylifera
ref|XP_008786639.1|  PREDICTED: LRR receptor-like serine/threonin...    149   2e-39   Phoenix dactylifera
ref|XP_006849687.1|  hypothetical protein AMTR_s00024p00237440          149   2e-39   
ref|XP_007136889.1|  hypothetical protein PHAVU_009G082500g             149   2e-39   Phaseolus vulgaris [French bean]
ref|XP_010047401.1|  PREDICTED: LRR receptor-like serine/threonin...    149   3e-39   Eucalyptus grandis [rose gum]
ref|XP_006381995.1|  hypothetical protein POPTR_0006s23680g             148   3e-39   
gb|EMS58253.1|  LRR receptor-like serine/threonine-protein kinase...    148   5e-39   Triticum urartu
ref|XP_011019342.1|  PREDICTED: LRR receptor-like serine/threonin...    148   5e-39   Populus euphratica
gb|AGL91674.1|  erecta-like leucine-rich-repeat receptor-like kinase    147   8e-39   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ89970.1|  predicted protein                                      147   8e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT12712.1|  LRR receptor-like serine/threonine-protein kinase...    147   9e-39   
gb|AGL91675.1|  erecta-like leucine-rich-repeat receptor-like kinase    146   2e-38   Triticum aestivum [Canadian hard winter wheat]
gb|EPS61595.1|  hypothetical protein M569_13200                         144   2e-38   Genlisea aurea
ref|XP_003561134.2|  PREDICTED: LRR receptor-like serine/threonin...    146   2e-38   
gb|AFW86032.1|  putative leucine-rich repeat receptor-like protei...    142   4e-38   
gb|AES59193.2|  LRR receptor-like kinase family protein                 145   5e-38   Medicago truncatula
gb|AFW86033.1|  putative leucine-rich repeat receptor-like protei...    142   5e-38   
ref|XP_003588942.1|  LRR receptor-like serine/threonine-protein k...    145   5e-38   
gb|KEH39916.1|  LRR receptor-like kinase family protein                 145   6e-38   Medicago truncatula
gb|AFW86031.1|  putative leucine-rich repeat receptor-like protei...    144   8e-38   
ref|XP_008658489.1|  PREDICTED: uncharacterized protein LOC100279...    144   9e-38   
ref|XP_010227884.1|  PREDICTED: LRR receptor-like serine/threonin...    144   1e-37   Brachypodium distachyon [annual false brome]
ref|XP_003564133.1|  PREDICTED: LRR receptor-like serine/threonin...    144   1e-37   Brachypodium distachyon [annual false brome]
ref|XP_010276048.1|  PREDICTED: LRR receptor-like serine/threonin...    144   1e-37   Nelumbo nucifera [Indian lotus]
ref|XP_010276057.1|  PREDICTED: LRR receptor-like serine/threonin...    144   1e-37   Nelumbo nucifera [Indian lotus]
ref|XP_002436407.1|  hypothetical protein SORBIDRAFT_10g001970          144   1e-37   Sorghum bicolor [broomcorn]
ref|XP_004964421.1|  PREDICTED: LRR receptor-like serine/threonin...    144   1e-37   Setaria italica
gb|AFJ38186.2|  receptor-like serine/threonine protein kinase 1         144   1e-37   Triticum aestivum [Canadian hard winter wheat]
gb|AFW86034.1|  putative leucine-rich repeat receptor-like protei...    144   1e-37   
ref|XP_004964941.1|  PREDICTED: LRR receptor-like serine/threonin...    144   1e-37   Setaria italica
ref|XP_006656743.1|  PREDICTED: LRR receptor-like serine/threonin...    144   1e-37   Oryza brachyantha
ref|XP_004964942.1|  PREDICTED: LRR receptor-like serine/threonin...    144   1e-37   Setaria italica
ref|XP_010273915.1|  PREDICTED: LRR receptor-like serine/threonin...    144   2e-37   Nelumbo nucifera [Indian lotus]
ref|XP_010273914.1|  PREDICTED: LRR receptor-like serine/threonin...    144   2e-37   Nelumbo nucifera [Indian lotus]
gb|AGL91672.1|  erecta leucine-rich-repeat receptor-like kinase         143   2e-37   Triticum aestivum [Canadian hard winter wheat]
gb|AFJ38187.2|  receptor-like serine/threonine protein kinase 2         143   2e-37   Triticum aestivum [Canadian hard winter wheat]
dbj|BAD44800.1|  putative transmembrane protein kinase                  143   3e-37   Oryza sativa Japonica Group [Japonica rice]
gb|ACY07616.1|  stress-induced protein kinase                           143   3e-37   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ96098.1|  predicted protein                                      143   3e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001056687.1|  Os06g0130100                                       143   3e-37   
gb|EEC80197.1|  hypothetical protein OsI_22078                          143   3e-37   Oryza sativa Indica Group [Indian rice]
dbj|BAK07025.1|  predicted protein                                      143   3e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001057087.1|  Os06g0203800                                       143   4e-37   
gb|AFC88469.1|  ERECTA                                                  142   4e-37   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006656595.1|  PREDICTED: LRR receptor-like serine/threonin...    141   1e-36   Oryza brachyantha
ref|XP_008647408.1|  PREDICTED: uncharacterized protein LOC100193...    140   2e-36   Zea mays [maize]
gb|AGT17158.1|  ERECTA-like 2                                           140   2e-36   Saccharum hybrid cultivar R570
ref|XP_008647407.1|  PREDICTED: uncharacterized protein LOC100193...    140   2e-36   Zea mays [maize]
ref|XP_008810292.1|  PREDICTED: LRR receptor-like serine/threonin...    140   2e-36   
gb|AFW76644.1|  putative leucine-rich repeat receptor-like protei...    140   2e-36   
ref|XP_002438023.1|  hypothetical protein SORBIDRAFT_10g006670          140   2e-36   Sorghum bicolor [broomcorn]
gb|AFW76643.1|  putative leucine-rich repeat receptor-like protei...    140   3e-36   
ref|XP_008810291.1|  PREDICTED: LRR receptor-like serine/threonin...    140   3e-36   Phoenix dactylifera
ref|XP_008810290.1|  PREDICTED: LRR receptor-like serine/threonin...    140   3e-36   
ref|XP_006858024.1|  hypothetical protein AMTR_s00069p00198500          139   7e-36   
ref|XP_010277441.1|  PREDICTED: LRR receptor-like serine/threonin...    138   1e-35   Nelumbo nucifera [Indian lotus]
ref|XP_010277439.1|  PREDICTED: LRR receptor-like serine/threonin...    138   1e-35   Nelumbo nucifera [Indian lotus]
ref|XP_010277442.1|  PREDICTED: LRR receptor-like serine/threonin...    138   2e-35   Nelumbo nucifera [Indian lotus]
gb|KEH43759.1|  LRR receptor-like kinase family protein                 138   2e-35   Medicago truncatula
gb|EMT11370.1|  LRR receptor-like serine/threonine-protein kinase...    138   2e-35   
ref|XP_009398741.1|  PREDICTED: LRR receptor-like serine/threonin...    137   3e-35   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG06831.1|  LRR receptor-like serine/threonine-protein kinase...    137   3e-35   Gossypium arboreum [tree cotton]
gb|AFJ14786.1|  ERECTA-like kinase                                      136   7e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011029995.1|  PREDICTED: LRR receptor-like serine/threonin...    136   9e-35   Populus euphratica
ref|XP_002322426.1|  PTH-1 family protein                               135   1e-34   
ref|XP_006490262.1|  PREDICTED: LRR receptor-like serine/threonin...    135   1e-34   
gb|KDO65362.1|  hypothetical protein CISIN_1g002278mg                   135   1e-34   Citrus sinensis [apfelsine]
ref|XP_002318267.2|  PTH-1 family protein                               135   1e-34   
ref|XP_011041677.1|  PREDICTED: LRR receptor-like serine/threonin...    135   1e-34   Populus euphratica
ref|XP_006588387.1|  PREDICTED: ERECTA-like kinase isoform X1           135   1e-34   Glycine max [soybeans]
ref|XP_004496653.1|  PREDICTED: LRR receptor-like serine/threonin...    135   1e-34   Cicer arietinum [garbanzo]
ref|XP_006588388.1|  PREDICTED: ERECTA-like kinase isoform X2           135   1e-34   Glycine max [soybeans]
ref|XP_006649092.1|  PREDICTED: LRR receptor-like serine/threonin...    135   2e-34   Oryza brachyantha
ref|XP_010940921.1|  PREDICTED: LRR receptor-like serine/threonin...    135   2e-34   Elaeis guineensis
ref|XP_006421768.1|  hypothetical protein CICLE_v10004259mg             135   2e-34   
ref|XP_007038488.1|  ERECTA-like 1                                      135   2e-34   
gb|ADM86148.1|  leucine-rich repeat receptor-like kinase                134   3e-34   Populus nigra x Populus x canadensis
gb|KJB39364.1|  hypothetical protein B456_007G009000                    134   4e-34   Gossypium raimondii
ref|XP_004149628.1|  PREDICTED: LRR receptor-like serine/threonin...    134   4e-34   
gb|KGN49592.1|  hypothetical protein Csa_5G014290                       134   5e-34   Cucumis sativus [cucumbers]
ref|XP_006348052.1|  PREDICTED: LRR receptor-like serine/threonin...    134   5e-34   
ref|XP_002981099.1|  hypothetical protein SELMODRAFT_114051             134   5e-34   
ref|XP_002982573.1|  hypothetical protein SELMODRAFT_155267             134   5e-34   
ref|XP_006348051.1|  PREDICTED: LRR receptor-like serine/threonin...    134   6e-34   Solanum tuberosum [potatoes]
ref|XP_009757535.1|  PREDICTED: LRR receptor-like serine/threonin...    134   6e-34   Nicotiana sylvestris
ref|XP_006606082.1|  PREDICTED: LRR receptor-like serine/threonin...    134   6e-34   Glycine max [soybeans]
gb|KHN15712.1|  LRR receptor-like serine/threonine-protein kinase...    134   7e-34   Glycine soja [wild soybean]
ref|XP_009757534.1|  PREDICTED: LRR receptor-like serine/threonin...    133   7e-34   Nicotiana sylvestris
ref|XP_007143329.1|  hypothetical protein PHAVU_007G063200g             133   7e-34   Phaseolus vulgaris [French bean]
ref|XP_006606083.1|  PREDICTED: LRR receptor-like serine/threonin...    133   7e-34   Glycine max [soybeans]
ref|XP_002975149.1|  hypothetical protein SELMODRAFT_102522             133   7e-34   
gb|AAL68842.1|AF466199_1  putative receptor protein kinase              133   7e-34   Sorghum bicolor [broomcorn]
ref|XP_002452905.1|  hypothetical protein SORBIDRAFT_04g034820          133   7e-34   
dbj|BAJ87863.1|  predicted protein                                      133   7e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010251324.1|  PREDICTED: LRR receptor-like serine/threonin...    129   8e-34   
ref|XP_002977553.1|  hypothetical protein SELMODRAFT_107124             133   9e-34   
ref|XP_010452673.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...    133   9e-34   
gb|AFW73724.1|  putative leucine-rich repeat receptor-like protei...    133   1e-33   
ref|XP_008465055.1|  PREDICTED: LRR receptor-like serine/threonin...    133   1e-33   Cucumis melo [Oriental melon]
emb|CDX99001.1|  BnaC09g48340D                                          133   1e-33   
ref|XP_002873299.1|  hypothetical protein ARALYDRAFT_908657             132   1e-33   Arabidopsis lyrata subsp. lyrata
ref|XP_010423243.1|  PREDICTED: LRR receptor-like serine/threonin...    132   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010423244.1|  PREDICTED: LRR receptor-like serine/threonin...    132   1e-33   
ref|XP_010491322.1|  PREDICTED: LRR receptor-like serine/threonin...    132   2e-33   Camelina sativa [gold-of-pleasure]
ref|XP_009600406.1|  PREDICTED: LRR receptor-like serine/threonin...    132   2e-33   Nicotiana tomentosiformis
gb|EPS66497.1|  hypothetical protein M569_08274                         132   2e-33   Genlisea aurea
ref|XP_010035002.1|  PREDICTED: LRR receptor-like serine/threonin...    132   2e-33   
ref|XP_004234153.1|  PREDICTED: LRR receptor-like serine/threonin...    132   3e-33   Solanum lycopersicum
ref|XP_009122365.1|  PREDICTED: LRR receptor-like serine/threonin...    132   3e-33   Brassica rapa
ref|NP_196335.2|  LRR receptor-like serine/threonine-protein kina...    131   3e-33   Arabidopsis thaliana [mouse-ear cress]
emb|CDX70013.1|  BnaA10g23620D                                          131   3e-33   
ref|XP_004308156.1|  PREDICTED: LRR receptor-like serine/threonin...    131   3e-33   Fragaria vesca subsp. vesca
emb|CAB87274.1|  receptor-like protein kinase                           131   3e-33   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190595.1|  LRR receptor-like serine/threonine-protein k...    131   4e-33   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA97187.1|  receptor-like protein kinase                           131   4e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006587379.1|  PREDICTED: LRR receptor-like serine/threonin...    131   4e-33   Glycine max [soybeans]
gb|AAP69763.1|  ERECTA-like kinase 1                                    131   4e-33   Arabidopsis thaliana [mouse-ear cress]
gb|KHN27841.1|  LRR receptor-like serine/threonine-protein kinase...    131   5e-33   Glycine soja [wild soybean]
ref|XP_002864777.1|  hypothetical protein ARALYDRAFT_496399             131   5e-33   
ref|NP_201029.1|  LRR receptor-like serine/threonine-protein kina...    131   5e-33   Arabidopsis thaliana [mouse-ear cress]
emb|CDY00268.1|  BnaA06g21690D                                          131   5e-33   
emb|CDX86913.1|  BnaC03g51830D                                          131   5e-33   
ref|XP_006399198.1|  hypothetical protein EUTSA_v10012600mg             130   6e-33   
ref|XP_010483915.1|  PREDICTED: LRR receptor-like serine/threonin...    130   6e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010483916.1|  PREDICTED: LRR receptor-like serine/threonin...    130   6e-33   Camelina sativa [gold-of-pleasure]
gb|EYU25015.1|  hypothetical protein MIMGU_mgv1a000865mg                130   8e-33   Erythranthe guttata [common monkey flower]
ref|XP_006279954.1|  hypothetical protein CARUB_v10025821mg             130   1e-32   Capsella rubella
ref|XP_010458423.1|  PREDICTED: LRR receptor-like serine/threonin...    130   1e-32   Camelina sativa [gold-of-pleasure]
ref|XP_007152392.1|  hypothetical protein PHAVU_004G126100g             129   2e-32   Phaseolus vulgaris [French bean]
gb|AGL91671.1|  erecta leucine-rich-repeat receptor-like kinase         129   2e-32   Triticum aestivum [Canadian hard winter wheat]
gb|EMS63677.1|  LRR receptor-like serine/threonine-protein kinase...    129   2e-32   Triticum urartu
gb|KHN24405.1|  LRR receptor-like serine/threonine-protein kinase...    129   2e-32   Glycine soja [wild soybean]
ref|XP_009151345.1|  PREDICTED: LRR receptor-like serine/threonin...    129   3e-32   Brassica rapa
ref|XP_009151343.1|  PREDICTED: LRR receptor-like serine/threonin...    129   3e-32   Brassica rapa
gb|KFK27954.1|  hypothetical protein AALP_AA8G452900                    129   3e-32   Arabis alpina [alpine rockcress]
ref|XP_002510897.1|  erecta, putative                                   129   3e-32   
ref|XP_010444058.1|  PREDICTED: LRR receptor-like serine/threonin...    129   3e-32   Camelina sativa [gold-of-pleasure]
gb|EMT04765.1|  LRR receptor-like serine/threonine-protein kinase...    128   4e-32   
ref|XP_010555314.1|  PREDICTED: LRR receptor-like serine/threonin...    128   4e-32   Tarenaya hassleriana [spider flower]
gb|KDP22376.1|  hypothetical protein JCGZ_26207                         128   5e-32   Jatropha curcas
ref|XP_006289323.1|  hypothetical protein CARUB_v10002808mg             128   5e-32   
gb|EMS68149.1|  LRR receptor-like serine/threonine-protein kinase...    127   8e-32   Triticum urartu
ref|NP_001235330.1|  ERECTA-like kinase                                 127   1e-31   Glycine max [soybeans]
ref|XP_006598682.1|  PREDICTED: ERECTA-like kinase isoform X1           127   1e-31   Glycine max [soybeans]
ref|XP_006598683.1|  PREDICTED: ERECTA-like kinase isoform X2           127   1e-31   Glycine max [soybeans]
ref|NP_001237639.1|  ERECTA-like kinase                                 127   1e-31   Glycine max [soybeans]
emb|CDP06164.1|  unnamed protein product                                122   2e-31   Coffea canephora [robusta coffee]
ref|XP_011076300.1|  PREDICTED: LRR receptor-like serine/threonin...    124   2e-30   Sesamum indicum [beniseed]
ref|XP_011076298.1|  PREDICTED: LRR receptor-like serine/threonin...    124   2e-30   Sesamum indicum [beniseed]
gb|EEE57902.1|  hypothetical protein OsJ_08587                          121   1e-29   Oryza sativa Japonica Group [Japonica rice]
gb|EEC74102.1|  hypothetical protein OsI_09151                          121   1e-29   Oryza sativa Indica Group [Indian rice]
gb|KHG04654.1|  LRR receptor-like serine/threonine-protein kinase...    118   2e-29   Gossypium arboreum [tree cotton]
ref|XP_009345019.1|  PREDICTED: LRR receptor-like serine/threonin...    113   7e-27   
ref|XP_009346939.1|  PREDICTED: LRR receptor-like serine/threonin...    113   7e-27   
ref|XP_008376471.1|  PREDICTED: LRR receptor-like serine/threonin...    113   9e-27   Malus domestica [apple tree]
emb|CBI24498.3|  unnamed protein product                                112   2e-26   Vitis vinifera
ref|XP_008234344.1|  PREDICTED: LRR receptor-like serine/threonin...    112   2e-26   Prunus mume [ume]
ref|XP_002269540.2|  PREDICTED: LRR receptor-like serine/threonin...    112   2e-26   Vitis vinifera
ref|XP_007221096.1|  hypothetical protein PRUPE_ppa017398mg             111   4e-26   
gb|EEE65279.1|  hypothetical protein OsJ_20503                          111   4e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004955237.1|  PREDICTED: LRR receptor-like serine/threonin...    110   7e-26   
emb|CDP05285.1|  unnamed protein product                                104   1e-23   Coffea canephora [robusta coffee]
emb|CDP06165.1|  unnamed protein product                              95.9    9e-23   Coffea canephora [robusta coffee]
dbj|BAK61880.1|  LRR receptor-like serine/threonine-protein kinase      100   4e-22   Citrus unshiu [satsuma mandarin]
emb|CDP21844.1|  unnamed protein product                              91.7    4e-21   Coffea canephora [robusta coffee]
gb|KDO73636.1|  hypothetical protein CISIN_1g0023492mg                89.0    6e-20   Citrus sinensis [apfelsine]
ref|XP_001763775.1|  ERL2a AtERECTA-like receptor S/T protein kin...  94.0    7e-20   
ref|XP_001770421.1|  ERL2b AtERECTA-like receptor S/T protein kin...  92.8    2e-19   
ref|XP_001755991.1|  ERL1d AtERECTA-like receptor S/T protein kin...  87.4    9e-18   
ref|XP_001783127.1|  ERL1a AtERECTA-like receptor S/T protein kin...  86.7    2e-17   
ref|XP_001755734.1|  ERL1b AtERECTA-like receptor S/T protein kin...  86.7    2e-17   
ref|XP_001770079.1|  ERL1c AtERECTA-like receptor S/T protein kin...  83.6    2e-16   
gb|AAT08020.1|  putative receptor protein kinase                      78.6    7e-16   Zea mays [maize]
gb|ABR17329.1|  unknown                                               79.3    5e-15   Picea sitchensis
ref|XP_006394418.1|  hypothetical protein EUTSA_v100036151mg          79.3    6e-15   
gb|AIR08789.1|  receptor-like kinase ERECTA                           79.3    9e-15   Medicago sativa [alfalfa]
ref|XP_004143019.1|  PREDICTED: probable LRR receptor-like serine...  77.4    4e-14   
gb|KGN62469.1|  hypothetical protein Csa_2G354950                     77.0    4e-14   Cucumis sativus [cucumbers]
ref|XP_010917823.1|  PREDICTED: probable LRR receptor-like serine...  74.3    4e-13   
ref|XP_003567118.1|  PREDICTED: leucine-rich repeat receptor-like...  72.4    7e-13   Brachypodium distachyon [annual false brome]
ref|XP_007157942.1|  hypothetical protein PHAVU_002G111100g           73.2    1e-12   Phaseolus vulgaris [French bean]
ref|XP_008674100.1|  PREDICTED: probable LRR receptor-like serine...  73.2    1e-12   
ref|XP_009611275.1|  PREDICTED: putative leucine-rich repeat rece...  72.8    1e-12   Nicotiana tomentosiformis
ref|XP_008674101.1|  PREDICTED: probable LRR receptor-like serine...  72.8    1e-12   
dbj|BAK02654.1|  predicted protein                                    72.8    2e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAY92716.1|  hypothetical protein OsI_14467                        71.2    2e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_006646325.1|  PREDICTED: piriformospora indica-insensitive...  71.2    2e-12   
gb|EMT25935.1|  LRR receptor-like serine/threonine-protein kinase...  71.2    2e-12   
gb|EAZ01492.1|  hypothetical protein OsI_23524                        72.0    2e-12   Oryza sativa Indica Group [Indian rice]
gb|KHN36048.1|  Putative LRR receptor-like serine/threonine-prote...  72.0    2e-12   Glycine soja [wild soybean]
ref|XP_009395673.1|  PREDICTED: putative receptor-like protein ki...  72.0    2e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001044253.2|  Os01g0750400                                     70.9    2e-12   
gb|KDP38742.1|  hypothetical protein JCGZ_04095                       72.0    3e-12   Jatropha curcas
ref|XP_010657518.1|  PREDICTED: receptor-like protein 12              70.9    3e-12   Vitis vinifera
ref|XP_009106214.1|  PREDICTED: probable LRR receptor-like serine...  72.0    3e-12   Brassica rapa
ref|NP_001238034.1|  receptor-like protein kinase precursor           72.0    3e-12   Glycine max [soybeans]
ref|XP_003524132.2|  PREDICTED: LRR receptor-like serine/threonin...  72.0    3e-12   Glycine max [soybeans]
gb|EYU39907.1|  hypothetical protein MIMGU_mgv1a024763mg              71.2    3e-12   Erythranthe guttata [common monkey flower]
ref|NP_001174877.1|  Os06g0587900                                     71.6    3e-12   
emb|CDX99433.1|  BnaC01g11190D                                        70.9    3e-12   
ref|XP_006359448.1|  PREDICTED: probably inactive leucine-rich re...  70.5    3e-12   
dbj|BAD87095.1|  disease resistance protein-like                      70.9    3e-12   Oryza sativa Japonica Group [Japonica rice]
gb|EEC71480.1|  hypothetical protein OsI_03743                        70.9    3e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_006404843.1|  hypothetical protein EUTSA_v10000044mg           71.2    4e-12   Eutrema salsugineum [saltwater cress]
emb|CBI28433.3|  unnamed protein product                              71.6    4e-12   Vitis vinifera
ref|XP_009132144.1|  PREDICTED: leucine-rich repeat receptor-like...  70.5    4e-12   Brassica rapa
ref|NP_198058.1|  receptor like protein 53                            71.2    4e-12   Arabidopsis thaliana [mouse-ear cress]
emb|CAE01955.2|  OSJNBb0071D01.1                                      71.2    4e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006355615.1|  PREDICTED: leucine-rich repeat receptor-like...  71.2    5e-12   Solanum tuberosum [potatoes]
gb|EEE60356.1|  hypothetical protein OsJ_13475                        71.2    5e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010447945.1|  PREDICTED: leucine-rich repeat receptor-like...  70.9    6e-12   Camelina sativa [gold-of-pleasure]
emb|CBJ26403.1|  Putative Leucine Rich Repeat Protein                 68.9    6e-12   Ectocarpus siliculosus
ref|XP_007033368.1|  Receptor like protein 6, putative                70.9    6e-12   
emb|CDY47508.1|  BnaAnng09060D                                        70.9    6e-12   Brassica napus [oilseed rape]
emb|CAN66148.1|  hypothetical protein VITISV_036826                   71.2    6e-12   Vitis vinifera
ref|XP_006405698.1|  hypothetical protein EUTSA_v10028121mg           70.5    7e-12   
ref|XP_002525021.1|  serine/threonine-protein kinase bri1, putative   70.9    7e-12   Ricinus communis
ref|XP_007033369.1|  Receptor like protein 6, putative                70.9    7e-12   
ref|XP_008809727.1|  PREDICTED: probable LRR receptor-like serine...  70.9    7e-12   Phoenix dactylifera
ref|XP_006282454.1|  hypothetical protein CARUB_v10004330mg           70.5    7e-12   Capsella rubella
ref|XP_009769366.1|  PREDICTED: leucine-rich repeat receptor-like...  70.9    7e-12   
gb|KCW53035.1|  hypothetical protein EUGRSUZ_J02327                   70.5    8e-12   
ref|XP_007020582.1|  Receptor like protein 53, putative               68.6    8e-12   
ref|NP_194781.2|  senescence-associated receptor-like kinase          70.1    8e-12   
emb|CBN74748.1|  LRR-GTPase of the ROCO family, putative pseudogene   70.5    8e-12   
emb|CDY05337.1|  BnaC02g40450D                                        70.5    8e-12   
ref|XP_010550838.1|  PREDICTED: receptor-like protein kinase 2        70.5    9e-12   
ref|XP_009395674.1|  PREDICTED: putative receptor-like protein ki...  70.5    9e-12   
ref|XP_009621771.1|  PREDICTED: leucine-rich repeat receptor-like...  70.5    9e-12   
gb|AFK44332.1|  unknown                                               67.4    9e-12   
ref|XP_010034664.1|  PREDICTED: LRR receptor-like serine/threonin...  70.5    9e-12   
emb|CDO98515.1|  unnamed protein product                              70.1    9e-12   
ref|XP_008657242.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  70.5    9e-12   
ref|XP_004504632.1|  PREDICTED: LRR receptor-like serine/threonin...  70.5    1e-11   
gb|KCW53034.1|  hypothetical protein EUGRSUZ_J02326                   70.1    1e-11   
ref|XP_010518811.1|  PREDICTED: probable LRR receptor-like serine...  70.1    1e-11   
ref|XP_002323749.1|  hypothetical protein POPTR_0017s07740g           70.1    1e-11   
ref|XP_003581467.1|  PREDICTED: probable LRR receptor-like serine...  70.5    1e-11   
ref|XP_010033401.1|  PREDICTED: receptor-like protein 12              70.1    1e-11   
ref|XP_010264582.1|  PREDICTED: receptor-like protein 12              70.1    1e-11   
ref|XP_010046357.1|  PREDICTED: leucine-rich repeat receptor-like...  70.1    1e-11   
gb|KCW45177.1|  hypothetical protein EUGRSUZ_L011922                  70.1    1e-11   
ref|XP_002867342.1|  predicted protein                                69.7    1e-11   
ref|XP_010917826.1|  PREDICTED: probable LRR receptor-like serine...  70.1    1e-11   
gb|EEE55385.1|  hypothetical protein OsJ_03464                        70.1    1e-11   
gb|KCW85317.1|  hypothetical protein EUGRSUZ_B02157                   70.1    1e-11   
ref|XP_010040482.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...  69.7    1e-11   
ref|XP_011468614.1|  PREDICTED: LRR receptor-like serine/threonin...  66.6    1e-11   
ref|XP_010433191.1|  PREDICTED: leucine-rich repeat receptor-like...  69.7    1e-11   
ref|XP_004292843.2|  PREDICTED: probably inactive leucine-rich re...  69.7    1e-11   
ref|XP_010479189.1|  PREDICTED: receptor-like protein 12              66.6    2e-11   
ref|XP_008444587.1|  PREDICTED: probable LRR receptor-like serine...  69.7    2e-11   
emb|CAN74952.1|  hypothetical protein VITISV_025649                   69.3    2e-11   
ref|XP_009403711.1|  PREDICTED: leucine-rich repeat receptor-like...  69.7    2e-11   
ref|XP_004495057.1|  PREDICTED: leucine-rich repeat receptor-like...  69.7    2e-11   
ref|XP_002518317.1|  serine/threonine-protein kinase bri1, putative   69.3    2e-11   
gb|KHN20484.1|  LRR receptor-like serine/threonine-protein kinase...  68.2    2e-11   
ref|XP_010026064.1|  PREDICTED: probable leucine-rich repeat rece...  69.3    2e-11   
emb|CAH66130.1|  OSIGBa0135L04.4                                      69.3    2e-11   
gb|EAZ01494.1|  hypothetical protein OsI_23526                        69.3    2e-11   
gb|AGE33919.1|  hypothetical protein                                  66.2    2e-11   
gb|EEC76609.1|  hypothetical protein OsI_14473                        69.3    2e-11   
gb|ADD60695.1|  putative somatic embryogenesis protein kinase 1       68.9    2e-11   
emb|CAE03915.2|  OSJNBb0015G09.9                                      69.3    2e-11   
emb|CDX78890.1|  BnaA01g09570D                                        68.6    2e-11   
gb|ABN08964.1|  Leucine-rich repeat, plant specific                   67.0    2e-11   
ref|XP_010911619.1|  PREDICTED: probable LRR receptor-like serine...  67.8    2e-11   
ref|NP_001173804.1|  Os04g0226800                                     69.3    2e-11   
gb|KCW58235.1|  hypothetical protein EUGRSUZ_H00937                   69.3    2e-11   
ref|XP_010100740.1|  putative LRR receptor-like serine/threonine-...  68.6    2e-11   
ref|XP_004247132.1|  PREDICTED: leucine-rich repeat receptor-like...  69.3    2e-11   
gb|KFK32549.1|  hypothetical protein AALP_AA6G257300                  69.3    2e-11   
ref|XP_006304528.1|  hypothetical protein CARUB_v10011388mg           68.2    2e-11   
gb|AJG42088.1|  LEPR3                                                 69.3    2e-11   
gb|KEH42461.1|  LRR receptor-like kinase family protein               69.3    2e-11   
ref|XP_006355906.1|  PREDICTED: leucine-rich repeat receptor-like...  69.3    2e-11   
ref|XP_010227572.1|  PREDICTED: probable LRR receptor-like serine...  68.9    2e-11   
ref|XP_006588706.1|  PREDICTED: leucine-rich repeat receptor-like...  68.9    3e-11   
gb|KJB69148.1|  hypothetical protein B456_011G008200                  68.9    3e-11   
gb|KHN05886.1|  Leucine-rich repeat receptor-like protein kinase ...  68.9    3e-11   
ref|XP_004148167.1|  PREDICTED: probable LRR receptor-like serine...  68.9    3e-11   
ref|XP_001780628.1|  predicted protein                                68.6    3e-11   
gb|EYU28106.1|  hypothetical protein MIMGU_mgv1a021947mg              67.8    3e-11   
ref|XP_004164688.1|  PREDICTED: probable LRR receptor-like serine...  68.9    3e-11   
ref|XP_011076386.1|  PREDICTED: leucine-rich repeat receptor-like...  68.9    3e-11   
ref|XP_006651034.1|  PREDICTED: leucine-rich repeat receptor-like...  68.9    3e-11   
ref|XP_010536377.1|  PREDICTED: probable LRR receptor-like serine...  68.9    3e-11   
emb|CBI24036.3|  unnamed protein product                              66.2    3e-11   
ref|XP_010670727.1|  PREDICTED: probable LRR receptor-like serine...  68.9    3e-11   
gb|KEH21610.1|  receptor-like protein                                 67.4    3e-11   
ref|XP_010670738.1|  PREDICTED: probable LRR receptor-like serine...  68.9    3e-11   
gb|KFK43041.1|  hypothetical protein AALP_AA1G070700                  67.4    3e-11   
gb|KEH31437.1|  LRR receptor-like kinase family protein               68.9    3e-11   
ref|XP_002526451.1|  Receptor protein kinase CLAVATA1 precursor, ...  68.9    3e-11   
gb|KJB60475.1|  hypothetical protein B456_009G307100                  68.9    3e-11   
gb|EYU17948.1|  hypothetical protein MIMGU_mgv1a022168mg              68.9    3e-11   
gb|KJB14600.1|  hypothetical protein B456_002G133000                  68.9    3e-11   
ref|XP_007011115.1|  Receptor like protein 6, putative                68.9    3e-11   
ref|XP_009766149.1|  PREDICTED: putative leucine-rich repeat rece...  68.9    3e-11   
ref|XP_010111587.1|  LRR receptor-like serine/threonine-protein k...  68.9    3e-11   
ref|XP_003532673.2|  PREDICTED: LRR receptor-like serine/threonin...  68.9    3e-11   
gb|ABN08962.1|  Leucine-rich repeat; Leucine-rich repeat, cystein...  68.6    3e-11   
ref|NP_001048946.2|  Os03g0145000                                     68.9    3e-11   
gb|KHN28913.1|  LRR receptor-like serine/threonine-protein kinase...  68.9    3e-11   
ref|XP_003621129.1|  Receptor-like protein kinase                     68.6    3e-11   
ref|XP_006285784.1|  hypothetical protein CARUB_v10007258mg           68.6    4e-11   
ref|XP_006412696.1|  hypothetical protein EUTSA_v10024678mg           67.8    4e-11   
ref|XP_010274094.1|  PREDICTED: polygalacturonase inhibitor 2-like    67.0    4e-11   
ref|XP_010458102.1|  PREDICTED: leucine-rich repeat receptor-like...  68.6    4e-11   
gb|KFK43040.1|  hypothetical protein AALP_AA1G070700                  67.4    4e-11   
gb|EAY88517.1|  hypothetical protein OsI_09989                        68.6    4e-11   
ref|XP_006370264.1|  Cf-4/9 disease resistance-like family protein    68.6    4e-11   
ref|XP_007011924.1|  Leucine-rich repeat family protein / protein...  68.6    4e-11   
ref|WP_044138497.1|  hypothetical protein                             65.5    4e-11   
gb|KCW45179.1|  hypothetical protein EUGRSUZ_L01193                   68.6    4e-11   
ref|XP_007023308.1|  Receptor like protein 1, putative                66.2    4e-11   
ref|XP_006280539.1|  hypothetical protein CARUB_v10026481mg           67.8    4e-11   
ref|XP_010040481.1|  PREDICTED: probable LRR receptor-like serine...  68.6    4e-11   
ref|XP_004962622.1|  PREDICTED: probable LRR receptor-like serine...  68.6    4e-11   
gb|KJB79384.1|  hypothetical protein B456_013G046700                  67.4    4e-11   
gb|KDO43312.1|  hypothetical protein CISIN_1g0376512mg                68.2    4e-11   
ref|XP_004963186.1|  PREDICTED: LRR receptor-like serine/threonin...  68.6    4e-11   
ref|XP_010544847.1|  PREDICTED: DNA-damage-repair/toleration prot...  67.4    4e-11   
ref|XP_009772313.1|  PREDICTED: probable LRR receptor-like serine...  68.6    4e-11   
gb|EMT21842.1|  Putative LRR receptor-like serine/threonine-prote...  68.6    4e-11   
emb|CDX72249.1|  BnaC07g42710D                                        68.2    4e-11   
ref|XP_010463452.1|  PREDICTED: receptor-like protein 12              68.2    4e-11   
gb|KHG04236.1|  Leucine-rich repeat receptor-like protein kinase ...  68.6    4e-11   
emb|CDY36044.1|  BnaC03g41540D                                        68.2    4e-11   
ref|XP_006450885.1|  hypothetical protein CICLE_v10010243mg           68.2    5e-11   
gb|KDO36075.1|  hypothetical protein CISIN_1g036266mg                 66.6    5e-11   
emb|CDY39211.1|  BnaA03g50230D                                        67.8    5e-11   
ref|XP_011015164.1|  PREDICTED: receptor-like protein 12 isoform X1   68.6    5e-11   
ref|XP_010106115.1|  LRR receptor-like serine/threonine-protein k...  68.2    5e-11   
ref|XP_007031845.1|  Serine/threonine-protein kinase bri1, putative   68.2    5e-11   
ref|XP_011015168.1|  PREDICTED: receptor-like protein 12 isoform X2   68.2    5e-11   
ref|XP_006412695.1|  hypothetical protein EUTSA_v10024678mg           67.8    5e-11   
ref|XP_009137929.1|  PREDICTED: probable LRR receptor-like serine...  67.8    5e-11   
ref|XP_006343726.1|  PREDICTED: receptor-like protein 12-like         68.2    5e-11   
ref|XP_004491128.1|  PREDICTED: probable LRR receptor-like serine...  68.2    5e-11   
ref|XP_010917821.1|  PREDICTED: putative receptor-like protein ki...  68.2    5e-11   
dbj|BAD34177.1|  putative disease resistance protein Cf-2.1           67.8    5e-11   
ref|XP_008444585.1|  PREDICTED: putative receptor-like protein ki...  68.2    5e-11   
ref|XP_006447088.1|  hypothetical protein CICLE_v10017744mg           68.2    5e-11   
ref|XP_010462223.1|  PREDICTED: receptor-like protein 12 isoform X2   68.2    5e-11   
ref|XP_010462222.1|  PREDICTED: receptor-like protein 12 isoform X1   68.2    6e-11   
ref|XP_009122402.1|  PREDICTED: receptor-like protein 12              68.2    6e-11   
ref|XP_010432978.1|  PREDICTED: probable LRR receptor-like serine...  67.8    6e-11   
gb|KFK23835.1|  hypothetical protein AALP_AAs50029U000200             67.4    6e-11   
ref|XP_010447704.1|  PREDICTED: probable LRR receptor-like serine...  67.8    6e-11   
ref|XP_010462193.1|  PREDICTED: receptor-like protein 12              68.2    6e-11   
ref|XP_009360211.1|  PREDICTED: probable LRR receptor-like serine...  68.2    6e-11   
ref|XP_008240711.1|  PREDICTED: LRR receptor-like serine/threonin...  68.2    6e-11   
ref|XP_006446432.1|  hypothetical protein CICLE_v100183241mg          67.8    6e-11   
emb|CDP17628.1|  unnamed protein product                              68.2    6e-11   
gb|KEH36630.1|  LRR receptor-like kinase                              67.0    6e-11   
ref|XP_010438169.1|  PREDICTED: probable LRR receptor-like serine...  67.8    6e-11   
gb|KEH33791.1|  LRR receptor-like kinase                              65.9    6e-11   
ref|XP_010096842.1|  LRR receptor-like serine/threonine-protein k...  67.8    6e-11   
ref|XP_008809710.1|  PREDICTED: LRR receptor-like serine/threonin...  68.2    6e-11   
ref|XP_006304536.1|  hypothetical protein CARUB_v10011409mg           67.8    6e-11   
ref|XP_006476119.1|  PREDICTED: probable LRR receptor-like serine...  67.8    7e-11   
ref|XP_006303684.1|  hypothetical protein CARUB_v10011769mg           67.8    7e-11   
ref|XP_010553235.1|  PREDICTED: receptor-like protein 12              67.8    7e-11   
gb|KDO66294.1|  hypothetical protein CISIN_1g004218mg                 67.8    7e-11   
ref|XP_008378167.1|  PREDICTED: putative receptor-like protein ki...  67.8    7e-11   
ref|XP_006359740.1|  PREDICTED: probably inactive leucine-rich re...  67.8    7e-11   
ref|XP_008444588.1|  PREDICTED: putative receptor-like protein ki...  67.8    7e-11   
ref|XP_004250859.1|  PREDICTED: DNA-damage-repair/toleration prot...  66.6    7e-11   
ref|XP_006303206.1|  hypothetical protein CARUB_v10011219mg           67.8    7e-11   
ref|XP_010470124.1|  PREDICTED: receptor-like protein 12              67.8    7e-11   
ref|XP_008776167.1|  PREDICTED: LRR receptor-like serine/threonin...  67.8    7e-11   
emb|CDP03798.1|  unnamed protein product                              67.8    7e-11   
ref|XP_010241269.1|  PREDICTED: LRR receptor-like serine/threonin...  67.4    7e-11   
gb|KDO38691.1|  hypothetical protein CISIN_1g0406991mg                64.7    7e-11   
ref|XP_002442559.1|  hypothetical protein SORBIDRAFT_08g021940        67.8    7e-11   
ref|XP_004485916.1|  PREDICTED: systemin receptor SR160-like          67.0    7e-11   
ref|XP_006446430.1|  hypothetical protein CICLE_v10014130mg           67.8    7e-11   
ref|XP_010429378.1|  PREDICTED: receptor-like protein 12              67.4    7e-11   
ref|XP_004517190.1|  PREDICTED: LRR receptor-like serine/threonin...  67.8    7e-11   
ref|XP_006477788.1|  PREDICTED: probable LRR receptor-like serine...  67.8    7e-11   
ref|XP_006357297.1|  PREDICTED: probably inactive leucine-rich re...  67.8    8e-11   
ref|XP_010905353.1|  PREDICTED: probable LRR receptor-like serine...  67.8    8e-11   
emb|CBI28418.3|  unnamed protein product                              67.4    8e-11   
ref|XP_010550315.1|  PREDICTED: leucine-rich repeat receptor-like...  67.8    8e-11   
ref|XP_006448739.1|  hypothetical protein CICLE_v10017714mg           67.8    8e-11   
gb|KDO49788.1|  hypothetical protein CISIN_1g036011mg                 67.8    8e-11   
emb|CDY36297.1|  BnaA01g31210D                                        67.4    8e-11   
ref|XP_003633782.1|  PREDICTED: receptor-like protein 12              67.8    8e-11   
gb|KDP41868.1|  hypothetical protein JCGZ_26886                       67.8    8e-11   
ref|XP_003633783.1|  PREDICTED: probable leucine-rich repeat rece...  67.8    8e-11   
ref|XP_004242981.1|  PREDICTED: receptor-like protein 12              67.8    8e-11   
ref|XP_010916723.1|  PREDICTED: probable LRR receptor-like serine...  67.8    8e-11   
ref|XP_006428116.1|  hypothetical protein CICLE_v10027283mg           67.8    9e-11   
ref|XP_004963245.1|  PREDICTED: putative receptor-like protein ki...  67.8    9e-11   
ref|XP_010110151.1|  putative LRR receptor-like serine/threonine-...  67.4    9e-11   
ref|XP_004143018.1|  PREDICTED: probable LRR receptor-like serine...  67.4    9e-11   
ref|XP_010554923.1|  PREDICTED: receptor-like protein 12              67.8    9e-11   
ref|XP_004491130.1|  PREDICTED: probable LRR receptor-like serine...  67.4    9e-11   
ref|XP_011087290.1|  PREDICTED: DNA-damage-repair/toleration prot...  66.2    9e-11   
emb|CDY36313.1|  BnaA01g31050D                                        67.4    9e-11   
emb|CBJ27108.1|  Hypothetical leucine rich repeat protein             64.3    9e-11   
gb|KHN34667.1|  Serine/threonine-protein kinase BRI1-like 2           67.0    9e-11   
ref|XP_006388335.1|  hypothetical protein POPTR_0223s00210g           67.4    9e-11   
gb|KGN62470.1|  hypothetical protein Csa_2G354960                     67.4    9e-11   
gb|KEH25796.1|  receptor-like protein                                 67.4    9e-11   
ref|XP_004156406.1|  PREDICTED: probable LRR receptor-like serine...  67.4    9e-11   
ref|XP_002280668.1|  PREDICTED: probable LRR receptor-like serine...  67.4    9e-11   
ref|XP_010463446.1|  PREDICTED: receptor-like protein 12              66.6    9e-11   
gb|KJB73168.1|  hypothetical protein B456_011G219000                  67.4    9e-11   
ref|XP_003621130.1|  Receptor-like protein kinase                     67.8    9e-11   
ref|XP_003553344.2|  PREDICTED: probably inactive leucine-rich re...  67.4    9e-11   
ref|XP_004491131.1|  PREDICTED: probable LRR receptor-like serine...  67.4    1e-10   
gb|ABN08958.1|  Leucine-rich repeat; Leucine-rich repeat, cystein...  67.4    1e-10   
gb|KJB10768.1|  hypothetical protein B456_001G223400                  67.4    1e-10   
ref|XP_002971773.1|  hypothetical protein SELMODRAFT_30363            67.4    1e-10   
gb|AES77348.2|  LRR receptor-like kinase family protein               67.4    1e-10   
ref|XP_008232515.1|  PREDICTED: receptor-like protein 12              67.4    1e-10   
gb|AGE33102.1|  hypothetical protein                                  64.3    1e-10   
ref|XP_006435709.1|  hypothetical protein CICLE_v10033791mg           67.0    1e-10   
ref|XP_010486594.1|  PREDICTED: leucine-rich repeat receptor-like...  67.4    1e-10   
gb|ABN08976.1|  Leucine-rich repeat; Leucine-rich repeat, cystein...  67.4    1e-10   
ref|XP_008809709.1|  PREDICTED: LRR receptor-like serine/threonin...  67.4    1e-10   
gb|KHM99106.1|  Receptor-like protein 12                              65.9    1e-10   
gb|AGE33915.1|  hypothetical protein                                  64.3    1e-10   
ref|XP_010064211.1|  PREDICTED: probable LRR receptor-like serine...  67.4    1e-10   
ref|XP_010046670.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  65.1    1e-10   
ref|XP_006388334.1|  hypothetical protein POPTR_0223s00200g           67.4    1e-10   
gb|EAZ01484.1|  hypothetical protein OsI_23516                        67.0    1e-10   
ref|XP_003621122.1|  Receptor-like protein kinase                     67.0    1e-10   
ref|XP_010553768.1|  PREDICTED: leucine-rich repeat receptor-like...  67.4    1e-10   
ref|XP_002963822.1|  hypothetical protein SELMODRAFT_30332            67.4    1e-10   
gb|KFK23531.1|  hypothetical protein AALP_AAs73006U000300             63.9    1e-10   
ref|XP_010930451.1|  PREDICTED: probable LRR receptor-like serine...  67.4    1e-10   
ref|XP_010492466.1|  PREDICTED: receptor-like protein 12              66.6    1e-10   
ref|XP_009401113.1|  PREDICTED: leucine-rich repeat receptor-like...  67.4    1e-10   
ref|XP_007152275.1|  hypothetical protein PHAVU_004G115700g           67.0    1e-10   
ref|XP_010917824.1|  PREDICTED: putative receptor-like protein ki...  67.4    1e-10   
ref|XP_010906158.1|  PREDICTED: LRR receptor-like serine/threonin...  67.4    1e-10   
gb|KFK41997.1|  hypothetical protein AALP_AA2G198900                  67.4    1e-10   
ref|XP_008357408.1|  PREDICTED: probably inactive leucine-rich re...  67.0    1e-10   



>emb|CBI20727.3| unnamed protein product [Vitis vinifera]
Length=986

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/82 (93%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNELYGDIPFSISKLKQLE L+LKNN+L+GPIPSTLSQIPNLK+LDLAQN+LSGEI
Sbjct  120  LDLSFNELYGDIPFSISKLKQLEQLVLKNNQLIGPIPSTLSQIPNLKILDLAQNRLSGEI  179

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNLVG
Sbjct  180  PRLIYWNEVLQYLGLRGNNLVG  201


 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL  L  L + NN L GPIP  LS   NL  L++  NKL+G I
Sbjct  335  LELNDNHLTGSIPSELGKLTDLFDLNVANNHLEGPIPDNLSSCTNLNSLNVHGNKLNGTI  394

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E + YL L  NNL G
Sbjct  395  PPAFEKLESMTYLNLSSNNLRG  416


 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+TL + NN + G IPS+L  + +L  L+L++N L+G I
Sbjct  407  LNLSSNNLRGSIPIELSRIGNLDTLDISNNRITGSIPSSLGDLEHLLKLNLSRNHLTGCI  466

Query  182  P  184
            P
Sbjct  467  P  467


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 52/106 (49%), Gaps = 25/106 (24%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQN------  163
            LDLS+N L G+IPF+I  L Q+ TL L+ N+L G IPS +  +  L VLDL+ N      
Sbjct  240  LDLSYNRLTGEIPFNIGFL-QVATLSLQGNQLSGQIPSVIGLMQALAVLDLSCNMLSGPI  298

Query  164  ------------------KLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
                              KL+G IP  +     L YL L  N+L G
Sbjct  299  PPILGNLTYTEKLYLHGNKLAGSIPPELGNMTKLHYLELNDNHLTG  344


 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S N + G IP S+  L+ L  L L  N L G IP+    + ++  +DL+ N LSG I
Sbjct  431  LDISNNRITGSIPSSLGDLEHLLKLNLSRNHLTGCIPAEFGNLRSVMEIDLSNNHLSGVI  490

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + + +L +  NNL G
Sbjct  491  PQELGQLQNMFFLRVENNNLSG  512



>gb|KDP34024.1| hypothetical protein JCGZ_07595 [Jatropha curcas]
Length=986

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/82 (94%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNE+YGDIPFSISKLKQLE LILKNN+L+GPIPSTLSQIPNLKVLDLAQN+LSGEI
Sbjct  120  LDLSFNEIYGDIPFSISKLKQLEFLILKNNQLIGPIPSTLSQIPNLKVLDLAQNRLSGEI  179

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNLVG
Sbjct  180  PRLIYWNEVLQYLGLRGNNLVG  201


 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP  + KL  L  L + NN L GPIP  LS   NL  L++  NKL+G I
Sbjct  335  LELNDNQLTGGIPAELGKLTDLFDLNVANNHLEGPIPDNLSSCTNLNSLNVHGNKLNGTI  394

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR     E + YL L  NN+ G
Sbjct  395  PRAFQRLESMTYLNLSSNNIRG  416


 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G+IPF+I  L Q+ TL L+ N+L G IPS +  +  L VLDL+ N LSG I
Sbjct  240  LDLSYNQLTGEIPFNIGFL-QVATLSLQGNQLGGKIPSVIGLMQALAVLDLSCNILSGPI  298

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L L GN L G
Sbjct  299  PPILGNLTYTEKLYLHGNKLTG  320


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N + G+IP  +S++  L+TL +  N++ G IPS+L  + +L  L+L++N+LSG I
Sbjct  407  LNLSSNNIRGNIPIELSRIGNLDTLDISKNKITGSIPSSLGDLEHLLKLNLSRNQLSGVI  466

Query  182  P  184
            P
Sbjct  467  P  467


 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP +  +L+ +  L L +N + G IP  LS+I NL  LD+++NK++G I
Sbjct  383  LNVHGNKLNGTIPRAFQRLESMTYLNLSSNNIRGNIPIELSRIGNLDTLDISKNKITGSI  442

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N L G
Sbjct  443  PSSLGDLEHLLKLNLSRNQLSG  464


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S N++ G IP S+  L+ L  L L  N+L G IP+    + ++  +DL+ N LSG I
Sbjct  431  LDISKNKITGSIPSSLGDLEHLLKLNLSRNQLSGVIPAEFGNLRSVMEIDLSHNHLSGVI  490

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + +  L L  NNL G
Sbjct  491  PEELSQLQNIFSLRLENNNLSG  512



>ref|XP_002280069.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Vitis vinifera]
Length=994

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/82 (93%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNELYGDIPFSISKLKQLE L+LKNN+L+GPIPSTLSQIPNLK+LDLAQN+LSGEI
Sbjct  128  LDLSFNELYGDIPFSISKLKQLEQLVLKNNQLIGPIPSTLSQIPNLKILDLAQNRLSGEI  187

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNLVG
Sbjct  188  PRLIYWNEVLQYLGLRGNNLVG  209


 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL  L  L + NN L GPIP  LS   NL  L++  NKL+G I
Sbjct  343  LELNDNHLTGSIPSELGKLTDLFDLNVANNHLEGPIPDNLSSCTNLNSLNVHGNKLNGTI  402

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E + YL L  NNL G
Sbjct  403  PPAFEKLESMTYLNLSSNNLRG  424


 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+TL + NN + G IPS+L  + +L  L+L++N L+G I
Sbjct  415  LNLSSNNLRGSIPIELSRIGNLDTLDISNNRITGSIPSSLGDLEHLLKLNLSRNHLTGCI  474

Query  182  P  184
            P
Sbjct  475  P  475


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 52/106 (49%), Gaps = 25/106 (24%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQN------  163
            LDLS+N L G+IPF+I  L Q+ TL L+ N+L G IPS +  +  L VLDL+ N      
Sbjct  248  LDLSYNRLTGEIPFNIGFL-QVATLSLQGNQLSGQIPSVIGLMQALAVLDLSCNMLSGPI  306

Query  164  ------------------KLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
                              KL+G IP  +     L YL L  N+L G
Sbjct  307  PPILGNLTYTEKLYLHGNKLAGSIPPELGNMTKLHYLELNDNHLTG  352


 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S N + G IP S+  L+ L  L L  N L G IP+    + ++  +DL+ N LSG I
Sbjct  439  LDISNNRITGSIPSSLGDLEHLLKLNLSRNHLTGCIPAEFGNLRSVMEIDLSNNHLSGVI  498

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + + +L +  NNL G
Sbjct  499  PQELGQLQNMFFLRVENNNLSG  520



>ref|XP_002516144.1| erecta, putative [Ricinus communis]
 gb|EEF46146.1| erecta, putative [Ricinus communis]
Length=980

 Score =   157 bits (396),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/82 (94%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNE+YGDIPFSISKLKQLE LILKNN+L+GPIPSTLSQIPNLKVLDLAQN+LSGEI
Sbjct  120  LDLSFNEIYGDIPFSISKLKQLEFLILKNNQLIGPIPSTLSQIPNLKVLDLAQNRLSGEI  179

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNLVG
Sbjct  180  PRLIYWNEVLQYLGLRGNNLVG  201


 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G+IPF+I  L Q+ TL L+ N+L G IPS +  +  L VLDL+ N LSG I
Sbjct  240  LDLSYNQLTGEIPFNIGFL-QVATLSLQGNQLGGKIPSVIGLMQALAVLDLSCNILSGPI  298

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L L GN L G
Sbjct  299  PPIVGNLTYTEKLYLHGNMLTG  320


 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP  + KL  L  L + NN L GPIP  LS   NL  L++  NKL+G I
Sbjct  335  LELNDNQLTGRIPPELGKLTDLFDLNVANNNLEGPIPDNLSSCTNLNSLNVHGNKLNGTI  394

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E + YL L  NN+ G
Sbjct  395  PHAFQRLESMTYLNLSSNNIKG  416


 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP +  +L+ +  L L +N + GPIP  LS+I NL  LD++ NK+SG I
Sbjct  383  LNVHGNKLNGTIPHAFQRLESMTYLNLSSNNIKGPIPIELSRIGNLDTLDISNNKISGSI  442

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N L+G
Sbjct  443  PSSLGDLEHLLKLNLSRNQLLG  464


 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S N++ G IP S+  L+ L  L L  N+L+G IP+    + ++  +DL+ N LSG I
Sbjct  431  LDISNNKISGSIPSSLGDLEHLLKLNLSRNQLLGVIPAEFGNLRSVMEIDLSNNHLSGVI  490

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + +  L L  NNL G
Sbjct  491  PQELSQLQNMFSLRLENNNLSG  512


 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N + G IP  +S++  L+TL + NN++ G IPS+L  + +L  L+L++N+L G I
Sbjct  407  LNLSSNNIKGPIPIELSRIGNLDTLDISNNKISGSIPSSLGDLEHLLKLNLSRNQLLGVI  466

Query  182  P  184
            P
Sbjct  467  P  467


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N+L G IP     L+ +  + L NN L G IP  LSQ+ N+  L L  N LSG++
Sbjct  455  LNLSRNQLLGVIPAEFGNLRSVMEIDLSNNHLSGVIPQELSQLQNMFSLRLENNNLSGDV  514

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
              LI     L  L +  NNL G
Sbjct  515  LSLINCLS-LTVLNVSYNNLAG  535



>ref|XP_007012431.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY30050.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=983

 Score =   156 bits (395),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 77/82 (94%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNELYGDIPFSISKLKQLE LILKNN+L+GPIPSTLSQIPNLKVLDLAQNKL GE+
Sbjct  123  LDLSFNELYGDIPFSISKLKQLEFLILKNNQLIGPIPSTLSQIPNLKVLDLAQNKLGGEV  182

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNLVG
Sbjct  183  PRLIYWNEVLQYLGLRGNNLVG  204


 Score = 65.1 bits (157),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G+IPF+I  L Q+ TL L+ N L G IPS +  +  L VLDL+ NKLSG I
Sbjct  243  LDLSYNQLTGEIPFNIGFL-QVATLSLQGNHLSGKIPSVIGLMQALAVLDLSCNKLSGPI  301

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L L GN L G
Sbjct  302  PSILGNLTYTEKLYLHGNQLTG  323


 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL +L  L + NN L GPIP  LS   NL  L++  NKL+G I
Sbjct  338  LELNDNHLTGHIPPELGKLTELFDLNVANNNLEGPIPHNLSSCTNLNSLNVHGNKLNGTI  397

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E + YL L  NN+ G
Sbjct  398  PPEFERLESMTYLNLSSNNIKG  419


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N + G IP  +S++  L+TL + NN++ G IPS+L  + +L  L+L++N L+G I
Sbjct  410  LNLSSNNIKGSIPIELSRIGNLDTLDISNNKISGLIPSSLGDLEHLLKLNLSRNHLTGVI  469

Query  182  P  184
            P
Sbjct  470  P  470


 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP    +L+ +  L L +N + G IP  LS+I NL  LD++ NK+SG I
Sbjct  386  LNVHGNKLNGTIPPEFERLESMTYLNLSSNNIKGSIPIELSRIGNLDTLDISNNKISGLI  445

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N+L G
Sbjct  446  PSSLGDLEHLLKLNLSRNHLTG  467


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S N++ G IP S+  L+ L  L L  N L G IP+    + ++  +DL+ N LSG I
Sbjct  434  LDISNNKISGLIPSSLGDLEHLLKLNLSRNHLTGVIPAEFGNLRSVMEIDLSNNHLSGII  493

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + +  L L  NNL G
Sbjct  494  PQELIQLQNMFSLRLENNNLSG  515


 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+L G IP  +  L   E L L  N+L G IP  L  +  L  L+L  N L+G I
Sbjct  290  LDLSCNKLSGPIPSILGNLTYTEKLYLHGNQLTGSIPPELGNMTKLHYLELNDNHLTGHI  349

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L +  NNL G
Sbjct  350  PPELGKLTELFDLNVANNNLEG  371



>ref|XP_009605434.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Nicotiana tomentosiformis]
Length=991

 Score =   156 bits (394),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 78/82 (95%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNELYGDIPFSISKLKQLE LILKNN+L+GPIPSTLSQIPNLKVLDLAQNKLSGEI
Sbjct  131  LDLSFNELYGDIPFSISKLKQLEYLILKNNQLIGPIPSTLSQIPNLKVLDLAQNKLSGEI  190

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNL G
Sbjct  191  PRLIYWNEVLQYLGLRGNNLGG  212


 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP  + KL +L  L + NN L GPIPS LS   NL  L++  NKL+G I
Sbjct  346  LELNDNQLTGCIPPELGKLNELFDLNVANNHLDGPIPSNLSCCTNLNSLNVHGNKLNGTI  405

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E + YL L  NNL G
Sbjct  406  PPAFQKLESMTYLNLSSNNLKG  427


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP +  KL+ +  L L +N L GPIP  LS+I NL  LDL+ N++SG I
Sbjct  394  LNVHGNKLNGTIPPAFQKLESMTYLNLSSNNLKGPIPIELSRIGNLDTLDLSNNRISGSI  453

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N++ G
Sbjct  454  PSSLGDLEHLLKLNLSKNDING  475


 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 51/106 (48%), Gaps = 25/106 (24%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQN------  163
            LDLS+N+L G+IPF+I  L Q+ TL L+ N L G IPS +  +  L VLDL+ N      
Sbjct  251  LDLSYNDLTGEIPFNIGFL-QVATLSLQGNRLSGQIPSVIGLMQALAVLDLSCNNLSGII  309

Query  164  ------------------KLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
                              KL+G IP  +     L YL L  N L G
Sbjct  310  PSILGNLTYTEKLYLHGNKLTGPIPPELGNMSKLHYLELNDNQLTG  355


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+TL L NN + G IPS+L  + +L  L+L++N ++G +
Sbjct  418  LNLSSNNLKGPIPIELSRIGNLDTLDLSNNRISGSIPSSLGDLEHLLKLNLSKNDINGYL  477

Query  182  P  184
            P
Sbjct  478  P  478


 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 34/61 (56%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N L G IP  +  L   E L L  N+L GPIP  L  +  L  L+L  N+L+G I
Sbjct  298  LDLSCNNLSGIIPSILGNLTYTEKLYLHGNKLTGPIPPELGNMSKLHYLELNDNQLTGCI  357

Query  182  P  184
            P
Sbjct  358  P  358



>ref|XP_010474472.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Camelina sativa]
Length=796

 Score =   155 bits (391),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 77/82 (94%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNEL GDIPFSISKLKQLE LILKNN+L+GPIPSTLSQIPNLK+LDLAQNKLSGEI
Sbjct  122  LDLSFNELSGDIPFSISKLKQLEKLILKNNQLIGPIPSTLSQIPNLKILDLAQNKLSGEI  181

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNLVG
Sbjct  182  PRLIYWNEVLQYLGLRGNNLVG  203


 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL  L  L + NN+L GPIP  LS   NL  L++  NK  G I
Sbjct  337  LELNDNHLTGHIPPELGKLTDLFDLNVANNDLEGPIPDHLSSCTNLNSLNVHGNKFGGTI  396

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR     E + YL L  NN+ G
Sbjct  397  PRAFQKLESMTYLNLSNNNIKG  418


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+  G IP +  KL+ +  L L NN + GPIP  LS+I NL  LDL+ NK++G I
Sbjct  385  LNVHGNKFGGTIPRAFQKLESMTYLNLSNNNIKGPIPVELSRIGNLDTLDLSNNKINGII  444

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  + L  N++ G
Sbjct  445  PSSLGDLEHLLKMNLSRNHITG  466


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 52/106 (49%), Gaps = 25/106 (24%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLA--------  157
            LDLS+N+L G+IPF I  L Q+ TL L+ N+L G IPS +  +  L VLDL+        
Sbjct  242  LDLSYNQLTGEIPFDIGFL-QVATLSLQGNQLSGKIPSVIGLMQALAVLDLSGNLLSGPI  300

Query  158  ----------------QNKLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
                             NKL+G IP  +     L YL L  N+L G
Sbjct  301  PPILGNLTFTEKLYLHSNKLTGSIPPELGNMSKLHYLELNDNHLTG  346


 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G+I   + +L  L    ++NN L G IP T+      +VLDL+ N+L+GEI
Sbjct  194  LGLRGNNLVGNISPDLCQLTGLWYFDVRNNSLTGSIPGTIGNCTAFQVLDLSYNQLTGEI  253

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN L G
Sbjct  254  PFDIGFLQV-ATLSLQGNQLSG  274


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N + G IP  +S++  L+TL L NN++ G IPS+L  + +L  ++L++N ++G +
Sbjct  409  LNLSNNNIKGPIPVELSRIGNLDTLDLSNNKINGIIPSSLGDLEHLLKMNLSRNHITGVV  468

Query  182  P  184
            P
Sbjct  469  P  469



>ref|XP_009802873.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Nicotiana sylvestris]
Length=990

 Score =   155 bits (393),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 78/82 (95%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNELYGDIPFSISKLKQLE LILKNN+L+GPIPSTLSQIPNLKVLDLAQNKLSGEI
Sbjct  131  LDLSFNELYGDIPFSISKLKQLEYLILKNNQLIGPIPSTLSQIPNLKVLDLAQNKLSGEI  190

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNL G
Sbjct  191  PRLIYWNEVLQYLGLRGNNLGG  212


 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+NEL G+IPF+I  L Q+ TL L+ N L G IPS +  +  L VLDL+ N LSG I
Sbjct  251  LDLSYNELTGEIPFNIGFL-QVATLSLQGNRLSGQIPSVIGLMQALAVLDLSCNNLSGII  309

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L L GN L+G
Sbjct  310  PSILGNLTYTEKLYLHGNKLIG  331


 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP  + KL +L  L + NN L GPIPS LS   NL  L++  NKL+G I
Sbjct  346  LELNDNQLTGRIPPELGKLNELFDLNVANNHLDGPIPSNLSSCTNLNSLNVHGNKLNGTI  405

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E + YL L  NNL G
Sbjct  406  PPAFQKLESMTYLNLSSNNLKG  427


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP +  KL+ +  L L +N L GPIP  LS+I NL  LDL+ N++SG I
Sbjct  394  LNVHGNKLNGTIPPAFQKLESMTYLNLSSNNLKGPIPIELSRIGNLDTLDLSNNRISGSI  453

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N++ G
Sbjct  454  PSSLGDLEHLLKLNLSKNDING  475


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N L G IP  +  L   E L L  N+L+GPIP  L  +  L  L+L  N+L+G I
Sbjct  298  LDLSCNNLSGIIPSILGNLTYTEKLYLHGNKLIGPIPPELGNMSKLHYLELNDNQLTGRI  357

Query  182  P  184
            P
Sbjct  358  P  358


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+TL L NN + G IPS+L  + +L  L+L++N ++G +
Sbjct  418  LNLSSNNLKGPIPIELSRIGNLDTLDLSNNRISGSIPSSLGDLEHLLKLNLSKNDINGYL  477

Query  182  P  184
            P
Sbjct  478  P  478



>ref|XP_008452789.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Cucumis melo]
Length=991

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLSFNE+YGDIPFSISKLKQLE L+LKNN L+GPIPSTLSQIPNLKVLDLAQN LSGEI
Sbjct  128  MDLSFNEIYGDIPFSISKLKQLEMLVLKNNRLIGPIPSTLSQIPNLKVLDLAQNNLSGEI  187

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNLVG
Sbjct  188  PRLIYWNEVLQYLGLRGNNLVG  209


 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G+IP  + KL  L  L + NN L GPIP  LS   NL  L++  NKL+G I
Sbjct  343  LELNDNHLAGNIPAELGKLTDLFDLNVANNNLGGPIPDNLSSCTNLNSLNVHGNKLNGTI  402

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E + YL L  N+L G
Sbjct  403  PPSFQRLESMTYLNLSSNDLRG  424


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP S  +L+ +  L L +N+L GPIP  LS+I NL  LD++ NK+SG I
Sbjct  391  LNVHGNKLNGTIPPSFQRLESMTYLNLSSNDLRGPIPVELSRIGNLDTLDISNNKISGTI  450

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
                   E L  L L  N+L G
Sbjct  451  SSSFGDLEHLLKLNLSRNHLTG  472


 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 52/106 (49%), Gaps = 25/106 (24%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLA--------  157
            LDLS+N L G+IPF+I  L Q+ TL L+ N+L GPIP  +  +  L VLDL+        
Sbjct  248  LDLSYNHLSGEIPFNIGFL-QVATLSLQGNQLSGPIPPVIGLMQALAVLDLSCNMLTGSI  306

Query  158  ----------------QNKLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
                             NKL+G IP  +     L YL L  N+L G
Sbjct  307  PSILGNLTYTEKLYLHSNKLTGPIPPELGNMTKLHYLELNDNHLAG  352


 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N L G IP  +  L   E L L +N+L GPIP  L  +  L  L+L  N L+G I
Sbjct  295  LDLSCNMLTGSIPSILGNLTYTEKLYLHSNKLTGPIPPELGNMTKLHYLELNDNHLAGNI  354

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L +  NNL G
Sbjct  355  PAELGKLTDLFDLNVANNNLGG  376


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G +   + +L  L    ++NN L G IP T+      +VLDL+ N LSGEI
Sbjct  200  LGLRGNNLVGTLSPDMCQLTGLWYFDVRNNSLTGSIPQTIGNCTAFQVLDLSYNHLSGEI  259

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN L G
Sbjct  260  PFNIGFLQVAT-LSLQGNQLSG  280


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N+L G IP  +S++  L+TL + NN++ G I S+   + +L  L+L++N L+G I
Sbjct  415  LNLSSNDLRGPIPVELSRIGNLDTLDISNNKISGTISSSFGDLEHLLKLNLSRNHLTGFI  474

Query  182  P  184
            P
Sbjct  475  P  475



>ref|NP_180201.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Arabidopsis 
thaliana]
 sp|Q42371.1|ERECT_ARATH RecName: Full=LRR receptor-like serine/threonine-protein kinase 
ERECTA; AltName: Full=Protein QUANTITATIVE RESISTANCE TO 
PLECTOSPHAERELLA 1; AltName: Full=Protein QUANTITATIVE RESISTANCE 
TO RALSTONIA SOLANACEARUM 1; AltName: Full=Protein TRANSPIRATION 
EFFICIENCY 1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC49302.1| ERECTA [Arabidopsis thaliana]
 dbj|BAA11869.1| receptor protein kinase [Arabidopsis thaliana]
 gb|AAC14518.1| putative receptor-like protein kinase, ERECTA [Arabidopsis thaliana]
 gb|AAK59615.1| putative receptor protein kinase, ERECTA [Arabidopsis thaliana]
 gb|ACN59296.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEC07825.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Arabidopsis 
thaliana]
Length=976

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/82 (94%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNEL GDIPFSISKLKQLE LILKNN+L+GPIPSTLSQIPNLK+LDLAQNKLSGEI
Sbjct  121  LDLSFNELSGDIPFSISKLKQLEQLILKNNQLIGPIPSTLSQIPNLKILDLAQNKLSGEI  180

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNLVG
Sbjct  181  PRLIYWNEVLQYLGLRGNNLVG  202


 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL  L  L + NN+L GPIP  LS   NL  L++  NK SG I
Sbjct  336  LELNDNHLTGHIPPELGKLTDLFDLNVANNDLEGPIPDHLSSCTNLNSLNVHGNKFSGTI  395

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR     E + YL L  NN+ G
Sbjct  396  PRAFQKLESMTYLNLSSNNIKG  417


 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G+IPF I  L Q+ TL L+ N+L G IPS +  +  L VLDL+ N LSG I
Sbjct  241  LDLSYNQLTGEIPFDIGFL-QVATLSLQGNQLSGKIPSVIGLMQALAVLDLSGNLLSGSI  299

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L L  N L G
Sbjct  300  PPILGNLTFTEKLYLHSNKLTG  321


 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+  G IP +  KL+ +  L L +N + GPIP  LS+I NL  LDL+ NK++G I
Sbjct  384  LNVHGNKFSGTIPRAFQKLESMTYLNLSSNNIKGPIPVELSRIGNLDTLDLSNNKINGII  443

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  + L  N++ G
Sbjct  444  PSSLGDLEHLLKMNLSRNHITG  465


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G+I   + +L  L    ++NN L G IP T+      +VLDL+ N+L+GEI
Sbjct  193  LGLRGNNLVGNISPDLCQLTGLWYFDVRNNSLTGSIPETIGNCTAFQVLDLSYNQLTGEI  252

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN L G
Sbjct  253  PFDIGFLQV-ATLSLQGNQLSG  273


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N + G IP  +S++  L+TL L NN++ G IPS+L  + +L  ++L++N ++G +
Sbjct  408  LNLSSNNIKGPIPVELSRIGNLDTLDLSNNKINGIIPSSLGDLEHLLKMNLSRNHITGVV  467

Query  182  P  184
            P
Sbjct  468  P  468



>ref|XP_004141340.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Cucumis sativus]
 ref|XP_004157376.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Cucumis sativus]
 gb|KGN55381.1| Erecta [Cucumis sativus]
Length=991

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLSFNE+YGDIPFSISKLKQLE L+LKNN L+GPIPSTLSQIPNLKVLDLAQN LSGEI
Sbjct  128  MDLSFNEIYGDIPFSISKLKQLEMLVLKNNRLIGPIPSTLSQIPNLKVLDLAQNNLSGEI  187

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNLVG
Sbjct  188  PRLIYWNEVLQYLGLRGNNLVG  209


 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N L G+IPF+I  L Q+ TL L+ N+L GPIP  +  +  L VLDL+ N L+G I
Sbjct  248  LDLSYNHLSGEIPFNIGFL-QVATLSLQGNQLSGPIPPVIGLMQALAVLDLSCNMLTGPI  306

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L L  N L G
Sbjct  307  PSILGNLTYTEKLYLHSNKLTG  328


 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G+IP  + KL  L  L + NN L GPIP  LS   NL  L++  NKL+G I
Sbjct  343  LELNDNHLAGNIPAELGKLTDLFDLNVANNNLGGPIPDNLSSCINLNSLNVHGNKLNGTI  402

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E + YL L  N+L G
Sbjct  403  PPSFQRLESMTYLNLSSNDLRG  424


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP S  +L+ +  L L +N+L GPIP  LS+I NL  LD++ NK+SG I
Sbjct  391  LNVHGNKLNGTIPPSFQRLESMTYLNLSSNDLRGPIPVELSRIGNLDTLDISNNKISGTI  450

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
                   E L  L L  N+L G
Sbjct  451  SSSFGDLEHLLKLNLSRNHLTG  472


 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N L G IP  +  L   E L L +N+L GPIP+ L  +  L  L+L  N L+G I
Sbjct  295  LDLSCNMLTGPIPSILGNLTYTEKLYLHSNKLTGPIPAELGNMTKLHYLELNDNHLAGNI  354

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L +  NNL G
Sbjct  355  PAELGKLTDLFDLNVANNNLGG  376


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G +   + +L  L    ++NN L G IP T+      +VLDL+ N LSGEI
Sbjct  200  LGLRGNNLVGTLSPDMCQLTGLWYFDVRNNSLTGSIPQTIGNCTAFQVLDLSYNHLSGEI  259

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN L G
Sbjct  260  PFNIGFLQVAT-LSLQGNQLSG  280


 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N+L G IP  +S++  L+TL + NN++ G I S+   + +L  L+L++N L+G I
Sbjct  415  LNLSSNDLRGPIPVELSRIGNLDTLDISNNKISGTISSSFGDLEHLLKLNLSRNHLTGFI  474

Query  182  P  184
            P
Sbjct  475  P  475



>ref|XP_006296065.1| hypothetical protein CARUB_v10025215mg [Capsella rubella]
 gb|EOA28963.1| hypothetical protein CARUB_v10025215mg [Capsella rubella]
Length=976

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/82 (94%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNEL GDIPFSISKLKQLE LILKNN+L+GPIPSTLSQIPNLK+LDLAQNKLSGEI
Sbjct  121  LDLSFNELSGDIPFSISKLKQLEHLILKNNQLIGPIPSTLSQIPNLKILDLAQNKLSGEI  180

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNLVG
Sbjct  181  PRLIYWNEVLQYLGLRGNNLVG  202


 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N+  G IP    KL+ + TL L NN + GPIP  LS+I NL  LDL+ NK++G IP  + 
Sbjct  389  NKFSGTIPRGFQKLESMTTLNLSNNNINGPIPVELSRIGNLDTLDLSNNKINGTIPSSLG  448

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  + L  N++ G
Sbjct  449  DLEHLLKMNLSRNHITG  465


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL  L  L + NN+L GPIP  LS   NL  L    NK SG I
Sbjct  336  LELNDNHLTGHIPPELGKLTDLFDLNVANNDLEGPIPDHLSSCTNLNSLIAHGNKFSGTI  395

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR     E +  L L  NN+ G
Sbjct  396  PRGFQKLESMTTLNLSNNNING  417


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 52/106 (49%), Gaps = 25/106 (24%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLA--------  157
            LDLS+N+L G+IPF I  L Q+ TL L+ N+L G IPS +  +  L VLDL+        
Sbjct  241  LDLSYNQLTGEIPFDIGFL-QVATLSLQGNQLSGKIPSVIGLMQALAVLDLSGNMLSGPI  299

Query  158  ----------------QNKLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
                             NKL+G IP  +     L YL L  N+L G
Sbjct  300  PPILGNLTFTEKLYLHSNKLTGSIPPELGNMSKLHYLELNDNHLTG  345


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G+I   + +L  L    ++NN L G IP T+      +VLDL+ N+L+GEI
Sbjct  193  LGLRGNNLVGNISPDLCQLTGLWYFDVRNNSLTGSIPETIGNCTAFQVLDLSYNQLTGEI  252

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN L G
Sbjct  253  PFDIGFLQV-ATLSLQGNQLSG  273


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N + G IP  +S++  L+TL L NN++ G IPS+L  + +L  ++L++N ++G I
Sbjct  408  LNLSNNNINGPIPVELSRIGNLDTLDLSNNKINGTIPSSLGDLEHLLKMNLSRNHITGVI  467

Query  182  P  184
            P
Sbjct  468  P  468


 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            ++LS N + G IP     L+ +  + L NN++ GPIP  L+Q+ N+ +L L  N L+G +
Sbjct  456  MNLSRNHITGVIPGDFGNLRSISEIDLSNNDISGPIPEELNQLQNIVLLRLENNNLTGNV  515

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
              L      L  L +  NNLVG
Sbjct  516  GSLANCLS-LNVLNVSHNNLVG  536


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N++ G IP S+  L+ L  + L  N + G IP     + ++  +DL+ N +SG I
Sbjct  432  LDLSNNKINGTIPSSLGDLEHLLKMNLSRNHITGVIPGDFGNLRSISEIDLSNNDISGPI  491

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + +  L L  NNL G
Sbjct  492  PEELNQLQNIVLLRLENNNLTG  513



>ref|XP_002880777.1| hypothetical protein ARALYDRAFT_481491 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57036.1| hypothetical protein ARALYDRAFT_481491 [Arabidopsis lyrata subsp. 
lyrata]
Length=976

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/82 (94%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNEL GDIPFSISKLKQLE LILKNN+L+GPIPSTLSQIPNLK+LDLAQNKLSGEI
Sbjct  121  LDLSFNELSGDIPFSISKLKQLEQLILKNNQLIGPIPSTLSQIPNLKILDLAQNKLSGEI  180

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNLVG
Sbjct  181  PRLIYWNEVLQYLGLRGNNLVG  202


 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL  L  L + NN+L GPIP  LS   NL  L++  NK SG I
Sbjct  336  LELNDNHLTGHIPPELGKLTDLFDLNVANNDLEGPIPDHLSSCTNLNSLNVHGNKFSGTI  395

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR     E + YL L  NN+ G
Sbjct  396  PRAFQKLESMTYLNLSNNNIKG  417


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+  G IP +  KL+ +  L L NN + GPIP  LS+I NL  LDL+ NK++G I
Sbjct  384  LNVHGNKFSGTIPRAFQKLESMTYLNLSNNNIKGPIPVELSRIGNLDTLDLSNNKINGII  443

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  + L  N++ G
Sbjct  444  PSSLGDLEHLLKMNLSRNHITG  465


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 52/106 (49%), Gaps = 25/106 (24%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLA--------  157
            LDLS+N+L G+IPF I  L Q+ TL L+ N+L G IPS +  +  L VLDL+        
Sbjct  241  LDLSYNQLTGEIPFDIGFL-QVATLSLQGNQLSGKIPSVIGLMQALAVLDLSGNLLSGPI  299

Query  158  ----------------QNKLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
                             NKL+G IP  +     L YL L  N+L G
Sbjct  300  PPILGNLTFTEKLYLHSNKLTGSIPPELGNMSKLHYLELNDNHLTG  345


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G+I   + +L  L    ++NN L G IP T+      +VLDL+ N+L+GEI
Sbjct  193  LGLRGNNLVGNISPDLCQLTGLWYFDVRNNSLTGSIPETIGNCTAFQVLDLSYNQLTGEI  252

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN L G
Sbjct  253  PFDIGFLQV-ATLSLQGNQLSG  273


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N + G IP  +S++  L+TL L NN++ G IPS+L  + +L  ++L++N ++G +
Sbjct  408  LNLSNNNIKGPIPVELSRIGNLDTLDLSNNKINGIIPSSLGDLEHLLKMNLSRNHITGVV  467

Query  182  P  184
            P
Sbjct  468  P  468


 Score = 46.6 bits (109),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            ++LS N + G +P     L+ +  + L NN++ GPIP  L+Q+ N+ +L L  N L+G +
Sbjct  456  MNLSRNHITGVVPGDFGNLRSIMEIDLSNNDISGPIPEELNQLQNIVLLRLENNNLTGNV  515

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
              L      L  L +  NNLVG
Sbjct  516  GSLANCLS-LTVLNVSHNNLVG  536



>ref|XP_010429655.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Camelina sativa]
Length=982

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/82 (94%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNEL GDIPFSISKLKQLE LILKNN+L+GPIPSTLSQIPNLK+LDLAQNKLSGEI
Sbjct  127  LDLSFNELSGDIPFSISKLKQLEQLILKNNQLIGPIPSTLSQIPNLKILDLAQNKLSGEI  186

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNLVG
Sbjct  187  PRLIYWNEVLQYLGLRGNNLVG  208


 Score = 61.6 bits (148),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL  L  L + NN L GPIP  LS   NL  L++  NK SG I
Sbjct  342  LELNDNHLTGHIPPELGKLTDLFDLNVANNNLEGPIPDHLSSCTNLNSLNVHGNKFSGTI  401

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR     E + YL L  NN+ G
Sbjct  402  PRAFQKLESMTYLNLSNNNIKG  423


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+  G IP +  KL+ +  L L NN + GPIP  LS+I NL  LDL+ NK++G I
Sbjct  390  LNVHGNKFSGTIPRAFQKLESMTYLNLSNNNIKGPIPVELSRIGNLDTLDLSNNKINGII  449

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  + L  N++ G
Sbjct  450  PSSLGDLEHLLKMNLSRNHITG  471


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 52/106 (49%), Gaps = 25/106 (24%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQN------  163
            LDLS+N+L G+IPF I  L Q+ TL L+ N+L G IPS +  +  L VLDL+ N      
Sbjct  247  LDLSYNQLTGEIPFDIGFL-QVATLSLQGNQLSGKIPSVIGLMQALAVLDLSSNLLSGPI  305

Query  164  ------------------KLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
                              KL+G IP  +     L YL L  N+L G
Sbjct  306  PPILGNLTFTEKLYLHSNKLTGSIPPELGNMSKLHYLELNDNHLTG  351


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G+I   + +L  L    ++NN L G IP T+      +VLDL+ N+L+GEI
Sbjct  199  LGLRGNNLVGNISPDLCQLTGLWYFDVRNNSLTGSIPGTIGNCTAFQVLDLSYNQLTGEI  258

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN L G
Sbjct  259  PFDIGFLQV-ATLSLQGNQLSG  279


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N + G IP  +S++  L+TL L NN++ G IPS+L  + +L  ++L++N ++G +
Sbjct  414  LNLSNNNIKGPIPVELSRIGNLDTLDLSNNKINGIIPSSLGDLEHLLKMNLSRNHITGVV  473

Query  182  P  184
            P
Sbjct  474  P  474



>ref|XP_010417421.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Camelina sativa]
Length=975

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/82 (94%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNEL GDIPFSISKLKQLE LILKNN+L+GPIPSTLSQIPNLK+LDLAQNKLSGEI
Sbjct  122  LDLSFNELSGDIPFSISKLKQLEKLILKNNQLIGPIPSTLSQIPNLKILDLAQNKLSGEI  181

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNLVG
Sbjct  182  PRLIYWNEVLQYLGLRGNNLVG  203


 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL  L  L + NN+L GPIP  LS   NL  L++  NK SG I
Sbjct  337  LELNDNHLTGHIPPELGKLTDLFDLNVANNDLEGPIPDHLSSCTNLNSLNVHGNKFSGTI  396

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR     E + YL L  NN+ G
Sbjct  397  PRAFQKLESMTYLNLSNNNIKG  418


 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 53/106 (50%), Gaps = 25/106 (24%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLA--------  157
            LDLSFNEL GDIPFSI  L Q+ TL L+ N+L G IPS +  +  L VLDL+        
Sbjct  242  LDLSFNELSGDIPFSIGFL-QVATLSLQGNQLSGKIPSVIGLMQALAVLDLSGNLLSGPI  300

Query  158  ----------------QNKLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
                             NKL+G IP  +     L YL L  N+L G
Sbjct  301  PPILGNLTFTEKLYLHSNKLTGSIPPELGNMSKLHYLELNDNHLTG  346


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+  G IP +  KL+ +  L L NN + GPIP  LS+I NL  LDL+ NK++G I
Sbjct  385  LNVHGNKFSGTIPRAFQKLESMTYLNLSNNNIKGPIPVELSRIGNLDTLDLSNNKINGII  444

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  + L  N++ G
Sbjct  445  PSSLGDLEHLLKMNLSRNHITG  466


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N + G IP  +S++  L+TL L NN++ G IPS+L  + +L  ++L++N ++G +
Sbjct  409  LNLSNNNIKGPIPVELSRIGNLDTLDLSNNKINGIIPSSLGDLEHLLKMNLSRNHITGVV  468

Query  182  P  184
            P
Sbjct  469  P  469



>ref|XP_004245043.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Solanum lycopersicum]
Length=990

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/82 (94%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNELYGDIPFSISKLKQLE LILKNN+L+GPIPSTLSQIPNLKVLDLAQN+LSGEI
Sbjct  129  LDLSFNELYGDIPFSISKLKQLEYLILKNNQLIGPIPSTLSQIPNLKVLDLAQNRLSGEI  188

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNL G
Sbjct  189  PRLIYWNEVLQYLGLRGNNLGG  210


 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP  + KL +L  L + NN L GPIPS +S   NL  L++  NKL+G I
Sbjct  344  LELNDNQLTGRIPPELGKLTELFDLNVANNHLDGPIPSNISSCTNLNSLNVHGNKLNGTI  403

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E + YL L  NNL G
Sbjct  404  PPAFQKLESMTYLNLSSNNLKG  425


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP +  KL+ +  L L +N L GPIP  LS+I N+  LDL+ N++SG I
Sbjct  392  LNVHGNKLNGTIPPAFQKLESMTYLNLSSNNLKGPIPIELSRIGNVDTLDLSNNRISGPI  451

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N + G
Sbjct  452  PMSLGDLEHLLKLNLSKNEING  473


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 51/106 (48%), Gaps = 25/106 (24%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQN------  163
            LDLS+N+L G+IPF+I  L Q+ TL L+ N L G IPS +  +  L VLDL+ N      
Sbjct  249  LDLSYNDLTGEIPFNIGFL-QVATLSLQGNRLSGQIPSVIGLMQALAVLDLSCNMLSGTI  307

Query  164  ------------------KLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
                              KLSG IP  +     L YL L  N L G
Sbjct  308  PSILGNLTYTEKLYLHGNKLSGSIPPELGNMTKLHYLELNDNQLTG  353


 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  ++TL L NN + GPIP +L  + +L  L+L++N+++G +
Sbjct  416  LNLSSNNLKGPIPIELSRIGNVDTLDLSNNRISGPIPMSLGDLEHLLKLNLSKNEINGNL  475

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +  + L  N+L G
Sbjct  476  PAEFGNLRSIMEIDLSSNHLSG  497


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS NE+ G++P     L+ +  + L +N L GP+P  L Q+PNL +L +  N LSG++
Sbjct  464  LNLSKNEINGNLPAEFGNLRSIMEIDLSSNHLSGPLPQELGQLPNLYLLKVENNNLSGDV  523

Query  182  PRL  190
              L
Sbjct  524  MSL  526


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS   L G++  +I +LK L ++ ++ N L G IP  +     LK LDL+ N+L G+I
Sbjct  81   LNLSSLNLDGELSPAIGQLKGLVSIDMRGNRLSGQIPDEIGDCSALKNLDLSFNELYGDI  140

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I   + L+YL L+ N L+G
Sbjct  141  PFSISKLKQLEYLILKNNQLIG  162



>ref|XP_009117015.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Brassica rapa]
 ref|XP_009117016.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Brassica rapa]
 gb|AGL91676.1| erecta leucine-rich-repeat receptor-like kinase [Brassica napus]
 emb|CDY11488.1| BnaA09g40540D [Brassica napus]
Length=987

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/82 (94%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNEL GDIPFSISKLKQLE LILKNN+L+GPIPSTLSQIPNLK+LDLAQNKLSGEI
Sbjct  121  LDLSFNELSGDIPFSISKLKQLEQLILKNNQLIGPIPSTLSQIPNLKILDLAQNKLSGEI  180

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNLVG
Sbjct  181  PRLIYWNEVLQYLGLRGNNLVG  202


 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL  L  L + NN L G IP  LS   NL  L++  NK SG I
Sbjct  336  LELNDNRLTGHIPPELGKLTDLFDLNVANNNLEGLIPDHLSSCTNLNSLNVHGNKFSGTI  395

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR     E + YL L  NN+ G
Sbjct  396  PRAFQKLESMTYLNLSNNNIRG  417


 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+  G IP +  KL+ +  L L NN + GPIP  LS+I NL  LDL+ NK++G I
Sbjct  384  LNVHGNKFSGTIPRAFQKLESMTYLNLSNNNIRGPIPVELSRIGNLDTLDLSNNKINGNI  443

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  + L  N++ G
Sbjct  444  PSSLGDLEHLLKMNLSRNHITG  465


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 51/106 (48%), Gaps = 25/106 (24%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLA--------  157
            LDLS+N+L G+IPF I  L Q+ TL L+ N+L G IPS +  +  L VLDL+        
Sbjct  241  LDLSYNQLTGEIPFDIGFL-QVATLSLQGNQLSGKIPSVIGLMQALAVLDLSGNMLSGPI  299

Query  158  ----------------QNKLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
                             NKL+G IP  +     L YL L  N L G
Sbjct  300  PPILGNLTFTEKLYLHSNKLTGSIPPELGNMSKLHYLELNDNRLTG  345


 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            ++LS N + G IP     L+ +  + L NN++ GPIP  L+Q+ N+ +L L  N L+G +
Sbjct  456  MNLSRNHITGQIPADFGNLRSIMEIDLSNNDISGPIPEELNQLQNMYMLRLENNNLTGNV  515

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
              L+     L  L +  NNLVG
Sbjct  516  GSLVNCLS-LTVLNVSYNNLVG  536


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N + G IP  +S++  L+TL L NN++ G IPS+L  + +L  ++L++N ++G+I
Sbjct  408  LNLSNNNIRGPIPVELSRIGNLDTLDLSNNKINGNIPSSLGDLEHLLKMNLSRNHITGQI  467

Query  182  P  184
            P
Sbjct  468  P  468


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N++ G+IP S+  L+ L  + L  N + G IP+    + ++  +DL+ N +SG I
Sbjct  432  LDLSNNKINGNIPSSLGDLEHLLKMNLSRNHITGQIPADFGNLRSIMEIDLSNNDISGPI  491

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + +  L L  NNL G
Sbjct  492  PEELNQLQNMYMLRLENNNLTG  513


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G++   + +L  L    ++NN L G IP T+      +VLDL+ N+L+GEI
Sbjct  193  LGLRGNNLVGNLSPDLCQLTGLWYFDVRNNSLTGSIPETIGNCTAFQVLDLSYNQLTGEI  252

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN L G
Sbjct  253  PFDIGFLQV-ATLSLQGNQLSG  273



>gb|AGL91677.1| erecta leucine-rich-repeat receptor-like kinase [Brassica napus]
 emb|CDX76712.1| BnaC08g32980D [Brassica napus]
Length=987

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/82 (94%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNEL GDIPFSISKLKQLE LILKNN+L+GPIPSTLSQIPNLK+LDLAQNKLSGEI
Sbjct  121  LDLSFNELSGDIPFSISKLKQLEQLILKNNQLIGPIPSTLSQIPNLKILDLAQNKLSGEI  180

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNLVG
Sbjct  181  PRLIYWNEVLQYLGLRGNNLVG  202


 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL  L  L + NN L G IP  LS   NL  L++  NK SG I
Sbjct  336  LELNDNRLTGHIPPELGKLTDLFDLNVANNNLEGLIPDHLSSCTNLNSLNVHGNKFSGNI  395

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR     E + YL L  NN+ G
Sbjct  396  PRAFQKLESMTYLNLSNNNIRG  417


 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+  G+IP +  KL+ +  L L NN + GPIP  LS+I NL  LDL+ NK++G I
Sbjct  384  LNVHGNKFSGNIPRAFQKLESMTYLNLSNNNIRGPIPVELSRIGNLDTLDLSNNKINGNI  443

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  + L  N++ G
Sbjct  444  PSSLGDLEHLLKMNLSRNHITG  465


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 51/106 (48%), Gaps = 25/106 (24%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLA--------  157
            LDLS+N+L G+IPF I  L Q+ TL L+ N+L G IPS +  +  L VLDL+        
Sbjct  241  LDLSYNQLTGEIPFDIGFL-QVATLSLQGNQLSGKIPSVIGLMQALAVLDLSGNMLSGPI  299

Query  158  ----------------QNKLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
                             NKL+G IP  +     L YL L  N L G
Sbjct  300  PPILGNLTFTEKLYLHSNKLTGSIPPELGNMSKLHYLELNDNRLTG  345


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N++ G+IP S+  L+ L  + L  N + G +P+    + ++  +DL+ N +SG I
Sbjct  432  LDLSNNKINGNIPSSLGDLEHLLKMNLSRNHITGLVPADFGNLRSIMEIDLSNNDISGPI  491

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L  L L  NNL G
Sbjct  492  PEELNQLQNLNMLRLENNNLTG  513


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G++   + +L  L    ++NN L G IP T+      +VLDL+ N+L+GEI
Sbjct  193  LGLRGNNLVGNLSPDLCQLTGLWYFDVRNNSLTGSIPETIGNCTAFQVLDLSYNQLTGEI  252

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN L G
Sbjct  253  PFDIGFLQV-ATLSLQGNQLSG  273


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            ++LS N + G +P     L+ +  + L NN++ GPIP  L+Q+ NL +L L  N L+G +
Sbjct  456  MNLSRNHITGLVPADFGNLRSIMEIDLSNNDISGPIPEELNQLQNLNMLRLENNNLTGNV  515

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
              L      L  L +  NNLVG
Sbjct  516  GSLANCLS-LTVLNVSYNNLVG  536


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N + G IP  +S++  L+TL L NN++ G IPS+L  + +L  ++L++N ++G +
Sbjct  408  LNLSNNNIRGPIPVELSRIGNLDTLDLSNNKINGNIPSSLGDLEHLLKMNLSRNHITGLV  467

Query  182  P  184
            P
Sbjct  468  P  468



>ref|XP_006353850.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Solanum tuberosum]
Length=990

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/82 (94%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNELYGDIPFSISKLKQLE LILKNN+L+GPIPSTLSQIPNLKVLDLAQN+LSGEI
Sbjct  129  LDLSFNELYGDIPFSISKLKQLEYLILKNNQLIGPIPSTLSQIPNLKVLDLAQNRLSGEI  188

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNL G
Sbjct  189  PRLIYWNEVLQYLGLRGNNLGG  210


 Score = 61.6 bits (148),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP  + KL +L  L + NN L GPIPS LS   NL  L++  NKL+G I
Sbjct  344  LELNDNQLTGRIPPELGKLTELFDLNVANNHLDGPIPSNLSSCTNLNSLNVHGNKLNGTI  403

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E + YL L  NNL G
Sbjct  404  PPAFQKLESMTYLNLSSNNLKG  425


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP +  KL+ +  L L +N L GPIP  LS+I N+  LDL+ N++SG I
Sbjct  392  LNVHGNKLNGTIPPAFQKLESMTYLNLSSNNLKGPIPIELSRIGNVDTLDLSNNRISGRI  451

Query  182  P  184
            P
Sbjct  452  P  452


 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 51/106 (48%), Gaps = 25/106 (24%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQN------  163
            LDLS+N+L G+IPF+I  L Q+ TL L+ N L G IPS +  +  L VLDL+ N      
Sbjct  249  LDLSYNDLTGEIPFNIGFL-QVATLSLQGNRLSGQIPSVIGLMQALAVLDLSCNMLSGTI  307

Query  164  ------------------KLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
                              KLSG IP  +     L YL L  N L G
Sbjct  308  PSILGNLTYTEKLYLHGNKLSGSIPPELGNMTKLHYLELNDNQLTG  353


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS NE+ G++P     L+ +  + L +N L GP+P  L Q+PNL +L L  N LSG++
Sbjct  464  LNLSKNEINGNLPAEFGNLRSIMEIDLSSNHLSGPLPQELGQLPNLYLLKLENNNLSGDV  523

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
              L      L  L +  NNL G
Sbjct  524  MSLASCLS-LNVLNVSYNNLGG  544


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N + G IP S+  L+ L  L L  NE+ G +P+    + ++  +DL+ N LSG +
Sbjct  440  LDLSNNRISGRIPLSLGDLEHLLKLNLSKNEINGNLPAEFGNLRSIMEIDLSSNHLSGPL  499

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +     L  L L  NNL G
Sbjct  500  PQELGQLPNLYLLKLENNNLSG  521


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS   L G++  +I +LK L ++ ++ N L G IP  +     LK LDL+ N+L G+I
Sbjct  81   LNLSSLNLDGELSPAIGQLKGLISIDVRGNRLSGQIPDEIGDCSALKNLDLSFNELYGDI  140

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I   + L+YL L+ N L+G
Sbjct  141  PFSISKLKQLEYLILKNNQLIG  162



>gb|EYU20292.1| hypothetical protein MIMGU_mgv1a026417mg, partial [Erythranthe 
guttata]
Length=953

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNELYGDIPFSISKLKQLE LILKNN+L+GPIPSTLSQIPNLK+LDLAQNKLSGEI
Sbjct  94   LDLSFNELYGDIPFSISKLKQLENLILKNNQLIGPIPSTLSQIPNLKILDLAQNKLSGEI  153

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQY+GLRGNNL G
Sbjct  154  PRLLYWNEVLQYMGLRGNNLQG  175


 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP +  KL+ +  L L +N L GPIP  LS+I NL  LDL+ NK+SGE+
Sbjct  357  LNVHGNKLSGTIPRAFQKLESMTNLNLSSNNLKGPIPIELSRIGNLDTLDLSNNKISGEM  416

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N L G
Sbjct  417  PSSLGDLEHLLTLNLSNNALTG  438


 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N   G+IPF+I  L Q+ TL L+ N   G IPS +  +  L VLDL+ N LSG I
Sbjct  214  LDLSYNNFSGEIPFNIGFL-QVATLSLQGNRFSGQIPSVIGLMQALAVLDLSCNVLSGSI  272

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L L GN L G
Sbjct  273  PPILGNLSYTEKLYLHGNKLTG  294


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL  L  L + NN L G IP  L    NL  L++  NKLSG I
Sbjct  309  LELNDNLLSGHIPSELGKLTDLFDLNVANNHLEGAIPDNLGSCTNLNSLNVHGNKLSGTI  368

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR     E +  L L  NNL G
Sbjct  369  PRAFQKLESMTNLNLSSNNLKG  390


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N++ G++P S+  L+ L TL L NN L G IP+    + ++  +DL++N LSG I
Sbjct  405  LDLSNNKISGEMPSSLGDLEHLLTLNLSNNALTGIIPAEFGNLRSVVEIDLSRNNLSGPI  464

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + L  L L  NN+ G
Sbjct  465  PQELGQLQNLFLLKLENNNISG  486


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+TL L NN++ G +PS+L  + +L  L+L+ N L+G I
Sbjct  381  LNLSSNNLKGPIPIELSRIGNLDTLDLSNNKISGEMPSSLGDLEHLLTLNLSNNALTGII  440

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +  + L  NNL G
Sbjct  441  PAEFGNLRSVVEIDLSRNNLSG  462



>gb|EYU32328.1| hypothetical protein MIMGU_mgv1a000790mg [Erythranthe guttata]
Length=985

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/82 (93%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNELYGDIPFSISKLKQLE LILKNN+L+GPIPSTLSQIPNLK+LDLAQNKLSGEI
Sbjct  124  LDLSFNELYGDIPFSISKLKQLENLILKNNQLIGPIPSTLSQIPNLKILDLAQNKLSGEI  183

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQYLGLRGNNL G
Sbjct  184  PRLLYWNEVLQYLGLRGNNLQG  205


 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N L G+IPF+I  L Q+ TL L+NN   G IPS +  +  L VLDL  N LSG I
Sbjct  244  LDLSYNNLTGEIPFNIGFL-QVATLSLQNNRFSGQIPSVIGLMQALAVLDLRYNVLSGTI  302

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L L GN L G
Sbjct  303  PPILGNLTYTEKLYLHGNRLSG  324


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL  L  L + NN L GPIP  LS   NL  L++  NKLSG +
Sbjct  339  LELNDNLLTGRIPPELGKLTDLFDLNVANNHLEGPIPDNLSSCTNLNSLNVHGNKLSGTV  398

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E + YL L  N + G
Sbjct  399  PPTFEKLESMTYLNLSANGISG  420


 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G +P +  KL+ +  L L  N + GPIP  LS+I NL  LDL+ N++SG +
Sbjct  387  LNVHGNKLSGTVPPTFEKLESMTYLNLSANGISGPIPIELSRIGNLDTLDLSNNRISGYM  446

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N L G
Sbjct  447  PSSLGDLEHLLKLNLSNNELTG  468


 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N + G +P S+  L+ L  L L NNEL G IP+    + ++  +DL+ N LSG I
Sbjct  435  LDLSNNRISGYMPSSLGDLEHLLKLNLSNNELTGVIPAEFGNLRSVMEIDLSSNHLSGSI  494

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + +  L L  NN+ G
Sbjct  495  PPALGQLQNVFLLKLENNNISG  516


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N + G IP  +S++  L+TL L NN + G +PS+L  + +L  L+L+ N+L+G I
Sbjct  411  LNLSANGISGPIPIELSRIGNLDTLDLSNNRISGYMPSSLGDLEHLLKLNLSNNELTGVI  470

Query  182  P  184
            P
Sbjct  471  P  471



>gb|KJB07391.1| hypothetical protein B456_001G019800 [Gossypium raimondii]
 gb|KJB07392.1| hypothetical protein B456_001G019800 [Gossypium raimondii]
 gb|KJB07393.1| hypothetical protein B456_001G019800 [Gossypium raimondii]
Length=983

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNELYGDIPFSISKL+QLE L+LKNN+L+GPIPSTLSQIPNLKVLDL+QNKLSGEI
Sbjct  123  LDLSFNELYGDIPFSISKLRQLEFLVLKNNQLIGPIPSTLSQIPNLKVLDLSQNKLSGEI  182

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQY GLRGNNLVG
Sbjct  183  PRLIYWNEVLQYFGLRGNNLVG  204


 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G+IPF+I  L Q+ TL L+ N L G IPS +  +  L VLDL+ NKLSG I
Sbjct  243  LDLSYNQLTGEIPFNIGFL-QVATLSLQGNRLSGKIPSVIGLMQALAVLDLSCNKLSGPI  301

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L L GN L G
Sbjct  302  PPILGNLTYTEKLYLHGNQLSG  323


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL +L  L + NN L GPIP  LS   NL  L++  NKL+G I
Sbjct  338  LELNDNYLTGLIPPELGKLTELFDLNVANNHLEGPIPENLSSCTNLNSLNVHGNKLNGTI  397

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E + YL L  N++ G
Sbjct  398  PPAFERLESMTYLNLSSNDIKG  419


 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP +  +L+ +  L L +N++ G I   LS+I NL  LD++ NK+SG I
Sbjct  386  LNVHGNKLNGTIPPAFERLESMTYLNLSSNDIKGFIAIELSRIGNLDTLDISNNKISGSI  445

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  NNL G
Sbjct  446  PSSLGDLEHLLKLNLSRNNLTG  467


 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S N++ G IP S+  L+ L  L L  N L G IP+    + ++  +DL+ N LSG I
Sbjct  434  LDISNNKISGSIPSSLGDLEHLLKLNLSRNNLTGVIPAEFGNLRSVLEIDLSNNHLSGII  493

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR +   + L  L +  NNL G
Sbjct  494  PRELAQLQDLYSLRIENNNLSG  515


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N++ G I   +S++  L+TL + NN++ G IPS+L  + +L  L+L++N L+G I
Sbjct  410  LNLSSNDIKGFIAIELSRIGNLDTLDISNNKISGSIPSSLGDLEHLLKLNLSRNNLTGVI  469

Query  182  P  184
            P
Sbjct  470  P  470



>ref|XP_007225368.1| hypothetical protein PRUPE_ppa000847mg [Prunus persica]
 gb|EMJ26567.1| hypothetical protein PRUPE_ppa000847mg [Prunus persica]
Length=983

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNE+YGDIPFSISKLKQLE LILKNN+L+GP+PSTLSQIPNLK+LDLAQN LSGEI
Sbjct  120  LDLSFNEIYGDIPFSISKLKQLENLILKNNQLIGPLPSTLSQIPNLKILDLAQNNLSGEI  179

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNLVG
Sbjct  180  PRLIYWNEVLQYLGLRGNNLVG  201


 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP ++ +L+ +  L L +N L G IP  LS+I NL  LDL+ NK+SG I
Sbjct  383  LNVHGNKLTGTIPPALQRLESMTYLNLSSNNLRGSIPIELSRIGNLDTLDLSNNKISGTI  442

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N+L G
Sbjct  443  PSSLGDLEHLLKLNLSRNHLTG  464


 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G  P  + KL  L  L + NN L G IP  LS   NL  L++  NKL+G I
Sbjct  335  LELNDNLLTGHFPPELGKLTDLFDLNVANNNLEGHIPDNLSSCTNLNSLNVHGNKLTGTI  394

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E + YL L  NNL G
Sbjct  395  PPALQRLESMTYLNLSSNNLRG  416


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+TL L NN++ G IPS+L  + +L  L+L++N L+G +
Sbjct  407  LNLSSNNLRGSIPIELSRIGNLDTLDLSNNKISGTIPSSLGDLEHLLKLNLSRNHLTGFV  466

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +  + L  N+L G
Sbjct  467  PGEFGNLRSIMEIDLSSNHLTG  488


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N++ G IP S+  L+ L  L L  N L G +P     + ++  +DL+ N L+G I
Sbjct  431  LDLSNNKISGTIPSSLGDLEHLLKLNLSRNHLTGFVPGEFGNLRSIMEIDLSSNHLTGLI  490

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + +  L L  NNL G
Sbjct  491  PQELSQLQNMFSLRLDHNNLTG  512



>ref|XP_008220575.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X1 [Prunus mume]
Length=992

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNE+YGDIPFSISKLKQLE LILKNN+L+GP+PSTLSQIPNLK+LDLAQN LSGEI
Sbjct  128  LDLSFNEIYGDIPFSISKLKQLENLILKNNQLIGPLPSTLSQIPNLKILDLAQNNLSGEI  187

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNLVG
Sbjct  188  PRLIYWNEVLQYLGLRGNNLVG  209


 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G  P  + KL  L  L + NN L GPIP  LS   NL  L++  NKL+G I
Sbjct  343  LELNDNLLTGHFPPELGKLTDLFDLNVANNNLEGPIPDNLSSCTNLNSLNVHGNKLTGTI  402

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E + YL L  NNL G
Sbjct  403  PPALQRLESMTYLNLSSNNLRG  424


 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP ++ +L+ +  L L +N L G IP  LS+I NL  LDL+ NK+SG I
Sbjct  391  LNVHGNKLTGTIPPALQRLESMTYLNLSSNNLRGSIPIELSRIGNLDTLDLSNNKISGTI  450

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N+L G
Sbjct  451  PSSLGDLEHLLKLNLSRNHLTG  472


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+TL L NN++ G IPS+L  + +L  L+L++N L+G +
Sbjct  415  LNLSSNNLRGSIPIELSRIGNLDTLDLSNNKISGTIPSSLGDLEHLLKLNLSRNHLTGFV  474

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +  + L  N+L G
Sbjct  475  PGEFGNLRSIMEIDLSSNHLTG  496


 Score = 47.0 bits (110),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N++ G IP S+  L+ L  L L  N L G +P     + ++  +DL+ N L+G I
Sbjct  439  LDLSNNKISGTIPSSLGDLEHLLKLNLSRNHLTGFVPGEFGNLRSIMEIDLSSNHLTGLI  498

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + +  L L  NNL G
Sbjct  499  PQELSQLQNIFSLRLDHNNLTG  520



>ref|XP_011081595.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Sesamum indicum]
Length=973

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNELYGDIPFS+SKLKQLE LILKNN+L+GPIPSTLSQIPNLK+LDLAQNKLSGEI
Sbjct  129  LDLSFNELYGDIPFSMSKLKQLENLILKNNQLIGPIPSTLSQIPNLKILDLAQNKLSGEI  188

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQY+GLRGNNL G
Sbjct  189  PRLIYWNEVLQYIGLRGNNLQG  210


 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL  L  L + NN L GPIP  LS   NL  L++  NKL+G I
Sbjct  330  LELNDNLLTGHIPPELGKLTDLFDLNVANNHLEGPIPDNLSSCTNLNSLNVHGNKLNGTI  389

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E + YL L  NNL G
Sbjct  390  PPAFQRLESMTYLNLSSNNLKG  411


 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 47/92 (51%), Gaps = 11/92 (12%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN   G+IPF+I  L Q+ TL L+ N   G IPS +  +  L VLDL+ N L G I
Sbjct  249  LDLSFNNFSGEIPFNIGFL-QVATLSLQGNRFSGQIPSVIGLMQALAVLDLSCNMLVGTI  307

Query  182  P----------RLIYWNEVLQYLGLRGNNLVG  247
            P          +L      L YL L  N L G
Sbjct  308  PSILGNLTYTEKLYLQGTKLHYLELNDNLLTG  339


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP +  +L+ +  L L +N L GPIP  LS+I NL  LDL+ N++SG +
Sbjct  378  LNVHGNKLNGTIPPAFQRLESMTYLNLSSNNLKGPIPIELSRIGNLDTLDLSNNRISGYM  437

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N+L G
Sbjct  438  PSSLGDLEHLLKLNLSNNDLSG  459


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+TL L NN + G +PS+L  + +L  L+L+ N LSG I
Sbjct  402  LNLSSNNLKGPIPIELSRIGNLDTLDLSNNRISGYMPSSLGDLEHLLKLNLSNNDLSGLI  461

Query  182  P  184
            P
Sbjct  462  P  462


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N + G +P S+  L+ L  L L NN+L G IP+    + ++  +DL+ N LSG I
Sbjct  426  LDLSNNRISGYMPSSLGDLEHLLKLNLSNNDLSGLIPAKFGNLRSVMEIDLSNNHLSGPI  485

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + +  L L  NN+ G
Sbjct  486  PEELGQLQNVFLLKLENNNISG  507


 Score = 46.6 bits (109),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N+L G IP     L+ +  + L NN L GPIP  L Q+ N+ +L L  N +SG++
Sbjct  450  LNLSNNDLSGLIPAKFGNLRSVMEIDLSNNHLSGPIPEELGQLQNVFLLKLENNNISGDV  509

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
              L      L  L +  NNL G
Sbjct  510  MSLSSCLS-LTVLNVSYNNLAG  530



>ref|XP_008220576.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X2 [Prunus mume]
Length=991

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNE+YGDIPFSISKLKQLE LILKNN+L+GP+PSTLSQIPNLK+LDLAQN LSGEI
Sbjct  128  LDLSFNEIYGDIPFSISKLKQLENLILKNNQLIGPLPSTLSQIPNLKILDLAQNNLSGEI  187

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNLVG
Sbjct  188  PRLIYWNEVLQYLGLRGNNLVG  209


 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G  P  + KL  L  L + NN L GPIP  LS   NL  L++  NKL+G I
Sbjct  343  LELNDNLLTGHFPPELGKLTDLFDLNVANNNLEGPIPDNLSSCTNLNSLNVHGNKLTGTI  402

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E + YL L  NNL G
Sbjct  403  PPALQRLESMTYLNLSSNNLRG  424


 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP ++ +L+ +  L L +N L G IP  LS+I NL  LDL+ NK+SG I
Sbjct  391  LNVHGNKLTGTIPPALQRLESMTYLNLSSNNLRGSIPIELSRIGNLDTLDLSNNKISGTI  450

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N+L G
Sbjct  451  PSSLGDLEHLLKLNLSRNHLTG  472


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+TL L NN++ G IPS+L  + +L  L+L++N L+G +
Sbjct  415  LNLSSNNLRGSIPIELSRIGNLDTLDLSNNKISGTIPSSLGDLEHLLKLNLSRNHLTGFV  474

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +  + L  N+L G
Sbjct  475  PGEFGNLRSIMEIDLSSNHLTG  496


 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N++ G IP S+  L+ L  L L  N L G +P     + ++  +DL+ N L+G I
Sbjct  439  LDLSNNKISGTIPSSLGDLEHLLKLNLSRNHLTGFVPGEFGNLRSIMEIDLSSNHLTGLI  498

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + +  L L  NNL G
Sbjct  499  PQELSQLQNIFSLRLDHNNLTG  520



>gb|KJB65469.1| hypothetical protein B456_010G096300 [Gossypium raimondii]
Length=927

 Score =   154 bits (388),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/82 (93%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNELYGDIPFSISKLKQLE LILK+N+L+GPIPSTLSQIPNLKVLDLAQN+LSGEI
Sbjct  79   LDLSFNELYGDIPFSISKLKQLEFLILKSNQLIGPIPSTLSQIPNLKVLDLAQNRLSGEI  138

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN LVG
Sbjct  139  PRLIYWNEVLQYLGLRGNKLVG  160


 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G+IPF+I  L Q+ TL L+ N L G IPS +  +  L VLDL+ NKLSG I
Sbjct  199  LDLSYNQLTGEIPFNIGFL-QVATLSLQGNRLSGKIPSVIGLMQALAVLDLSSNKLSGHI  257

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L L GN L G
Sbjct  258  PPILGNLTYTEKLYLHGNKLTG  279


 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP  + KL +L  L + NN L GP+P  LS   NL  L++  NKL+G I
Sbjct  294  LELNDNQLTGHIPPELGKLTELFDLNVANNNLEGPLPDNLSSCTNLNSLNVHGNKLNGTI  353

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E + YL L  NN+ G
Sbjct  354  PSAFERLESMTYLNLSSNNIKG  375


 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S NE+ G IP S+  L+ L  L L  N L G IP+  + + ++  +DL+ N LSG I
Sbjct  390  LDISNNEINGSIPSSLGDLEHLLKLNLNRNHLAGVIPAEFANLRSVMEIDLSNNHLSGVI  449

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR +   + L  L L  NNL G
Sbjct  450  PRELMQLQNLFSLRLENNNLSG  471


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N + G IP  +S++  L+TL + NNE+ G IPS+L  + +L  L+L +N L+G I
Sbjct  366  LNLSSNNIKGSIPIELSRIGNLDTLDISNNEINGSIPSSLGDLEHLLKLNLNRNHLAGVI  425

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +  + L  N+L G
Sbjct  426  PAEFANLRSVMEIDLSNNHLSG  447


 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G +   + +L  L    ++NN L G IP  +      +VLDL+ N+L+GEI
Sbjct  151  LGLRGNKLVGGLSPDVCQLTGLWYFDVRNNSLTGSIPQNIGNCTAFQVLDLSYNQLTGEI  210

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN L G
Sbjct  211  PFNIGFLQVAT-LSLQGNRLSG  231



>gb|KJB65470.1| hypothetical protein B456_010G096300 [Gossypium raimondii]
Length=928

 Score =   154 bits (388),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/82 (93%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNELYGDIPFSISKLKQLE LILK+N+L+GPIPSTLSQIPNLKVLDLAQN+LSGEI
Sbjct  79   LDLSFNELYGDIPFSISKLKQLEFLILKSNQLIGPIPSTLSQIPNLKVLDLAQNRLSGEI  138

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN LVG
Sbjct  139  PRLIYWNEVLQYLGLRGNKLVG  160


 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G+IPF+I  L Q+ TL L+ N L G IPS +  +  L VLDL+ NKLSG I
Sbjct  199  LDLSYNQLTGEIPFNIGFL-QVATLSLQGNRLSGKIPSVIGLMQALAVLDLSSNKLSGHI  257

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L L GN L G
Sbjct  258  PPILGNLTYTEKLYLHGNKLTG  279


 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP  + KL +L  L + NN L GP+P  LS   NL  L++  NKL+G I
Sbjct  294  LELNDNQLTGHIPPELGKLTELFDLNVANNNLEGPLPDNLSSCTNLNSLNVHGNKLNGTI  353

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E + YL L  NN+ G
Sbjct  354  PSAFERLESMTYLNLSSNNIKG  375


 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S NE+ G IP S+  L+ L  L L  N L G IP+  + + ++  +DL+ N LSG I
Sbjct  390  LDISNNEINGSIPSSLGDLEHLLKLNLNRNHLAGVIPAEFANLRSVMEIDLSNNHLSGVI  449

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR +   + L  L L  NNL G
Sbjct  450  PRELMQLQNLFSLRLENNNLSG  471


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N + G IP  +S++  L+TL + NNE+ G IPS+L  + +L  L+L +N L+G I
Sbjct  366  LNLSSNNIKGSIPIELSRIGNLDTLDISNNEINGSIPSSLGDLEHLLKLNLNRNHLAGVI  425

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +  + L  N+L G
Sbjct  426  PAEFANLRSVMEIDLSNNHLSG  447


 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G +   + +L  L    ++NN L G IP  +      +VLDL+ N+L+GEI
Sbjct  151  LGLRGNKLVGGLSPDVCQLTGLWYFDVRNNSLTGSIPQNIGNCTAFQVLDLSYNQLTGEI  210

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN L G
Sbjct  211  PFNIGFLQVAT-LSLQGNRLSG  231



>ref|XP_011069519.1| PREDICTED: LOW QUALITY PROTEIN: LRR receptor-like serine/threonine-protein 
kinase ERECTA [Sesamum indicum]
Length=992

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNELYGDIPFS+SKLKQLE LILKNN+L+GPIPSTLSQIPNLK+LDLAQNKLSGEI
Sbjct  136  LDLSFNELYGDIPFSVSKLKQLENLILKNNKLIGPIPSTLSQIPNLKILDLAQNKLSGEI  195

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQYLGLRGNNL G
Sbjct  196  PRLLYWNEVLQYLGLRGNNLQG  217


 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP  + KL  L  L + NN L GPIP  LS   NL  L++  NKL+G +
Sbjct  347  LELNDNQLTGHIPPELGKLTDLFDLNVANNHLEGPIPDNLSSCTNLNSLNVHGNKLNGTV  406

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E + YL L  NNL G
Sbjct  407  PLAFQKLESMTYLNLSSNNLQG  428


 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 48/80 (60%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N   G+IPF+I  L Q+ TL L+NN   G IPS +  +  L VLDL+ N LSG I
Sbjct  256  LDLSYNNFTGEIPFNIGFL-QVATLSLQNNRFSGQIPSVIGLMQALAVLDLSYNLLSGTI  314

Query  182  PRLIYWNEVLQYLGLRGNNL  241
            P ++      + L L GN L
Sbjct  315  PPILGNLTYTEKLYLHGNKL  334


 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G +P +  KL+ +  L L +N L GPIP  LS+I NL  LDL+ N++SG I
Sbjct  395  LNVHGNKLNGTVPLAFQKLESMTYLNLSSNNLQGPIPIELSRIGNLDTLDLSNNRISGYI  454

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N+L G
Sbjct  455  PSPLGDLEHLLKLNLSNNDLSG  476


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+TL L NN + G IPS L  + +L  L+L+ N LSG I
Sbjct  419  LNLSSNNLQGPIPIELSRIGNLDTLDLSNNRISGYIPSPLGDLEHLLKLNLSNNDLSGVI  478

Query  182  P  184
            P
Sbjct  479  P  479


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N+L G IP     L+ +  + L NN L GPIP  L Q+ N+ +L L  N +SG++
Sbjct  467  LNLSNNDLSGVIPAEFGNLRSVMEIDLSNNRLSGPIPQELGQLQNVFLLKLENNNISGDV  526

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
              L      L  L +  NNLVG
Sbjct  527  MSLANCLS-LTVLNVSYNNLVG  547


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N + G IP  +  L+ L  L L NN+L G IP+    + ++  +DL+ N+LSG I
Sbjct  443  LDLSNNRISGYIPSPLGDLEHLLKLNLSNNDLSGVIPAEFGNLRSVMEIDLSNNRLSGPI  502

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + +  L L  NN+ G
Sbjct  503  PQELGQLQNVFLLKLENNNISG  524



>gb|KJB65473.1| hypothetical protein B456_010G096300 [Gossypium raimondii]
Length=978

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/82 (93%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNELYGDIPFSISKLKQLE LILK+N+L+GPIPSTLSQIPNLKVLDLAQN+LSGEI
Sbjct  123  LDLSFNELYGDIPFSISKLKQLEFLILKSNQLIGPIPSTLSQIPNLKVLDLAQNRLSGEI  182

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN LVG
Sbjct  183  PRLIYWNEVLQYLGLRGNKLVG  204


 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G+IPF+I  L Q+ TL L+ N L G IPS +  +  L VLDL+ NKLSG I
Sbjct  243  LDLSYNQLTGEIPFNIGFL-QVATLSLQGNRLSGKIPSVIGLMQALAVLDLSSNKLSGHI  301

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L L GN L G
Sbjct  302  PPILGNLTYTEKLYLHGNKLTG  323


 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP  + KL +L  L + NN L GP+P  LS   NL  L++  NKL+G I
Sbjct  338  LELNDNQLTGHIPPELGKLTELFDLNVANNNLEGPLPDNLSSCTNLNSLNVHGNKLNGTI  397

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E + YL L  NN+ G
Sbjct  398  PSAFERLESMTYLNLSSNNIKG  419


 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S NE+ G IP S+  L+ L  L L  N L G IP+  + + ++  +DL+ N LSG I
Sbjct  434  LDISNNEINGSIPSSLGDLEHLLKLNLNRNHLAGVIPAEFANLRSVMEIDLSNNHLSGVI  493

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR +   + L  L L  NNL G
Sbjct  494  PRELMQLQNLFSLRLENNNLSG  515


 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N + G IP  +S++  L+TL + NNE+ G IPS+L  + +L  L+L +N L+G I
Sbjct  410  LNLSSNNIKGSIPIELSRIGNLDTLDISNNEINGSIPSSLGDLEHLLKLNLNRNHLAGVI  469

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +  + L  N+L G
Sbjct  470  PAEFANLRSVMEIDLSNNHLSG  491


 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G +   + +L  L    ++NN L G IP  +      +VLDL+ N+L+GEI
Sbjct  195  LGLRGNKLVGGLSPDVCQLTGLWYFDVRNNSLTGSIPQNIGNCTAFQVLDLSYNQLTGEI  254

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN L G
Sbjct  255  PFNIGFLQVAT-LSLQGNRLSG  275



>gb|KJB65471.1| hypothetical protein B456_010G096300 [Gossypium raimondii]
Length=971

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/82 (93%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNELYGDIPFSISKLKQLE LILK+N+L+GPIPSTLSQIPNLKVLDLAQN+LSGEI
Sbjct  123  LDLSFNELYGDIPFSISKLKQLEFLILKSNQLIGPIPSTLSQIPNLKVLDLAQNRLSGEI  182

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN LVG
Sbjct  183  PRLIYWNEVLQYLGLRGNKLVG  204


 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G+IPF+I  L Q+ TL L+ N L G IPS +  +  L VLDL+ NKLSG I
Sbjct  243  LDLSYNQLTGEIPFNIGFL-QVATLSLQGNRLSGKIPSVIGLMQALAVLDLSSNKLSGHI  301

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L L GN L G
Sbjct  302  PPILGNLTYTEKLYLHGNKLTG  323


 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP  + KL +L  L + NN L GP+P  LS   NL  L++  NKL+G I
Sbjct  338  LELNDNQLTGHIPPELGKLTELFDLNVANNNLEGPLPDNLSSCTNLNSLNVHGNKLNGTI  397

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E + YL L  NN+ G
Sbjct  398  PSAFERLESMTYLNLSSNNIKG  419


 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S NE+ G IP S+  L+ L  L L  N L G IP+  + + ++  +DL+ N LSG I
Sbjct  434  LDISNNEINGSIPSSLGDLEHLLKLNLNRNHLAGVIPAEFANLRSVMEIDLSNNHLSGVI  493

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR +   + L  L L  NNL G
Sbjct  494  PRELMQLQNLFSLRLENNNLSG  515


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N + G IP  +S++  L+TL + NNE+ G IPS+L  + +L  L+L +N L+G I
Sbjct  410  LNLSSNNIKGSIPIELSRIGNLDTLDISNNEINGSIPSSLGDLEHLLKLNLNRNHLAGVI  469

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +  + L  N+L G
Sbjct  470  PAEFANLRSVMEIDLSNNHLSG  491


 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G +   + +L  L    ++NN L G IP  +      +VLDL+ N+L+GEI
Sbjct  195  LGLRGNKLVGGLSPDVCQLTGLWYFDVRNNSLTGSIPQNIGNCTAFQVLDLSYNQLTGEI  254

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN L G
Sbjct  255  PFNIGFLQVAT-LSLQGNRLSG  275



>gb|KJB65472.1| hypothetical protein B456_010G096300 [Gossypium raimondii]
Length=972

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/82 (93%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNELYGDIPFSISKLKQLE LILK+N+L+GPIPSTLSQIPNLKVLDLAQN+LSGEI
Sbjct  123  LDLSFNELYGDIPFSISKLKQLEFLILKSNQLIGPIPSTLSQIPNLKVLDLAQNRLSGEI  182

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN LVG
Sbjct  183  PRLIYWNEVLQYLGLRGNKLVG  204


 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G+IPF+I  L Q+ TL L+ N L G IPS +  +  L VLDL+ NKLSG I
Sbjct  243  LDLSYNQLTGEIPFNIGFL-QVATLSLQGNRLSGKIPSVIGLMQALAVLDLSSNKLSGHI  301

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L L GN L G
Sbjct  302  PPILGNLTYTEKLYLHGNKLTG  323


 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP  + KL +L  L + NN L GP+P  LS   NL  L++  NKL+G I
Sbjct  338  LELNDNQLTGHIPPELGKLTELFDLNVANNNLEGPLPDNLSSCTNLNSLNVHGNKLNGTI  397

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E + YL L  NN+ G
Sbjct  398  PSAFERLESMTYLNLSSNNIKG  419


 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S NE+ G IP S+  L+ L  L L  N L G IP+  + + ++  +DL+ N LSG I
Sbjct  434  LDISNNEINGSIPSSLGDLEHLLKLNLNRNHLAGVIPAEFANLRSVMEIDLSNNHLSGVI  493

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR +   + L  L L  NNL G
Sbjct  494  PRELMQLQNLFSLRLENNNLSG  515


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N + G IP  +S++  L+TL + NNE+ G IPS+L  + +L  L+L +N L+G I
Sbjct  410  LNLSSNNIKGSIPIELSRIGNLDTLDISNNEINGSIPSSLGDLEHLLKLNLNRNHLAGVI  469

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +  + L  N+L G
Sbjct  470  PAEFANLRSVMEIDLSNNHLSG  491


 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G +   + +L  L    ++NN L G IP  +      +VLDL+ N+L+GEI
Sbjct  195  LGLRGNKLVGGLSPDVCQLTGLWYFDVRNNSLTGSIPQNIGNCTAFQVLDLSYNQLTGEI  254

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN L G
Sbjct  255  PFNIGFLQVAT-LSLQGNRLSG  275



>ref|XP_010261893.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Nelumbo nucifera]
Length=979

 Score =   153 bits (387),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN+++GDIPFSISKLKQLE+L LKNN L+GPIPSTLSQIPNLK+LDLAQNKLSGEI
Sbjct  120  LDLSFNDIFGDIPFSISKLKQLESLYLKNNHLIGPIPSTLSQIPNLKILDLAQNKLSGEI  179

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNLVG
Sbjct  180  PRLIYWNEVLQYLGLRGNNLVG  201


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP  + KL  L  L + NN L GP+P  LS   NL  L++  N L+G I
Sbjct  335  LELNDNQLTGKIPPELGKLTDLFDLNVANNNLEGPMPDNLSSCTNLNSLNVHGNNLNGTI  394

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E + YL L  NNL G
Sbjct  395  PPEFERLESMTYLNLSSNNLKG  416


 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N L G IP    +L+ +  L L +N L GPIP  LS+I NL  LD++ NK+SG I
Sbjct  383  LNVHGNNLNGTIPPEFERLESMTYLNLSSNNLKGPIPIELSRIGNLDTLDISNNKISGFI  442

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N+L G
Sbjct  443  PSSLGDLEHLLKLNLSKNHLSG  464


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 43/82 (52%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP     L+ +  + L NN L GPIP  L Q+ NL  L L  N LSG++
Sbjct  455  LNLSKNHLSGVIPAEFGNLRSIMDIDLSNNHLSGPIPQELGQLQNLYSLKLENNNLSGDV  514

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
              LI     L  L +  NNL G
Sbjct  515  LSLISCFS-LTILNISYNNLAG  535


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+TL + NN++ G IPS+L  + +L  L+L++N LSG I
Sbjct  407  LNLSSNNLKGPIPIELSRIGNLDTLDISNNKISGFIPSSLGDLEHLLKLNLSKNHLSGVI  466

Query  182  P  184
            P
Sbjct  467  P  467


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S N++ G IP S+  L+ L  L L  N L G IP+    + ++  +DL+ N LSG I
Sbjct  431  LDISNNKISGFIPSSLGDLEHLLKLNLSKNHLSGVIPAEFGNLRSIMDIDLSNNHLSGPI  490

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + L  L L  NNL G
Sbjct  491  PQELGQLQNLYSLKLENNNLSG  512


 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N L G IP  +  L   E L L  N+L GPIP  L  +  L  L+L  N+L+G+I
Sbjct  287  LDLSCNLLTGPIPPILGNLTYTEKLYLHGNKLTGPIPPELGNMTKLHYLELNDNQLTGKI  346

Query  182  P  184
            P
Sbjct  347  P  347



>emb|CDP13474.1| unnamed protein product [Coffea canephora]
Length=992

 Score =   153 bits (387),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD SFNELYGDIPFSISKLKQLE LILKNN+L+GPIPSTLSQIPNLK+LDLAQN LSGEI
Sbjct  130  LDFSFNELYGDIPFSISKLKQLERLILKNNQLIGPIPSTLSQIPNLKILDLAQNSLSGEI  189

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN LVG
Sbjct  190  PRLIYWNEVLQYLGLRGNKLVG  211


 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 53/82 (65%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G+IPF+I  L Q+ TL L++N+L G IPS +  +  L VLDL+ N LSG I
Sbjct  250  LDLSYNQLTGEIPFNIGFL-QVATLSLQDNKLSGQIPSVIGLMQALAVLDLSCNNLSGPI  308

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L L GN L G
Sbjct  309  PPILGNLTYTEKLYLHGNKLTG  330


 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL +L  L + NN L GPIP  LS   NL  L++  NKL+G I
Sbjct  345  LELNDNRLSGRIPPELGKLTELFDLNVANNNLEGPIPENLSSCTNLNSLNVHDNKLNGTI  404

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR     E + YL L  NN+ G
Sbjct  405  PRAFQRLESMTYLNLSSNNIRG  426


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP +  +L+ +  L L +N + GPIP  LS+I NL  LDL+ N++SG I
Sbjct  393  LNVHDNKLNGTIPRAFQRLESMTYLNLSSNNIRGPIPIELSRIGNLDTLDLSNNQISGSI  452

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I   E L  L L  N L G
Sbjct  453  PSPIGDLEHLLKLNLSNNALTG  474


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N++ G IP  I  L+ L  L L NN L G IP+    + ++  +DL+ N LSG I
Sbjct  441  LDLSNNQISGSIPSPIGDLEHLLKLNLSNNALTGIIPAEFGNLRSIMEIDLSNNHLSGAI  500

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + +  L +  NNL G
Sbjct  501  PQELGQLQNIFLLKVVNNNLSG  522


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N + G IP  +S++  L+TL L NN++ G IPS +  + +L  L+L+ N L+G I
Sbjct  417  LNLSSNNIRGPIPIELSRIGNLDTLDLSNNQISGSIPSPIGDLEHLLKLNLSNNALTGII  476

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +  + L  N+L G
Sbjct  477  PAEFGNLRSIMEIDLSNNHLSG  498



>gb|KFK32516.1| hypothetical protein AALP_AA6G252800 [Arabis alpina]
Length=981

 Score =   153 bits (387),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 76/82 (93%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNEL GDIPFSISKLKQLE LILKNN+L+GPIPSTLSQIPNLK+LDLAQN LSGEI
Sbjct  125  LDLSFNELSGDIPFSISKLKQLEQLILKNNQLIGPIPSTLSQIPNLKILDLAQNNLSGEI  184

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNLVG
Sbjct  185  PRLIYWNEVLQYLGLRGNNLVG  206


 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  + KL  L  L + NNEL GPIP  LS   NL +L++  NK +G I
Sbjct  340  LELSDNRLTGHIPPELGKLTDLFDLSVANNELEGPIPDNLSSCTNLNILNVHGNKFNGTI  399

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+     E + YL L  N + G
Sbjct  400  PQAFQKLESMTYLNLSNNYIRG  421


 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+  G IP +  KL+ +  L L NN + GPIP  LS+I NL  LDL+ NK++G I
Sbjct  388  LNVHGNKFNGTIPQAFQKLESMTYLNLSNNYIRGPIPIELSRIGNLDTLDLSNNKINGII  447

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  + L  N++ G
Sbjct  448  PSSLGDLEHLLKMNLSRNHITG  469


 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 49/106 (46%), Gaps = 25/106 (24%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLA--------  157
            LDLS N L G+IPF I  L Q+ TL L+ N+L G IPS +  +  L VLDL+        
Sbjct  245  LDLSHNNLTGEIPFDIGFL-QVATLSLQGNQLSGKIPSVIGLMQALAVLDLSWNLLSGPI  303

Query  158  ----------------QNKLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
                             NKL+G IP  +     L YL L  N L G
Sbjct  304  PPILGNLTFTEKMYLHSNKLTGSIPPELGNMSKLHYLELSDNRLTG  349


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G +   + +L  L    ++NN L G IP T+      +VLDL+ N L+GEI
Sbjct  197  LGLRGNNLVGSLSPDLCQLTGLWYFDVRNNSLTGSIPETIGNCTAFQVLDLSHNNLTGEI  256

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN L G
Sbjct  257  PFDIGFLQV-ATLSLQGNQLSG  277


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N + G IP  +S++  L+TL L NN++ G IPS+L  + +L  ++L++N ++G +
Sbjct  412  LNLSNNYIRGPIPIELSRIGNLDTLDLSNNKINGIIPSSLGDLEHLLKMNLSRNHITGRV  471

Query  182  P  184
            P
Sbjct  472  P  472



>ref|XP_006474503.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Citrus sinensis]
Length=981

 Score =   153 bits (386),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 76/82 (93%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNELYGDIPFSISKLKQLE LILKNN+L+GPIPSTLSQ+PNLKVLDLA NKLSGEI
Sbjct  121  LDLSFNELYGDIPFSISKLKQLEFLILKNNQLIGPIPSTLSQLPNLKVLDLALNKLSGEI  180

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQYLGLRGNNLVG
Sbjct  181  PRLLYWNEVLQYLGLRGNNLVG  202


 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP ++ KL  L  L + NN L GPIP  LS   NL  L++  NKL+G I
Sbjct  336  LELNDNQLTGHIPPALGKLTDLFDLNVANNHLEGPIPDNLSSCTNLNSLNVHGNKLNGTI  395

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E + YL L  NN+ G
Sbjct  396  PPAFQRLESMTYLNLSSNNIRG  417


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP +  +L+ +  L L +N + GPIP  LS+I NL  LD++ NK+SG I
Sbjct  384  LNVHGNKLNGTIPPAFQRLESMTYLNLSSNNIRGPIPVELSRIGNLDTLDMSNNKISGSI  443

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N L G
Sbjct  444  PSPLGDLEHLLKLNLSRNQLTG  465


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 52/106 (49%), Gaps = 25/106 (24%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLA--------  157
            LDLS+N+L G+IPF+I  L Q+ TL L+ N+L G IPS +  +  L VLDL+        
Sbjct  241  LDLSYNQLNGEIPFNIGFL-QIATLSLQGNQLTGKIPSVIGLMQALAVLDLSCNMLSGPI  299

Query  158  ----------------QNKLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
                             NKL+G IP  +     L YL L  N L G
Sbjct  300  PPILGNLSYTEKLYLHSNKLTGHIPPELGNMTKLHYLELNDNQLTG  345


 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N + G IP  +S++  L+TL + NN++ G IPS L  + +L  L+L++N+L+G I
Sbjct  408  LNLSSNNIRGPIPVELSRIGNLDTLDMSNNKISGSIPSPLGDLEHLLKLNLSRNQLTGFI  467

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +  + L  N+L G
Sbjct  468  PGEFGNLRSVMEIDLSHNHLTG  489


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N+L G IP     L+ +  + L +N L G IP  LSQ+ N+  L L  N LSG++
Sbjct  456  LNLSRNQLTGFIPGEFGNLRSVMEIDLSHNHLTGVIPEELSQLQNMFSLRLDYNNLSGDV  515

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
              LI     L  L L  NNLVG
Sbjct  516  MSLINCLS-LSVLNLSYNNLVG  536



>ref|XP_007161048.1| hypothetical protein PHAVU_001G038400g [Phaseolus vulgaris]
 gb|ESW33042.1| hypothetical protein PHAVU_001G038400g [Phaseolus vulgaris]
Length=744

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNE+ GDIPFSISKLKQLE LILKNN+L+GPIPSTLSQIPNLK+LDLAQN LSGEI
Sbjct  120  LDLSFNEIRGDIPFSISKLKQLENLILKNNQLIGPIPSTLSQIPNLKILDLAQNNLSGEI  179

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNL+G
Sbjct  180  PRLIYWNEVLQYLGLRGNNLIG  201


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL  L  L + NN L G IPS +S   NL  L++  NKLSG I
Sbjct  335  LELNDNHLSGHIPPELGKLTDLFDLNVANNNLEGTIPSNISSCKNLNSLNVHGNKLSGTI  394

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E +  L L  NNL G
Sbjct  395  PPALQSLESMTSLNLSSNNLQG  416


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+TL + NN LVG IPS+L  + +L  L+L++N L+G I
Sbjct  407  LNLSSNNLQGAIPIELSRIGNLDTLDISNNHLVGSIPSSLGDLEHLLKLNLSRNNLTGVI  466

Query  182  P  184
            P
Sbjct  467  P  467


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP ++  L+ + +L L +N L G IP  LS+I NL  LD++ N L G I
Sbjct  383  LNVHGNKLSGTIPPALQSLESMTSLNLSSNNLQGAIPIELSRIGNLDTLDISNNHLVGSI  442

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  NNL G
Sbjct  443  PSSLGDLEHLLKLNLSRNNLTG  464


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S N L G IP S+  L+ L  L L  N L G IP+    + ++  +DL+ N+LSG I
Sbjct  431  LDISNNHLVGSIPSSLGDLEHLLKLNLSRNNLTGVIPAEFGNLRSVMEIDLSNNQLSGLI  490

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + +  L L  N L G
Sbjct  491  PEELSQLQNMLSLRLENNKLTG  512



>ref|XP_009337156.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Pyrus x bretschneideri]
Length=992

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNE++GDIPFSISKLKQLE LILKNN+L+GP+PSTLSQIPNLK+LDLAQN LSGEI
Sbjct  130  LDLSFNEIFGDIPFSISKLKQLENLILKNNQLIGPLPSTLSQIPNLKILDLAQNNLSGEI  189

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNLVG
Sbjct  190  PRLIYWNEVLQYLGLRGNNLVG  211


 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL  L  L + NN L GPIP  LS   NL  L++  NKLSG I
Sbjct  345  LELNDNHLTGHIPPELGKLTDLYDLNVANNYLQGPIPDNLSSCTNLNSLNVHGNKLSGTI  404

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E + YL L  N L G
Sbjct  405  PTALQRLESMTYLNLSSNYLRG  426


 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP ++ +L+ +  L L +N L GPIP  LS I NL  LD++ NKLSG I
Sbjct  393  LNVHGNKLSGTIPTALQRLESMTYLNLSSNYLRGPIPIELSSIGNLDTLDISNNKLSGTI  452

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N+L G
Sbjct  453  PSSLGDLEHLLKLNLSRNHLTG  474


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 52/106 (49%), Gaps = 25/106 (24%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLA--------  157
            LDLS+N+L G IPF+I  L Q+ TL L+ N+L GPIP  +  +  L VLDL+        
Sbjct  250  LDLSYNQLTGGIPFNIGFL-QVATLSLQGNQLSGPIPPVIGLMQALAVLDLSCNALSGPI  308

Query  158  ----------------QNKLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
                             NKL+G IP  +     L YL L  N+L G
Sbjct  309  PPILGNLTYTEKLYLHANKLNGSIPPELGQMTKLHYLELNDNHLTG  354


 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S +  L+TL + NN+L G IPS+L  + +L  L+L++N L+G I
Sbjct  417  LNLSSNYLRGPIPIELSSIGNLDTLDISNNKLSGTIPSSLGDLEHLLKLNLSRNHLTGFI  476

Query  182  P  184
            P
Sbjct  477  P  477


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP     L+ +  + L NN+L G IP  LSQ+ N+ +L L  N +SG++
Sbjct  465  LNLSRNHLTGFIPGEFGNLRSVMEIDLSNNQLTGLIPQELSQLQNMNLLRLEHNNISGDV  524

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
              LI     L  L +  NNL G
Sbjct  525  VSLINCFS-LSVLNVSYNNLAG  545


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S N+L G IP S+  L+ L  L L  N L G IP     + ++  +DL+ N+L+G I
Sbjct  441  LDISNNKLSGTIPSSLGDLEHLLKLNLSRNHLTGFIPGEFGNLRSVMEIDLSNNQLTGLI  500

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + +  L L  NN+ G
Sbjct  501  PQELSQLQNMNLLRLEHNNISG  522



>ref|XP_008393446.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Malus domestica]
Length=992

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNE++GDIPFSISKLKQLE LILKNN+L+GP+PSTLSQIPNLK+LDLAQN LSGEI
Sbjct  130  LDLSFNEIFGDIPFSISKLKQLENLILKNNQLIGPLPSTLSQIPNLKILDLAQNNLSGEI  189

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNLVG
Sbjct  190  PRLIYWNEVLQYLGLRGNNLVG  211


 Score = 61.6 bits (148),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G IPF+I  L Q+ TL L+ N+L GPIPS +  +  L VLDL+ N LSG I
Sbjct  250  LDLSYNQLTGGIPFNIGFL-QVATLSLQGNQLSGPIPSVIGLMQALAVLDLSSNALSGPI  308

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L L  N L G
Sbjct  309  PPILGNLTYTEKLYLHANKLNG  330


 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL  L  L + NN L GPIP  LS   NL  L++  NKLSG I
Sbjct  345  LELNDNHLTGHIPPELGKLTDLYDLNVANNYLQGPIPDNLSSCTNLNSLNVHGNKLSGTI  404

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E + YL L  N L G
Sbjct  405  PPALQRLESMTYLNLSSNYLRG  426


 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP ++ +L+ +  L L +N L GPIP  LS I NL  LD++ NK+SG I
Sbjct  393  LNVHGNKLSGTIPPALQRLESMTYLNLSSNYLRGPIPIELSFIGNLDTLDISNNKISGTI  452

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N+L G
Sbjct  453  PSSLGDLEHLLKLNLSRNHLTG  474


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP     L+ +  + L NN+L G IP  LSQ+ N+ +L L  N +SG++
Sbjct  465  LNLSRNHLTGFIPGEFGNLRSVMEIDLSNNQLTGLIPRELSQLQNMNLLRLEHNNISGDV  524

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
              LI     L  L +  NNL G
Sbjct  525  VSLINCFS-LSVLNVSYNNLAG  545


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S N++ G IP S+  L+ L  L L  N L G IP     + ++  +DL+ N+L+G I
Sbjct  441  LDISNNKISGTIPSSLGDLEHLLKLNLSRNHLTGFIPGEFGNLRSVMEIDLSNNQLTGLI  500

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR +   + +  L L  NN+ G
Sbjct  501  PRELSQLQNMNLLRLEHNNISG  522


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S +  L+TL + NN++ G IPS+L  + +L  L+L++N L+G I
Sbjct  417  LNLSSNYLRGPIPIELSFIGNLDTLDISNNKISGTIPSSLGDLEHLLKLNLSRNHLTGFI  476

Query  182  P  184
            P
Sbjct  477  P  477


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  I  ++ L  L L +N L GPIP  L  +   + L L  NKL+G I
Sbjct  273  LSLQGNQLSGPIPSVIGLMQALAVLDLSSNALSGPIPPILGNLTYTEKLYLHANKLNGSI  332

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N+L G
Sbjct  333  PPELGQMSKLHYLELNDNHLTG  354



>ref|XP_007161049.1| hypothetical protein PHAVU_001G038400g [Phaseolus vulgaris]
 gb|ESW33043.1| hypothetical protein PHAVU_001G038400g [Phaseolus vulgaris]
Length=958

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNE+ GDIPFSISKLKQLE LILKNN+L+GPIPSTLSQIPNLK+LDLAQN LSGEI
Sbjct  120  LDLSFNEIRGDIPFSISKLKQLENLILKNNQLIGPIPSTLSQIPNLKILDLAQNNLSGEI  179

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNL+G
Sbjct  180  PRLIYWNEVLQYLGLRGNNLIG  201


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL  L  L + NN L G IPS +S   NL  L++  NKLSG I
Sbjct  335  LELNDNHLSGHIPPELGKLTDLFDLNVANNNLEGTIPSNISSCKNLNSLNVHGNKLSGTI  394

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E +  L L  NNL G
Sbjct  395  PPALQSLESMTSLNLSSNNLQG  416


 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+TL + NN LVG IPS+L  + +L  L+L++N L+G I
Sbjct  407  LNLSSNNLQGAIPIELSRIGNLDTLDISNNHLVGSIPSSLGDLEHLLKLNLSRNNLTGVI  466

Query  182  P  184
            P
Sbjct  467  P  467


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP ++  L+ + +L L +N L G IP  LS+I NL  LD++ N L G I
Sbjct  383  LNVHGNKLSGTIPPALQSLESMTSLNLSSNNLQGAIPIELSRIGNLDTLDISNNHLVGSI  442

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  NNL G
Sbjct  443  PSSLGDLEHLLKLNLSRNNLTG  464


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S N L G IP S+  L+ L  L L  N L G IP+    + ++  +DL+ N+LSG I
Sbjct  431  LDISNNHLVGSIPSSLGDLEHLLKLNLSRNNLTGVIPAEFGNLRSVMEIDLSNNQLSGLI  490

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + +  L L  N L G
Sbjct  491  PEELSQLQNMLSLRLENNKLTG  512



>ref|XP_004303459.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Fragaria vesca subsp. vesca]
Length=983

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNE++GDIPFSISKLKQLE+++LKNN+L+GP+PSTLSQIPNLK LDLAQN LSGEI
Sbjct  121  LDLSFNEIHGDIPFSISKLKQLESIVLKNNQLIGPLPSTLSQIPNLKTLDLAQNNLSGEI  180

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNLVG
Sbjct  181  PRLIYWNEVLQYLGLRGNNLVG  202


 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G+IPF+I  L Q+ TL L+ N+L GPIPS +  +  L VLDL+ N LSG I
Sbjct  241  LDLSYNQLTGEIPFNIGFL-QVATLSLQGNQLSGPIPSVIGLMQALAVLDLSGNMLSGPI  299

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L L  N L G
Sbjct  300  PPILGNLTYTEKLYLHANKLTG  321


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 44/80 (55%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    LSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPR  187
            L+ N L G IP  + KL  L  L + +N L GPIP  LS   NL  L++  NKL+G IP 
Sbjct  338  LNDNHLTGQIPPELGKLTNLFDLNVADNNLQGPIPDNLSSCTNLNTLNVHGNKLNGTIPP  397

Query  188  LIYWNEVLQYLGLRGNNLVG  247
             +   E L YL L  N+L G
Sbjct  398  ALQRLESLTYLNLSSNSLHG  417


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L+G IP  +S++  L+TL L +N+  G IPS+L  + +L  L+L++N ++G I
Sbjct  408  LNLSSNSLHGSIPIELSRIGNLDTLDLSDNKFSGAIPSSLGDLEHLLKLNLSRNHMTGFI  467

Query  182  P  184
            P
Sbjct  468  P  468


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N + G IP     L+ +  + L NN+L G IP  LSQ+ NL  L L  N +SGE+
Sbjct  456  LNLSRNHMTGFIPAEFGNLRSVVDIDLSNNQLTGMIPQELSQLQNLFALRLEHNNISGEM  515

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
              LI     L  L +  NNL G
Sbjct  516  VSLINCLS-LAVLNVSYNNLAG  536


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  I  ++ L  L L  N L GPIP  L  +   + L L  NKL+G I
Sbjct  264  LSLQGNQLSGPIPSVIGLMQALAVLDLSGNMLSGPIPPILGNLTYTEKLYLHANKLTGSI  323

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L YL L  N+L G
Sbjct  324  PPELGQMEQLHYLVLNDNHLTG  345


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+  G IP S+  L+ L  L L  N + G IP+    + ++  +DL+ N+L+G I
Sbjct  432  LDLSDNKFSGAIPSSLGDLEHLLKLNLSRNHMTGFIPAEFGNLRSVVDIDLSNNQLTGMI  491

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + L  L L  NN+ G
Sbjct  492  PQELSQLQNLFALRLEHNNISG  513



>ref|XP_006452987.1| hypothetical protein CICLE_v100073971mg, partial [Citrus clementina]
 gb|ESR66227.1| hypothetical protein CICLE_v100073971mg, partial [Citrus clementina]
Length=503

 Score =   149 bits (375),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NELYGDIPFSISKLKQLE LILKNN+L+GPIPSTLSQ+PNLKVLDLA NKLSGEI
Sbjct  121  LDLSINELYGDIPFSISKLKQLEFLILKNNQLIGPIPSTLSQLPNLKVLDLALNKLSGEI  180

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQYLGLRGNNLVG
Sbjct  181  PRLLYWNEVLQYLGLRGNNLVG  202


 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP ++ KL  L  L + NN L GPIP  LS   NL  L++  NKL+G I
Sbjct  336  LELNDNQLTGHIPPALGKLTDLFDLNVANNHLEGPIPDNLSSCTNLNSLNVHGNKLNGTI  395

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E + YL L  NN+ G
Sbjct  396  PPAFQRLESMTYLNLSLNNIRG  417


 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP +  +L+ +  L L  N + GPIP  LS+I NL  LD++ NK+SG I
Sbjct  384  LNVHGNKLNGTIPPAFQRLESMTYLNLSLNNIRGPIPVELSRIGNLDTLDMSNNKISGSI  443

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N L G
Sbjct  444  PSPLGDLEHLLKLNLSRNQLTG  465


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 52/106 (49%), Gaps = 25/106 (24%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLA--------  157
            LDLS+N+L G+IPF+I  L Q+ TL L+ N+L G IPS +  +  L VLDL+        
Sbjct  241  LDLSYNQLSGEIPFNIGFL-QIATLSLQGNQLTGKIPSVIGLMQALAVLDLSCNMLSGPI  299

Query  158  ----------------QNKLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
                             NKL+G IP  +     L YL L  N L G
Sbjct  300  PPILGNLSYTEKLYLHSNKLTGHIPPELGNMTKLHYLELNDNQLTG  345


 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N + G IP  +S++  L+TL + NN++ G IPS L  + +L  L+L++N+L+G I
Sbjct  408  LNLSLNNIRGPIPVELSRIGNLDTLDMSNNKISGSIPSPLGDLEHLLKLNLSRNQLTGFI  467

Query  182  P  184
            P
Sbjct  468  P  468


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G +   + +L  L    ++NN L G IP  +    + +VLDL+ N+LSGEI
Sbjct  193  LGLRGNNLVGTLSPDMCQLSGLWYFDVRNNSLTGSIPQNIGNCTSFQVLDLSYNQLSGEI  252

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + ++   L L+GN L G
Sbjct  253  PFNIGFLQI-ATLSLQGNQLTG  273



>ref|XP_010669304.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Beta vulgaris subsp. vulgaris]
Length=992

 Score =   151 bits (382),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNELYGDIPFSISKLKQLE LILKNN+L GPIPSTLSQIPNLK+LDLAQN L+G+I
Sbjct  132  LDLSFNELYGDIPFSISKLKQLEALILKNNQLTGPIPSTLSQIPNLKILDLAQNSLTGDI  191

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNL G
Sbjct  192  PRLIYWNEVLQYLGLRGNNLGG  213


 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL  L  L + NN L GPIP  LS   NL  +++  NKL+G I
Sbjct  347  LELNDNHLTGHIPPELGKLTDLFDLNIANNNLEGPIPGNLSSCANLNSINVHGNKLNGTI  406

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E + YL L  N L G
Sbjct  407  PAAFESLESMTYLNLSANQLRG  428


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N+L G IP  IS++  L+TL L +N + G IPS L  + +L  L+L++N + G I
Sbjct  419  LNLSANQLRGSIPLEISRMGNLDTLDLSDNHISGSIPSPLGDLEHLLKLNLSRNHIGGLI  478

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +  + L  N LVG
Sbjct  479  PTEFGNLRSIVEIDLSSNQLVG  500


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 53/106 (50%), Gaps = 25/106 (24%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLA--------  157
            LDLS+N+L G+IPF+I  L Q+ TL L+ N+L G IPS +  +  L VLDL+        
Sbjct  252  LDLSYNQLTGEIPFNIGFL-QVATLSLQGNQLSGEIPSVIGLMQALAVLDLSFNQLTGTI  310

Query  158  ----------------QNKLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
                             NKL+G IP  +     L YL L  N+L G
Sbjct  311  PPILGNLSYTEKLYLHGNKLTGSIPPELGNMTKLHYLELNDNHLTG  356


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN+L G IP  +  L   E L L  N+L G IP  L  +  L  L+L  N L+G I
Sbjct  299  LDLSFNQLTGTIPPILGNLSYTEKLYLHGNKLTGSIPPELGNMTKLHYLELNDNHLTGHI  358

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L +  NNL G
Sbjct  359  PPELGKLTDLFDLNIANNNLEG  380


 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 43/77 (56%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N+L G IP +   L+ +  L L  N+L G IP  +S++ NL  LDL+ N +SG IP  + 
Sbjct  400  NKLNGTIPAAFESLESMTYLNLSANQLRGSIPLEISRMGNLDTLDLSDNHISGSIPSPLG  459

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N++ G
Sbjct  460  DLEHLLKLNLSRNHIGG  476



>ref|XP_009362801.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Pyrus x bretschneideri]
Length=992

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLSFNE++GDIPFSISKLKQLE LILKNN+L+GP+PSTLSQIPNLK+LDLAQN L+GEI
Sbjct  130  IDLSFNEIFGDIPFSISKLKQLENLILKNNQLIGPLPSTLSQIPNLKILDLAQNNLTGEI  189

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNLVG
Sbjct  190  PRLIYWNEVLQYLGLRGNNLVG  211


 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 53/82 (65%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G+IPF+I  L Q+ TL L+ N+L GPIPS +  +  L VLDL+ N LSG I
Sbjct  250  LDLSYNQLTGEIPFNIGFL-QVATLSLQGNQLSGPIPSVIGLMQALAVLDLSSNALSGSI  308

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L L GN L G
Sbjct  309  PPILGNLTYTEKLYLHGNKLNG  330


 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP ++ +L+ +  L L +N L GPIP  LS+I NL  LD++ NKLSG I
Sbjct  393  LNVHGNKLNGTIPPALQRLESMTYLNLSSNYLRGPIPIELSRIGNLDTLDISNNKLSGTI  452

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N+L G
Sbjct  453  PSSLGDLEHLLKLNLSRNHLTG  474


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL  L  L + NN L GPIP  LS   NL  L++  NKL+G I
Sbjct  345  LELNDNHLTGYIPPELGKLTDLYDLNVANNYLQGPIPDNLSSCTNLNSLNVHGNKLNGTI  404

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E + YL L  N L G
Sbjct  405  PPALQRLESMTYLNLSSNYLRG  426


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+TL + NN+L G IPS+L  + +L  L+L++N L+G I
Sbjct  417  LNLSSNYLRGPIPIELSRIGNLDTLDISNNKLSGTIPSSLGDLEHLLKLNLSRNHLTGFI  476

Query  182  P  184
            P
Sbjct  477  P  477


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S N+L G IP S+  L+ L  L L  N L G IP     + ++  +DL+ N+L+G I
Sbjct  441  LDISNNKLSGTIPSSLGDLEHLLKLNLSRNHLTGFIPGEFGNLRSVMEIDLSSNQLTGLI  500

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + +  L L  NN+ G
Sbjct  501  PQELSQLQNMNLLRLDHNNISG  522


 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP     L+ +  + L +N+L G IP  LSQ+ N+ +L L  N +SG++
Sbjct  465  LNLSRNHLTGFIPGEFGNLRSVMEIDLSSNQLTGLIPQELSQLQNMNLLRLDHNNISGDV  524

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
              LI     L  L +  NNL G
Sbjct  525  VSLINCFS-LSVLNVSYNNLAG  545



>ref|XP_008393579.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Malus domestica]
Length=991

 Score =   151 bits (381),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLSFNE++GDIPFSISKLKQLE LILKNN+L+GP+PSTLSQIPNLK+LDLAQN L+GEI
Sbjct  129  IDLSFNEIFGDIPFSISKLKQLENLILKNNQLIGPLPSTLSQIPNLKILDLAQNNLTGEI  188

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNLVG
Sbjct  189  PRLIYWNEVLQYLGLRGNNLVG  210


 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 53/82 (65%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G+IPF+I  L Q+ TL L+ N+L GPIPS +  +  L VLDL+ N LSG I
Sbjct  249  LDLSYNQLTGEIPFNIGFL-QVATLSLQGNQLSGPIPSVIGLMQALAVLDLSSNALSGSI  307

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L L GN L G
Sbjct  308  PPILGNLTYTEKLYLHGNKLNG  329


 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP ++ +L+ +  L L +N L GPIP  LS+I NL  LD++ NKLSG I
Sbjct  392  LNVHGNKLNGTIPPALQRLESMTYLNLSSNHLRGPIPIELSRIGNLDTLDISNNKLSGTI  451

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N+L G
Sbjct  452  PSSLGDLEHLLKLNLSRNHLTG  473


 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL  L  L + NN L GPIP  LS   NL  L++  NKL+G I
Sbjct  344  LELNDNHLTGYIPPELGKLTDLYDLNVANNYLQGPIPDNLSSCTNLNSLNVHGNKLNGTI  403

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E + YL L  N+L G
Sbjct  404  PPALQRLESMTYLNLSSNHLRG  425


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+TL + NN+L G IPS+L  + +L  L+L++N L+G I
Sbjct  416  LNLSSNHLRGPIPIELSRIGNLDTLDISNNKLSGTIPSSLGDLEHLLKLNLSRNHLTGFI  475

Query  182  P  184
            P
Sbjct  476  P  476


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S N+L G IP S+  L+ L  L L  N L G IP     + ++  +DL+ N+L+G I
Sbjct  440  LDISNNKLSGTIPSSLGDLEHLLKLNLSRNHLTGFIPGEFGNLRSVMEIDLSSNQLTGLI  499

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + +  L L  NN+ G
Sbjct  500  PQELSQLQNMNLLRLDHNNISG  521


 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP     L+ +  + L +N+L G IP  LSQ+ N+ +L L  N +SG++
Sbjct  464  LNLSRNHLTGFIPGEFGNLRSVMEIDLSSNQLTGLIPQELSQLQNMNLLRLDHNNISGDV  523

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
              LI     L  L +  NNL G
Sbjct  524  VSLINCFS-LSVLNVSYNNLAG  544



>gb|KHN37058.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Glycine 
soja]
Length=980

 Score =   150 bits (380),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNE+ GDIPFSISKLKQLE LILKNN+L+GPIPSTLSQIP+LK+LDLAQN LSGEI
Sbjct  120  LDLSFNEIRGDIPFSISKLKQLENLILKNNQLIGPIPSTLSQIPDLKILDLAQNNLSGEI  179

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNLVG
Sbjct  180  PRLIYWNEVLQYLGLRGNNLVG  201


 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G+IPF+I  L Q+ TL L+ N+L G IP  +  +  L VLDL+ N LSG I
Sbjct  240  LDLSYNQLTGEIPFNIGFL-QVATLSLQGNKLSGHIPPVIGLMQALAVLDLSCNLLSGSI  298

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L L GN L G
Sbjct  299  PPILGNLTYTEKLYLHGNKLTG  320


 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL  L  L + NN L GPIPS LS   NL  L++  NKL+G I
Sbjct  335  LELNDNHLSGHIPPELGKLTDLFDLNVANNNLEGPIPSNLSSCKNLNSLNVHGNKLNGSI  394

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E +  L L  NNL G
Sbjct  395  PPSLQSLESMTSLNLSSNNLQG  416


 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+TL + NN LVG IPS+L  + +L  L+L++N L+G I
Sbjct  407  LNLSSNNLQGAIPIELSRIGNLDTLDISNNNLVGSIPSSLGDLEHLLKLNLSRNNLTGII  466

Query  182  P  184
            P
Sbjct  467  P  467


 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP S+  L+ + +L L +N L G IP  LS+I NL  LD++ N L G I
Sbjct  383  LNVHGNKLNGSIPPSLQSLESMTSLNLSSNNLQGAIPIELSRIGNLDTLDISNNNLVGSI  442

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  NNL G
Sbjct  443  PSSLGDLEHLLKLNLSRNNLTG  464



>ref|XP_010917192.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Elaeis guineensis]
Length=986

 Score =   150 bits (380),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN +YGDIPFSISKLK LE LILKNN+L+GPIPSTLSQIPNLK LDLAQNKLSGEI
Sbjct  125  LDLSFNNIYGDIPFSISKLKHLENLILKNNQLIGPIPSTLSQIPNLKTLDLAQNKLSGEI  184

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNL G
Sbjct  185  PRLIYWNEVLQYLGLRGNNLEG  206


 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N L G+IPF+I  L Q+ TL L+ N+  GPIPS +  +  L VLDL+ N+L+G I
Sbjct  245  LDLSYNRLTGEIPFNIGFL-QVATLSLQGNKFTGPIPSVIGLMQALAVLDLSNNRLTGPI  303

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L L+GN L+G
Sbjct  304  PPILGNLTYTEKLYLQGNKLMG  325


 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  +  L  L  L + NN L GPIP  LS   NL   +   NKL+G I
Sbjct  340  LELNDNNLTGRIPPELGNLTDLFDLNIANNNLEGPIPENLSSCVNLNSFNAHGNKLNGTI  399

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+     E + YL L  NNL G
Sbjct  400  PQAFRSLESMTYLNLSSNNLTG  421


 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N+L G IP +   L+ +  L L +N L GPIP  LS+I NL  LD++ NK+SG IP  + 
Sbjct  393  NKLNGTIPQAFRSLESMTYLNLSSNNLTGPIPIELSRIGNLDTLDISCNKISGSIPPSMG  452

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N+L G
Sbjct  453  SLEHLLKLNLSNNHLNG  469


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N L G IP  +  L   E L L+ N+L+GPIP  L  +  L  L+L  N L+G I
Sbjct  292  LDLSNNRLTGPIPPILGNLTYTEKLYLQGNKLMGPIPPELGNMTRLHYLELNDNNLTGRI  351

Query  182  P  184
            P
Sbjct  352  P  352


 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 36/61 (59%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S N++ G IP S+  L+ L  L L NN L G IP+    + ++  +DL+ N  SG I
Sbjct  436  LDISCNKISGSIPPSMGSLEHLLKLNLSNNHLNGSIPAEFGNLRSIMEIDLSNNHHSGSI  495

Query  182  P  184
            P
Sbjct  496  P  496



>ref|XP_009408412.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Musa acuminata subsp. malaccensis]
Length=980

 Score =   150 bits (380),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 73/82 (89%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N +YGDIPFS+SKLKQLE LILKNN+L+GPIPSTLSQIPNLK+LDLAQNKLSGEI
Sbjct  121  LDLSYNSIYGDIPFSVSKLKQLENLILKNNQLIGPIPSTLSQIPNLKILDLAQNKLSGEI  180

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNL G
Sbjct  181  PRLIYWNEVLQYLGLRGNNLEG  202


 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G+IPF+I  L Q+ TL L+ N+  GPIP  +  +  L VLDL+ N LSG I
Sbjct  241  LDLSYNQLTGEIPFNIGFL-QVATLSLQGNKFSGPIPPVIGLMQALAVLDLSCNLLSGPI  299

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L L+GN L G
Sbjct  300  PPILGNLTYTEKLYLQGNKLTG  321


 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S NE+ G IP S+  L+ L  L L NN+LVG IP+    + ++  +DL+ N LSG I
Sbjct  432  LDISCNEINGPIPSSVGGLEHLLKLNLSNNKLVGNIPAEFGNLRSIMEIDLSSNDLSGPI  491

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + L  L L  NNL G
Sbjct  492  PQELGLLQNLITLKLESNNLSG  513


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N+L G IP +  KL+ +  L L +N L G IP  LS+I NL  LD++ N+++G IP  + 
Sbjct  389  NKLNGTIPLAFKKLESMTYLNLSSNRLKGSIPIELSRISNLDTLDISCNEINGPIPSSVG  448

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N LVG
Sbjct  449  GLEHLLKLNLSNNKLVG  465


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+TL +  NE+ GPIPS++  + +L  L+L+ NKL G I
Sbjct  408  LNLSSNRLKGSIPIELSRISNLDTLDISCNEINGPIPSSVGGLEHLLKLNLSNNKLVGNI  467

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +  + L  N+L G
Sbjct  468  PAEFGNLRSIMEIDLSSNDLSG  489


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP  + KL  L  L + NN   GPIP  LS   NL   +   NKL+G I
Sbjct  336  LELNDNQLSGLIPPELGKLTDLFDLNIANNNFEGPIPENLSSCVNLNSFNAHGNKLNGTI  395

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E + YL L  N L G
Sbjct  396  PLAFKKLESMTYLNLSSNRLKG  417



>ref|XP_004498861.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X3 [Cicer arietinum]
Length=959

 Score =   150 bits (379),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNE+ GDIPFSISKLKQLE L LKNN+L+GPIPSTLSQIPNLK+LDLAQN LSGEI
Sbjct  96   LDLSFNEIRGDIPFSISKLKQLENLALKNNQLIGPIPSTLSQIPNLKILDLAQNNLSGEI  155

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNLVG
Sbjct  156  PRLIYWNEVLQYLGLRGNNLVG  177


 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G IPF+I  L Q+ TL L+ N+L G IPS +  +  L VLDL+ N L+G I
Sbjct  216  LDLSYNQLTGVIPFNIGFL-QIATLSLQGNKLSGQIPSVIGLMQALAVLDLSCNMLTGPI  274

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L L GN L G
Sbjct  275  PPILGNLTYTEKLYLHGNKLTG  296


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL +L  L + NN L GPIP  +S   NL  L++  NKL+G I
Sbjct  311  LELNDNHLSGRIPPELGKLTELFDLNVANNNLEGPIPGNISSCTNLNSLNVHGNKLNGTI  370

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E +  L L  NNL G
Sbjct  371  PPTLQSLESMTSLNLSSNNLQG  392


 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+TL + NN+L+G IPS+L  + +L  L+L++N L+G I
Sbjct  383  LNLSSNNLQGVIPIELSRIGNLDTLDISNNKLIGSIPSSLGDLEHLLKLNLSRNNLTGPI  442

Query  182  P  184
            P
Sbjct  443  P  443


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP ++  L+ + +L L +N L G IP  LS+I NL  LD++ NKL G I
Sbjct  359  LNVHGNKLNGTIPPTLQSLESMTSLNLSSNNLQGVIPIELSRIGNLDTLDISNNKLIGSI  418

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  NNL G
Sbjct  419  PSSLGDLEHLLKLNLSRNNLTG  440


 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S N+L G IP S+  L+ L  L L  N L GPIP+    + ++  +DL+ NKLS  I
Sbjct  407  LDISNNKLIGSIPSSLGDLEHLLKLNLSRNNLTGPIPAEFGNLKSVMEIDLSHNKLSDLI  466

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + +  L L  N L G
Sbjct  467  PVELGQLQNIASLRLENNELTG  488



>ref|XP_004498860.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X2 [Cicer arietinum]
Length=980

 Score =   150 bits (379),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNE+ GDIPFSISKLKQLE L LKNN+L+GPIPSTLSQIPNLK+LDLAQN LSGEI
Sbjct  121  LDLSFNEIRGDIPFSISKLKQLENLALKNNQLIGPIPSTLSQIPNLKILDLAQNNLSGEI  180

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNLVG
Sbjct  181  PRLIYWNEVLQYLGLRGNNLVG  202


 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G IPF+I  L Q+ TL L+ N+L G IPS +  +  L VLDL+ N L+G I
Sbjct  241  LDLSYNQLTGVIPFNIGFL-QIATLSLQGNKLSGQIPSVIGLMQALAVLDLSCNMLTGPI  299

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L L GN L G
Sbjct  300  PPILGNLTYTEKLYLHGNKLTG  321


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL +L  L + NN L GPIP  +S   NL  L++  NKL+G I
Sbjct  336  LELNDNHLSGRIPPELGKLTELFDLNVANNNLEGPIPGNISSCTNLNSLNVHGNKLNGTI  395

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E +  L L  NNL G
Sbjct  396  PPTLQSLESMTSLNLSSNNLQG  417


 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+TL + NN+L+G IPS+L  + +L  L+L++N L+G I
Sbjct  408  LNLSSNNLQGVIPIELSRIGNLDTLDISNNKLIGSIPSSLGDLEHLLKLNLSRNNLTGPI  467

Query  182  P  184
            P
Sbjct  468  P  468


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP ++  L+ + +L L +N L G IP  LS+I NL  LD++ NKL G I
Sbjct  384  LNVHGNKLNGTIPPTLQSLESMTSLNLSSNNLQGVIPIELSRIGNLDTLDISNNKLIGSI  443

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  NNL G
Sbjct  444  PSSLGDLEHLLKLNLSRNNLTG  465


 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S N+L G IP S+  L+ L  L L  N L GPIP+    + ++  +DL+ NKLS  I
Sbjct  432  LDISNNKLIGSIPSSLGDLEHLLKLNLSRNNLTGPIPAEFGNLKSVMEIDLSHNKLSDLI  491

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + +  L L  N L G
Sbjct  492  PVELGQLQNIASLRLENNELTG  513



>ref|XP_004498859.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X1 [Cicer arietinum]
Length=984

 Score =   150 bits (379),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNE+ GDIPFSISKLKQLE L LKNN+L+GPIPSTLSQIPNLK+LDLAQN LSGEI
Sbjct  121  LDLSFNEIRGDIPFSISKLKQLENLALKNNQLIGPIPSTLSQIPNLKILDLAQNNLSGEI  180

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNLVG
Sbjct  181  PRLIYWNEVLQYLGLRGNNLVG  202


 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G IPF+I  L Q+ TL L+ N+L G IPS +  +  L VLDL+ N L+G I
Sbjct  241  LDLSYNQLTGVIPFNIGFL-QIATLSLQGNKLSGQIPSVIGLMQALAVLDLSCNMLTGPI  299

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L L GN L G
Sbjct  300  PPILGNLTYTEKLYLHGNKLTG  321


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL +L  L + NN L GPIP  +S   NL  L++  NKL+G I
Sbjct  336  LELNDNHLSGRIPPELGKLTELFDLNVANNNLEGPIPGNISSCTNLNSLNVHGNKLNGTI  395

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E +  L L  NNL G
Sbjct  396  PPTLQSLESMTSLNLSSNNLQG  417


 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+TL + NN+L+G IPS+L  + +L  L+L++N L+G I
Sbjct  408  LNLSSNNLQGVIPIELSRIGNLDTLDISNNKLIGSIPSSLGDLEHLLKLNLSRNNLTGPI  467

Query  182  P  184
            P
Sbjct  468  P  468


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP ++  L+ + +L L +N L G IP  LS+I NL  LD++ NKL G I
Sbjct  384  LNVHGNKLNGTIPPTLQSLESMTSLNLSSNNLQGVIPIELSRIGNLDTLDISNNKLIGSI  443

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  NNL G
Sbjct  444  PSSLGDLEHLLKLNLSRNNLTG  465


 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S N+L G IP S+  L+ L  L L  N L GPIP+    + ++  +DL+ NKLS  I
Sbjct  432  LDISNNKLIGSIPSSLGDLEHLLKLNLSRNNLTGPIPAEFGNLKSVMEIDLSHNKLSDLI  491

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + +  L L  N L G
Sbjct  492  PVELGQLQNIASLRLENNELTG  513



>ref|XP_006581305.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Glycine max]
 gb|KHN32167.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Glycine 
soja]
Length=984

 Score =   150 bits (379),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLSFNE+ GDIPFS+SK+KQLE LILKNN+L+GPIPSTLSQ+PNLK+LDLAQN LSGEI
Sbjct  121  IDLSFNEIRGDIPFSVSKMKQLENLILKNNQLIGPIPSTLSQVPNLKILDLAQNNLSGEI  180

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNLVG
Sbjct  181  PRLIYWNEVLQYLGLRGNNLVG  202


 Score = 61.6 bits (148),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G+IPF+I  L Q+ TL L+ N+L G IPS +  +  L VLDL+ N LSG I
Sbjct  241  LDLSYNKLTGEIPFNIGYL-QVATLSLQGNKLSGHIPSVIGLMQALTVLDLSCNMLSGPI  299

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L L GN L G
Sbjct  300  PPILGNLTYTEKLYLHGNKLTG  321


 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL  L  L + NN L GP+P  LS   NL  L++  NKLSG +
Sbjct  336  LELNDNHLSGHIPPELGKLTDLFDLNVANNNLEGPVPDNLSLCKNLNSLNVHGNKLSGTV  395

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P   +  E + YL L  N L G
Sbjct  396  PSAFHSLESMTYLNLSSNKLQG  417


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N+L G IP  +S++  L+TL + NN ++G IPS++  + +L  L+L++N L+G I
Sbjct  408  LNLSSNKLQGSIPVELSRIGNLDTLDISNNNIIGSIPSSIGDLEHLLKLNLSRNHLTGFI  467

Query  182  P  184
            P
Sbjct  468  P  468


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP     L+ +  + L NN+L G IP  LSQ+ N+  L L +NKLSG++
Sbjct  456  LNLSRNHLTGFIPAEFGNLRSVMDIDLSNNQLSGLIPEELSQLQNIISLRLEKNKLSGDV  515

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
              L      L  L +  NNLVG
Sbjct  516  SSLANCFS-LSLLNVSYNNLVG  536



>ref|XP_006408746.1| hypothetical protein EUTSA_v10001898mg [Eutrema salsugineum]
 gb|ESQ50199.1| hypothetical protein EUTSA_v10001898mg [Eutrema salsugineum]
Length=977

 Score =   150 bits (379),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 76/82 (93%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNEL GDIPFSISKLKQLE LILKNN+L+GPIPSTLSQIPNLK LDLAQNKLSGEI
Sbjct  121  LDLSFNELSGDIPFSISKLKQLEQLILKNNQLIGPIPSTLSQIPNLKNLDLAQNKLSGEI  180

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNL G
Sbjct  181  PRLIYWNEVLQYLGLRGNNLEG  202


 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL  L  L + NN+L G IP  LS   NL  L++  NK +G I
Sbjct  336  LELNDNRLTGHIPPELGKLTDLFDLNVANNDLEGHIPDHLSSCTNLNSLNVHGNKFNGTI  395

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR     E + YL L  NN+ G
Sbjct  396  PRAFQKLESMTYLNLSNNNIRG  417


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+  G IP +  KL+ +  L L NN + GPIP  LS+I NL  LDL+ NK++G I
Sbjct  384  LNVHGNKFNGTIPRAFQKLESMTYLNLSNNNIRGPIPVELSRIGNLDTLDLSNNKINGII  443

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  + L  N++ G
Sbjct  444  PSSLGDLEHLLKMNLSRNHITG  465


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 51/106 (48%), Gaps = 25/106 (24%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLA--------  157
            LDLS+N+L G+IPF I  L Q+ TL L+ N+L G IPS +  +  L VLDL+        
Sbjct  241  LDLSYNQLSGEIPFDIGFL-QVATLSLQGNQLSGKIPSVIGLMQALAVLDLSGNLLSGPI  299

Query  158  ----------------QNKLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
                             NKL+G IP  +     L YL L  N L G
Sbjct  300  PPILGNLTFTEKLYLHSNKLTGSIPPELGNMSKLHYLELNDNRLTG  345


 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N++ G IP S+  L+ L  + L  N + G +P+    + N+  +DL+ N+LSG I
Sbjct  432  LDLSNNKINGIIPSSLGDLEHLLKMNLSRNHITGVVPADFGNLRNVMEIDLSNNELSGPI  491

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + +  L L  NNL G
Sbjct  492  PEELNQLQTMFLLRLEHNNLTG  513


 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G+I   + +L  L    ++NN L G IP T+      +VLDL+ N+LSGEI
Sbjct  193  LGLRGNNLEGNISPDLCQLTGLWYFDVRNNSLTGSIPETIGNCTAFQVLDLSYNQLSGEI  252

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN L G
Sbjct  253  PFDIGFLQV-ATLSLQGNQLSG  273


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N + G IP  +S++  L+TL L NN++ G IPS+L  + +L  ++L++N ++G +
Sbjct  408  LNLSNNNIRGPIPVELSRIGNLDTLDLSNNKINGIIPSSLGDLEHLLKMNLSRNHITGVV  467

Query  182  P  184
            P
Sbjct  468  P  468


 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            ++LS N + G +P     L+ +  + L NNEL GPIP  L+Q+  + +L L  N L+G +
Sbjct  456  MNLSRNHITGVVPADFGNLRNVMEIDLSNNELSGPIPEELNQLQTMFLLRLEHNNLTGNV  515

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
              L      L  L +  NNLVG
Sbjct  516  GSLTNCLS-LTVLNVSYNNLVG  536



>ref|XP_006578096.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X2 [Glycine max]
Length=992

 Score =   150 bits (379),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLSFNE+ GDIPFS+SK+KQLE LILKNN+L+GPIPSTLSQ+PNLK+LDLAQN LSGEI
Sbjct  121  IDLSFNEIRGDIPFSVSKMKQLENLILKNNQLIGPIPSTLSQVPNLKILDLAQNNLSGEI  180

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNLVG
Sbjct  181  PRLIYWNEVLQYLGLRGNNLVG  202


 Score = 62.0 bits (149),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL  L  L + NN L GP+P  LS   NL  L++  NKLSG +
Sbjct  336  LELNDNHLSGHIPPELGKLTDLFDLNVANNNLEGPVPDNLSSCKNLNSLNVHGNKLSGTV  395

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P   +  E + YL L  NNL G
Sbjct  396  PSAFHSLESMTYLNLSSNNLQG  417


 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G+IPF+I  L Q+ TL L+ N+ +G IPS +  +  L VLDL+ N LSG I
Sbjct  241  LDLSYNKLTGEIPFNIGYL-QVATLSLQGNKFLGHIPSVIGLMQALTVLDLSCNMLSGPI  299

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L L GN L G
Sbjct  300  PPILGNLTYTEKLYLHGNKLTG  321


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+TL + NN ++G IPS++  + +L  L+L++N L+G I
Sbjct  408  LNLSSNNLQGSIPIELSRIGNLDTLDISNNNIIGSIPSSIGDLEHLLKLNLSRNHLTGFI  467

Query  182  P  184
            P
Sbjct  468  P  468


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP     L+ +  + L NN+L G IP  LSQ+ N+  L L +NKLSG++
Sbjct  456  LNLSRNHLTGFIPAEFGNLRSVMDIDLSNNQLSGLIPEELSQLQNIISLRLEKNKLSGDV  515

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
              L+     L  L +  NNLVG
Sbjct  516  SSLLNCFS-LSLLNVSYNNLVG  536



>ref|XP_003522304.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X1 [Glycine max]
 gb|KHN29675.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Glycine 
soja]
Length=985

 Score =   150 bits (379),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLSFNE+ GDIPFS+SK+KQLE LILKNN+L+GPIPSTLSQ+PNLK+LDLAQN LSGEI
Sbjct  121  IDLSFNEIRGDIPFSVSKMKQLENLILKNNQLIGPIPSTLSQVPNLKILDLAQNNLSGEI  180

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNLVG
Sbjct  181  PRLIYWNEVLQYLGLRGNNLVG  202


 Score = 62.0 bits (149),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL  L  L + NN L GP+P  LS   NL  L++  NKLSG +
Sbjct  336  LELNDNHLSGHIPPELGKLTDLFDLNVANNNLEGPVPDNLSSCKNLNSLNVHGNKLSGTV  395

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P   +  E + YL L  NNL G
Sbjct  396  PSAFHSLESMTYLNLSSNNLQG  417


 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G+IPF+I  L Q+ TL L+ N+ +G IPS +  +  L VLDL+ N LSG I
Sbjct  241  LDLSYNKLTGEIPFNIGYL-QVATLSLQGNKFLGHIPSVIGLMQALTVLDLSCNMLSGPI  299

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L L GN L G
Sbjct  300  PPILGNLTYTEKLYLHGNKLTG  321


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+TL + NN ++G IPS++  + +L  L+L++N L+G I
Sbjct  408  LNLSSNNLQGSIPIELSRIGNLDTLDISNNNIIGSIPSSIGDLEHLLKLNLSRNHLTGFI  467

Query  182  P  184
            P
Sbjct  468  P  468


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP     L+ +  + L NN+L G IP  LSQ+ N+  L L +NKLSG++
Sbjct  456  LNLSRNHLTGFIPAEFGNLRSVMDIDLSNNQLSGLIPEELSQLQNIISLRLEKNKLSGDV  515

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
              L+     L  L +  NNLVG
Sbjct  516  SSLLNCFS-LSLLNVSYNNLVG  536



>ref|XP_003544548.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Glycine max]
 gb|KHN17259.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Glycine 
soja]
Length=980

 Score =   150 bits (379),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 73/82 (89%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNE+ GDIPFSISKLKQ+E LILKNN+L+GPIPSTLSQIP+LK+LDLAQN LSGEI
Sbjct  120  LDLSFNEIRGDIPFSISKLKQMENLILKNNQLIGPIPSTLSQIPDLKILDLAQNNLSGEI  179

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNLVG
Sbjct  180  PRLIYWNEVLQYLGLRGNNLVG  201


 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G+IPF+I  L Q+ TL L+ N+L G IPS +  +  L VLDL+ N LSG I
Sbjct  240  LDLSYNQLTGEIPFNIGFL-QVATLSLQGNKLSGHIPSVIGLMQALAVLDLSCNMLSGPI  298

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L L GN L G
Sbjct  299  PPILGNLTYTEKLYLHGNKLTG  320


 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL  L  L + NN L GPIPS LS   NL  L++  NKL+G I
Sbjct  335  LELNDNHLSGHIPPELGKLTDLFDLNVANNNLKGPIPSNLSSCKNLNSLNVHGNKLNGSI  394

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E +  L L  NNL G
Sbjct  395  PPSLQSLESMTSLNLSSNNLQG  416


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP S+  L+ + +L L +N L G IP  LS+I NL  LD++ NKL G I
Sbjct  383  LNVHGNKLNGSIPPSLQSLESMTSLNLSSNNLQGAIPIELSRIGNLDTLDISNNKLVGSI  442

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  NNL G
Sbjct  443  PSSLGDLEHLLKLNLSRNNLTG  464


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+TL + NN+LVG IPS+L  + +L  L+L++N L+G I
Sbjct  407  LNLSSNNLQGAIPIELSRIGNLDTLDISNNKLVGSIPSSLGDLEHLLKLNLSRNNLTGVI  466

Query  182  P  184
            P
Sbjct  467  P  467


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S N+L G IP S+  L+ L  L L  N L G IP+    + ++  +DL+ N+LSG I
Sbjct  431  LDISNNKLVGSIPSSLGDLEHLLKLNLSRNNLTGVIPAEFGNLRSVMEIDLSDNQLSGFI  490

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + +  L L  N L G
Sbjct  491  PEELSQLQNMISLRLENNKLTG  512



>ref|XP_010098375.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Morus 
notabilis]
 gb|EXB74899.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Morus 
notabilis]
Length=1011

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNE+ GDIPFSISKLK+LE L+LKNN L+GPIPSTLSQIPNLKVLDLAQN LSGEI
Sbjct  113  LDLSFNEICGDIPFSISKLKELEFLVLKNNRLIGPIPSTLSQIPNLKVLDLAQNNLSGEI  172

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNLVG
Sbjct  173  PRLIYWNEVLQYLGLRGNNLVG  194


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 34/61 (56%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N L G IP S+  L   E L L  N+L GPIP  L  +  L  L+L  N LSG I
Sbjct  280  LDLSCNMLSGPIPPSLGNLTYTEKLYLHGNKLTGPIPPELGNMSKLHYLELNDNHLSGRI  339

Query  182  P  184
            P
Sbjct  340  P  340



>ref|XP_010526027.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Tarenaya hassleriana]
Length=982

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNEL GDIPFSISKLKQLE L LKNN+L+GPIPSTLSQIPNLK LDLAQNKLSGEI
Sbjct  129  LDLSFNELSGDIPFSISKLKQLEALYLKNNQLIGPIPSTLSQIPNLKNLDLAQNKLSGEI  188

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQ+LGLRGNNLVG
Sbjct  189  PRLIYWNEVLQFLGLRGNNLVG  210


 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + +L  L  L L NN+L GPIP  LS   NL  L++  NKL+G I
Sbjct  344  LELNDNHLSGRIPPELGQLTDLFDLNLANNDLEGPIPDNLSSCTNLISLNVHGNKLNGTI  403

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR     E + YL L  NN+ G
Sbjct  404  PRGFQKLESMTYLNLSNNNIRG  425


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP    KL+ +  L L NN + GPIP  LS I NL  LDL+ NK+SG I
Sbjct  392  LNVHGNKLNGTIPRGFQKLESMTYLNLSNNNIRGPIPVDLSHIGNLDKLDLSNNKISGII  451

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  + L  N++ G
Sbjct  452  PSSLGDLEHLLKMNLSRNHITG  473


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 51/106 (48%), Gaps = 25/106 (24%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQN------  163
            LDLS+N+L G+IPF+I  L Q+ TL L+ N+L G IP     +  L VLDL+ N      
Sbjct  249  LDLSYNQLTGEIPFNIGFL-QVATLSLQGNQLSGKIPYVFGLMQALAVLDLSSNLLSGPI  307

Query  164  ------------------KLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
                              KL+G IP  +     L YL L  N+L G
Sbjct  308  PPILGNLTYTEKLYLHSNKLTGSIPPELGNMTKLHYLELNDNHLSG  353


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G +   + +L  L    +KNN L G IP  +    + +VLDL+ N+L+GEI
Sbjct  201  LGLRGNNLVGSLSPDMCQLTGLWFFDVKNNSLTGSIPDNIGNCTSFQVLDLSYNQLTGEI  260

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN L G
Sbjct  261  PFNIGFLQV-ATLSLQGNQLSG  281


 Score = 47.0 bits (110),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N++ G IP S+  L+ L  + L  N + G +P     + ++  +DL+ N LSG I
Sbjct  440  LDLSNNKISGIIPSSLGDLEHLLKMNLSRNHITGVVPPEFGNLRSIMEIDLSNNDLSGTI  499

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + +  L L  NNL G
Sbjct  500  PEELSQLQNMFLLRLEHNNLTG  521



>ref|XP_008786642.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X3 [Phoenix dactylifera]
Length=960

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/82 (89%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN +YGDIPFSISKLK+LE+LILK+N+L+GPIPSTLSQIPNLK LDLAQNKLSGEI
Sbjct  147  LDLSFNNIYGDIPFSISKLKRLESLILKSNQLIGPIPSTLSQIPNLKTLDLAQNKLSGEI  206

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNL G
Sbjct  207  PRLIYWNEVLQYLGLRGNNLEG  228


 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G+IPF+I  L Q+ TL L+ N+  G IPS +  +  L VLDL+ N L+G I
Sbjct  267  LDLSYNQLTGEIPFNIGFL-QVATLSLQGNKFTGFIPSVIGLMQALAVLDLSNNLLTGPI  325

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L L+GN L G
Sbjct  326  PPILGNLTYTEKLYLQGNKLTG  347


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  +  L  L  L + NN L GPIP  LS   NL   +   N L+G I
Sbjct  362  LELNDNNLTGHIPPELGNLTDLFDLNIANNNLQGPIPENLSSCANLISFNAPGNNLNGTI  421

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+     E + YL L  NNL G
Sbjct  422  PQAFRNLESMTYLNLSSNNLTG  443


 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 44/77 (57%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N L G IP +   L+ +  L L +N L GPIP  LS+I NL  LD++ NK+SG IP  I 
Sbjct  415  NNLNGTIPQAFRNLESMTYLNLSSNNLTGPIPIELSRIGNLDTLDISCNKISGPIPPSIG  474

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N+L G
Sbjct  475  NLEHLLKLNLSNNHLNG  491


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N L G IP  +  L   E L L+ N+L GPIP  L  +  L+ L+L  N L+G I
Sbjct  314  LDLSNNLLTGPIPPILGNLTYTEKLYLQGNKLTGPIPPELGNMTRLRYLELNDNNLTGHI  373

Query  182  P  184
            P
Sbjct  374  P  374



>ref|XP_008786640.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X2 [Phoenix dactylifera]
Length=985

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/82 (89%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN +YGDIPFSISKLK+LE+LILK+N+L+GPIPSTLSQIPNLK LDLAQNKLSGEI
Sbjct  125  LDLSFNNIYGDIPFSISKLKRLESLILKSNQLIGPIPSTLSQIPNLKTLDLAQNKLSGEI  184

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNL G
Sbjct  185  PRLIYWNEVLQYLGLRGNNLEG  206


 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G+IPF+I  L Q+ TL L+ N+  G IPS +  +  L VLDL+ N L+G I
Sbjct  245  LDLSYNQLTGEIPFNIGFL-QVATLSLQGNKFTGFIPSVIGLMQALAVLDLSNNLLTGPI  303

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L L+GN L G
Sbjct  304  PPILGNLTYTEKLYLQGNKLTG  325


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  +  L  L  L + NN L GPIP  LS   NL   +   N L+G I
Sbjct  340  LELNDNNLTGHIPPELGNLTDLFDLNIANNNLQGPIPENLSSCANLISFNAPGNNLNGTI  399

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+     E + YL L  NNL G
Sbjct  400  PQAFRNLESMTYLNLSSNNLTG  421


 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 44/77 (57%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N L G IP +   L+ +  L L +N L GPIP  LS+I NL  LD++ NK+SG IP  I 
Sbjct  393  NNLNGTIPQAFRNLESMTYLNLSSNNLTGPIPIELSRIGNLDTLDISCNKISGPIPPSIG  452

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N+L G
Sbjct  453  NLEHLLKLNLSNNHLNG  469


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N L G IP  +  L   E L L+ N+L GPIP  L  +  L+ L+L  N L+G I
Sbjct  292  LDLSNNLLTGPIPPILGNLTYTEKLYLQGNKLTGPIPPELGNMTRLRYLELNDNNLTGHI  351

Query  182  P  184
            P
Sbjct  352  P  352



>ref|XP_008786639.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X1 [Phoenix dactylifera]
Length=1007

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/82 (89%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN +YGDIPFSISKLK+LE+LILK+N+L+GPIPSTLSQIPNLK LDLAQNKLSGEI
Sbjct  147  LDLSFNNIYGDIPFSISKLKRLESLILKSNQLIGPIPSTLSQIPNLKTLDLAQNKLSGEI  206

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNL G
Sbjct  207  PRLIYWNEVLQYLGLRGNNLEG  228


 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G+IPF+I  L Q+ TL L+ N+  G IPS +  +  L VLDL+ N L+G I
Sbjct  267  LDLSYNQLTGEIPFNIGFL-QVATLSLQGNKFTGFIPSVIGLMQALAVLDLSNNLLTGPI  325

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L L+GN L G
Sbjct  326  PPILGNLTYTEKLYLQGNKLTG  347


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  +  L  L  L + NN L GPIP  LS   NL   +   N L+G I
Sbjct  362  LELNDNNLTGHIPPELGNLTDLFDLNIANNNLQGPIPENLSSCANLISFNAPGNNLNGTI  421

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+     E + YL L  NNL G
Sbjct  422  PQAFRNLESMTYLNLSSNNLTG  443


 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 44/77 (57%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N L G IP +   L+ +  L L +N L GPIP  LS+I NL  LD++ NK+SG IP  I 
Sbjct  415  NNLNGTIPQAFRNLESMTYLNLSSNNLTGPIPIELSRIGNLDTLDISCNKISGPIPPSIG  474

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N+L G
Sbjct  475  NLEHLLKLNLSNNHLNG  491


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N L G IP  +  L   E L L+ N+L GPIP  L  +  L+ L+L  N L+G I
Sbjct  314  LDLSNNLLTGPIPPILGNLTYTEKLYLQGNKLTGPIPPELGNMTRLRYLELNDNNLTGHI  373

Query  182  P  184
            P
Sbjct  374  P  374



>ref|XP_006849687.1| hypothetical protein AMTR_s00024p00237440 [Amborella trichopoda]
 gb|ERN11268.1| hypothetical protein AMTR_s00024p00237440 [Amborella trichopoda]
Length=995

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN++YGDIPFSISKLKQLE LILKNN+L+GPIPSTLSQ+PNLK+LDLAQN LSGEI
Sbjct  131  LDLSFNDIYGDIPFSISKLKQLEYLILKNNQLMGPIPSTLSQLPNLKILDLAQNNLSGEI  190

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQ+LGLRGNN VG
Sbjct  191  PRLIYWNEVLQFLGLRGNNFVG  212


 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP  + KL +L  L L NN L GPIP  LS   NL  L++  N+L+G I
Sbjct  346  LELNDNQLTGQIPSELGKLTELFDLNLANNYLEGPIPENLSSCVNLNSLNVHNNRLNGTI  405

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E + YL L  NNL G
Sbjct  406  PPAFERLESMTYLNLSMNNLKG  427


 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N L G IP +  +L+ +  L L  N L G IP  LS+I NL  LD++ NK+SG I
Sbjct  394  LNVHNNRLNGTIPPAFERLESMTYLNLSMNNLKGVIPIELSRISNLDTLDISSNKISGSI  453

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I   E L  L L  N LVG
Sbjct  454  PSSIGDLEHLLKLNLSRNRLVG  475


 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 52/106 (49%), Gaps = 25/106 (24%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQN------  163
            LDLS+N+L G+IPF+I  L Q+ TL L+ N+L G IPS +  +  L VLDL+ N      
Sbjct  251  LDLSYNQLTGEIPFNIGFL-QVATLSLQGNQLSGKIPSVIGLMQALAVLDLSCNLLSGPI  309

Query  164  ------------------KLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
                              KL+G IP  +     L YL L  N L G
Sbjct  310  PPILGNLTYTEKLYLHGNKLTGPIPPELGNMTKLHYLELNDNQLTG  355


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+TL + +N++ G IPS++  + +L  L+L++N+L G I
Sbjct  418  LNLSMNNLKGVIPIELSRISNLDTLDISSNKISGSIPSSIGDLEHLLKLNLSRNRLVGFI  477

Query  182  P  184
            P
Sbjct  478  P  478


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N L G IP  +  L   E L L  N+L GPIP  L  +  L  L+L  N+L+G+I
Sbjct  298  LDLSCNLLSGPIPPILGNLTYTEKLYLHGNKLTGPIPPELGNMTKLHYLELNDNQLTGQI  357

Query  182  P  184
            P
Sbjct  358  P  358



>ref|XP_007136889.1| hypothetical protein PHAVU_009G082500g [Phaseolus vulgaris]
 gb|ESW08883.1| hypothetical protein PHAVU_009G082500g [Phaseolus vulgaris]
Length=958

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLSFNE+ GDIPFSISK+KQLE LILKNN+L+GPIPSTLSQ+PNLK+LDLAQN LSGEI
Sbjct  117  VDLSFNEIRGDIPFSISKMKQLENLILKNNQLIGPIPSTLSQVPNLKILDLAQNNLSGEI  176

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNL+G
Sbjct  177  PRLIYWNEVLQYLGLRGNNLMG  198


 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL  L  L + NN L GPIPS LS   NL  L++  NKLSG I
Sbjct  332  LELNDNHLSGHIPPELGKLTDLFDLNVANNNLEGPIPSNLSSCKNLNSLNVHGNKLSGTI  391

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E + YL L  NNL G
Sbjct  392  PSSLQSLESMTYLNLSSNNLQG  413


 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G+IPF+I  L Q+ TL L+ N+L G IPS +  +  L VLDL+ N LSG I
Sbjct  237  LDLSYNKLSGEIPFNIGFL-QVATLSLQGNKLSGHIPSVIGLMQALAVLDLSCNLLSGPI  295

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L L GN L G
Sbjct  296  PHILGNLTYTEKLYLHGNKLTG  317


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP     L+ +  + L NN+L G IP  LSQ+ N+  L L +NKLSG++
Sbjct  452  LNLSRNHLTGFIPAEFGNLRSVMDIDLSNNQLSGLIPEELSQLQNMIYLRLEKNKLSGDV  511

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
              L+     L  + +  NNLVG
Sbjct  512  SSLVNCLS-LSLINVSYNNLVG  532


 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+TL +  N +VG IPS++  + +L  L+L++N L+G I
Sbjct  404  LNLSSNNLQGSIPIELSRIGNLDTLDISKNNIVGSIPSSIGDLEHLLKLNLSRNHLTGFI  463

Query  182  P  184
            P
Sbjct  464  P  464


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S N + G IP SI  L+ L  L L  N L G IP+    + ++  +DL+ N+LSG I
Sbjct  428  LDISKNNIVGSIPSSIGDLEHLLKLNLSRNHLTGFIPAEFGNLRSVMDIDLSNNQLSGLI  487

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + + YL L  N L G
Sbjct  488  PEELSQLQNMIYLRLEKNKLSG  509


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G +   I +L  L    ++NN L G IP  +      +VLDL+ NKLSGEI
Sbjct  189  LGLRGNNLMGSLSPDICQLTGLWYFDVRNNSLTGSIPENIGNCTAFQVLDLSYNKLSGEI  248

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN L G
Sbjct  249  PFNIGFLQVAT-LSLQGNKLSG  269



>ref|XP_010047401.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Eucalyptus grandis]
 gb|KCW79310.1| hypothetical protein EUGRSUZ_C00732 [Eucalyptus grandis]
Length=988

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNEL GDIPFSISKLKQLE L LKNN+L+GPIPSTLSQIPNLK LDLAQN LSGEI
Sbjct  120  LDLSFNELDGDIPFSISKLKQLELLALKNNQLIGPIPSTLSQIPNLKTLDLAQNNLSGEI  179

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQYLGLRGNNLVG
Sbjct  180  PRLLYWNEVLQYLGLRGNNLVG  201


 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L  N+L G IP S+ +L+++  L + +N L+G IP  LS+I  L  LDL+ NKLSG I
Sbjct  383  LNLHGNKLNGTIPPSLQRLEKISKLNISSNNLMGSIPIELSRIGYLDTLDLSNNKLSGSI  442

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E LQ L L  N+L G
Sbjct  443  PFSLGDLEHLQKLNLSRNHLTG  464


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+L G IPFS+  L+ L+ L L  N L G IP+    +  +  +DL+ N LSG I
Sbjct  431  LDLSNNKLSGSIPFSLGDLEHLQKLNLSRNHLTGFIPAEFGNLRIIMDIDLSNNHLSGLI  490

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + +  L L  NNL G
Sbjct  491  PEELSQLQSIFSLRLDHNNLSG  512


 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL +L  L + NN L G IP  +S   NL  L+L  NKL+G I
Sbjct  335  LELNDNHLTGSIPPELGKLTELYDLNVANNNLEGQIPDNISSCTNLNSLNLHGNKLNGTI  394

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E +  L +  NNL+G
Sbjct  395  PPSLQRLEKISKLNISSNNLMG  416


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 53/106 (50%), Gaps = 25/106 (24%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQN------  163
            LDLS+N+L G IPF+I  L Q+ TL L+ N+L G IPS +  +  L VLDL+ N      
Sbjct  240  LDLSYNQLTGKIPFNIGFL-QVATLSLQGNQLSGQIPSVIGLMQALAVLDLSCNMLTGPI  298

Query  164  ------------------KLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
                              KL+G+IP  +     L YL L  N+L G
Sbjct  299  PPILGNLTYTEKLYLNGNKLTGQIPPELGNMSKLHYLELNDNHLTG  344


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 42/80 (53%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    LSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPR  187
            L+ N+L G IP  +  + +L  L L +N L G IP  L ++  L  L++A N L G+IP 
Sbjct  313  LNGNKLTGQIPPELGNMSKLHYLELNDNHLTGSIPPELGKLTELYDLNVANNNLEGQIPD  372

Query  188  LIYWNEVLQYLGLRGNNLVG  247
             I     L  L L GN L G
Sbjct  373  NISSCTNLNSLNLHGNKLNG  392



>ref|XP_006381995.1| hypothetical protein POPTR_0006s23680g [Populus trichocarpa]
 gb|ERP59792.1| hypothetical protein POPTR_0006s23680g [Populus trichocarpa]
Length=890

 Score =   148 bits (374),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/82 (89%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNE+ GDIPFSISKLKQLE L+LKNN+L+GPIP TLSQIPNLKVLDLAQN+LSGEI
Sbjct  120  LDLSFNEINGDIPFSISKLKQLELLVLKNNQLIGPIPLTLSQIPNLKVLDLAQNRLSGEI  179

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQYLGLRGNNLVG
Sbjct  180  PRLLYWNEVLQYLGLRGNNLVG  201


 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N L G IP ++ +L+ +  L L +N + GPIP  LS+I NL  LD++ NK+SG I
Sbjct  383  LNVHGNNLNGTIPRALRRLESMTNLNLSSNNIQGPIPIELSRISNLDTLDISNNKISGSI  442

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  + + E L  L L  N L G
Sbjct  443  PSSLGYLEHLLKLNLSRNQLTG  464


 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G+IP  + KL  L  L + NN L GPIP  LS   NL  L++  N L+G I
Sbjct  335  LELNDNQLIGNIPPELGKLTDLYDLNVANNHLEGPIPDNLSSCTNLNSLNVHGNNLNGTI  394

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR +   E +  L L  NN+ G
Sbjct  395  PRALRRLESMTNLNLSSNNIQG  416


 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N + G IP  +S++  L+TL + NN++ G IPS+L  + +L  L+L++N+L+G I
Sbjct  407  LNLSSNNIQGPIPIELSRISNLDTLDISNNKISGSIPSSLGYLEHLLKLNLSRNQLTGFI  466

Query  182  P  184
            P
Sbjct  467  P  467


 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 44/80 (55%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    LSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPR  187
            L  N+L G IP  +  + +L  L L +N+L+G IP  L ++ +L  L++A N L G IP 
Sbjct  313  LHGNQLTGSIPPELGNMTKLHYLELNDNQLIGNIPPELGKLTDLYDLNVANNHLEGPIPD  372

Query  188  LIYWNEVLQYLGLRGNNLVG  247
             +     L  L + GNNL G
Sbjct  373  NLSSCTNLNSLNVHGNNLNG  392


 Score = 46.6 bits (109),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 50/106 (47%), Gaps = 25/106 (24%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVG------------------------PI  109
            LDLSFN+L G+IPF+I  L Q+ TL L+ N+L G                        PI
Sbjct  240  LDLSFNQLTGEIPFNIGFL-QIATLSLQGNQLTGKIPPVIGLMQALAVLDLSCNMLSGPI  298

Query  110  PSTLSQIPNLKVLDLAQNKLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
            P  L  +   + L L  N+L+G IP  +     L YL L  N L+G
Sbjct  299  PPILGNLTYTEKLYLHGNQLTGSIPPELGNMTKLHYLELNDNQLIG  344



>gb|EMS58253.1| LRR receptor-like serine/threonine-protein kinase ERL2 [Triticum 
urartu]
Length=933

 Score =   148 bits (373),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN LYGDIPFSISKLKQLE LILKNN+L GPIPSTLSQIPNLK+LDLAQN+L+G+I
Sbjct  119  LDLSFNLLYGDIPFSISKLKQLEDLILKNNQLTGPIPSTLSQIPNLKILDLAQNQLTGDI  178

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  179  PRLIYWNEVLQYLGLRGNSLTG  200


 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S+N++ G+IP++I  L Q+ TL L+ N L G IP  +  +  L VL L  NKL+GE+
Sbjct  239  LDISYNKISGEIPYNIGFL-QVATLSLQGNRLTGKIPEVIGLMQALAVLYLHGNKLTGEV  297

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  298  PPELGNMTKLSYLQLNDNELVG  319


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+NE  G +P +I  L+ L  L L  N L G +P+    + +++V+DL+ N +SG +
Sbjct  406  LDLSYNEFSGPVPATIGDLEHLLQLNLSKNHLSGSVPAEFGNLRSIQVIDLSNNAMSGYL  465

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L  L L  N LVG
Sbjct  466  PEELGQLQNLDSLILNNNTLVG  487


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G IP  + KL++L  L L NN L GPIP+ +S    L   ++  N+L+G I
Sbjct  310  LQLNDNELVGTIPAELGKLEELFELNLANNNLEGPIPTNISSCTALNKFNVYGNRLNGSI  369

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L  L L  NN  G
Sbjct  370  PAGFQNLESLTNLNLSSNNFKG  391


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLS N + G +P  + +L+ L++LIL NN LVG IP+ L+   +L +L+L+ N  SG +
Sbjct  454  IDLSNNAMSGYLPEELGQLQNLDSLILNNNTLVGEIPAQLANCFSLNILNLSYNNFSGHV  513

Query  182  P  184
            P
Sbjct  514  P  514


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N   G IP  +  +  L+TL L  NE  GP+P+T+  + +L  L+L++N LSG +
Sbjct  382  LNLSSNNFKGHIPSELGHIINLDTLDLSYNEFSGPVPATIGDLEHLLQLNLSKNHLSGSV  441

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +Q + L  N + G
Sbjct  442  PAEFGNLRSIQVIDLSNNAMSG  463


 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 39/77 (51%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N L G IP     L+ L  L L +N   G IPS L  I NL  LDL+ N+ SG +P  I 
Sbjct  363  NRLNGSIPAGFQNLESLTNLNLSSNNFKGHIPSELGHIINLDTLDLSYNEFSGPVPATIG  422

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N+L G
Sbjct  423  DLEHLLQLNLSKNHLSG  439


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 43/80 (54%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    LSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPR  187
            L  N+L G++P  +  + +L  L L +NELVG IP+ L ++  L  L+LA N L G IP 
Sbjct  288  LHGNKLTGEVPPELGNMTKLSYLQLNDNELVGTIPAELGKLEELFELNLANNNLEGPIPT  347

Query  188  LIYWNEVLQYLGLRGNNLVG  247
             I     L    + GN L G
Sbjct  348  NISSCTALNKFNVYGNRLNG  367


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G +P     L+ ++ + L NN + G +P  L Q+ NL  L L  N L GEI
Sbjct  430  LNLSKNHLSGSVPAEFGNLRSIQVIDLSNNAMSGYLPEELGQLQNLDSLILNNNTLVGEI  489

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L L  NN  G
Sbjct  490  PAQLANCFSLNILNLSYNNFSG  511



>ref|XP_011019342.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Populus euphratica]
Length=980

 Score =   148 bits (373),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/82 (89%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNE+ GDIPFSISKLKQLE L+LKNN+L GPIP TLSQIPNLKVLDLAQN+LSGEI
Sbjct  120  LDLSFNEINGDIPFSISKLKQLELLVLKNNQLTGPIPLTLSQIPNLKVLDLAQNRLSGEI  179

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQYLGLRGNNLVG
Sbjct  180  PRLLYWNEVLQYLGLRGNNLVG  201


 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N L G IP ++ +L+ +  L L +N + GPIP  LS+I NL  LD++ NK+SG I
Sbjct  383  LNVHGNSLNGTIPRALRRLESMTNLNLSSNNIQGPIPIELSRISNLDTLDISNNKISGSI  442

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  + + E L  L L  N L G
Sbjct  443  PSSLGYLEHLLKLNLSRNQLTG  464


 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G+IP  + KL  L  L + +N L GPIP  LS   NL  L++  N L+G I
Sbjct  335  LELNDNQLTGNIPPELGKLTDLYDLNVASNHLEGPIPDNLSSCTNLNSLNVHGNSLNGTI  394

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR +   E +  L L  NN+ G
Sbjct  395  PRALRRLESMTNLNLSSNNIQG  416


 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N + G IP  +S++  L+TL + NN++ G IPS+L  + +L  L+L++N+L+G I
Sbjct  407  LNLSSNNIQGPIPIELSRISNLDTLDISNNKISGSIPSSLGYLEHLLKLNLSRNQLTGFI  466

Query  182  P  184
            P
Sbjct  467  P  467


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S N++ G IP S+  L+ L  L L  N+L G IP+    + ++  +DL+ N LSG I
Sbjct  431  LDISNNKISGSIPSSLGYLEHLLKLNLSRNQLTGFIPAEFGNLRSVMEIDLSDNHLSGLI  490

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + +  L L  NNL G
Sbjct  491  PQELSQIQNMFLLRLENNNLSG  512


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N+L G IP     L+ +  + L +N L G IP  LSQI N+ +L L  N LSG++
Sbjct  455  LNLSRNQLTGFIPAEFGNLRSVMEIDLSDNHLSGLIPQELSQIQNMFLLRLENNNLSGDV  514

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
              LI     L  L +  NNL G
Sbjct  515  MSLINCLS-LSVLNVSYNNLAG  535



>gb|AGL91674.1| erecta-like leucine-rich-repeat receptor-like kinase [Triticum 
aestivum]
Length=981

 Score =   147 bits (372),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN LYGDIPFSISKLKQLE LILKNN+L GPIPSTLSQIPNLK+LDLAQN+L+G+I
Sbjct  126  LDLSFNLLYGDIPFSISKLKQLEDLILKNNQLTGPIPSTLSQIPNLKILDLAQNQLTGDI  185

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  186  PRLIYWNEVLQYLGLRGNSLTG  207


 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S+N++ G+IP++I  L Q+ TL L+ N L G IP  +  +  L VL L  NKL+GE+
Sbjct  246  LDISYNKISGEIPYNIGFL-QVATLSLQGNRLTGKIPEVIGLMQALAVLYLHGNKLTGEV  304

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  305  PPELGNMTKLSYLQLNDNELVG  326


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+NE  G +P +I  L+ L  L L  N L G +P+    + +++V+DL+ N +SG +
Sbjct  413  LDLSYNEFSGPVPATIGDLEHLLQLNLSKNHLSGSVPAEFGNLRSIQVIDLSNNAISGYL  472

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L  L L  N LVG
Sbjct  473  PEELGQLQNLDSLILNNNTLVG  494


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G IP  + KL++L  L L NN L GPIP+ +S    L   ++  N+L+G I
Sbjct  317  LQLNDNELVGTIPAELGKLEELFELNLANNNLEGPIPTNISSCTALNKFNVYGNRLNGSI  376

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L  L L  NN  G
Sbjct  377  PAGFQNLESLTNLNLSSNNFKG  398


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLS N + G +P  + +L+ L++LIL NN LVG IP+ L+   +L +L+L+ N  SG +
Sbjct  461  IDLSNNAISGYLPEELGQLQNLDSLILNNNTLVGEIPAQLANCFSLNILNLSYNNFSGHV  520

Query  182  P  184
            P
Sbjct  521  P  521


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N   G IP  +  +  L+TL L  NE  GP+P+T+  + +L  L+L++N LSG +
Sbjct  389  LNLSSNNFKGHIPSELGHIINLDTLDLSYNEFSGPVPATIGDLEHLLQLNLSKNHLSGSV  448

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +Q + L  N + G
Sbjct  449  PAEFGNLRSIQVIDLSNNAISG  470


 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 39/77 (51%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N L G IP     L+ L  L L +N   G IPS L  I NL  LDL+ N+ SG +P  I 
Sbjct  370  NRLNGSIPAGFQNLESLTNLNLSSNNFKGHIPSELGHIINLDTLDLSYNEFSGPVPATIG  429

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N+L G
Sbjct  430  DLEHLLQLNLSKNHLSG  446


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G++P  +  + +L  L L +NELVG IP+ L ++  L  L+LA N L G I
Sbjct  293  LYLHGNKLTGEVPPELGNMTKLSYLQLNDNELVGTIPAELGKLEELFELNLANNNLEGPI  352

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GN L G
Sbjct  353  PTNISSCTALNKFNVYGNRLNG  374


 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G +P     L+ ++ + L NN + G +P  L Q+ NL  L L  N L GEI
Sbjct  437  LNLSKNHLSGSVPAEFGNLRSIQVIDLSNNAISGYLPEELGQLQNLDSLILNNNTLVGEI  496

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L L  NN  G
Sbjct  497  PAQLANCFSLNILNLSYNNFSG  518



>dbj|BAJ89970.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=982

 Score =   147 bits (372),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN LYGDIPFSISKLKQLE LILKNN+L GPIPSTLSQIPNLK+LDLAQN+L+G+I
Sbjct  126  LDLSFNLLYGDIPFSISKLKQLEDLILKNNQLTGPIPSTLSQIPNLKILDLAQNQLTGDI  185

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  186  PRLIYWNEVLQYLGLRGNSLTG  207


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+NE  G +P +I  L+ L  L L  N L G +P+    + +++V+DL+ N +SG +
Sbjct  437  LDLSYNEFSGPVPATIGDLEHLLQLNLSKNHLSGSVPAEFGNLRSIQVIDLSNNAMSGYL  496

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L  L L  N LVG
Sbjct  497  PEELGQLQNLDSLILNNNTLVG  518


 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G IP  + KL++L  L L NN+L GPIP+ +S    L   ++  N+L+G I
Sbjct  341  LQLNDNELVGTIPAELGKLEELFELNLANNKLEGPIPTNISSCTALNKFNVYGNRLNGSI  400

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L  L L  NN  G
Sbjct  401  PAGFQNLESLTNLNLSSNNFKG  422


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLS N + G +P  + +L+ L++LIL NN LVG IP+ L+   +L +L+L+ N  SG +
Sbjct  485  IDLSNNAMSGYLPEELGQLQNLDSLILNNNTLVGEIPAQLANCFSLNILNLSYNNFSGHV  544

Query  182  P  184
            P
Sbjct  545  P  545


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 44/80 (55%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    LSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPR  187
            L  N+L G++P  +  + +L  L L +NELVG IP+ L ++  L  L+LA NKL G IP 
Sbjct  319  LHGNKLTGEVPPELGNMTKLSYLQLNDNELVGTIPAELGKLEELFELNLANNKLEGPIPT  378

Query  188  LIYWNEVLQYLGLRGNNLVG  247
             I     L    + GN L G
Sbjct  379  NISSCTALNKFNVYGNRLNG  398


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N   G IP  +  +  L+TL L  NE  GP+P+T+  + +L  L+L++N LSG +
Sbjct  413  LNLSSNNFKGHIPSELGHIINLDTLDLSYNEFSGPVPATIGDLEHLLQLNLSKNHLSGSV  472

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +Q + L  N + G
Sbjct  473  PAEFGNLRSIQVIDLSNNAMSG  494


 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 39/77 (51%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N L G IP     L+ L  L L +N   G IPS L  I NL  LDL+ N+ SG +P  I 
Sbjct  394  NRLNGSIPAGFQNLESLTNLNLSSNNFKGHIPSELGHIINLDTLDLSYNEFSGPVPATIG  453

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N+L G
Sbjct  454  DLEHLLQLNLSKNHLSG  470


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NELVG IP  L  +     L L  NKL+GE+
Sbjct  269  LSLQGNRLTGKIPEVIGLMQALAVLDLSENELVGSIPPILGNLSYTGKLYLHGNKLTGEV  328

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  329  PPELGNMTKLSYLQLNDNELVG  350


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G +P     L+ ++ + L NN + G +P  L Q+ NL  L L  N L GEI
Sbjct  461  LNLSKNHLSGSVPAEFGNLRSIQVIDLSNNAMSGYLPEELGQLQNLDSLILNNNTLVGEI  520

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L L  NN  G
Sbjct  521  PAQLANCFSLNILNLSYNNFSG  542



>gb|EMT12712.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Aegilops 
tauschii]
Length=961

 Score =   147 bits (371),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN LYGDIPFSISKLKQLE LILKNN+L GPIPSTLSQIPNLK+LDLAQN+L+G+I
Sbjct  163  LDLSFNLLYGDIPFSISKLKQLEDLILKNNQLTGPIPSTLSQIPNLKILDLAQNQLTGDI  222

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  223  PRLIYWNEVLQYLGLRGNSLTG  244


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+NEL G +P +I  L+ L  L L  N L G +P+    + +++V+DL+ N +SG +
Sbjct  474  LDLSYNELSGPVPATIGDLEHLLQLNLSKNHLSGSVPAEFGNLRSIQVIDLSNNAMSGYL  533

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L  L L  N LVG
Sbjct  534  PEELGQLQNLDSLILNNNILVG  555


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G IP  + KL++L  L L NN L GPIP+ +S    L   ++  N+L+G I
Sbjct  378  LQLNDNELVGTIPAELGKLEELFELNLANNNLEGPIPTNISSCTALNKFNVYGNRLNGSI  437

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L  L L  NN  G
Sbjct  438  PAGFQNLESLTNLNLSSNNFKG  459


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N   G IP  +  +  L+TL L  NEL GP+P+T+  + +L  L+L++N LSG +
Sbjct  450  LNLSSNNFKGHIPSELGHIINLDTLDLSYNELSGPVPATIGDLEHLLQLNLSKNHLSGSV  509

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +Q + L  N + G
Sbjct  510  PAEFGNLRSIQVIDLSNNAMSG  531


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NELVGPIP  L  +     L L  NKL+GE+
Sbjct  306  LSLQGNRLTGKIPEVIGLMQALAVLDLSENELVGPIPPILGNLSYTGKLYLHGNKLTGEV  365

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  366  PPELGNMTKLSYLQLNDNELVG  387


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 40/77 (52%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N L G IP     L+ L  L L +N   G IPS L  I NL  LDL+ N+LSG +P  I 
Sbjct  431  NRLNGSIPAGFQNLESLTNLNLSSNNFKGHIPSELGHIINLDTLDLSYNELSGPVPATIG  490

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N+L G
Sbjct  491  DLEHLLQLNLSKNHLSG  507


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLS N + G +P  + +L+ L++LIL NN LVG IP+ L+   +L +L+L+ N  SG +
Sbjct  522  IDLSNNAMSGYLPEELGQLQNLDSLILNNNILVGEIPAQLANCFSLNILNLSYNNFSGHV  581

Query  182  P  184
            P
Sbjct  582  P  582


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 43/80 (54%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    LSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPR  187
            L  N+L G++P  +  + +L  L L +NELVG IP+ L ++  L  L+LA N L G IP 
Sbjct  356  LHGNKLTGEVPPELGNMTKLSYLQLNDNELVGTIPAELGKLEELFELNLANNNLEGPIPT  415

Query  188  LIYWNEVLQYLGLRGNNLVG  247
             I     L    + GN L G
Sbjct  416  NISSCTALNKFNVYGNRLNG  435


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G +P     L+ ++ + L NN + G +P  L Q+ NL  L L  N L GEI
Sbjct  498  LNLSKNHLSGSVPAEFGNLRSIQVIDLSNNAMSGYLPEELGQLQNLDSLILNNNILVGEI  557

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L L  NN  G
Sbjct  558  PAQLANCFSLNILNLSYNNFSG  579



>gb|AGL91675.1| erecta-like leucine-rich-repeat receptor-like kinase [Triticum 
aestivum]
Length=958

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLSFN LYGDIPFSISKLKQLE LILKNN+L GPIPSTLSQIPNLK+LDLAQN+L+G+I
Sbjct  100  VDLSFNLLYGDIPFSISKLKQLEDLILKNNQLTGPIPSTLSQIPNLKILDLAQNQLTGDI  159

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  160  PRLIYWNEVLQYLGLRGNSLTG  181


 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+NEL G +P +I  L+ L  L L  N L G +P+    + +++V+DL+ N +SG +
Sbjct  411  LDLSYNELSGPVPATIGDLEHLLQLNLSKNHLSGSVPAEFGNLRSIQVIDLSNNAMSGYL  470

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L  L L  N LVG
Sbjct  471  PEELGQLQNLDSLILNNNILVG  492


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G IP  + KL++L  L L NN L GPIP+ +S    L   ++  N+L+G I
Sbjct  315  LQLNDNELVGTIPAELGKLEELFELNLANNNLEGPIPTNISSCTALNKFNVYGNRLNGSI  374

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L  L L  NN  G
Sbjct  375  PAGFQNLESLTNLNLSSNNFKG  396


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N   G IP  +  +  L+TL L  NEL GP+P+T+  + +L  L+L++N LSG +
Sbjct  387  LNLSSNNFKGHIPSELGHIINLDTLDLSYNELSGPVPATIGDLEHLLQLNLSKNHLSGSV  446

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +Q + L  N + G
Sbjct  447  PAEFGNLRSIQVIDLSNNAMSG  468


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NELVGPIP  L  +     L L  NKL+GE+
Sbjct  243  LSLQGNRLTGKIPEVIGLMQALAVLDLSENELVGPIPPILGNLSYTGKLYLHGNKLTGEV  302

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  303  PPELGNMTKLSYLQLNDNELVG  324


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLS N + G +P  + +L+ L++LIL NN LVG IP+ L+   +L +L+L+ N  SG +
Sbjct  459  IDLSNNAMSGYLPEELGQLQNLDSLILNNNILVGEIPAQLANCFSLNILNLSYNNFSGHV  518

Query  182  P  184
            P
Sbjct  519  P  519


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 40/77 (52%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N L G IP     L+ L  L L +N   G IPS L  I NL  LDL+ N+LSG +P  I 
Sbjct  368  NRLNGSIPAGFQNLESLTNLNLSSNNFKGHIPSELGHIINLDTLDLSYNELSGPVPATIG  427

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N+L G
Sbjct  428  DLEHLLQLNLSKNHLSG  444


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G++P  +  + +L  L L +NELVG IP+ L ++  L  L+LA N L G I
Sbjct  291  LYLHGNKLTGEVPPELGNMTKLSYLQLNDNELVGTIPAELGKLEELFELNLANNNLEGPI  350

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GN L G
Sbjct  351  PTNISSCTALNKFNVYGNRLNG  372


 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G +P     L+ ++ + L NN + G +P  L Q+ NL  L L  N L GEI
Sbjct  435  LNLSKNHLSGSVPAEFGNLRSIQVIDLSNNAMSGYLPEELGQLQNLDSLILNNNILVGEI  494

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L L  NN  G
Sbjct  495  PAQLANCFSLNILNLSYNNFSG  516



>gb|EPS61595.1| hypothetical protein M569_13200, partial [Genlisea aurea]
Length=612

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN+L GDIPFSIS+LKQLETLILK+N+L+GPIPSTLSQIPNLK+LDLAQN LSGEI
Sbjct  99   LDLSFNQLRGDIPFSISRLKQLETLILKSNQLIGPIPSTLSQIPNLKILDLAQNNLSGEI  158

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQ+LGLRGNNL G
Sbjct  159  PRLLYWNEVLQFLGLRGNNLQG  180


 Score = 61.6 bits (148),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N   G+IPF++  L Q+ TL L+NN   GPIPS +  +  L VLDL+ N L+G I
Sbjct  219  LDLSYNNFSGEIPFNVGFL-QVATLSLQNNHFSGPIPSVIGLMQALAVLDLSFNMLNGTI  277

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L L GN L G
Sbjct  278  PPILGNLSYTEKLYLHGNQLTG  299


 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G+IP  + KL  L  L L NN+L GP+P  LS   NL  L+L  NKL+G +
Sbjct  314  LELNDNYLTGNIPVELGKLTDLFDLNLANNDLEGPVPDNLSSCTNLNSLNLHGNKLNGTV  373

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E + YL L  N L G
Sbjct  374  PSAFQKLERMTYLNLSSNYLAG  395


 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G++P S+  L+ L  L L NNE  GPIPS    + ++  +DL+ N LSG I
Sbjct  410  LDLSTNMFSGNLPPSLGDLEHLLKLNLSNNEFNGPIPSEFGNLRSVMEIDLSNNHLSGPI  469

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + +  L L  NNL G
Sbjct  470  PDELSQLQNVFLLKLENNNLGG  491


 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L  N+L G +P +  KL+++  L L +N L GPIP  LS+I NL  LDL+ N  SG +
Sbjct  362  LNLHGNKLNGTVPSAFQKLERMTYLNLSSNYLAGPIPIELSRIGNLDTLDLSTNMFSGNL  421

Query  182  P  184
            P
Sbjct  422  P  422


 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 33/61 (54%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN L G IP  +  L   E L L  N+L G IP  L  +  L  L+L  N L+G I
Sbjct  266  LDLSFNMLNGTIPPILGNLSYTEKLYLHGNQLTGSIPPELGNMSKLHYLELNDNYLTGNI  325

Query  182  P  184
            P
Sbjct  326  P  326


 Score = 46.6 bits (109),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 43/82 (52%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G +   I +L  L    ++NN L GPIP  +    + +VLDL+ N  SGEI
Sbjct  171  LGLRGNNLQGSLSSDICQLTGLWYFDVRNNSLSGPIPDNIGNCTSFEVLDLSYNNFSGEI  230

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  + + +V   L L+ N+  G
Sbjct  231  PFNVGFLQV-ATLSLQNNHFSG  251



>ref|XP_003561134.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Brachypodium distachyon]
Length=943

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN LYGDIPFSISKLKQLE LILKNN+L GPIPSTLSQIPNLK LDLAQN+L+G+I
Sbjct  90   LDLSFNLLYGDIPFSISKLKQLEDLILKNNQLTGPIPSTLSQIPNLKTLDLAQNQLTGDI  149

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  150  PRLIYWNEVLQYLGLRGNSLTG  171


 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+NE  G IP +I  L+ L  L L  N L GP+P+    + +++V+D++ N +SG +
Sbjct  401  LDLSYNEFSGPIPATIGDLEHLLQLNLSKNHLNGPVPAEFGNLRSVQVIDISNNAMSGYL  460

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + L  L L  N+ VG
Sbjct  461  PQELGQLQNLDSLILNNNSFVG  482


 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G IP  + KL++L  L L NN L GPIP+ +S    L   ++  N+L+G I
Sbjct  305  LQLNDNELVGTIPAELGKLEELFELNLANNNLEGPIPTNISSCTALNKFNVYGNRLNGSI  364

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  NN  G
Sbjct  365  PAGFQNLESLTYLNLSSNNFKG  386


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NELVGPIP  L  +     L L  NKL+GE+
Sbjct  233  LSLQGNRLTGKIPDVIGLMQALAVLDLSENELVGPIPPILGNLSYTGKLYLHGNKLTGEV  292

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  293  PPELGNMTKLSYLQLNDNELVG  314


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+S N + G +P  + +L+ L++LIL NN  VG IP+ L+   +L +L+L+ N  SG +
Sbjct  449  IDISNNAMSGYLPQELGQLQNLDSLILNNNSFVGEIPAQLANCFSLNILNLSYNNFSGHV  508

Query  182  P  184
            P
Sbjct  509  P  509


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G++P  +  + +L  L L +NELVG IP+ L ++  L  L+LA N L G I
Sbjct  281  LYLHGNKLTGEVPPELGNMTKLSYLQLNDNELVGTIPAELGKLEELFELNLANNNLEGPI  340

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GN L G
Sbjct  341  PTNISSCTALNKFNVYGNRLNG  362


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 39/77 (51%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N L G IP     L+ L  L L +N   G IPS L  I NL  LDL+ N+ SG IP  I 
Sbjct  358  NRLNGSIPAGFQNLESLTYLNLSSNNFKGQIPSELGHIINLDTLDLSYNEFSGPIPATIG  417

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N+L G
Sbjct  418  DLEHLLQLNLSKNHLNG  434


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N   G IP  +  +  L+TL L  NE  GPIP+T+  + +L  L+L++N L+G +
Sbjct  377  LNLSSNNFKGQIPSELGHIINLDTLDLSYNEFSGPIPATIGDLEHLLQLNLSKNHLNGPV  436

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +Q + +  N + G
Sbjct  437  PAEFGNLRSVQVIDISNNAMSG  458



>gb|AFW86032.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=508

 Score =   142 bits (359),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFSISKLKQLE LILKNN+L GPIPSTLSQIPNLK LDLAQNKL+G+I
Sbjct  125  LDLSGNLLYGDIPFSISKLKQLEDLILKNNQLTGPIPSTLSQIPNLKTLDLAQNKLTGDI  184

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  185  PRLIYWNEVLQYLGLRGNSLTG  206


 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S+N++ G+IP++I  L Q+ TL L+ N L+G IP  +  +  L VLDL++N+L G I
Sbjct  245  LDISYNQISGEIPYNIGYL-QVATLSLQGNRLIGKIPEVIGLMQALAVLDLSENELVGPI  303

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++        L L GN L G
Sbjct  304  PPILGNLSYTGKLYLHGNKLTG  325


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 40/77 (52%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N L G IP    KL+ L  L L +N   G IPS L  I NL  LDL+ N+ SG +P  I 
Sbjct  393  NRLNGSIPAGFQKLESLTYLNLSSNSFKGQIPSELGHIVNLDTLDLSYNEFSGPVPPTIG  452

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N+L G
Sbjct  453  DLEHLLELNLSKNHLTG  469


 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 38/62 (61%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+NE  G +P +I  L+ L  L L  N L G +P+    + +++V+D++ N LSG +
Sbjct  436  LDLSYNEFSGPVPPTIGDLEHLLELNLSKNHLTGSVPAEFGNLRSVQVIDMSSNNLSGYL  495

Query  182  PR  187
            P 
Sbjct  496  PE  497


 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G IP  + KL +L  L L NN L G IP+ +S    L   ++  N+L+G I
Sbjct  340  LQLNDNELVGTIPAELGKLTELFELNLANNNLEGHIPANISSCSALNKFNVYGNRLNGSI  399

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  N+  G
Sbjct  400  PAGFQKLESLTYLNLSSNSFKG  421


 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NELVGPIP  L  +     L L  NKL+G I
Sbjct  268  LSLQGNRLIGKIPEVIGLMQALAVLDLSENELVGPIPPILGNLSYTGKLYLHGNKLTGHI  327

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  328  PPELGNMSKLSYLQLNDNELVG  349


 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 42/80 (53%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    LSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPR  187
            L  N+L G IP  +  + +L  L L +NELVG IP+ L ++  L  L+LA N L G IP 
Sbjct  318  LHGNKLTGHIPPELGNMSKLSYLQLNDNELVGTIPAELGKLTELFELNLANNNLEGHIPA  377

Query  188  LIYWNEVLQYLGLRGNNLVG  247
             I     L    + GN L G
Sbjct  378  NISSCSALNKFNVYGNRLNG  397



>gb|AES59193.2| LRR receptor-like kinase family protein [Medicago truncatula]
Length=985

 Score =   145 bits (366),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD SFNE+ GDIPFSISKLKQLE L+L+NN+L+GPIPSTLSQIPNLK LDLA N LSGEI
Sbjct  121  LDFSFNEIRGDIPFSISKLKQLEFLVLRNNQLIGPIPSTLSQIPNLKYLDLAHNNLSGEI  180

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQYLGLRGNNLVG
Sbjct  181  PRLLYWNEVLQYLGLRGNNLVG  202


 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP +   L+ + +L L +N L GPIP  LS+I NL  LD++ NK+SG I
Sbjct  384  LNVHGNKLNGTIPATFHSLESMTSLNLSSNNLQGPIPIELSRIGNLDTLDISNNKISGPI  443

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  NNL G
Sbjct  444  PSSLGDLEHLLKLNLSRNNLTG  465


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+TL + NN++ GPIPS+L  + +L  L+L++N L+G I
Sbjct  408  LNLSSNNLQGPIPIELSRIGNLDTLDISNNKISGPIPSSLGDLEHLLKLNLSRNNLTGPI  467

Query  182  P  184
            P
Sbjct  468  P  468


 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL  L  L + NN L GPIPS LS   +L  L++  NKL+G I
Sbjct  336  LELNDNLLSGHIPPELGKLTSLFDLNVANNNLEGPIPSDLSLCTSLTGLNVHGNKLNGTI  395

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P   +  E +  L L  NNL G
Sbjct  396  PATFHSLESMTSLNLSSNNLQG  417


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S N++ G IP S+  L+ L  L L  N L GPIP+    + ++  +DL+ N+LS  I
Sbjct  432  LDISNNKISGPIPSSLGDLEHLLKLNLSRNNLTGPIPAEFGNLKSIMEIDLSHNQLSEMI  491

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + +  L L  N+L G
Sbjct  492  PVELGQLQSIASLRLENNDLTG  513


 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G +   + +L  L    +KNN L G IP  +    + +VLDL+ N+L+GEI
Sbjct  193  LGLRGNNLVGSLSPDMCQLTGLWYFDVKNNSLTGNIPENIGNCTSFQVLDLSSNELTGEI  252

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + ++   L L+GNNL G
Sbjct  253  PFNIGFLQI-ATLSLQGNNLSG  273



>gb|AFW86033.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=550

 Score =   142 bits (359),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFSISKLKQLE LILKNN+L GPIPSTLSQIPNLK LDLAQNKL+G+I
Sbjct  125  LDLSGNLLYGDIPFSISKLKQLEDLILKNNQLTGPIPSTLSQIPNLKTLDLAQNKLTGDI  184

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  185  PRLIYWNEVLQYLGLRGNSLTG  206


 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S+N++ G+IP++I  L Q+ TL L+ N L+G IP  +  +  L VLDL++N+L G I
Sbjct  245  LDISYNQISGEIPYNIGYL-QVATLSLQGNRLIGKIPEVIGLMQALAVLDLSENELVGPI  303

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++        L L GN L G
Sbjct  304  PPILGNLSYTGKLYLHGNKLTG  325


 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+NE  G +P +I  L+ L  L L  N L G +P+    + +++V+D++ N LSG +
Sbjct  436  LDLSYNEFSGPVPPTIGDLEHLLELNLSKNHLTGSVPAEFGNLRSVQVIDMSSNNLSGYL  495

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L  L L  N+L G
Sbjct  496  PEELGQLQNLDSLILNNNSLAG  517


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 40/77 (52%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N L G IP    KL+ L  L L +N   G IPS L  I NL  LDL+ N+ SG +P  I 
Sbjct  393  NRLNGSIPAGFQKLESLTYLNLSSNSFKGQIPSELGHIVNLDTLDLSYNEFSGPVPPTIG  452

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N+L G
Sbjct  453  DLEHLLELNLSKNHLTG  469


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G IP  + KL +L  L L NN L G IP+ +S    L   ++  N+L+G I
Sbjct  340  LQLNDNELVGTIPAELGKLTELFELNLANNNLEGHIPANISSCSALNKFNVYGNRLNGSI  399

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  N+  G
Sbjct  400  PAGFQKLESLTYLNLSSNSFKG  421


 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NELVGPIP  L  +     L L  NKL+G I
Sbjct  268  LSLQGNRLIGKIPEVIGLMQALAVLDLSENELVGPIPPILGNLSYTGKLYLHGNKLTGHI  327

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  328  PPELGNMSKLSYLQLNDNELVG  349


 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 42/80 (53%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    LSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPR  187
            L  N+L G IP  +  + +L  L L +NELVG IP+ L ++  L  L+LA N L G IP 
Sbjct  318  LHGNKLTGHIPPELGNMSKLSYLQLNDNELVGTIPAELGKLTELFELNLANNNLEGHIPA  377

Query  188  LIYWNEVLQYLGLRGNNLVG  247
             I     L    + GN L G
Sbjct  378  NISSCSALNKFNVYGNRLNG  397



>ref|XP_003588942.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Medicago 
truncatula]
Length=978

 Score =   145 bits (366),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD SFNE+ GDIPFSISKLKQLE L+L+NN+L+GPIPSTLSQIPNLK LDLA N LSGEI
Sbjct  121  LDFSFNEIRGDIPFSISKLKQLEFLVLRNNQLIGPIPSTLSQIPNLKYLDLAHNNLSGEI  180

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQYLGLRGNNLVG
Sbjct  181  PRLLYWNEVLQYLGLRGNNLVG  202


 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP +   L+ + +L L +N L GPIP  LS+I NL  LD++ NK+SG I
Sbjct  377  LNVHGNKLNGTIPATFHSLESMTSLNLSSNNLQGPIPIELSRIGNLDTLDISNNKISGPI  436

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  NNL G
Sbjct  437  PSSLGDLEHLLKLNLSRNNLTG  458


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+TL + NN++ GPIPS+L  + +L  L+L++N L+G I
Sbjct  401  LNLSSNNLQGPIPIELSRIGNLDTLDISNNKISGPIPSSLGDLEHLLKLNLSRNNLTGPI  460

Query  182  P  184
            P
Sbjct  461  P  461


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S N++ G IP S+  L+ L  L L  N L GPIP+    + ++  +DL+ N+LS  I
Sbjct  425  LDISNNKISGPIPSSLGDLEHLLKLNLSRNNLTGPIPAEFGNLKSIMEIDLSHNQLSEMI  484

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + +  L L  N+L G
Sbjct  485  PVELGQLQSIASLRLENNDLTG  506


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G +   + +L  L    +KNN L G IP  +    + +VLDL+ N+L+GEI
Sbjct  193  LGLRGNNLVGSLSPDMCQLTGLWYFDVKNNSLTGNIPENIGNCTSFQVLDLSSNELTGEI  252

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + ++   L L+GNNL G
Sbjct  253  PFNIGFLQI-ATLSLQGNNLSG  273



>gb|KEH39916.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=956

 Score =   145 bits (365),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD SFNE+ GDIPFSISKLKQLE L+L+NN+L+GPIPSTLSQIPNLK LDLA N LSGEI
Sbjct  92   LDFSFNEIRGDIPFSISKLKQLEFLVLRNNQLIGPIPSTLSQIPNLKYLDLAHNNLSGEI  151

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQYLGLRGNNLVG
Sbjct  152  PRLLYWNEVLQYLGLRGNNLVG  173


 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP +   L+ + +L L +N L GPIP  LS+I NL  LD++ NK+SG I
Sbjct  355  LNVHGNKLNGTIPATFHSLESMTSLNLSSNNLQGPIPIELSRIGNLDTLDISNNKISGPI  414

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  NNL G
Sbjct  415  PSSLGDLEHLLKLNLSRNNLTG  436


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+TL + NN++ GPIPS+L  + +L  L+L++N L+G I
Sbjct  379  LNLSSNNLQGPIPIELSRIGNLDTLDISNNKISGPIPSSLGDLEHLLKLNLSRNNLTGPI  438

Query  182  P  184
            P
Sbjct  439  P  439


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL  L  L + NN L GPIPS LS   +L  L++  NKL+G I
Sbjct  307  LELNDNLLSGHIPPELGKLTSLFDLNVANNNLEGPIPSDLSLCTSLTGLNVHGNKLNGTI  366

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P   +  E +  L L  NNL G
Sbjct  367  PATFHSLESMTSLNLSSNNLQG  388


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S N++ G IP S+  L+ L  L L  N L GPIP+    + ++  +DL+ N+LS  I
Sbjct  403  LDISNNKISGPIPSSLGDLEHLLKLNLSRNNLTGPIPAEFGNLKSIMEIDLSHNQLSEMI  462

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + +  L L  N+L G
Sbjct  463  PVELGQLQSIASLRLENNDLTG  484


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G +   + +L  L    +KNN L G IP  +    + +VLDL+ N+L+GEI
Sbjct  164  LGLRGNNLVGSLSPDMCQLTGLWYFDVKNNSLTGNIPENIGNCTSFQVLDLSSNELTGEI  223

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + ++   L L+GNNL G
Sbjct  224  PFNIGFLQI-ATLSLQGNNLSG  244



>gb|AFW86031.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=944

 Score =   144 bits (364),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFSISKLKQLE LILKNN+L GPIPSTLSQIPNLK LDLAQNKL+G+I
Sbjct  125  LDLSGNLLYGDIPFSISKLKQLEDLILKNNQLTGPIPSTLSQIPNLKTLDLAQNKLTGDI  184

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  185  PRLIYWNEVLQYLGLRGNSLTG  206


 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S+N++ G+IP++I  L Q+ TL L+ N L+G IP  +  +  L VLDL++N+L G I
Sbjct  245  LDISYNQISGEIPYNIGYL-QVATLSLQGNRLIGKIPEVIGLMQALAVLDLSENELVGPI  303

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++        L L GN L G
Sbjct  304  PPILGNLSYTGKLYLHGNKLTG  325


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G IP  + KL +L  L L NN L G IP+ +S    L   ++  N+L+G I
Sbjct  340  LQLNDNELVGTIPAELGKLTELFELNLANNNLEGHIPANISSCSALNKFNVYGNRLNGSI  399

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  N+  G
Sbjct  400  PAGFQKLESLTYLNLSSNSFKG  421


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 42/80 (53%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    LSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPR  187
            L  N+L G IP  +  + +L  L L +NELVG IP+ L ++  L  L+LA N L G IP 
Sbjct  318  LHGNKLTGHIPPELGNMSKLSYLQLNDNELVGTIPAELGKLTELFELNLANNNLEGHIPA  377

Query  188  LIYWNEVLQYLGLRGNNLVG  247
             I     L    + GN L G
Sbjct  378  NISSCSALNKFNVYGNRLNG  397


 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NELVGPIP  L  +     L L  NKL+G I
Sbjct  268  LSLQGNRLIGKIPEVIGLMQALAVLDLSENELVGPIPPILGNLSYTGKLYLHGNKLTGHI  327

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  328  PPELGNMSKLSYLQLNDNELVG  349


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+S N L G +P  + +L+ L++LIL NN L G IP+ L+   +L  L+L+ N  SG +
Sbjct  460  IDMSSNNLSGYLPEELGQLQNLDSLILNNNSLAGEIPAQLANCFSLVSLNLSYNNFSGHV  519

Query  182  P  184
            P
Sbjct  520  P  520


 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N   G IP  +  +  L+TL L  N L G +P+    + +++V+D++ N LSG +
Sbjct  412  LNLSSNSFKGQIPSELGHIVNLDTLNLSKNHLTGSVPAEFGNLRSVQVIDMSSNNLSGYL  471

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L  L L  N+L G
Sbjct  472  PEELGQLQNLDSLILNNNSLAG  493


 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G +P     L+ ++ + + +N L G +P  L Q+ NL  L L  N L+GEI
Sbjct  436  LNLSKNHLTGSVPAEFGNLRSVQVIDMSSNNLSGYLPEELGQLQNLDSLILNNNSLAGEI  495

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L L  NN  G
Sbjct  496  PAQLANCFSLVSLNLSYNNFSG  517



>ref|XP_008658489.1| PREDICTED: uncharacterized protein LOC100279811 isoform X1 [Zea 
mays]
 gb|AFW86035.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=985

 Score =   144 bits (364),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFSISKLKQLE LILKNN+L GPIPSTLSQIPNLK LDLAQNKL+G+I
Sbjct  125  LDLSGNLLYGDIPFSISKLKQLEDLILKNNQLTGPIPSTLSQIPNLKTLDLAQNKLTGDI  184

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  185  PRLIYWNEVLQYLGLRGNSLTG  206


 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S+N++ G+IP++I  L Q+ TL L+ N L+G IP  +  +  L VLDL++N+L G I
Sbjct  245  LDISYNQISGEIPYNIGYL-QVATLSLQGNRLIGKIPEVIGLMQALAVLDLSENELVGPI  303

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++        L L GN L G
Sbjct  304  PPILGNLSYTGKLYLHGNKLTG  325


 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+NE  G +P +I  L+ L  L L  N L G +P+    + +++V+D++ N LSG +
Sbjct  436  LDLSYNEFSGPVPPTIGDLEHLLELNLSKNHLTGSVPAEFGNLRSVQVIDMSSNNLSGYL  495

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L  L L  N+L G
Sbjct  496  PEELGQLQNLDSLILNNNSLAG  517


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 40/77 (52%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N L G IP    KL+ L  L L +N   G IPS L  I NL  LDL+ N+ SG +P  I 
Sbjct  393  NRLNGSIPAGFQKLESLTYLNLSSNSFKGQIPSELGHIVNLDTLDLSYNEFSGPVPPTIG  452

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N+L G
Sbjct  453  DLEHLLELNLSKNHLTG  469


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G IP  + KL +L  L L NN L G IP+ +S    L   ++  N+L+G I
Sbjct  340  LQLNDNELVGTIPAELGKLTELFELNLANNNLEGHIPANISSCSALNKFNVYGNRLNGSI  399

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  N+  G
Sbjct  400  PAGFQKLESLTYLNLSSNSFKG  421


 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 42/80 (53%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    LSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPR  187
            L  N+L G IP  +  + +L  L L +NELVG IP+ L ++  L  L+LA N L G IP 
Sbjct  318  LHGNKLTGHIPPELGNMSKLSYLQLNDNELVGTIPAELGKLTELFELNLANNNLEGHIPA  377

Query  188  LIYWNEVLQYLGLRGNNLVG  247
             I     L    + GN L G
Sbjct  378  NISSCSALNKFNVYGNRLNG  397


 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NELVGPIP  L  +     L L  NKL+G I
Sbjct  268  LSLQGNRLIGKIPEVIGLMQALAVLDLSENELVGPIPPILGNLSYTGKLYLHGNKLTGHI  327

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  328  PPELGNMSKLSYLQLNDNELVG  349


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+S N L G +P  + +L+ L++LIL NN L G IP+ L+   +L  L+L+ N  SG +
Sbjct  484  IDMSSNNLSGYLPEELGQLQNLDSLILNNNSLAGEIPAQLANCFSLVSLNLSYNNFSGHV  543

Query  182  P  184
            P
Sbjct  544  P  544


 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G +P     L+ ++ + + +N L G +P  L Q+ NL  L L  N L+GEI
Sbjct  460  LNLSKNHLTGSVPAEFGNLRSVQVIDMSSNNLSGYLPEELGQLQNLDSLILNNNSLAGEI  519

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L L  NN  G
Sbjct  520  PAQLANCFSLVSLNLSYNNFSG  541



>ref|XP_010227884.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X2 [Brachypodium distachyon]
Length=977

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN L GDIPFS+SKLK LETLILKNN+L+G IPSTLSQ+PNLK+LDLAQNKLSGEI
Sbjct  120  LDLSFNNLDGDIPFSVSKLKHLETLILKNNQLIGAIPSTLSQLPNLKILDLAQNKLSGEI  179

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  180  PRLIYWNEVLQYLGLRGNHLEG  201


 Score = 64.7 bits (156),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+  G IPF+I  L Q+ TL L+ N+  GPIPS +  +  L VLDL+ N+LSG I
Sbjct  240  LDLSYNQFTGSIPFNIGFL-QIATLSLQGNKFTGPIPSVIGLMQALAVLDLSYNQLSGPI  298

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L ++GN L G
Sbjct  299  PSILGNLTYTEKLYMQGNRLTG  320


 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N+L G IP S+ KL+ + +L L +N L GPIP  LS+I NL VLDL+ N ++G IP  I 
Sbjct  388  NKLNGTIPRSLCKLESMTSLNLSSNYLTGPIPIELSRINNLDVLDLSCNMITGPIPSAIG  447

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N LVG
Sbjct  448  SLEHLLTLNLSKNGLVG  464


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP  + KL  L  L L NN L GPIP+ +S   NL   +   NKL+G I
Sbjct  335  LELNDNQLTGSIPSELGKLTGLYDLNLANNNLEGPIPNNISSCVNLNSFNAYGNKLNGTI  394

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR +   E +  L L  N L G
Sbjct  395  PRSLCKLESMTSLNLSSNYLTG  416


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N + G IP +I  L+ L TL L  N LVG IP+    + ++  +DL+ N L+G I
Sbjct  431  LDLSCNMITGPIPSAIGSLEHLLTLNLSKNGLVGFIPAEFGNLRSIMEIDLSNNHLAGLI  490

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ I   + L  L L  NN+ G
Sbjct  491  PQEIGMLQNLMLLKLESNNITG  512


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G IP  +  L   E L ++ N L G IP  L  +  L  L+L  N+L+G I
Sbjct  287  LDLSYNQLSGPIPSILGNLTYTEKLYMQGNRLTGTIPPELGNMSTLHYLELNDNQLTGSI  346

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L L  NNL G
Sbjct  347  PSELGKLTGLYDLNLANNNLEG  368


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+ L L  N + GPIPS +  + +L  L+L++N L G I
Sbjct  407  LNLSSNYLTGPIPIELSRINNLDVLDLSCNMITGPIPSAIGSLEHLLTLNLSKNGLVGFI  466

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +  + L  N+L G
Sbjct  467  PAEFGNLRSIMEIDLSNNHLAG  488


 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 43/82 (52%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G +   I +L  L    +KNN L G IP T+    + +VLDL+ N+ +G I
Sbjct  192  LGLRGNHLEGSLSPDICQLTGLWYFDVKNNSLTGEIPETIGNCTSFQVLDLSYNQFTGSI  251

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + ++   L L+GN   G
Sbjct  252  PFNIGFLQIAT-LSLQGNKFTG  272



>ref|XP_003564133.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X1 [Brachypodium distachyon]
Length=978

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN L GDIPFS+SKLK LETLILKNN+L+G IPSTLSQ+PNLK+LDLAQNKLSGEI
Sbjct  120  LDLSFNNLDGDIPFSVSKLKHLETLILKNNQLIGAIPSTLSQLPNLKILDLAQNKLSGEI  179

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  180  PRLIYWNEVLQYLGLRGNHLEG  201


 Score = 64.7 bits (156),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+  G IPF+I  L Q+ TL L+ N+  GPIPS +  +  L VLDL+ N+LSG I
Sbjct  240  LDLSYNQFTGSIPFNIGFL-QIATLSLQGNKFTGPIPSVIGLMQALAVLDLSYNQLSGPI  298

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L ++GN L G
Sbjct  299  PSILGNLTYTEKLYMQGNRLTG  320


 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N+L G IP S+ KL+ + +L L +N L GPIP  LS+I NL VLDL+ N ++G IP  I 
Sbjct  388  NKLNGTIPRSLCKLESMTSLNLSSNYLTGPIPIELSRINNLDVLDLSCNMITGPIPSAIG  447

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N LVG
Sbjct  448  SLEHLLTLNLSKNGLVG  464


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP  + KL  L  L L NN L GPIP+ +S   NL   +   NKL+G I
Sbjct  335  LELNDNQLTGSIPSELGKLTGLYDLNLANNNLEGPIPNNISSCVNLNSFNAYGNKLNGTI  394

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR +   E +  L L  N L G
Sbjct  395  PRSLCKLESMTSLNLSSNYLTG  416


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N + G IP +I  L+ L TL L  N LVG IP+    + ++  +DL+ N L+G I
Sbjct  431  LDLSCNMITGPIPSAIGSLEHLLTLNLSKNGLVGFIPAEFGNLRSIMEIDLSNNHLAGLI  490

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ I   + L  L L  NN+ G
Sbjct  491  PQEIGMLQNLMLLKLESNNITG  512


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G IP  +  L   E L ++ N L G IP  L  +  L  L+L  N+L+G I
Sbjct  287  LDLSYNQLSGPIPSILGNLTYTEKLYMQGNRLTGTIPPELGNMSTLHYLELNDNQLTGSI  346

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L L  NNL G
Sbjct  347  PSELGKLTGLYDLNLANNNLEG  368


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+ L L  N + GPIPS +  + +L  L+L++N L G I
Sbjct  407  LNLSSNYLTGPIPIELSRINNLDVLDLSCNMITGPIPSAIGSLEHLLTLNLSKNGLVGFI  466

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +  + L  N+L G
Sbjct  467  PAEFGNLRSIMEIDLSNNHLAG  488


 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 43/82 (52%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G +   I +L  L    +KNN L G IP T+    + +VLDL+ N+ +G I
Sbjct  192  LGLRGNHLEGSLSPDICQLTGLWYFDVKNNSLTGEIPETIGNCTSFQVLDLSYNQFTGSI  251

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + ++   L L+GN   G
Sbjct  252  PFNIGFLQIAT-LSLQGNKFTG  272



>ref|XP_010276048.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Nelumbo nucifera]
Length=981

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFSISKLKQLE LILKNN+L GPIPSTLSQIPNLK LDLAQN+L+GEI
Sbjct  128  LDLSSNSLYGDIPFSISKLKQLEDLILKNNQLTGPIPSTLSQIPNLKTLDLAQNQLTGEI  187

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLG RGN+L G
Sbjct  188  PRLIYWNEVLQYLGFRGNSLTG  209


 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G IP  + KL++L  L L NN L GPIP  +S    L   ++  N+LSG I
Sbjct  343  LQLNDNELVGGIPAELGKLEELFELNLANNNLEGPIPQNISSCSALNQFNVHGNRLSGSI  402

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L Y+ L  NN  G
Sbjct  403  PSGFQNLESLTYMNLSSNNFKG  424


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+  G +P SI  L+ L TL L  N L GP+P   + + +++++D++ N LSG I
Sbjct  439  LDLSSNDFSGPVPSSIGDLEHLLTLNLSRNHLDGPLPVEFANLRSIQIIDMSFNNLSGAI  498

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + +  L L  NNL G
Sbjct  499  PEELGQLQNIVALILNNNNLHG  520


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            ++LS N   G IP  + ++  L+TL L +N+  GP+PS++  + +L  L+L++N L G +
Sbjct  415  MNLSSNNFKGGIPVQLGRIINLDTLDLSSNDFSGPVPSSIGDLEHLLTLNLSRNHLDGPL  474

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +Q + +  NNL G
Sbjct  475  PVEFANLRSIQIIDMSFNNLSG  496


 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G +P  +  + +L  L L +NELVG IP+ L ++  L  L+LA N L G I
Sbjct  319  LYLHGNKLTGKVPPELGNMSKLSYLQLNDNELVGGIPAELGKLEELFELNLANNNLEGPI  378

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ I     L    + GN L G
Sbjct  379  PQNISSCSALNQFNVHGNRLSG  400


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NELVGPIP  L  +     L L  NKL+G++
Sbjct  271  LSLQGNRLTGKIPEVIGLMQALAVLDLSENELVGPIPPILGNLSYTGKLYLHGNKLTGKV  330

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  331  PPELGNMSKLSYLQLNDNELVG  352


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+SFN L G IP  + +L+ +  LIL NN L G IP  L+   +L  L+++ N LSG I
Sbjct  487  IDMSFNNLSGAIPEELGQLQNIVALILNNNNLHGGIPPQLTNCFSLVNLNISYNNLSGVI  546

Query  182  P  184
            P
Sbjct  547  P  547



>ref|XP_010276057.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Nelumbo nucifera]
Length=965

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFSISKLKQLE LILKNN+L GPIPSTLSQIPNLK LDLAQN+L+GEI
Sbjct  112  LDLSSNSLYGDIPFSISKLKQLEDLILKNNQLTGPIPSTLSQIPNLKTLDLAQNQLTGEI  171

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLG RGN+L G
Sbjct  172  PRLIYWNEVLQYLGFRGNSLTG  193


 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G IP  + KL++L  L L NN L GPIP  +S    L   ++  N+LSG I
Sbjct  327  LQLNDNELVGGIPAELGKLEELFELNLANNNLEGPIPQNISSCSALNQFNVHGNRLSGSI  386

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L Y+ L  NN  G
Sbjct  387  PSGFQNLESLTYMNLSSNNFKG  408


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+  G +P SI  L+ L TL L  N L GP+P   + + +++++D++ N LSG I
Sbjct  423  LDLSSNDFSGPVPSSIGDLEHLLTLNLSRNHLDGPLPVEFANLRSIQIIDMSFNNLSGAI  482

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + +  L L  NNL G
Sbjct  483  PEELGQLQNIVALILNNNNLHG  504


 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            ++LS N   G IP  + ++  L+TL L +N+  GP+PS++  + +L  L+L++N L G +
Sbjct  399  MNLSSNNFKGGIPVQLGRIINLDTLDLSSNDFSGPVPSSIGDLEHLLTLNLSRNHLDGPL  458

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +Q + +  NNL G
Sbjct  459  PVEFANLRSIQIIDMSFNNLSG  480


 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G +P  +  + +L  L L +NELVG IP+ L ++  L  L+LA N L G I
Sbjct  303  LYLHGNKLTGKVPPELGNMSKLSYLQLNDNELVGGIPAELGKLEELFELNLANNNLEGPI  362

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ I     L    + GN L G
Sbjct  363  PQNISSCSALNQFNVHGNRLSG  384


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NELVGPIP  L  +     L L  NKL+G++
Sbjct  255  LSLQGNRLTGKIPEVIGLMQALAVLDLSENELVGPIPPILGNLSYTGKLYLHGNKLTGKV  314

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  315  PPELGNMSKLSYLQLNDNELVG  336


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+SFN L G IP  + +L+ +  LIL NN L G IP  L+   +L  L+++ N LSG I
Sbjct  471  IDMSFNNLSGAIPEELGQLQNIVALILNNNNLHGGIPPQLTNCFSLVNLNISYNNLSGVI  530

Query  182  P  184
            P
Sbjct  531  P  531



>ref|XP_002436407.1| hypothetical protein SORBIDRAFT_10g001970 [Sorghum bicolor]
 gb|EER87774.1| hypothetical protein SORBIDRAFT_10g001970 [Sorghum bicolor]
Length=978

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFSISKLKQLE LILKNN+L GPIPSTLSQIPNLK LDLAQNKL+G+I
Sbjct  122  LDLSGNLLYGDIPFSISKLKQLEDLILKNNQLTGPIPSTLSQIPNLKTLDLAQNKLTGDI  181

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  182  PRLIYWNEVLQYLGLRGNSLTG  203


 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S+N++ G+IP++I  L Q+ TL L+ N L+G IP  +  +  L VLDL++N+L G I
Sbjct  242  LDISYNQISGEIPYNIGYL-QVATLSLQGNRLIGKIPEVIGLMQALAVLDLSENELVGPI  300

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++        L L GN L G
Sbjct  301  PPILGNLSYTGKLYLHGNKLTG  322


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+NE  G +P +I  L+ L  L L  N L G +P+    + +++V+D++ N L+G +
Sbjct  433  LDLSYNEFSGPVPPTIGDLEHLLELNLSKNHLTGSVPAEFGNLRSVQVIDISSNNLTGYL  492

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L  L L  NNLVG
Sbjct  493  PEELGQLQNLDSLILNNNNLVG  514


 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G IP  + KL +L  L L NN L G IP+ +S    L   ++  N+L+G I
Sbjct  337  LQLNDNELVGTIPAELGKLTELFELNLANNNLEGHIPANISSCSALNKFNVYGNRLNGSI  396

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  NN  G
Sbjct  397  PAGFQELESLTYLNLSSNNFKG  418


 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 42/80 (53%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    LSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPR  187
            L  N+L G IP  +  + +L  L L +NELVG IP+ L ++  L  L+LA N L G IP 
Sbjct  315  LHGNKLTGHIPPELGNMSKLSYLQLNDNELVGTIPAELGKLTELFELNLANNNLEGHIPA  374

Query  188  LIYWNEVLQYLGLRGNNLVG  247
             I     L    + GN L G
Sbjct  375  NISSCSALNKFNVYGNRLNG  394


 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NELVGPIP  L  +     L L  NKL+G I
Sbjct  265  LSLQGNRLIGKIPEVIGLMQALAVLDLSENELVGPIPPILGNLSYTGKLYLHGNKLTGHI  324

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  325  PPELGNMSKLSYLQLNDNELVG  346


 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 40/77 (52%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N L G IP    +L+ L  L L +N   G IPS L  I NL  LDL+ N+ SG +P  I 
Sbjct  390  NRLNGSIPAGFQELESLTYLNLSSNNFKGQIPSELGHIVNLDTLDLSYNEFSGPVPPTIG  449

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N+L G
Sbjct  450  DLEHLLELNLSKNHLTG  466


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+S N L G +P  + +L+ L++LIL NN LVG IP+ L+   +L  L+L+ N  +G +
Sbjct  481  IDISSNNLTGYLPEELGQLQNLDSLILNNNNLVGEIPAQLANCFSLITLNLSYNNFTGHV  540

Query  182  P  184
            P
Sbjct  541  P  541



>ref|XP_004964421.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like [Setaria italica]
Length=978

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFSISKLKQLE LILKNN+L GPIPSTLSQIPNLK LDLAQNKL+G+I
Sbjct  123  LDLSGNLLYGDIPFSISKLKQLEDLILKNNQLTGPIPSTLSQIPNLKTLDLAQNKLTGDI  182

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  183  PRLIYWNEVLQYLGLRGNSLTG  204


 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+  G +P +I  L+ L  L L  N L+G +P+    + +++V+D++ N LSG +
Sbjct  434  LDLSYNDFSGPVPPTIGDLEHLLELNLSKNHLIGSVPAEFGNLRSVQVIDISSNNLSGYL  493

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L  L L  NNLVG
Sbjct  494  PEELGQLQNLDSLILNNNNLVG  515


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G IP  + KL +L  L L NN L G IP+ +S    L   ++  N+L+G I
Sbjct  338  LQLNDNELTGTIPAELGKLTELFELNLANNNLEGHIPANISSCSALNKFNVYGNRLNGSI  397

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  NNL G
Sbjct  398  PGGFQKLESLTYLNLSSNNLKG  419


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 41/77 (53%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N L G IP    KL+ L  L L +N L G IPS L  I NL  LDL+ N  SG +P  I 
Sbjct  391  NRLNGSIPGGFQKLESLTYLNLSSNNLKGQIPSELGHIVNLDTLDLSYNDFSGPVPPTIG  450

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N+L+G
Sbjct  451  DLEHLLELNLSKNHLIG  467


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+S N L G +P  + +L+ L++LIL NN LVG IP+ L+   +L  L+L+ N  SG +
Sbjct  482  IDISSNNLSGYLPEELGQLQNLDSLILNNNNLVGEIPAQLANCFSLITLNLSYNNFSGHV  541

Query  182  P  184
            P
Sbjct  542  P  542


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 41/80 (51%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    LSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPR  187
            L  N+L G IP  +  + +L  L L +NEL G IP+ L ++  L  L+LA N L G IP 
Sbjct  316  LHGNKLTGHIPPELGNMSKLSYLQLNDNELTGTIPAELGKLTELFELNLANNNLEGHIPA  375

Query  188  LIYWNEVLQYLGLRGNNLVG  247
             I     L    + GN L G
Sbjct  376  NISSCSALNKFNVYGNRLNG  395


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 40/82 (49%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  N+LVGPIP  L  +     L L  NKL+G I
Sbjct  266  LSLQGNRLTGRIPEVIGLMQALAVLDLSENDLVGPIPPILGNLSYTGKLYLHGNKLTGHI  325

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N L G
Sbjct  326  PPELGNMSKLSYLQLNDNELTG  347



>gb|AFJ38186.2| receptor-like serine/threonine protein kinase 1 [Triticum aestivum]
 gb|AGL91673.1| erecta leucine-rich-repeat receptor-like kinase [Triticum aestivum]
Length=975

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN L GDIPFS+SKLK LETLILKNN+LVG IPSTLSQ+PNLK+LDLAQNKLSGEI
Sbjct  119  LDLSFNNLDGDIPFSVSKLKHLETLILKNNQLVGAIPSTLSQLPNLKILDLAQNKLSGEI  178

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN L G
Sbjct  179  PRLIYWNEVLQYLGLRGNQLEG  200


 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N L G IPF+I  L Q+ TL L+ N+  GPIPS +  +  L VLDL+ N+LSG I
Sbjct  239  LDLSYNHLTGSIPFNIGFL-QVATLSLQGNKFTGPIPSVIGLMQALAVLDLSYNQLSGPI  297

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L ++GN L G
Sbjct  298  PSILGNLSYTEKLYMQGNRLTG  319


 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N+L G IP S+ KL+ + +L L +N L GPIP  LS+I NL +LDL+ N ++G IP  I 
Sbjct  387  NKLNGTIPRSLCKLESMTSLNLSSNHLSGPIPIELSRINNLDILDLSCNMITGPIPSAIG  446

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N LVG
Sbjct  447  SLEHLLKLNLSKNALVG  463


 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP  + KL  L  L L NN L GPIP+ +S   NL   +   NKL+G I
Sbjct  334  LELNDNQLTGSIPSELGKLTGLYDLNLANNSLEGPIPNNISSCVNLNSFNAHGNKLNGTI  393

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR +   E +  L L  N+L G
Sbjct  394  PRSLCKLESMTSLNLSSNHLSG  415


 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N + G IP +I  L+ L  L L  N LVG IP+    + ++  +DL+ N L G I
Sbjct  430  LDLSCNMITGPIPSAIGSLEHLLKLNLSKNALVGFIPAEFGNLRSIGEIDLSNNHLGGLI  489

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + L  L L  NN+ G
Sbjct  490  PQELGMLQNLMLLKLENNNITG  511


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G IP  +  L   E L ++ N L G IP  L  +  L  L+L  N+L+G I
Sbjct  286  LDLSYNQLSGPIPSILGNLSYTEKLYMQGNRLTGTIPPELGNMSTLHYLELNDNQLTGSI  345

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L L  N+L G
Sbjct  346  PSELGKLTGLYDLNLANNSLEG  367


 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+ L L  N + GPIPS +  + +L  L+L++N L G I
Sbjct  406  LNLSSNHLSGPIPIELSRINNLDILDLSCNMITGPIPSAIGSLEHLLKLNLSKNALVGFI  465

Query  182  P  184
            P
Sbjct  466  P  466


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G +   + +L  L    +KNN L G IP T+    + +VLDL+ N L+G I
Sbjct  191  LGLRGNQLEGTLSPDMCQLTGLWYFDVKNNSLTGEIPETIGNCTSFQVLDLSYNHLTGSI  250

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN   G
Sbjct  251  PFNIGFLQVAT-LSLQGNKFTG  271



>gb|AFW86034.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=1007

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFSISKLKQLE LILKNN+L GPIPSTLSQIPNLK LDLAQNKL+G+I
Sbjct  125  LDLSGNLLYGDIPFSISKLKQLEDLILKNNQLTGPIPSTLSQIPNLKTLDLAQNKLTGDI  184

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  185  PRLIYWNEVLQYLGLRGNSLTG  206


 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S+N++ G+IP++I  L Q+ TL L+ N L+G IP  +  +  L VLDL++N+L G I
Sbjct  245  LDISYNQISGEIPYNIGYL-QVATLSLQGNRLIGKIPEVIGLMQALAVLDLSENELVGPI  303

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++        L L GN L G
Sbjct  304  PPILGNLSYTGKLYLHGNKLTG  325


 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+NE  G +P +I  L+ L  L L  N L G +P+    + +++V+D++ N LSG +
Sbjct  436  LDLSYNEFSGPVPPTIGDLEHLLELNLSKNHLTGSVPAEFGNLRSVQVIDMSSNNLSGYL  495

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L  L L  N+L G
Sbjct  496  PEELGQLQNLDSLILNNNSLAG  517


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 40/77 (52%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N L G IP    KL+ L  L L +N   G IPS L  I NL  LDL+ N+ SG +P  I 
Sbjct  393  NRLNGSIPAGFQKLESLTYLNLSSNSFKGQIPSELGHIVNLDTLDLSYNEFSGPVPPTIG  452

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N+L G
Sbjct  453  DLEHLLELNLSKNHLTG  469


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G IP  + KL +L  L L NN L G IP+ +S    L   ++  N+L+G I
Sbjct  340  LQLNDNELVGTIPAELGKLTELFELNLANNNLEGHIPANISSCSALNKFNVYGNRLNGSI  399

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  N+  G
Sbjct  400  PAGFQKLESLTYLNLSSNSFKG  421


 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +NELVG IP+ L ++  L  L+LA N L G I
Sbjct  316  LYLHGNKLTGHIPPELGNMSKLSYLQLNDNELVGTIPAELGKLTELFELNLANNNLEGHI  375

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GN L G
Sbjct  376  PANISSCSALNKFNVYGNRLNG  397


 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NELVGPIP  L  +     L L  NKL+G I
Sbjct  268  LSLQGNRLIGKIPEVIGLMQALAVLDLSENELVGPIPPILGNLSYTGKLYLHGNKLTGHI  327

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  328  PPELGNMSKLSYLQLNDNELVG  349


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+S N L G +P  + +L+ L++LIL NN L G IP+ L+   +L  L+L+ N  SG +
Sbjct  484  IDMSSNNLSGYLPEELGQLQNLDSLILNNNSLAGEIPAQLANCFSLVSLNLSYNNFSGHV  543

Query  182  P  184
            P
Sbjct  544  P  544


 Score = 47.0 bits (110),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G +P     L+ ++ + + +N L G +P  L Q+ NL  L L  N L+GEI
Sbjct  460  LNLSKNHLTGSVPAEFGNLRSVQVIDMSSNNLSGYLPEELGQLQNLDSLILNNNSLAGEI  519

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L L  NN  G
Sbjct  520  PAQLANCFSLVSLNLSYNNFSG  541



>ref|XP_004964941.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X1 [Setaria italica]
Length=996

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN L GDIPFSISKLKQLE LILKNN+LVG IPSTLSQ+PNLK+LDLAQNKL+GEI
Sbjct  125  LDLSFNNLDGDIPFSISKLKQLENLILKNNQLVGAIPSTLSQLPNLKILDLAQNKLTGEI  184

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  185  PRLIYWNEVLQYLGLRGNHLEG  206


 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+  G IPF+I  L Q+ TL L+ N+  GPIPS +  +  L VLDL+ N+LSG I
Sbjct  245  LDLSYNQFTGPIPFNIGFL-QVATLSLQGNKFTGPIPSVIGLMQALAVLDLSYNQLSGPI  303

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L ++GN L G
Sbjct  304  PSILGNLTYTEKLYMQGNRLTG  325


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N+L G IP S+ KL+ +  L L +N L GPIP  LS+I NL  LDL+ N ++G IP  I 
Sbjct  393  NKLNGTIPLSLRKLESMTYLNLSSNFLSGPIPIELSRINNLDTLDLSCNMMTGPIPPAIG  452

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N  +G
Sbjct  453  SLEHLLRLNLSKNGFLG  469


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP  + KL  L  L L NN L GPIP  LS   NL   +   NKL+G I
Sbjct  340  LELNDNQLTGSIPPELGKLTGLFDLNLANNNLEGPIPDNLSSCVNLNSFNAYGNKLNGTI  399

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E + YL L  N L G
Sbjct  400  PLSLRKLESMTYLNLSSNFLSG  421


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G IP  +  L   E L ++ N L G IP  L  +  L  L+L  N+L+G I
Sbjct  292  LDLSYNQLSGPIPSILGNLTYTEKLYMQGNRLTGSIPPELGNMSTLHYLELNDNQLTGSI  351

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L L  NNL G
Sbjct  352  PPELGKLTGLFDLNLANNNLEG  373


 Score = 47.0 bits (110),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+  G IP  I  ++ L  L L  N+L GPIPS L  +   + L +  N+L+G I
Sbjct  268  LSLQGNKFTGPIPSVIGLMQALAVLDLSYNQLSGPIPSILGNLTYTEKLYMQGNRLTGSI  327

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N L G
Sbjct  328  PPELGNMSTLHYLELNDNQLTG  349



>ref|XP_006656743.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Oryza brachyantha]
Length=979

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLSFN L GDIPFS+SKLK LE+LILKNNEL+G IPSTLSQ+PNLK+LDLAQNKLSGEI
Sbjct  119  VDLSFNSLDGDIPFSVSKLKHLESLILKNNELIGVIPSTLSQLPNLKILDLAQNKLSGEI  178

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNL G
Sbjct  179  PRLIYWNEVLQYLGLRGNNLEG  200


 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+  G IPF+I  L Q+ TL L+ N   GPIPS +  +  L VLDL+ N+LSG I
Sbjct  239  LDLSYNKFSGSIPFNIGFL-QVATLSLQGNMFTGPIPSVIGLMQALAVLDLSYNQLSGSI  297

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L ++GNNL G
Sbjct  298  PSILGNLTYTEKLYMQGNNLTG  319


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP  + KL  L  L L NN+L GPIP  +S   NL   +   N+L+G I
Sbjct  334  LELNDNQLSGFIPPELGKLTGLFDLNLANNQLEGPIPENISSCVNLNSFNAYGNRLNGTI  393

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  ++  E + YL L  N L G
Sbjct  394  PPSLHKLESMTYLNLSSNFLRG  415


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 44/77 (57%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N L G IP S+ KL+ +  L L +N L G IP  LS+I NL  LDL+ N ++G IP  I 
Sbjct  387  NRLNGTIPPSLHKLESMTYLNLSSNFLRGTIPIELSRINNLDTLDLSCNMITGPIPSAIG  446

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N LVG
Sbjct  447  SLEHLLRLNLSKNGLVG  463


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G +   I +L  L    +KNN L GPIP T+    + +VLDL+ NK SG I
Sbjct  191  LGLRGNNLEGSLSPDICQLTGLWYFDVKNNSLTGPIPETIGNCTSFQVLDLSYNKFSGSI  250

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN   G
Sbjct  251  PFNIGFLQVAT-LSLQGNMFTG  271


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 36/61 (59%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G IP  +  L   E L ++ N L GPIP  L  +  L  L+L  N+LSG I
Sbjct  286  LDLSYNQLSGSIPSILGNLTYTEKLYMQGNNLTGPIPPELGNMSTLHYLELNDNQLSGFI  345

Query  182  P  184
            P
Sbjct  346  P  346


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+TL L  N + GPIPS +  + +L  L+L++N L G I
Sbjct  406  LNLSSNFLRGTIPIELSRINNLDTLDLSCNMITGPIPSAIGSLEHLLRLNLSKNGLVGFI  465

Query  182  P  184
            P
Sbjct  466  P  466


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N + G IP +I  L+ L  L L  N LVG IP+ +  + ++  +D+++N L G I
Sbjct  430  LDLSCNMITGPIPSAIGSLEHLLRLNLSKNGLVGFIPAEVGNLRSIMEIDMSRNHLGGLI  489

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + L  L L  NN+ G
Sbjct  490  PQELGMLQNLILLKLENNNITG  511



>ref|XP_004964942.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X2 [Setaria italica]
Length=990

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN L GDIPFSISKLKQLE LILKNN+LVG IPSTLSQ+PNLK+LDLAQNKL+GEI
Sbjct  125  LDLSFNNLDGDIPFSISKLKQLENLILKNNQLVGAIPSTLSQLPNLKILDLAQNKLTGEI  184

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  185  PRLIYWNEVLQYLGLRGNHLEG  206


 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+  G IPF+I  L Q+ TL L+ N+  GPIPS +  +  L VLDL+ N+LSG I
Sbjct  245  LDLSYNQFTGPIPFNIGFL-QVATLSLQGNKFTGPIPSVIGLMQALAVLDLSYNQLSGPI  303

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L ++GN L G
Sbjct  304  PSILGNLTYTEKLYMQGNRLTG  325


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N+L G IP S+ KL+ +  L L +N L GPIP  LS+I NL  LDL+ N ++G IP  I 
Sbjct  393  NKLNGTIPLSLRKLESMTYLNLSSNFLSGPIPIELSRINNLDTLDLSCNMMTGPIPPAIG  452

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N  +G
Sbjct  453  SLEHLLRLNLSKNGFLG  469


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP  + KL  L  L L NN L GPIP  LS   NL   +   NKL+G I
Sbjct  340  LELNDNQLTGSIPPELGKLTGLFDLNLANNNLEGPIPDNLSSCVNLNSFNAYGNKLNGTI  399

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E + YL L  N L G
Sbjct  400  PLSLRKLESMTYLNLSSNFLSG  421


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G IP  +  L   E L ++ N L G IP  L  +  L  L+L  N+L+G I
Sbjct  292  LDLSYNQLSGPIPSILGNLTYTEKLYMQGNRLTGSIPPELGNMSTLHYLELNDNQLTGSI  351

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L L  NNL G
Sbjct  352  PPELGKLTGLFDLNLANNNLEG  373


 Score = 47.0 bits (110),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+  G IP  I  ++ L  L L  N+L GPIPS L  +   + L +  N+L+G I
Sbjct  268  LSLQGNKFTGPIPSVIGLMQALAVLDLSYNQLSGPIPSILGNLTYTEKLYMQGNRLTGSI  327

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N L G
Sbjct  328  PPELGNMSTLHYLELNDNQLTG  349



>ref|XP_010273915.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X2 [Nelumbo nucifera]
Length=965

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN +YGDIPFSISKLKQ+E LILKNN+L+G IPST SQIPNLK+LDLAQNKLSGEI
Sbjct  120  LDLSFNNIYGDIPFSISKLKQIEFLILKNNQLIGSIPSTFSQIPNLKILDLAQNKLSGEI  179

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYW++VLQYLGLR NNLVG
Sbjct  180  PRLIYWSQVLQYLGLRDNNLVG  201


 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL  L  L + NN L GPIP  LS   NL  L++  NKL G I
Sbjct  335  LELNDNMLTGQIPPELGKLTDLFDLNVANNNLEGPIPDDLSSCTNLNSLNVHGNKLKGTI  394

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E + YL L  NNL G
Sbjct  395  PSKLERLESMTYLNLSSNNLKG  416


 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP  + +L+ +  L L +N L GPIP  LS+I NL  LD++ NK+SG I
Sbjct  383  LNVHGNKLKGTIPSKLERLESMTYLNLSSNNLKGPIPIELSRIGNLDTLDISNNKISGYI  442

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N LVG
Sbjct  443  PSSLGDLEHLLELNLSKNRLVG  464


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+TL + NN++ G IPS+L  + +L  L+L++N+L G I
Sbjct  407  LNLSSNNLKGPIPIELSRIGNLDTLDISNNKISGYIPSSLGDLEHLLELNLSKNRLVGII  466

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +  + L  N+L+G
Sbjct  467  PAEFGNLRSIMNIDLSNNHLLG  488


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 51/106 (48%), Gaps = 25/106 (24%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQN------  163
            LDLS+N+L G+IPF+I  L Q+ TL L+ N+L G IP  +  +  L VLDL+ N      
Sbjct  240  LDLSYNQLTGEIPFNIGFL-QVATLSLQGNQLSGKIPPVIGLMQALAVLDLSCNMLTGSI  298

Query  164  ------------------KLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
                              KL+G IP  +     L YL L  N L G
Sbjct  299  PSILGNLTYTEKLYLHGNKLTGSIPPELGNMTKLHYLELNDNMLTG  344


 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 36/61 (59%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP     L+ +  + L NN L+GPIP  L Q+ NL  L+++ N L G I
Sbjct  455  LNLSKNRLVGIIPAEFGNLRSIMNIDLSNNHLLGPIPVELGQLQNLYSLNVSYNNLVGAI  514

Query  182  P  184
            P
Sbjct  515  P  515



>ref|XP_010273914.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X1 [Nelumbo nucifera]
Length=988

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN +YGDIPFSISKLKQ+E LILKNN+L+G IPST SQIPNLK+LDLAQNKLSGEI
Sbjct  120  LDLSFNNIYGDIPFSISKLKQIEFLILKNNQLIGSIPSTFSQIPNLKILDLAQNKLSGEI  179

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYW++VLQYLGLR NNLVG
Sbjct  180  PRLIYWSQVLQYLGLRDNNLVG  201


 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL  L  L + NN L GPIP  LS   NL  L++  NKL G I
Sbjct  335  LELNDNMLTGQIPPELGKLTDLFDLNVANNNLEGPIPDDLSSCTNLNSLNVHGNKLKGTI  394

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E + YL L  NNL G
Sbjct  395  PSKLERLESMTYLNLSSNNLKG  416


 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP  + +L+ +  L L +N L GPIP  LS+I NL  LD++ NK+SG I
Sbjct  383  LNVHGNKLKGTIPSKLERLESMTYLNLSSNNLKGPIPIELSRIGNLDTLDISNNKISGYI  442

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N LVG
Sbjct  443  PSSLGDLEHLLELNLSKNRLVG  464


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+TL + NN++ G IPS+L  + +L  L+L++N+L G I
Sbjct  407  LNLSSNNLKGPIPIELSRIGNLDTLDISNNKISGYIPSSLGDLEHLLELNLSKNRLVGII  466

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +  + L  N+L+G
Sbjct  467  PAEFGNLRSIMNIDLSNNHLLG  488


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 51/106 (48%), Gaps = 25/106 (24%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQN------  163
            LDLS+N+L G+IPF+I  L Q+ TL L+ N+L G IP  +  +  L VLDL+ N      
Sbjct  240  LDLSYNQLTGEIPFNIGFL-QVATLSLQGNQLSGKIPPVIGLMQALAVLDLSCNMLTGSI  298

Query  164  ------------------KLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
                              KL+G IP  +     L YL L  N L G
Sbjct  299  PSILGNLTYTEKLYLHGNKLTGSIPPELGNMTKLHYLELNDNMLTG  344


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP     L+ +  + L NN L+GPIP  L Q+ NL  L +  N LSG +
Sbjct  455  LNLSKNRLVGIIPAEFGNLRSIMNIDLSNNHLLGPIPVELGQLQNLYSLRINNNNLSGNL  514

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
              L+     L  L +  NNLVG
Sbjct  515  FPLVSCFS-LTILNVSYNNLVG  535



>gb|AGL91672.1| erecta leucine-rich-repeat receptor-like kinase [Triticum aestivum]
Length=976

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN L GDIPFS+SKLK LETLILKNN+LVG IPSTLSQ+PNLK LDLAQNKLSGEI
Sbjct  120  LDLSFNNLDGDIPFSVSKLKHLETLILKNNQLVGAIPSTLSQLPNLKTLDLAQNKLSGEI  179

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN L G
Sbjct  180  PRLIYWNEVLQYLGLRGNQLEG  201


 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N L G IPF+I  L Q+ TL L+ N+  GPIPS +  +  L VLDL+ N+LSG I
Sbjct  240  LDLSYNRLTGSIPFNIGFL-QVATLSLQGNKFTGPIPSVIGLMQALAVLDLSYNQLSGPI  298

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L ++GN L G
Sbjct  299  PSILGNLTYTEKLYMQGNRLTG  320


 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N+L G IP S+ KL+ + +L L +N L GPIP  LS+I NL +LDL+ N ++G IP  I 
Sbjct  388  NKLNGTIPRSLCKLESMTSLNLSSNHLSGPIPIELSRINNLDILDLSCNMITGPIPSAIG  447

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N LVG
Sbjct  448  SLEHLLKLNLSKNALVG  464


 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP  + KL  L  L L NN L GPIP+ +S   NL   +   NKL+G I
Sbjct  335  LELNDNQLTGSIPSELGKLTGLYDLNLANNSLEGPIPNNISSCVNLNSFNAHGNKLNGTI  394

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR +   E +  L L  N+L G
Sbjct  395  PRSLCKLESMTSLNLSSNHLSG  416


 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N + G IP +I  L+ L  L L  N LVG IP+    + ++  +DL+ N L G I
Sbjct  431  LDLSCNMITGPIPSAIGSLEHLLKLNLSKNALVGFIPAEFGNLRSIMEIDLSNNHLGGLI  490

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + L  L L  NN+ G
Sbjct  491  PQELGMLQNLMLLKLENNNITG  512


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G IP  +  L   E L ++ N L G IP  L  +  L  L+L  N+L+G I
Sbjct  287  LDLSYNQLSGPIPSILGNLTYTEKLYMQGNRLTGTIPPELGNMSTLHYLELNDNQLTGSI  346

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L L  N+L G
Sbjct  347  PSELGKLTGLYDLNLANNSLEG  368


 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+ L L  N + GPIPS +  + +L  L+L++N L G I
Sbjct  407  LNLSSNHLSGPIPIELSRINNLDILDLSCNMITGPIPSAIGSLEHLLKLNLSKNALVGFI  466

Query  182  P  184
            P
Sbjct  467  P  467


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G +   + +L  L    +KNN L G IP T+    + +VLDL+ N+L+G I
Sbjct  192  LGLRGNQLEGILSPDMCQLTGLWYFDVKNNSLTGEIPDTIGNCTSFQVLDLSYNRLTGSI  251

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN   G
Sbjct  252  PFNIGFLQVAT-LSLQGNKFTG  272



>gb|AFJ38187.2| receptor-like serine/threonine protein kinase 2 [Triticum aestivum]
Length=976

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN L GDIPFS+SKLK LETLILKNN+LVG IPSTLSQ+PNLK LDLAQNKLSGEI
Sbjct  120  LDLSFNNLDGDIPFSVSKLKHLETLILKNNQLVGAIPSTLSQLPNLKTLDLAQNKLSGEI  179

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN L G
Sbjct  180  PRLIYWNEVLQYLGLRGNQLEG  201


 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N L G IPF+I  L Q+ TL L+ N+  GPIPS +  +  L VLDL+ N+LSG I
Sbjct  240  LDLSYNRLTGSIPFNIGFL-QVATLSLQGNKFTGPIPSVIGLMQALAVLDLSYNQLSGPI  298

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L ++GN L G
Sbjct  299  PSILGNLTYTEKLYMQGNRLTG  320


 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N+L G IP S+ KL+ + +L L +N L GPIP  LS+I NL +LDL+ N ++G IP  I 
Sbjct  388  NKLNGTIPRSLCKLESMTSLNLSSNHLSGPIPIELSRINNLDILDLSCNMITGPIPSAIG  447

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N LVG
Sbjct  448  SLEHLLKLNLSKNALVG  464


 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP  + KL  L  L L NN L GPIP+ +S   NL   +   NKL+G I
Sbjct  335  LELNDNQLTGSIPSELGKLTGLYDLNLANNSLEGPIPNNISSCVNLNSFNAHGNKLNGTI  394

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR +   E +  L L  N+L G
Sbjct  395  PRSLCKLESMTSLNLSSNHLSG  416


 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N + G IP +I  L+ L  L L  N LVG IP+    + ++  +DL+ N L G I
Sbjct  431  LDLSCNMITGPIPSAIGSLEHLLKLNLSKNALVGFIPAEFGNLRSIMEIDLSNNHLGGLI  490

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + L  L L  NN+ G
Sbjct  491  PQELGMLQNLMLLKLENNNITG  512


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G IP  +  L   E L ++ N L G IP  L  +  L  L+L  N+L+G I
Sbjct  287  LDLSYNQLSGPIPSILGNLTYTEKLYMQGNRLTGTIPPELGNMSTLHYLELNDNQLTGSI  346

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L L  N+L G
Sbjct  347  PSELGKLTGLYDLNLANNSLEG  368


 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+ L L  N + GPIPS +  + +L  L+L++N L G I
Sbjct  407  LNLSSNHLSGPIPIELSRINNLDILDLSCNMITGPIPSAIGSLEHLLKLNLSKNALVGFI  466

Query  182  P  184
            P
Sbjct  467  P  467


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G +   + +L  L    +KNN L G IP T+    + +VLDL+ N+L+G I
Sbjct  192  LGLRGNQLEGILSPDMCQLTGLWYFDVKNNSLTGEIPDTIGNCTSFQVLDLSYNRLTGSI  251

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN   G
Sbjct  252  PFNIGFLQVAT-LSLQGNKFTG  272



>dbj|BAD44800.1| putative transmembrane protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAD67663.1| putative transmembrane protein kinase [Oryza sativa Japonica 
Group]
 gb|EEC79921.1| hypothetical protein OsI_21484 [Oryza sativa Indica Group]
Length=980

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFSISKLKQLE LILKNN+L GPIPSTLSQIPNLK LDLAQN+L+G+I
Sbjct  128  LDLSGNLLYGDIPFSISKLKQLEELILKNNQLTGPIPSTLSQIPNLKTLDLAQNQLTGDI  187

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  188  PRLIYWNEVLQYLGLRGNSLTG  209


 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+NE  G +P +I  L+ L  L L  N L GP+P+    + +++V+D++ N LSG +
Sbjct  439  LDLSYNEFSGPVPATIGDLEHLLELNLSKNHLDGPVPAEFGNLRSVQVIDMSNNNLSGSL  498

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L  L L  NNLVG
Sbjct  499  PEELGQLQNLDSLILNNNNLVG  520


 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G IP  + KL++L  L L NN L GPIP+ +S    L   ++  NKL+G I
Sbjct  343  LQLNDNELVGTIPAELGKLEELFELNLANNNLQGPIPANISSCTALNKFNVYGNKLNGSI  402

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  NN  G
Sbjct  403  PAGFQKLESLTYLNLSSNNFKG  424


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N   G+IP  +  +  L+TL L  NE  GP+P+T+  + +L  L+L++N L G +
Sbjct  415  LNLSSNNFKGNIPSELGHIINLDTLDLSYNEFSGPVPATIGDLEHLLELNLSKNHLDGPV  474

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +Q + +  NNL G
Sbjct  475  PAEFGNLRSVQVIDMSNNNLSG  496


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NELVGPIPS L  +     L L  NKL+G I
Sbjct  271  LSLQGNRLTGKIPDVIGLMQALAVLDLSENELVGPIPSILGNLSYTGKLYLHGNKLTGVI  330

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  331  PPELGNMSKLSYLQLNDNELVG  352


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 41/77 (53%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N+L G IP    KL+ L  L L +N   G IPS L  I NL  LDL+ N+ SG +P  I 
Sbjct  396  NKLNGSIPAGFQKLESLTYLNLSSNNFKGNIPSELGHIINLDTLDLSYNEFSGPVPATIG  455

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N+L G
Sbjct  456  DLEHLLELNLSKNHLDG  472


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 42/80 (53%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    LSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPR  187
            L  N+L G IP  +  + +L  L L +NELVG IP+ L ++  L  L+LA N L G IP 
Sbjct  321  LHGNKLTGVIPPELGNMSKLSYLQLNDNELVGTIPAELGKLEELFELNLANNNLQGPIPA  380

Query  188  LIYWNEVLQYLGLRGNNLVG  247
             I     L    + GN L G
Sbjct  381  NISSCTALNKFNVYGNKLNG  400



>gb|ACY07616.1| stress-induced protein kinase [Oryza sativa Japonica Group]
Length=980

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFSISKLKQLE LILKNN+L GPIPSTLSQIPNLK LDLAQN+L+G+I
Sbjct  128  LDLSGNLLYGDIPFSISKLKQLEELILKNNQLTGPIPSTLSQIPNLKTLDLAQNQLTGDI  187

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  188  PRLIYWNEVLQYLGLRGNSLTG  209


 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+NE  G IP +I  L+ L  L L  N L G +P+    + +++V+D++ N LSG +
Sbjct  439  LDLSYNEFSGPIPATIGDLEHLPELNLSKNHLDGVVPAEFGNLRSVQVIDMSNNDLSGSL  498

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L  L L  NNLVG
Sbjct  499  PEELGQLQNLDSLTLNNNNLVG  520


 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G IP  + KL++L  L L NN L GPIP+ +S    L   ++  NKL+G I
Sbjct  343  LQLNDNELVGTIPAELGKLEELFELNLANNNLQGPIPANISSCTALNKFNVYGNKLNGSI  402

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  NN  G
Sbjct  403  PAGFQKLESLTYLNLSSNNFKG  424


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 41/77 (53%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N+L G IP    KL+ L  L L +N   G IPS L  I NL  LDL+ N+ SG IP  I 
Sbjct  396  NKLNGSIPAGFQKLESLTYLNLSSNNFKGNIPSELGHIINLDTLDLSYNEFSGPIPATIG  455

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N+L G
Sbjct  456  DLEHLPELNLSKNHLDG  472


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NELVGPIPS L  +     L L  NKL+G I
Sbjct  271  LSLQGNRLTGKIPDVIGLMQALAVLDLSENELVGPIPSILGNLSYTGKLYLHGNKLTGVI  330

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  331  PPELGNMSKLSYLQLNDNELVG  352


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N   G+IP  +  +  L+TL L  NE  GPIP+T+  + +L  L+L++N L G +
Sbjct  415  LNLSSNNFKGNIPSELGHIINLDTLDLSYNEFSGPIPATIGDLEHLPELNLSKNHLDGVV  474

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +Q + +  N+L G
Sbjct  475  PAEFGNLRSVQVIDMSNNDLSG  496


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 42/80 (53%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    LSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPR  187
            L  N+L G IP  +  + +L  L L +NELVG IP+ L ++  L  L+LA N L G IP 
Sbjct  321  LHGNKLTGVIPPELGNMSKLSYLQLNDNELVGTIPAELGKLEELFELNLANNNLQGPIPA  380

Query  188  LIYWNEVLQYLGLRGNNLVG  247
             I     L    + GN L G
Sbjct  381  NISSCTALNKFNVYGNKLNG  400


 Score = 46.6 bits (109),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G +P     L+ ++ + + NN+L G +P  L Q+ NL  L L  N L GEI
Sbjct  463  LNLSKNHLDGVVPAEFGNLRSVQVIDMSNNDLSGSLPEELGQLQNLDSLTLNNNNLVGEI  522

Query  182  P  184
            P
Sbjct  523  P  523



>dbj|BAJ96098.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=977

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN L GDIPFS+SKLK+LETLILKNN+LVG IPSTLSQ+PNLK+LDLAQNKL+GEI
Sbjct  119  LDLSFNNLDGDIPFSVSKLKRLETLILKNNQLVGAIPSTLSQLPNLKILDLAQNKLTGEI  178

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN L G
Sbjct  179  PRLIYWNEVLQYLGLRGNQLEG  200


 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N   G IPF+I  L Q+ TL L+ N+  G IPS +  +  L VLDL+ N+LSG I
Sbjct  239  LDLSYNRFTGSIPFNIGFL-QVATLSLQGNKFTGSIPSVIGLMQALAVLDLSYNQLSGPI  297

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L ++GN L G
Sbjct  298  PSILGNLTYTEKLYMQGNRLTG  319


 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N+L G IP S+ KL+ + +L L +N L GPIP  LS+I NL +LDL+ N ++G IP  I 
Sbjct  387  NKLNGTIPRSLRKLESMTSLNLSSNHLSGPIPIELSRINNLDILDLSCNMITGPIPSAIG  446

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N LVG
Sbjct  447  SLEHLLKLNLSKNALVG  463


 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP  + KL  L  L L NN L GPIP+ +S   NL   +   NKL+G I
Sbjct  334  LELNDNQLTGSIPSELGKLTGLYDLNLANNSLEGPIPNNISSCVNLNSFNAYGNKLNGTI  393

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR +   E +  L L  N+L G
Sbjct  394  PRSLRKLESMTSLNLSSNHLSG  415


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N + G IP +I  L+ L  L L  N LVG IP+    + ++  +DL+ N L G I
Sbjct  430  LDLSCNMITGPIPSAIGSLEHLLKLNLSKNALVGFIPAEFGNLRSIMEIDLSNNHLGGLI  489

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + L  L L  NN+ G
Sbjct  490  PQELGMLQNLMLLKLENNNITG  511


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G IP  +  L   E L ++ N L G IP  L  +  L  L+L  N+L+G I
Sbjct  286  LDLSYNQLSGPIPSILGNLTYTEKLYMQGNRLTGTIPPELGNMSTLHYLELNDNQLTGSI  345

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L L  N+L G
Sbjct  346  PSELGKLTGLYDLNLANNSLEG  367


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+ L L  N + GPIPS +  + +L  L+L++N L G I
Sbjct  406  LNLSSNHLSGPIPIELSRINNLDILDLSCNMITGPIPSAIGSLEHLLKLNLSKNALVGFI  465

Query  182  P  184
            P
Sbjct  466  P  466


 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+  G IP  I  ++ L  L L  N+L GPIPS L  +   + L +  N+L+G I
Sbjct  262  LSLQGNKFTGSIPSVIGLMQALAVLDLSYNQLSGPIPSILGNLTYTEKLYMQGNRLTGTI  321

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N L G
Sbjct  322  PPELGNMSTLHYLELNDNQLTG  343


 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G +   + +L  L    +KNN L G IP T+    + +VLDL+ N+ +G I
Sbjct  191  LGLRGNQLEGTLSPDMCQLTGLWYFDVKNNSLTGEIPETIGNCTSFQVLDLSYNRFTGSI  250

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN   G
Sbjct  251  PFNIGFLQVAT-LSLQGNKFTG  271



>ref|NP_001056687.1| Os06g0130100 [Oryza sativa Japonica Group]
 gb|AAQ01160.1| transmembrane protein kinase [Oryza sativa]
 dbj|BAF18601.1| Os06g0130100 [Oryza sativa Japonica Group]
Length=999

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFSISKLKQLE LILKNN+L GPIPSTLSQIPNLK LDLAQN+L+G+I
Sbjct  128  LDLSGNLLYGDIPFSISKLKQLEELILKNNQLTGPIPSTLSQIPNLKTLDLAQNQLTGDI  187

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  188  PRLIYWNEVLQYLGLRGNSLTG  209


 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+NE  G +P +I  L+ L  L L  N L GP+P+    + +++V+D++ N LSG +
Sbjct  439  LDLSYNEFSGPVPATIGDLEHLLELNLSKNHLDGPVPAEFGNLRSVQVIDMSNNNLSGSL  498

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L  L L  NNLVG
Sbjct  499  PEELGQLQNLDSLILNNNNLVG  520


 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G IP  + KL++L  L L NN L GPIP+ +S    L   ++  NKL+G I
Sbjct  343  LQLNDNELVGTIPAELGKLEELFELNLANNNLQGPIPANISSCTALNKFNVYGNKLNGSI  402

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  NN  G
Sbjct  403  PAGFQKLESLTYLNLSSNNFKG  424


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N   G+IP  +  +  L+TL L  NE  GP+P+T+  + +L  L+L++N L G +
Sbjct  415  LNLSSNNFKGNIPSELGHIINLDTLDLSYNEFSGPVPATIGDLEHLLELNLSKNHLDGPV  474

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +Q + +  NNL G
Sbjct  475  PAEFGNLRSVQVIDMSNNNLSG  496


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NELVGPIPS L  +     L L  NKL+G I
Sbjct  271  LSLQGNRLTGKIPDVIGLMQALAVLDLSENELVGPIPSILGNLSYTGKLYLHGNKLTGVI  330

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  331  PPELGNMSKLSYLQLNDNELVG  352


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 41/77 (53%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N+L G IP    KL+ L  L L +N   G IPS L  I NL  LDL+ N+ SG +P  I 
Sbjct  396  NKLNGSIPAGFQKLESLTYLNLSSNNFKGNIPSELGHIINLDTLDLSYNEFSGPVPATIG  455

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N+L G
Sbjct  456  DLEHLLELNLSKNHLDG  472


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 42/80 (53%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    LSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPR  187
            L  N+L G IP  +  + +L  L L +NELVG IP+ L ++  L  L+LA N L G IP 
Sbjct  321  LHGNKLTGVIPPELGNMSKLSYLQLNDNELVGTIPAELGKLEELFELNLANNNLQGPIPA  380

Query  188  LIYWNEVLQYLGLRGNNLVG  247
             I     L    + GN L G
Sbjct  381  NISSCTALNKFNVYGNKLNG  400



>gb|EEC80197.1| hypothetical protein OsI_22078 [Oryza sativa Indica Group]
Length=930

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN L GDIPFS+SKLK +E+LILKNN+L+G IPSTLSQ+PNLK+LDLAQNKLSGEI
Sbjct  118  LDLSFNSLDGDIPFSVSKLKHIESLILKNNQLIGVIPSTLSQLPNLKILDLAQNKLSGEI  177

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNL G
Sbjct  178  PRLIYWNEVLQYLGLRGNNLEG  199


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G IP  +  L   E L ++ N+L GPIP  L  +  L  L+L  N+LSG I
Sbjct  261  LDLSYNQLSGPIPSILGNLTYTEKLYMQGNKLTGPIPPELGNMSTLHYLELNDNQLSGFI  320

Query  182  P  184
            P
Sbjct  321  P  321


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP    KL  L  L L NN   GPIP  +S   NL   +   N+L+G I
Sbjct  309  LELNDNQLSGFIPPEFGKLTGLFDLNLANNNFEGPIPDNISSCVNLNSFNAYGNRLNGTI  368

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  ++  E + YL L  N L G
Sbjct  369  PPSLHKLESMTYLNLSSNFLSG  390


 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+T  L NN LVG IP+ +  + ++  +D++ N L G I
Sbjct  381  LNLSSNFLSGSIPIELSRINNLDTFNLSNNGLVGFIPAEIGNLRSIMEIDMSNNHLGGLI  440

Query  182  PR  187
            P+
Sbjct  441  PQ  442



>dbj|BAK07025.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=977

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN L GDIPFS+SKLK+LETLILKNN+LVG IPSTLSQ+PNLK+LDLAQNKL+GEI
Sbjct  119  LDLSFNNLDGDIPFSVSKLKRLETLILKNNQLVGAIPSTLSQLPNLKILDLAQNKLTGEI  178

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN L G
Sbjct  179  PRLIYWNEVLQYLGLRGNQLEG  200


 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N   G IPF+I  L Q+ TL L+ N+  G IPS +  +  L VLDL+ N+LSG I
Sbjct  239  LDLSYNRFTGSIPFNIGFL-QVATLSLQGNKFTGSIPSVIGLMQALAVLDLSYNQLSGPI  297

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L ++GN L G
Sbjct  298  PSILGNLTYTEKLYMQGNRLTG  319


 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N+L G IP S+ KL+ + +L L +N L GPIP  LS+I NL +LDL+ N ++G IP  I 
Sbjct  387  NKLNGTIPRSLRKLESMTSLNLSSNHLSGPIPIELSRINNLDILDLSCNMITGPIPSAIG  446

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N LVG
Sbjct  447  SLEHLLKLNLSKNALVG  463


 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP  + KL  L  L L NN L GPIP+ +S   NL   +   NKL+G I
Sbjct  334  LELNDNQLTGSIPSELGKLTGLYDLNLANNSLEGPIPNNISSCVNLNSFNAYGNKLNGTI  393

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR +   E +  L L  N+L G
Sbjct  394  PRSLRKLESMTSLNLSSNHLSG  415


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N + G IP +I  L+ L  L L  N LVG IP+    + ++  +DL+ N L G I
Sbjct  430  LDLSCNMITGPIPSAIGSLEHLLKLNLSKNALVGFIPAEFGNLRSIMEIDLSNNHLGGLI  489

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + L  L L  NN+ G
Sbjct  490  PQELGMLQNLMLLKLENNNITG  511


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G IP  +  L   E L ++ N L G IP  L  +  L  L+L  N+L+G I
Sbjct  286  LDLSYNQLSGPIPSILGNLTYTEKLYMQGNRLTGTIPPELGNMSTLHYLELNDNQLTGSI  345

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L L  N+L G
Sbjct  346  PSELGKLTGLYDLNLANNSLEG  367


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+ L L  N + GPIPS +  + +L  L+L++N L G I
Sbjct  406  LNLSSNHLSGPIPIELSRINNLDILDLSCNMITGPIPSAIGSLEHLLKLNLSKNALVGFI  465

Query  182  P  184
            P
Sbjct  466  P  466


 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+  G IP  I  ++ L  L L  N+L GPIPS L  +   + L +  N+L+G I
Sbjct  262  LSLQGNKFTGSIPSVIGLMQALAVLDLSYNQLSGPIPSILGNLTYTEKLYMQGNRLTGTI  321

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N L G
Sbjct  322  PPELGNMSTLHYLELNDNQLTG  343



>ref|NP_001057087.1| Os06g0203800 [Oryza sativa Japonica Group]
 dbj|BAD35990.1| putative receptor protein kinase [Oryza sativa Japonica Group]
 dbj|BAF19001.1| Os06g0203800 [Oryza sativa Japonica Group]
Length=978

 Score =   143 bits (360),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN L GDIPFS+SKLK +E+LILKNN+L+G IPSTLSQ+PNLK+LDLAQNKLSGEI
Sbjct  118  LDLSFNSLDGDIPFSVSKLKHIESLILKNNQLIGVIPSTLSQLPNLKILDLAQNKLSGEI  177

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNL G
Sbjct  178  PRLIYWNEVLQYLGLRGNNLEG  199


 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G I   I +L  L    +KNN L GPIP T+    + +VLDL+ NKLSG I
Sbjct  190  LGLRGNNLEGSISPDICQLTGLWYFDVKNNSLTGPIPETIGNCTSFQVLDLSYNKLSGSI  249

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN   G
Sbjct  250  PFNIGFLQVAT-LSLQGNMFTG  270


 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 44/77 (57%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N L G IP S+ KL+ +  L L +N L G IP  LS+I NL  LDL+ N ++G IP  I 
Sbjct  386  NRLNGTIPPSLHKLESMTYLNLSSNFLSGSIPIELSRINNLDTLDLSCNMITGPIPSTIG  445

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N LVG
Sbjct  446  SLEHLLRLNLSNNGLVG  462


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G IP  +  L   E L ++ N+L GPIP  L  +  L  L+L  N+LSG I
Sbjct  285  LDLSYNQLSGPIPSILGNLTYTEKLYMQGNKLTGPIPPELGNMSTLHYLELNDNQLSGFI  344

Query  182  P  184
            P
Sbjct  345  P  345


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP    KL  L  L L NN   GPIP  +S   NL   +   N+L+G I
Sbjct  333  LELNDNQLSGFIPPEFGKLTGLFDLNLANNNFEGPIPDNISSCVNLNSFNAYGNRLNGTI  392

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  ++  E + YL L  N L G
Sbjct  393  PPSLHKLESMTYLNLSSNFLSG  414


 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+TL L  N + GPIPST+  + +L  L+L+ N L G I
Sbjct  405  LNLSSNFLSGSIPIELSRINNLDTLDLSCNMITGPIPSTIGSLEHLLRLNLSNNGLVGFI  464

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     +  + +  N+L G
Sbjct  465  PAEIGNLRSIMEIDMSNNHLGG  486



>gb|AFC88469.1| ERECTA [Triticum aestivum]
Length=977

 Score =   142 bits (359),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN L GDIPFS+SKLK +E+LILKNN+L+G IPSTLSQ+PNLK+LDLAQNKLSGEI
Sbjct  119  LDLSFNSLDGDIPFSVSKLKHIESLILKNNQLIGVIPSTLSQLPNLKILDLAQNKLSGEI  178

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGNNL G
Sbjct  179  PRLIYWNEVLQYLGLRGNNLEG  200


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G I   I +L  L    +KNN L GPIP T+    + +VLDL+ NKLSG I
Sbjct  191  LGLRGNNLEGSISPDICQLTGLWYFDVKNNSLTGPIPETIGNCTSFQVLDLSYNKLSGSI  250

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN   G
Sbjct  251  PFNIGFLQVAT-LSLQGNMFTG  271


 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 44/77 (57%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N L G IP S+ KL+ +  L L +N L G IP  LS+I NL  LDL+ N ++G IP  I 
Sbjct  387  NRLNGTIPPSLHKLESMTYLNLSSNFLSGSIPIELSRINNLDTLDLSCNMITGPIPSTIG  446

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N LVG
Sbjct  447  SLEHLLRLNLSNNGLVG  463


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G IP  +  L   E L ++ N+L GPIP  L  +  L  L+L  N+LSG I
Sbjct  286  LDLSYNQLSGPIPSILGNLTYTEKLYMQGNKLTGPIPPELGNMSTLHYLELNDNQLSGFI  345

Query  182  P  184
            P
Sbjct  346  P  346


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP    KL  L  L L NN   GPIP  +S   NL   +   N+L+G I
Sbjct  334  LELNDNQLSGFIPPEFGKLTGLFDLNLANNNFEGPIPDNISSCVNLNSFNAYGNRLNGTI  393

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  ++  E + YL L  N L G
Sbjct  394  PPSLHKLESMTYLNLSSNFLSG  415


 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+TL L  N + GPIPST+  + +L  L+L+ N L G I
Sbjct  406  LNLSSNFLSGSIPIELSRINNLDTLDLSCNMITGPIPSTIGSLEHLLRLNLSNNGLVGFI  465

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     +  + +  N+L G
Sbjct  466  PAEIGNLRSIMEIDMSNNHLGG  487



>ref|XP_006656595.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like [Oryza brachyantha]
Length=984

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFSISKLKQ E LILKNN+L GPIPSTLSQIPNLK LDLAQN+L+G+I
Sbjct  133  LDLSGNLLYGDIPFSISKLKQFEELILKNNQLTGPIPSTLSQIPNLKTLDLAQNQLTGDI  192

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  193  PRLIYWNEVLQYLGLRGNSLTG  214


 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G IP  + KL++L  L L NN L GPIP+ +S    L   ++  NKL+G I
Sbjct  348  LQLNDNELVGTIPAELGKLEELFELNLANNNLQGPIPANISSCTALNKFNVYGNKLNGSI  407

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  NN  G
Sbjct  408  PAGFQKLESLTYLNLSSNNFKG  429


 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+NE  G +P +I  L+ L  L L  N L G +P+    + +++V+D++ N LSG +
Sbjct  444  LDLSYNEFSGPVPATIGDLEHLLELNLSKNHLGGSVPAEFGNLRSIQVIDMSNNNLSGSL  503

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + L  L L  NNLVG
Sbjct  504  PQELGQLQNLDSLILNNNNLVG  525


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+S N L G +P  + +L+ L++LIL NN LVG IP+ L+   +L  L+L+ N LSG +
Sbjct  492  IDMSNNNLSGSLPQELGQLQNLDSLILNNNNLVGEIPAQLANCFSLNTLNLSYNNLSGHV  551

Query  182  P  184
            P
Sbjct  552  P  552


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N   G+IP  +  +  L+TL L  NE  GP+P+T+  + +L  L+L++N L G +
Sbjct  420  LNLSSNNFKGNIPSELGHIINLDTLDLSYNEFSGPVPATIGDLEHLLELNLSKNHLGGSV  479

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +Q + +  NNL G
Sbjct  480  PAEFGNLRSIQVIDMSNNNLSG  501


 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NELVGPIPS L  +     L L  NKL+G I
Sbjct  276  LSLQGNRLTGKIPEVIGLMQALAVLDLSENELVGPIPSILGNLSYTGKLYLHGNKLTGVI  335

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  336  PPELGNMSKLSYLQLNDNELVG  357


 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 41/77 (53%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N+L G IP    KL+ L  L L +N   G IPS L  I NL  LDL+ N+ SG +P  I 
Sbjct  401  NKLNGSIPAGFQKLESLTYLNLSSNNFKGNIPSELGHIINLDTLDLSYNEFSGPVPATIG  460

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N+L G
Sbjct  461  DLEHLLELNLSKNHLGG  477


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G +P     L+ ++ + + NN L G +P  L Q+ NL  L L  N L GEI
Sbjct  468  LNLSKNHLGGSVPAEFGNLRSIQVIDMSNNNLSGSLPQELGQLQNLDSLILNNNNLVGEI  527

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L L  NNL G
Sbjct  528  PAQLANCFSLNTLNLSYNNLSG  549


 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +NELVG IP+ L ++  L  L+LA N L G I
Sbjct  324  LYLHGNKLTGVIPPELGNMSKLSYLQLNDNELVGTIPAELGKLEELFELNLANNNLQGPI  383

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GN L G
Sbjct  384  PANISSCTALNKFNVYGNKLNG  405



>ref|XP_008647408.1| PREDICTED: uncharacterized protein LOC100193598 isoform X2 [Zea 
mays]
Length=993

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD SFN L GDIPFSISKLK LE LILKNN+L+G IPSTLSQ+PNLK+LDLAQNKL+GEI
Sbjct  127  LDFSFNNLDGDIPFSISKLKHLENLILKNNQLIGAIPSTLSQLPNLKILDLAQNKLTGEI  186

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  187  PRLIYWNEVLQYLGLRGNHLEG  208


 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N   G IPF+I  L Q+ TL L+ N+  GPIPS +  +  L VLDL+ N+LSG I
Sbjct  247  LDLSYNRFTGPIPFNIGFL-QVATLSLQGNKFTGPIPSVIGLMQALAVLDLSYNQLSGPI  305

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L ++GN L G
Sbjct  306  PSILGNLTYTEKLYMQGNRLTG  327


 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP  + +L  L  L L NN L GPIP  LS   NL   +   NKL+G I
Sbjct  342  LELNDNQLTGSIPPELGRLTGLFDLNLANNHLEGPIPDNLSSCVNLNSFNAYGNKLNGTI  401

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR +   E + YL L  N + G
Sbjct  402  PRSLRKLESMTYLNLSSNFISG  423


 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N+L G IP S+ KL+ +  L L +N + G IP  LS+I NL  LDL+ N ++G IP  I 
Sbjct  395  NKLNGTIPRSLRKLESMTYLNLSSNFISGSIPIELSRINNLDTLDLSCNMMTGPIPSSIG  454

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N+LVG
Sbjct  455  NLEHLLRLNLSKNDLVG  471


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N + G IP SI  L+ L  L L  N+LVG IP+    + ++  +DL+ N L G I
Sbjct  438  LDLSCNMMTGPIPSSIGNLEHLLRLNLSKNDLVGFIPAEFGNLRSVMEIDLSYNHLGGLI  497

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + L  L L  NN+ G
Sbjct  498  PQELGMLQNLMLLKLENNNITG  519


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N + G IP  +S++  L+TL L  N + GPIPS++  + +L  L+L++N L G I
Sbjct  414  LNLSSNFISGSIPIELSRINNLDTLDLSCNMMTGPIPSSIGNLEHLLRLNLSKNDLVGFI  473

Query  182  P  184
            P
Sbjct  474  P  474


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G IP  +  L   E L ++ N L G IP  L  +  L  L+L  N+L+G I
Sbjct  294  LDLSYNQLSGPIPSILGNLTYTEKLYMQGNRLTGSIPPELGNMSTLHYLELNDNQLTGSI  353

Query  182  P  184
            P
Sbjct  354  P  354


 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 43/82 (52%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G +   + +L  L    +KNN L G IP T+    + +VLDL+ N+ +G I
Sbjct  199  LGLRGNHLEGSLSPDMCQLTGLWYFDVKNNSLTGAIPDTIGNCTSFQVLDLSYNRFTGPI  258

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN   G
Sbjct  259  PFNIGFLQVAT-LSLQGNKFTG  279


 Score = 47.0 bits (110),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+  G IP  I  ++ L  L L  N+L GPIPS L  +   + L +  N+L+G I
Sbjct  270  LSLQGNKFTGPIPSVIGLMQALAVLDLSYNQLSGPIPSILGNLTYTEKLYMQGNRLTGSI  329

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N L G
Sbjct  330  PPELGNMSTLHYLELNDNQLTG  351



>gb|AGT17158.1| ERECTA-like 2 [Saccharum hybrid cultivar R570]
Length=986

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N L GDIPFSISKLKQLE LILKNN+L GPIPSTLSQIPNLK LDLAQNKL+G+I
Sbjct  130  LDLSGNLLNGDIPFSISKLKQLEDLILKNNQLTGPIPSTLSQIPNLKTLDLAQNKLTGDI  189

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  190  PRLIYWNEVLQYLGLRGNSLTG  211


 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S+N++ G+IP++I  L Q+ TL L+ N L+G IP  +  +  L VLDL++N+L G I
Sbjct  250  LDISYNQISGEIPYNIGYL-QVATLSLQGNRLIGKIPEVIGLMQALAVLDLSENELVGPI  308

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++        L L GN L G
Sbjct  309  PPILGNLSYTGKLYLHGNKLTG  330


 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+NE  G +P +I  L+ L  L L  N L G +P+    + +++V+D++ N LSG +
Sbjct  441  LDLSYNEFSGPVPPTIGDLEHLLELNLSKNHLTGSVPAEFGNLRSVQVIDISSNNLSGYL  500

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L  L L  NNLVG
Sbjct  501  PEELGQLQNLDSLILNNNNLVG  522


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G IP  + KL +L  L L NN L G IP+ +S    L   ++  N+L+G I
Sbjct  345  LQLNDNELVGTIPDELGKLTELFELNLANNNLEGHIPANISSCSALNKFNVYGNRLNGSI  404

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  NN  G
Sbjct  405  PAGFQKLESLTYLNLSSNNFKG  426


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 40/77 (52%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N L G IP    KL+ L  L L +N   G IPS L  I NL  LDL+ N+ SG +P  I 
Sbjct  398  NRLNGSIPAGFQKLESLTYLNLSSNNFKGQIPSELGHIVNLDTLDLSYNEFSGPVPPTIG  457

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N+L G
Sbjct  458  DLEHLLELNLSKNHLTG  474


 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NELVGPIP  L  +     L L  NKL+G I
Sbjct  273  LSLQGNRLIGKIPEVIGLMQALAVLDLSENELVGPIPPILGNLSYTGKLYLHGNKLTGHI  332

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  333  PPELGNMSKLSYLQLNDNELVG  354


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 41/80 (51%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    LSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPR  187
            L  N+L G IP  +  + +L  L L +NELVG IP  L ++  L  L+LA N L G IP 
Sbjct  323  LHGNKLTGHIPPELGNMSKLSYLQLNDNELVGTIPDELGKLTELFELNLANNNLEGHIPA  382

Query  188  LIYWNEVLQYLGLRGNNLVG  247
             I     L    + GN L G
Sbjct  383  NISSCSALNKFNVYGNRLNG  402


 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+S N L G +P  + +L+ L++LIL NN LVG IP+ L+   +L  L+L+ N  +G +
Sbjct  489  IDISSNNLSGYLPEELGQLQNLDSLILNNNNLVGEIPAQLANCFSLITLNLSYNNFTGHV  548

Query  182  P  184
            P
Sbjct  549  P  549



>ref|XP_008647407.1| PREDICTED: uncharacterized protein LOC100193598 isoform X1 [Zea 
mays]
 gb|ACN29076.1| unknown [Zea mays]
 gb|AFW76645.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=994

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD SFN L GDIPFSISKLK LE LILKNN+L+G IPSTLSQ+PNLK+LDLAQNKL+GEI
Sbjct  127  LDFSFNNLDGDIPFSISKLKHLENLILKNNQLIGAIPSTLSQLPNLKILDLAQNKLTGEI  186

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  187  PRLIYWNEVLQYLGLRGNHLEG  208


 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N   G IPF+I  L Q+ TL L+ N+  GPIPS +  +  L VLDL+ N+LSG I
Sbjct  247  LDLSYNRFTGPIPFNIGFL-QVATLSLQGNKFTGPIPSVIGLMQALAVLDLSYNQLSGPI  305

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L ++GN L G
Sbjct  306  PSILGNLTYTEKLYMQGNRLTG  327


 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP  + +L  L  L L NN L GPIP  LS   NL   +   NKL+G I
Sbjct  342  LELNDNQLTGSIPPELGRLTGLFDLNLANNHLEGPIPDNLSSCVNLNSFNAYGNKLNGTI  401

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR +   E + YL L  N + G
Sbjct  402  PRSLRKLESMTYLNLSSNFISG  423


 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N+L G IP S+ KL+ +  L L +N + G IP  LS+I NL  LDL+ N ++G IP  I 
Sbjct  395  NKLNGTIPRSLRKLESMTYLNLSSNFISGSIPIELSRINNLDTLDLSCNMMTGPIPSSIG  454

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N+LVG
Sbjct  455  NLEHLLRLNLSKNDLVG  471


 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N + G IP SI  L+ L  L L  N+LVG IP+    + ++  +DL+ N L G I
Sbjct  438  LDLSCNMMTGPIPSSIGNLEHLLRLNLSKNDLVGFIPAEFGNLRSVMEIDLSYNHLGGLI  497

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + L  L L  NN+ G
Sbjct  498  PQELGMLQNLMLLKLENNNITG  519


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N + G IP  +S++  L+TL L  N + GPIPS++  + +L  L+L++N L G I
Sbjct  414  LNLSSNFISGSIPIELSRINNLDTLDLSCNMMTGPIPSSIGNLEHLLRLNLSKNDLVGFI  473

Query  182  P  184
            P
Sbjct  474  P  474


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G IP  +  L   E L ++ N L G IP  L  +  L  L+L  N+L+G I
Sbjct  294  LDLSYNQLSGPIPSILGNLTYTEKLYMQGNRLTGSIPPELGNMSTLHYLELNDNQLTGSI  353

Query  182  P  184
            P
Sbjct  354  P  354


 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 43/82 (52%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G +   + +L  L    +KNN L G IP T+    + +VLDL+ N+ +G I
Sbjct  199  LGLRGNHLEGSLSPDMCQLTGLWYFDVKNNSLTGAIPDTIGNCTSFQVLDLSYNRFTGPI  258

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN   G
Sbjct  259  PFNIGFLQVAT-LSLQGNKFTG  279


 Score = 47.0 bits (110),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+  G IP  I  ++ L  L L  N+L GPIPS L  +   + L +  N+L+G I
Sbjct  270  LSLQGNKFTGPIPSVIGLMQALAVLDLSYNQLSGPIPSILGNLTYTEKLYMQGNRLTGSI  329

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N L G
Sbjct  330  PPELGNMSTLHYLELNDNQLTG  351



>ref|XP_008810292.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X3 [Phoenix dactylifera]
Length=939

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFSISKLKQLE L LKNN+L GPIPSTLSQIPNLK LDLAQN+L+G+I
Sbjct  136  LDLSGNALYGDIPFSISKLKQLEELNLKNNQLTGPIPSTLSQIPNLKTLDLAQNQLTGDI  195

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  196  PRLIYWNEVLQYLGLRGNSLSG  217


 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL++L  L L NN L GPIP  +S    L   ++  N+L+G I
Sbjct  351  LQLNDNKLVGTIPAELGKLEELFELNLANNNLEGPIPQNISSCTALNKFNVHGNRLNGSI  410

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  NNL G
Sbjct  411  PLQFQKLESLTYLNLSRNNLGG  432


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+S N+L G IP  + +L+ ++TLIL NN+L G IP  L+   +L  L+L+ N  SG++
Sbjct  447  IDISCNKLSGPIPEELGQLQNIDTLILNNNDLYGEIPVQLTNCFSLSSLNLSFNNFSGDV  506

Query  182  P  184
            P
Sbjct  507  P  507


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N+L GPIP  L  +  L  L L  NKL G I
Sbjct  303  LDLSENELVGTIPPILGNLSYTGKLYLHGNKLTGPIPPELGNMTKLSYLQLNDNKLVGTI  362

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  NNL G
Sbjct  363  PAELGKLEELFELNLANNNLEG  384


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G +P     L+ ++T+ +  N+L GPIP  L Q+ N+  L L  N L GEI
Sbjct  423  LNLSRNNLGGPLPAEFGNLRSVQTIDISCNKLSGPIPEELGQLQNIDTLILNNNDLYGEI  482

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L L  NN  G
Sbjct  483  PVQLTNCFSLSSLNLSFNNFSG  504


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +N+LVG IP+ L ++  L  L+LA N L G I
Sbjct  327  LYLHGNKLTGPIPPELGNMTKLSYLQLNDNKLVGTIPAELGKLEELFELNLANNNLEGPI  386

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ I     L    + GN L G
Sbjct  387  PQNISSCTALNKFNVHGNRLNG  408


 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 42/77 (55%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N L G IP    KL+ L  L L  N L GP+P+    + +++ +D++ NKLSG IP  + 
Sbjct  404  NRLNGSIPLQFQKLESLTYLNLSRNNLGGPLPAEFGNLRSVQTIDISCNKLSGPIPEELG  463

Query  197  WNEVLQYLGLRGNNLVG  247
              + +  L L  N+L G
Sbjct  464  QLQNIDTLILNNNDLYG  480



>gb|AFW76644.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=898

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD SFN L GDIPFSISKLK LE LILKNN+L+G IPSTLSQ+PNLK+LDLAQNKL+GEI
Sbjct  127  LDFSFNNLDGDIPFSISKLKHLENLILKNNQLIGAIPSTLSQLPNLKILDLAQNKLTGEI  186

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  187  PRLIYWNEVLQYLGLRGNHLEG  208


 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N   G IPF+I  L Q+ TL L+ N+  GPIPS +  +  L VLDL+ N+LSG I
Sbjct  247  LDLSYNRFTGPIPFNIGFL-QVATLSLQGNKFTGPIPSVIGLMQALAVLDLSYNQLSGPI  305

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L ++GN L G
Sbjct  306  PSILGNLTYTEKLYMQGNRLTG  327


 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP  + +L  L  L L NN L GPIP  LS   NL   +   NKL+G I
Sbjct  342  LELNDNQLTGSIPPELGRLTGLFDLNLANNHLEGPIPDNLSSCVNLNSFNAYGNKLNGTI  401

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR +   E + YL L  N + G
Sbjct  402  PRSLRKLESMTYLNLSSNFISG  423


 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N+L G IP S+ KL+ +  L L +N + G IP  LS+I NL  LDL+ N ++G IP  I 
Sbjct  395  NKLNGTIPRSLRKLESMTYLNLSSNFISGSIPIELSRINNLDTLDLSCNMMTGPIPSSIG  454

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N+LVG
Sbjct  455  NLEHLLRLNLSKNDLVG  471


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N + G IP SI  L+ L  L L  N+LVG IP+    + ++  +DL+ N L G I
Sbjct  438  LDLSCNMMTGPIPSSIGNLEHLLRLNLSKNDLVGFIPAEFGNLRSVMEIDLSYNHLGGLI  497

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + L  L L  NN+ G
Sbjct  498  PQELGMLQNLMLLKLENNNITG  519


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N + G IP  +S++  L+TL L  N + GPIPS++  + +L  L+L++N L G I
Sbjct  414  LNLSSNFISGSIPIELSRINNLDTLDLSCNMMTGPIPSSIGNLEHLLRLNLSKNDLVGFI  473

Query  182  P  184
            P
Sbjct  474  P  474


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G IP  +  L   E L ++ N L G IP  L  +  L  L+L  N+L+G I
Sbjct  294  LDLSYNQLSGPIPSILGNLTYTEKLYMQGNRLTGSIPPELGNMSTLHYLELNDNQLTGSI  353

Query  182  P  184
            P
Sbjct  354  P  354


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 43/82 (52%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G +   + +L  L    +KNN L G IP T+    + +VLDL+ N+ +G I
Sbjct  199  LGLRGNHLEGSLSPDMCQLTGLWYFDVKNNSLTGAIPDTIGNCTSFQVLDLSYNRFTGPI  258

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN   G
Sbjct  259  PFNIGFLQVAT-LSLQGNKFTG  279


 Score = 47.0 bits (110),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+  G IP  I  ++ L  L L  N+L GPIPS L  +   + L +  N+L+G I
Sbjct  270  LSLQGNKFTGPIPSVIGLMQALAVLDLSYNQLSGPIPSILGNLTYTEKLYMQGNRLTGSI  329

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N L G
Sbjct  330  PPELGNMSTLHYLELNDNQLTG  351



>ref|XP_002438023.1| hypothetical protein SORBIDRAFT_10g006670 [Sorghum bicolor]
 gb|EER89390.1| hypothetical protein SORBIDRAFT_10g006670 [Sorghum bicolor]
Length=982

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD SFN L GDIPFSISKLK LE LILKNN+L+G IPSTLSQ+PNLK+LDLAQNKL+GEI
Sbjct  122  LDFSFNNLDGDIPFSISKLKHLENLILKNNQLIGAIPSTLSQLPNLKILDLAQNKLTGEI  181

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  182  PRLIYWNEVLQYLGLRGNHLEG  203


 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N   G IPF+I  L Q+ TL L+ N+  GPIPS +  +  L VLDL+ N+LSG I
Sbjct  242  LDLSYNRFTGPIPFNIGFL-QVATLSLQGNKFTGPIPSVIGLMQALAVLDLSYNQLSGPI  300

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L ++GN L G
Sbjct  301  PSILGNLTYTEKLYIQGNKLTG  322


 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP  + +L  L  L L NN L GPIP  LS   NL   +   NKL+G I
Sbjct  337  LELNDNQLTGSIPPELGRLTGLFDLNLANNHLEGPIPDNLSSCVNLNSFNAYGNKLNGTI  396

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR +   E + YL L  N + G
Sbjct  397  PRSLRKLESMTYLNLSSNFISG  418


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N+L G IP S+ KL+ +  L L +N + G IP  LS+I NL  LDL+ N ++G IP  I 
Sbjct  390  NKLNGTIPRSLRKLESMTYLNLSSNFISGSIPIELSRINNLDTLDLSCNMMTGPIPSSIG  449

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N LVG
Sbjct  450  SLEHLLRLNLSKNGLVG  466


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N + G IP SI  L+ L  L L  N LVG IP+    + ++  +DL+ N L G I
Sbjct  433  LDLSCNMMTGPIPSSIGSLEHLLRLNLSKNGLVGFIPAEFGNLRSVMEIDLSYNHLGGLI  492

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + L  L L  NN+ G
Sbjct  493  PQELEMLQNLMLLKLENNNITG  514


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N + G IP  +S++  L+TL L  N + GPIPS++  + +L  L+L++N L G I
Sbjct  409  LNLSSNFISGSIPIELSRINNLDTLDLSCNMMTGPIPSSIGSLEHLLRLNLSKNGLVGFI  468

Query  182  P  184
            P
Sbjct  469  P  469


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 36/61 (59%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G IP  +  L   E L ++ N+L G IP  L  +  L  L+L  N+L+G I
Sbjct  289  LDLSYNQLSGPIPSILGNLTYTEKLYIQGNKLTGSIPPELGNMSTLHYLELNDNQLTGSI  348

Query  182  P  184
            P
Sbjct  349  P  349


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+  G IP  I  ++ L  L L  N+L GPIPS L  +   + L +  NKL+G I
Sbjct  265  LSLQGNKFTGPIPSVIGLMQALAVLDLSYNQLSGPIPSILGNLTYTEKLYIQGNKLTGSI  324

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N L G
Sbjct  325  PPELGNMSTLHYLELNDNQLTG  346



>gb|AFW76643.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=1034

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD SFN L GDIPFSISKLK LE LILKNN+L+G IPSTLSQ+PNLK+LDLAQNKL+GEI
Sbjct  167  LDFSFNNLDGDIPFSISKLKHLENLILKNNQLIGAIPSTLSQLPNLKILDLAQNKLTGEI  226

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  227  PRLIYWNEVLQYLGLRGNHLEG  248


 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N   G IPF+I  L Q+ TL L+ N+  GPIPS +  +  L VLDL+ N+LSG I
Sbjct  287  LDLSYNRFTGPIPFNIGFL-QVATLSLQGNKFTGPIPSVIGLMQALAVLDLSYNQLSGPI  345

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L ++GN L G
Sbjct  346  PSILGNLTYTEKLYMQGNRLTG  367


 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP  + +L  L  L L NN L GPIP  LS   NL   +   NKL+G I
Sbjct  382  LELNDNQLTGSIPPELGRLTGLFDLNLANNHLEGPIPDNLSSCVNLNSFNAYGNKLNGTI  441

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR +   E + YL L  N + G
Sbjct  442  PRSLRKLESMTYLNLSSNFISG  463


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N+L G IP S+ KL+ +  L L +N + G IP  LS+I NL  LDL+ N ++G IP  I 
Sbjct  435  NKLNGTIPRSLRKLESMTYLNLSSNFISGSIPIELSRINNLDTLDLSCNMMTGPIPSSIG  494

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N+LVG
Sbjct  495  NLEHLLRLNLSKNDLVG  511


 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N + G IP SI  L+ L  L L  N+LVG IP+    + ++  +DL+ N L G I
Sbjct  478  LDLSCNMMTGPIPSSIGNLEHLLRLNLSKNDLVGFIPAEFGNLRSVMEIDLSYNHLGGLI  537

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + L  L L  NN+ G
Sbjct  538  PQELGMLQNLMLLKLENNNITG  559


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N + G IP  +S++  L+TL L  N + GPIPS++  + +L  L+L++N L G I
Sbjct  454  LNLSSNFISGSIPIELSRINNLDTLDLSCNMMTGPIPSSIGNLEHLLRLNLSKNDLVGFI  513

Query  182  P  184
            P
Sbjct  514  P  514


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G IP  +  L   E L ++ N L G IP  L  +  L  L+L  N+L+G I
Sbjct  334  LDLSYNQLSGPIPSILGNLTYTEKLYMQGNRLTGSIPPELGNMSTLHYLELNDNQLTGSI  393

Query  182  P  184
            P
Sbjct  394  P  394


 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 43/82 (52%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G +   + +L  L    +KNN L G IP T+    + +VLDL+ N+ +G I
Sbjct  239  LGLRGNHLEGSLSPDMCQLTGLWYFDVKNNSLTGAIPDTIGNCTSFQVLDLSYNRFTGPI  298

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN   G
Sbjct  299  PFNIGFLQVAT-LSLQGNKFTG  319


 Score = 47.0 bits (110),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+  G IP  I  ++ L  L L  N+L GPIPS L  +   + L +  N+L+G I
Sbjct  310  LSLQGNKFTGPIPSVIGLMQALAVLDLSYNQLSGPIPSILGNLTYTEKLYMQGNRLTGSI  369

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N L G
Sbjct  370  PPELGNMSTLHYLELNDNQLTG  391



>ref|XP_008810291.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Phoenix dactylifera]
Length=987

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFSISKLKQLE L LKNN+L GPIPSTLSQIPNLK LDLAQN+L+G+I
Sbjct  136  LDLSGNALYGDIPFSISKLKQLEELNLKNNQLTGPIPSTLSQIPNLKTLDLAQNQLTGDI  195

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  196  PRLIYWNEVLQYLGLRGNSLSG  217


 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL++L  L L NN L GPIP  +S    L   ++  N+L+G I
Sbjct  351  LQLNDNKLVGTIPAELGKLEELFELNLANNNLEGPIPQNISSCTALNKFNVHGNRLNGSI  410

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL    NN  G
Sbjct  411  PLQFQKLESLTYLNFSSNNFKG  432


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+S N+L G IP  + +L+ ++TLIL NN+L G IP  L+   +L  L+L+ N  SG++
Sbjct  495  IDISCNKLSGPIPEELGQLQNIDTLILNNNDLYGEIPVQLTNCFSLSSLNLSFNNFSGDV  554

Query  182  P  184
            P
Sbjct  555  P  555


 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G IP SI  L+ L  L L  N L GP+P+    + +++ +D++ NKLSG I
Sbjct  447  LDLSNNHFSGPIPDSIGDLEHLLELNLSRNNLGGPLPAEFGNLRSVQTIDISCNKLSGPI  506

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + +  L L  N+L G
Sbjct  507  PEELGQLQNIDTLILNNNDLYG  528


 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N+L GPIP  L  +  L  L L  NKL G I
Sbjct  303  LDLSENELVGTIPPILGNLSYTGKLYLHGNKLTGPIPPELGNMTKLSYLQLNDNKLVGTI  362

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  NNL G
Sbjct  363  PAELGKLEELFELNLANNNLEG  384


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G +P     L+ ++T+ +  N+L GPIP  L Q+ N+  L L  N L GEI
Sbjct  471  LNLSRNNLGGPLPAEFGNLRSVQTIDISCNKLSGPIPEELGQLQNIDTLILNNNDLYGEI  530

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L L  NN  G
Sbjct  531  PVQLTNCFSLSSLNLSFNNFSG  552


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 43/80 (54%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    LSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPR  187
            L  N+L G IP  +  + +L  L L +N+LVG IP+ L ++  L  L+LA N L G IP+
Sbjct  329  LHGNKLTGPIPPELGNMTKLSYLQLNDNKLVGTIPAELGKLEELFELNLANNNLEGPIPQ  388

Query  188  LIYWNEVLQYLGLRGNNLVG  247
             I     L    + GN L G
Sbjct  389  NISSCTALNKFNVHGNRLNG  408


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 38/77 (49%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N L G IP    KL+ L  L   +N   G +P  L +I NL  LDL+ N  SG IP  I 
Sbjct  404  NRLNGSIPLQFQKLESLTYLNFSSNNFKGKVPWELGRIINLDTLDLSNNHFSGPIPDSIG  463

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  NNL G
Sbjct  464  DLEHLLELNLSRNNLGG  480


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+ S N   G +P+ + ++  L+TL L NN   GPIP ++  + +L  L+L++N L G +
Sbjct  423  LNFSSNNFKGKVPWELGRIINLDTLDLSNNHFSGPIPDSIGDLEHLLELNLSRNNLGGPL  482

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +Q + +  N L G
Sbjct  483  PAEFGNLRSVQTIDISCNKLSG  504



>ref|XP_008810290.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Phoenix dactylifera]
Length=1017

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFSISKLKQLE L LKNN+L GPIPSTLSQIPNLK LDLAQN+L+G+I
Sbjct  136  LDLSGNALYGDIPFSISKLKQLEELNLKNNQLTGPIPSTLSQIPNLKTLDLAQNQLTGDI  195

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  196  PRLIYWNEVLQYLGLRGNSLSG  217


 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL++L  L L NN L GPIP  +S    L   ++  N+L+G I
Sbjct  351  LQLNDNKLVGTIPAELGKLEELFELNLANNNLEGPIPQNISSCTALNKFNVHGNRLNGSI  410

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL    NN  G
Sbjct  411  PLQFQKLESLTYLNFSSNNFKG  432


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+S N+L G IP  + +L+ ++TLIL NN+L G IP  L+   +L  L+L+ N  SG++
Sbjct  495  IDISCNKLSGPIPEELGQLQNIDTLILNNNDLYGEIPVQLTNCFSLSSLNLSFNNFSGDV  554

Query  182  P  184
            P
Sbjct  555  P  555


 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G IP SI  L+ L  L L  N L GP+P+    + +++ +D++ NKLSG I
Sbjct  447  LDLSNNHFSGPIPDSIGDLEHLLELNLSRNNLGGPLPAEFGNLRSVQTIDISCNKLSGPI  506

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + +  L L  N+L G
Sbjct  507  PEELGQLQNIDTLILNNNDLYG  528


 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N+L GPIP  L  +  L  L L  NKL G I
Sbjct  303  LDLSENELVGTIPPILGNLSYTGKLYLHGNKLTGPIPPELGNMTKLSYLQLNDNKLVGTI  362

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  NNL G
Sbjct  363  PAELGKLEELFELNLANNNLEG  384


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G +P     L+ ++T+ +  N+L GPIP  L Q+ N+  L L  N L GEI
Sbjct  471  LNLSRNNLGGPLPAEFGNLRSVQTIDISCNKLSGPIPEELGQLQNIDTLILNNNDLYGEI  530

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L L  NN  G
Sbjct  531  PVQLTNCFSLSSLNLSFNNFSG  552


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +N+LVG IP+ L ++  L  L+LA N L G I
Sbjct  327  LYLHGNKLTGPIPPELGNMTKLSYLQLNDNKLVGTIPAELGKLEELFELNLANNNLEGPI  386

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ I     L    + GN L G
Sbjct  387  PQNISSCTALNKFNVHGNRLNG  408


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 38/77 (49%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N L G IP    KL+ L  L   +N   G +P  L +I NL  LDL+ N  SG IP  I 
Sbjct  404  NRLNGSIPLQFQKLESLTYLNFSSNNFKGKVPWELGRIINLDTLDLSNNHFSGPIPDSIG  463

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  NNL G
Sbjct  464  DLEHLLELNLSRNNLGG  480


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+ S N   G +P+ + ++  L+TL L NN   GPIP ++  + +L  L+L++N L G +
Sbjct  423  LNFSSNNFKGKVPWELGRIINLDTLDLSNNHFSGPIPDSIGDLEHLLELNLSRNNLGGPL  482

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +Q + +  N L G
Sbjct  483  PAEFGNLRSVQTIDISCNKLSG  504



>ref|XP_006858024.1| hypothetical protein AMTR_s00069p00198500 [Amborella trichopoda]
 gb|ERN19491.1| hypothetical protein AMTR_s00069p00198500 [Amborella trichopoda]
Length=977

 Score =   139 bits (350),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFSISKLKQLE LILKNN+L GPIPSTLSQIPNLK LDLAQN+L G+I
Sbjct  118  LDLSSNALYGDIPFSISKLKQLEELILKNNQLTGPIPSTLSQIPNLKTLDLAQNRLIGDI  177

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLR N L G
Sbjct  178  PRLIYWNEVLQYLGLRSNVLTG  199


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLS N+L G IP  + +L+ + +LIL NN+L G IPS L+   +L  L+L+ N LSG +
Sbjct  477  VDLSCNKLVGGIPPELGQLQNIGSLILNNNQLHGEIPSQLANCFSLNTLNLSYNNLSGSV  536

Query  182  PRL  190
            P L
Sbjct  537  PDL  539


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N+  G IP  + ++  L+TL L +N+  G IPS++  + +L  L+L++N+L+G +
Sbjct  405  LNLSSNKFKGTIPVELGRIVNLDTLDLSDNDFSGSIPSSVGDLEHLLELNLSRNRLNGYV  464

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +Q + L  N LVG
Sbjct  465  PSEFGNLRSVQVVDLSCNKLVG  486


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL++L  L L NN L GPIP  +S    L   ++  N L+G I
Sbjct  333  LQLNDNQLVGGIPPELGKLEELFELNLANNYLEGPIPENISSCTALNQFNVHGNSLNGTI  392

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  N   G
Sbjct  393  PSKFENLESLTYLNLSSNKFKG  414


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G +P     L+ ++ + L  N+LVG IP  L Q+ N+  L L  N+L GEI
Sbjct  453  LNLSRNRLNGYVPSEFGNLRSVQVVDLSCNKLVGGIPPELGQLQNIGSLILNNNQLHGEI  512

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L L  NNL G
Sbjct  513  PSQLANCFSLNTLNLSYNNLSG  534


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+  G IP S+  L+ L  L L  N L G +PS    + +++V+DL+ NKL G I
Sbjct  429  LDLSDNDFSGSIPSSVGDLEHLLELNLSRNRLNGYVPSEFGNLRSVQVVDLSCNKLVGGI  488

Query  182  P  184
            P
Sbjct  489  P  489


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 40/82 (49%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NELVG IP  L  +     L L  NKL+G I
Sbjct  261  LSLQGNRLSGKIPEVIGLMQALAVLDLSENELVGTIPPILGNLSYTGKLYLHSNKLTGHI  320

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  321  PPELGNMTKLSYLQLNDNQLVG  342



>ref|XP_010277441.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Nelumbo nucifera]
Length=962

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N  YGDIPFS+SKLKQLE L LKNN+L GPIPSTLSQ+PNLK LDLA N+L+GEI
Sbjct  130  LDLSDNSFYGDIPFSLSKLKQLEDLTLKNNQLTGPIPSTLSQLPNLKTLDLAHNQLTGEI  189

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  190  PRLIYWNEVLQYLGLRGNSLTG  211


 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L NNELVG IP+ L ++  L  L+LA N L G I
Sbjct  321  LYLHGNKLTGPIPPELGNMSKLSYLQLNNNELVGGIPAELGKLGGLFELNLANNNLEGPI  380

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ I +   L    + GN L G
Sbjct  381  PQNISFCTALNQFNVHGNRLSG  402


 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N   G IP  + ++  L+TL L +N+  GP+P+ +  + +L  LD++ NKLSG I
Sbjct  417  LNLSSNNFKGKIPVQLGRIINLDTLDLSSNDFSGPVPALIGDLEHLLTLDMSFNKLSGRI  476

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + +  L L  NNL G
Sbjct  477  PEELGQLQNIVSLILNNNNLHG  498


 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G IP  + KL  L  L L NN L GPIP  +S    L   ++  N+LSG I
Sbjct  345  LQLNNNELVGGIPAELGKLGGLFELNLANNNLEGPIPQNISFCTALNQFNVHGNRLSGPI  404

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        L YL L  NN  G
Sbjct  405  PSGFRNLGSLTYLNLSSNNFKG  426


 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+SFN+L G IP  + +L+ + +LIL NN L G IP+ L    +L  ++++ N LSG+I
Sbjct  465  LDMSFNKLSGRIPEELGQLQNIVSLILNNNNLHGEIPTQLINCFSLVEMNVSFNNLSGDI  524

Query  182  PRL  190
            P +
Sbjct  525  PAI  527


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  I  ++ L  L L  NELVGPIP  L  +     L L  NKL+G I
Sbjct  273  LSLQGNKLTGRIPEVIGLMQALAVLDLSENELVGPIPPILGNLSYTGKLYLHGNKLTGPI  332

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  333  PPELGNMSKLSYLQLNNNELVG  354


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+  G +P  I  L+ L TL +  N+L G IP  L Q+ N+  L L  N L GEI
Sbjct  441  LDLSSNDFSGPVPALIGDLEHLLTLDMSFNKLSGRIPEELGQLQNIVSLILNNNNLHGEI  500

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  + +  NNL G
Sbjct  501  PTQLINCFSLVEMNVSFNNLSG  522



>ref|XP_010277439.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Nelumbo nucifera]
Length=986

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N  YGDIPFS+SKLKQLE L LKNN+L GPIPSTLSQ+PNLK LDLA N+L+GEI
Sbjct  130  LDLSDNSFYGDIPFSLSKLKQLEDLTLKNNQLTGPIPSTLSQLPNLKTLDLAHNQLTGEI  189

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  190  PRLIYWNEVLQYLGLRGNSLTG  211


 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L NNELVG IP+ L ++  L  L+LA N L G I
Sbjct  321  LYLHGNKLTGPIPPELGNMSKLSYLQLNNNELVGGIPAELGKLGGLFELNLANNNLEGPI  380

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ I +   L    + GN L G
Sbjct  381  PQNISFCTALNQFNVHGNRLSG  402


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+  G +P  I  L+ L TL L  N L GP+P     + +++V+D++ NKLSG I
Sbjct  441  LDLSSNDFSGPVPALIGDLEHLLTLNLSKNCLNGPVPVEFGNLRSVQVIDMSFNKLSGRI  500

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + +  L L  NNL G
Sbjct  501  PEELGQLQNIVSLILNNNNLHG  522


 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G IP  + KL  L  L L NN L GPIP  +S    L   ++  N+LSG I
Sbjct  345  LQLNNNELVGGIPAELGKLGGLFELNLANNNLEGPIPQNISFCTALNQFNVHGNRLSGPI  404

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        L YL L  NN  G
Sbjct  405  PSGFRNLGSLTYLNLSSNNFKG  426


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  I  ++ L  L L  NELVGPIP  L  +     L L  NKL+G I
Sbjct  273  LSLQGNKLTGRIPEVIGLMQALAVLDLSENELVGPIPPILGNLSYTGKLYLHGNKLTGPI  332

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  333  PPELGNMSKLSYLQLNNNELVG  354


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+SFN+L G IP  + +L+ + +LIL NN L G IP+ L    +L  ++++ N LSG+I
Sbjct  489  IDMSFNKLSGRIPEELGQLQNIVSLILNNNNLHGEIPTQLINCFSLVEMNVSFNNLSGDI  548

Query  182  PRL  190
            P +
Sbjct  549  PAI  551



>ref|XP_010277442.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X3 [Nelumbo nucifera]
 ref|XP_010277443.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X3 [Nelumbo nucifera]
Length=947

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N  YGDIPFS+SKLKQLE L LKNN+L GPIPSTLSQ+PNLK LDLA N+L+GEI
Sbjct  91   LDLSDNSFYGDIPFSLSKLKQLEDLTLKNNQLTGPIPSTLSQLPNLKTLDLAHNQLTGEI  150

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  151  PRLIYWNEVLQYLGLRGNSLTG  172


 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L NNELVG IP+ L ++  L  L+LA N L G I
Sbjct  282  LYLHGNKLTGPIPPELGNMSKLSYLQLNNNELVGGIPAELGKLGGLFELNLANNNLEGPI  341

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ I +   L    + GN L G
Sbjct  342  PQNISFCTALNQFNVHGNRLSG  363


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+  G +P  I  L+ L TL L  N L GP+P     + +++V+D++ NKLSG I
Sbjct  402  LDLSSNDFSGPVPALIGDLEHLLTLNLSKNCLNGPVPVEFGNLRSVQVIDMSFNKLSGRI  461

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + +  L L  NNL G
Sbjct  462  PEELGQLQNIVSLILNNNNLHG  483


 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G IP  + KL  L  L L NN L GPIP  +S    L   ++  N+LSG I
Sbjct  306  LQLNNNELVGGIPAELGKLGGLFELNLANNNLEGPIPQNISFCTALNQFNVHGNRLSGPI  365

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        L YL L  NN  G
Sbjct  366  PSGFRNLGSLTYLNLSSNNFKG  387


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  I  ++ L  L L  NELVGPIP  L  +     L L  NKL+G I
Sbjct  234  LSLQGNKLTGRIPEVIGLMQALAVLDLSENELVGPIPPILGNLSYTGKLYLHGNKLTGPI  293

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  294  PPELGNMSKLSYLQLNNNELVG  315


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+SFN+L G IP  + +L+ + +LIL NN L G IP+ L    +L  ++++ N LSG+I
Sbjct  450  IDMSFNKLSGRIPEELGQLQNIVSLILNNNNLHGEIPTQLINCFSLVEMNVSFNNLSGDI  509

Query  182  PRL  190
            P +
Sbjct  510  PAI  512



>gb|KEH43759.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=993

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+LYGDIPFSISKLKQLE L LKNN+L GPIPSTLSQIPNLK LDLA+NKL GEI
Sbjct  138  LDLSDNQLYGDIPFSISKLKQLEFLNLKNNQLTGPIPSTLSQIPNLKTLDLARNKLIGEI  197

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQYLGLRGN L G
Sbjct  198  PRLLYWNEVLQYLGLRGNMLTG  219


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G+IP    KL+ L  L L NN L G IP  +S    L   ++  N+LSG I
Sbjct  353  LQLNGNQLVGEIPKEFGKLENLFELNLANNHLEGSIPHNISSCTALNQFNVHGNQLSGSI  412

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  NN  G
Sbjct  413  PTTFRNLESLTYLNLSANNFKG  434


 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G +P S+  L+ L TL L +N L GP+ + L  + +++ +D++ N LSG I
Sbjct  449  LDLSSNNFSGHVPASVGYLEHLLTLNLSHNHLEGPLSAELGNLRSIQTMDMSFNNLSGSI  508

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I   + L  L L  N+L G
Sbjct  509  PPEIGQLQNLASLTLNNNDLHG  530


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+SFN L G IP  I +L+ L +L L NN+L G IP  L+   +L  L+ + N  SG +
Sbjct  497  MDMSFNNLSGSIPPEIGQLQNLASLTLNNNDLHGKIPEQLTNCFSLSTLNFSYNNFSGVV  556

Query  182  P  184
            P
Sbjct  557  P  557


 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  N+LVGPIP  L  +     L L  N L+G I
Sbjct  281  LSLQGNRLTGKIPEVIGLMQALAILDLSENQLVGPIPPILGNLSFTGKLYLHGNILTGSI  340

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L GN LVG
Sbjct  341  PPELGNMSKLSYLQLNGNQLVG  362



>gb|EMT11370.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Aegilops 
tauschii]
Length=1019

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN L GDIPFS+SKLK LETLILKNN+LVG IPSTLSQ+PNLK+LDLAQNKLSGEI
Sbjct  119  LDLSFNNLDGDIPFSVSKLKHLETLILKNNQLVGAIPSTLSQLPNLKILDLAQNKLSGEI  178

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYL L  N+L G
Sbjct  179  PRLIYWNEVLQYLDLSYNHLTG  200


 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N L G IPF+I  L Q+ TL L+ N+  GPIPS +  +  L VLDL+ N+LSG I
Sbjct  191  LDLSYNHLTGSIPFNIGFL-QVATLSLQGNKFTGPIPSVIGLMQALAVLDLSYNQLSGPI  249

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L ++GN L G
Sbjct  250  PSILGNLSYTEKLYMQGNRLTG  271


 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N+L G IP S+ KL+ + +L L +N L GPIP  LS+I NL +LDL+ N ++G IP  I 
Sbjct  339  NKLNGTIPRSLCKLESMTSLNLSSNHLSGPIPIELSRINNLDILDLSCNMITGPIPSAIG  398

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N LVG
Sbjct  399  SLEHLLKLNLSKNALVG  415


 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP  + KL  L  L L NN L GPIP+ +S   NL   +   NKL+G I
Sbjct  286  LELNDNQLTGSIPSELGKLTGLYDLNLANNSLEGPIPNNISSCVNLNSFNAHGNKLNGTI  345

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR +   E +  L L  N+L G
Sbjct  346  PRSLCKLESMTSLNLSSNHLSG  367


 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N + G IP +I  L+ L  L L  N LVG IP+    + ++  +DL+ N L G I
Sbjct  382  LDLSCNMITGPIPSAIGSLEHLLKLNLSKNALVGFIPAEFGNLRSIGEIDLSNNHLGGLI  441

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + L  L L  NN+ G
Sbjct  442  PQELGMLQNLMLLKLENNNITG  463


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G IP  +  L   E L ++ N L G IP  L  +  L  L+L  N+L+G I
Sbjct  238  LDLSYNQLSGPIPSILGNLSYTEKLYMQGNRLTGTIPPELGNMSTLHYLELNDNQLTGSI  297

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L L  N+L G
Sbjct  298  PSELGKLTGLYDLNLANNSLEG  319


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+ L L  N + GPIPS +  + +L  L+L++N L G I
Sbjct  358  LNLSSNHLSGPIPIELSRINNLDILDLSCNMITGPIPSAIGSLEHLLKLNLSKNALVGFI  417

Query  182  P  184
            P
Sbjct  418  P  418



>ref|XP_009398741.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Musa acuminata subsp. malaccensis]
Length=996

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPF +SKLKQLE L LKNN+L GPIPSTLSQIPNLK LDLAQN+L+GEI
Sbjct  144  LDLSGNALYGDIPFLLSKLKQLEELNLKNNKLTGPIPSTLSQIPNLKTLDLAQNQLTGEI  203

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  204  PRLIYWNEVLQYLGLRGNSLTG  225


 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S+N++ G+IP++I  L Q+ TL L+ N L+G IP  +  +  L VLDL++N+L G I
Sbjct  264  LDISYNQITGEIPYNIGFL-QVATLSLQGNRLIGKIPDVIGLMQALAVLDLSENELVGTI  322

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++        L L GN L G
Sbjct  323  PPILGNLSYTGKLYLHGNKLTG  344


 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+  G IP S+  L+ L  L L  N+L G +P+    + +++V+D++ NKLSG+I
Sbjct  455  LDLSDNDFSGPIPDSVGDLEHLLVLNLSRNDLAGRLPAEFGNLRSVQVIDMSYNKLSGKI  514

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L  L L  NNL G
Sbjct  515  PEELGQLQYLDTLILNNNNLYG  536


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+S+N+L G IP  + +L+ L+TLIL NN L G IP+ L+   +L  L+L+ N  SG+I
Sbjct  503  IDMSYNKLSGKIPEELGQLQYLDTLILNNNNLYGEIPAQLANCFSLTSLNLSFNNFSGDI  562

Query  182  P  184
            P
Sbjct  563  P  563


 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL++L  L L NN L GPIP  +S    L   ++  N+L+G I
Sbjct  359  LQLNDNQLVGSIPEELGKLEELFELNLANNCLEGPIPRNISSCTALNKFNVCGNRLNGSI  418

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL    NN  G
Sbjct  419  PLEFQKLESLTYLNFSLNNFNG  440


 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+ S N   G+IP  + ++  L+TL L +N+  GPIP ++  + +L VL+L++N L+G +
Sbjct  431  LNFSLNNFNGEIPSELGRIVNLDTLDLSDNDFSGPIPDSVGDLEHLLVLNLSRNDLAGRL  490

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +Q + +  N L G
Sbjct  491  PAEFGNLRSVQVIDMSYNKLSG  512


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 38/77 (49%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N L G IP    KL+ L  L    N   G IPS L +I NL  LDL+ N  SG IP  + 
Sbjct  412  NRLNGSIPLEFQKLESLTYLNFSLNNFNGEIPSELGRIVNLDTLDLSDNDFSGPIPDSVG  471

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N+L G
Sbjct  472  DLEHLLVLNLSRNDLAG  488


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 42/80 (53%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    LSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPR  187
            L  N+L G IP  +  + +L  L L +N+LVG IP  L ++  L  L+LA N L G IPR
Sbjct  337  LHGNKLTGPIPPELGNMTKLSYLQLNDNQLVGSIPEELGKLEELFELNLANNCLEGPIPR  396

Query  188  LIYWNEVLQYLGLRGNNLVG  247
             I     L    + GN L G
Sbjct  397  NISSCTALNKFNVCGNRLNG  416


 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 40/82 (49%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N+L GPIP  L  +  L  L L  N+L G I
Sbjct  311  LDLSENELVGTIPPILGNLSYTGKLYLHGNKLTGPIPPELGNMTKLSYLQLNDNQLVGSI  370

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N L G
Sbjct  371  PEELGKLEELFELNLANNCLEG  392



>gb|KHG06831.1| LRR receptor-like serine/threonine-protein kinase ERL2 [Gossypium 
arboreum]
Length=991

 Score =   137 bits (345),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFSISKLK+LE L LKNN+L GPIPSTL+QIPNLK LDLA+N+LSGEI
Sbjct  132  LDLSDNLLYGDIPFSISKLKRLEFLNLKNNQLTGPIPSTLTQIPNLKTLDLARNRLSGEI  191

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN L+G
Sbjct  192  PRLIYWNEVLQYLGLRGNMLIG  213


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N L G IP  + KL+QL  L L NN L GPIP  +S    L   ++  N+L+G I
Sbjct  347  LQLNDNHLVGSIPSELGKLEQLFELNLANNHLEGPIPHNISSCTALNKFNVHGNRLNGTI  406

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  NN  G
Sbjct  407  PPGFQNLESLTYLNLSLNNFKG  428


 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLSFN + G+IP    +L+ + +LILKNN+L G IP  L+   +L  L+++ N LSG I
Sbjct  491  IDLSFNCITGNIPVEFGQLQNIVSLILKNNKLQGEIPEQLTNCFSLTNLNVSYNNLSGVI  550

Query  182  P  184
            P
Sbjct  551  P  551


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +N LVG IPS L ++  L  L+LA N L G I
Sbjct  323  LYLHGNKLTGPIPPELGNMSKLSYLQLNDNHLVGSIPSELGKLEQLFELNLANNHLEGPI  382

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GN L G
Sbjct  383  PHNISSCTALNKFNVHGNRLNG  404


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N   G +P  +  +  L+TL L  N   GP+P+++ ++ +L  L+L+ NKL G++
Sbjct  419  LNLSLNNFKGRVPVELGHIINLDTLDLSGNNFSGPLPASIGELEHLLTLNLSDNKLDGQL  478

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +Q + L  N + G
Sbjct  479  PAEFGNLRSIQIIDLSFNCITG  500


 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 40/82 (49%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N+L GPIP  L  +  L  L L  N L G I
Sbjct  299  LDLSENELVGHIPPVLGNLSFTGKLYLHGNKLTGPIPPELGNMSKLSYLQLNDNHLVGSI  358

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N+L G
Sbjct  359  PSELGKLEQLFELNLANNHLEG  380


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G+IP  I  ++ L  L L  NELVG IP  L  +     L L  NKL+G I
Sbjct  275  LSLQGNKLTGNIPEVIGLMQALAVLDLSENELVGHIPPVLGNLSFTGKLYLHGNKLTGPI  334

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N+LVG
Sbjct  335  PPELGNMSKLSYLQLNDNHLVG  356



>gb|AFJ14786.1| ERECTA-like kinase [Oryza sativa Japonica Group]
Length=986

 Score =   136 bits (343),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N L GDIPFSISKLK LE LILKNN+LVG IPSTLSQ+PNLK+LDLAQNKL+GEI
Sbjct  120  LDLSSNNLGGDIPFSISKLKHLENLILKNNQLVGMIPSTLSQLPNLKILDLAQNKLNGEI  179

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLR NNL G
Sbjct  180  PRLIYWNEVLQYLGLRSNNLEG  201


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP  + KL  L  L L NN L GPIP  +S   NL   +   NKL+G +
Sbjct  335  LELNDNQLTGFIPPELGKLTGLFDLNLANNNLEGPIPDNISSCMNLISFNAYGNKLNGTV  394

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR ++  E + YL L  N L G
Sbjct  395  PRSLHKLESITYLNLSSNYLSG  416


 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N+L G +P S+ KL+ +  L L +N L G IP  L+++ NL  LDL+ N ++G IP  I 
Sbjct  388  NKLNGTVPRSLHKLESITYLNLSSNYLSGAIPIELAKMKNLGTLDLSCNMVAGPIPSAIG  447

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L    NNLVG
Sbjct  448  SLEHLLRLNFSNNNLVG  464


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N + G IP +I  L+ L  L   NN LVG IP+    + ++  +DL+ N L G I
Sbjct  431  LDLSCNMVAGPIPSAIGSLEHLLRLNFSNNNLVGYIPAEFGNLRSIMEIDLSSNHLGGLI  490

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + L  L L  NN+ G
Sbjct  491  PQEVGMLQNLILLKLESNNITG  512


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G +   + +L  L    +KNN L G IP T+    + +VLDL+ N+L+GEI
Sbjct  192  LGLRSNNLEGSLSPEMCQLTGLWYFDVKNNSLTGIIPDTIGNCTSFQVLDLSYNRLTGEI  251

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GNN  G
Sbjct  252  PFNIGFLQVAT-LSLQGNNFSG  272


 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN+L G IP  +  L   E L L+ N L G IP  L  +  L  L+L  N+L+G I
Sbjct  287  LDLSFNQLSGPIPSILGNLTYTEKLYLQGNRLTGSIPPELGNMSTLHYLELNDNQLTGFI  346

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L L  NNL G
Sbjct  347  PPELGKLTGLFDLNLANNNLEG  368


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  ++K+K L TL L  N + GPIPS +  + +L  L+ + N L G I
Sbjct  407  LNLSSNYLSGAIPIELAKMKNLGTLDLSCNMVAGPIPSAIGSLEHLLRLNFSNNNLVGYI  466

Query  182  P  184
            P
Sbjct  467  P  467


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 47/105 (45%), Gaps = 23/105 (22%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLK-----------------------QLETLILKNNELVGPIP  112
            LDLS+N L G+IPF+I  L+                        L  L L  N+L GPIP
Sbjct  240  LDLSYNRLTGEIPFNIGFLQVATLSLQGNNFSGPIPSVIGLMQALAVLDLSFNQLSGPIP  299

Query  113  STLSQIPNLKVLDLAQNKLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
            S L  +   + L L  N+L+G IP  +     L YL L  N L G
Sbjct  300  SILGNLTYTEKLYLQGNRLTGSIPPELGNMSTLHYLELNDNQLTG  344



>ref|XP_011029995.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Populus euphratica]
Length=984

 Score =   136 bits (342),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFSISKLKQL+TL LKNN+L GPIPSTL+QIPNLK LDLA+N+L+GEI
Sbjct  126  LDLSDNLLYGDIPFSISKLKQLDTLNLKNNQLTGPIPSTLTQIPNLKTLDLAKNQLTGEI  185

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNE+LQYLGLRGN L G
Sbjct  186  PRLIYWNEILQYLGLRGNLLTG  207


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLSFN + G IP  + +L+ + TLIL NN+L G IP  L+   +L  L+ + N LSG +
Sbjct  485  IDLSFNNVTGSIPVELGQLQNIVTLILNNNDLQGEIPDQLTNCFSLANLNFSYNNLSGIV  544

Query  182  P  184
            P
Sbjct  545  P  545


 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L +NELVGPIP  L  +     L L  NKL+G I
Sbjct  269  LSLQGNSLTGRIPEVIGLMQALAVLDLSDNELVGPIPPILGNLSYTGKLYLHGNKLTGPI  328

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  329  PPELGNMSKLSYLQLNDNQLVG  350


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  +  L+QL  L L NN L GPIP+ +S    L  L++  N LSG I
Sbjct  341  LQLNDNQLVGRIPPELGMLEQLFELNLANNHLEGPIPNNISSCRALNQLNVYGNHLSGII  400

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
                   E L YL L  N+  G
Sbjct  401  ASGFKGLESLTYLNLSSNDFKG  422


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N+L GPIP  L  +  L  L L  N+L G I
Sbjct  293  LDLSDNELVGPIPPILGNLSYTGKLYLHGNKLTGPIPPELGNMSKLSYLQLNDNQLVGRI  352

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N+L G
Sbjct  353  PPELGMLEQLFELNLANNHLEG  374



>ref|XP_002322426.1| PTH-1 family protein [Populus trichocarpa]
 gb|EEF06553.1| PTH-1 family protein [Populus trichocarpa]
Length=870

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFS+SKLKQL+TL LKNN+L GPIPSTL+QIPNLK LDLA+N+L+GEI
Sbjct  91   LDLSGNLLYGDIPFSLSKLKQLDTLNLKNNQLTGPIPSTLTQIPNLKTLDLAKNQLTGEI  150

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN L G
Sbjct  151  PRLIYWNEVLQYLGLRGNLLTG  172


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL QL  L L NN L GPIP  +S    L   ++  N LSG I
Sbjct  306  LQLNDNQLVGSIPPELGKLGQLFELNLANNHLEGPIPHNISFCRALNQFNVHGNHLSGII  365

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  N+  G
Sbjct  366  PSGFKDLESLTYLNLSSNDFKG  387


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L +NELVGPIP+ L  +     L L  NKL+G I
Sbjct  234  LSLQGNNLTGRIPEVIGLMQALAVLDLSDNELVGPIPAILGNLSYTGKLYLHGNKLTGPI  293

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  294  PPELGNMSKLSYLQLNDNQLVG  315


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G +   I +L  L    +++N+L G IPS++    + ++LD++ N+ +GEI
Sbjct  163  LGLRGNLLTGTLSEDICQLTGLWYFDVRDNKLTGTIPSSIGNCTSFEILDISYNQFTGEI  222

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GNNL G
Sbjct  223  PYNIGFLQVAT-LSLQGNNLTG  243



>ref|XP_006490262.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like [Citrus sinensis]
Length=965

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            ++LS N LYGDIPFSISKLKQLE L LKNN+L GPIPSTL+QIPNLK LDLA+N+L+GEI
Sbjct  113  IELSDNSLYGDIPFSISKLKQLEFLNLKNNQLTGPIPSTLTQIPNLKTLDLARNQLTGEI  172

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN L G
Sbjct  173  PRLIYWNEVLQYLGLRGNALTG  194


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  + KL+QL  L L +N L GPIP  +S    L   ++  N+LSG I
Sbjct  328  LQLQNNQLVGTIPAELGKLEQLFELNLADNNLEGPIPHNISSCTALNQFNVHGNRLSGAI  387

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        L YL L  NN  G
Sbjct  388  PSSFRNLGSLTYLNLSRNNFKG  409


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L+NN+LVG IP+ L ++  L  L+LA N L G I
Sbjct  304  LYLHGNKLTGPIPPELGNMSKLSYLQLQNNQLVGTIPAELGKLEQLFELNLADNNLEGPI  363

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GN L G
Sbjct  364  PHNISSCTALNQFNVHGNRLSG  385


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+SFN+L G IP  + +L+ + +LIL NN L G IP  LS   +L  L+++ N LSG I
Sbjct  472  IDMSFNQLSGSIPAELGQLQNIISLILNNNNLQGGIPDQLSNCFSLSNLNVSYNNLSGII  531

Query  182  P  184
            P
Sbjct  532  P  532


 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  I  ++ L  L L  NELVGPIP  L  +     L L  NKL+G I
Sbjct  256  LSLQGNKLTGKIPEVIGLMQALAVLDLSENELVGPIPPILGNLSYTGKLYLHGNKLTGPI  315

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L+ N LVG
Sbjct  316  PPELGNMSKLSYLQLQNNQLVG  337


 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G +P SI  L+ L TL L  N L G +P+    + +++ +D++ N+LSG I
Sbjct  424  LDLSVNNFSGSVPASIGDLEHLLTLNLSRNHLNGLLPAKFGNLRSIQTIDMSFNQLSGSI  483

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + +  L L  NNL G
Sbjct  484  PAELGQLQNIISLILNNNNLQG  505


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N+L GPIP  L  +  L  L L  N+L G I
Sbjct  280  LDLSENELVGPIPPILGNLSYTGKLYLHGNKLTGPIPPELGNMSKLSYLQLQNNQLVGTI  339

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  NNL G
Sbjct  340  PAELGKLEQLFELNLADNNLEG  361



>gb|KDO65362.1| hypothetical protein CISIN_1g002278mg [Citrus sinensis]
Length=943

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            ++LS N LYGDIPFSISKLKQLE L LKNN+L GPIPSTL+QIPNLK LDLA+N+L+GEI
Sbjct  91   IELSDNSLYGDIPFSISKLKQLEFLNLKNNQLTGPIPSTLTQIPNLKTLDLARNQLTGEI  150

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN L G
Sbjct  151  PRLIYWNEVLQYLGLRGNALTG  172


 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  + KL+QL  L L +N L GPIP  +S    L   ++  N+LSG I
Sbjct  306  LQLQNNQLVGTIPAELGKLEQLFELNLADNNLEGPIPHNISSCTALNQFNVHGNRLSGAI  365

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        L YL L  NN  G
Sbjct  366  PSSFRNLGSLTYLNLSRNNFKG  387


 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L+NN+LVG IP+ L ++  L  L+LA N L G I
Sbjct  282  LYLHGNKLTGPIPPELGNMSKLSYLQLQNNQLVGTIPAELGKLEQLFELNLADNNLEGPI  341

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GN L G
Sbjct  342  PHNISSCTALNQFNVHGNRLSG  363


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+SFN+L G IP  + +L+ + +LIL NN L G IP  LS   +L  L+++ N LSG I
Sbjct  450  IDMSFNQLSGSIPAELGQLQNIISLILNNNNLQGGIPDQLSNCFSLSNLNVSYNNLSGII  509

Query  182  P  184
            P
Sbjct  510  P  510


 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  I  ++ L  L L  NELVGPIP  L  +     L L  NKL+G I
Sbjct  234  LSLQGNKLTGKIPEVIGLMQALAVLDLSENELVGPIPPILGNLSYTGKLYLHGNKLTGPI  293

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L+ N LVG
Sbjct  294  PPELGNMSKLSYLQLQNNQLVG  315


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G +P SI  L+ L TL L  N L G +P+    + +++ +D++ N+LSG I
Sbjct  402  LDLSVNNFSGSVPASIGDLEHLLTLNLSRNHLNGLLPAEFGNLRSIQTIDMSFNQLSGSI  461

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + +  L L  NNL G
Sbjct  462  PAELGQLQNIISLILNNNNLQG  483


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N+L GPIP  L  +  L  L L  N+L G I
Sbjct  258  LDLSENELVGPIPPILGNLSYTGKLYLHGNKLTGPIPPELGNMSKLSYLQLQNNQLVGTI  317

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  NNL G
Sbjct  318  PAELGKLEQLFELNLADNNLEG  339



>ref|XP_002318267.2| PTH-1 family protein [Populus trichocarpa]
 gb|EEE96487.2| PTH-1 family protein [Populus trichocarpa]
Length=984

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGD+PFSISKLKQL+TL LKNN+L GPIPSTL+QIPNLK LDLA+N+L+GEI
Sbjct  126  LDLSDNLLYGDMPFSISKLKQLDTLNLKNNQLTGPIPSTLTQIPNLKTLDLAKNQLTGEI  185

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN L G
Sbjct  186  PRLIYWNEVLQYLGLRGNLLTG  207


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+SFN + G IP  + +L+ + TLIL NN+L G IP  L+   +L  L+ + N LSG +
Sbjct  485  IDMSFNNVTGSIPVELGQLQNIVTLILNNNDLQGEIPDQLTNCFSLANLNFSYNNLSGIV  544

Query  182  P  184
            P
Sbjct  545  P  545


 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L +NELVGPIP  L  +     L L  NKL+G I
Sbjct  269  LSLQGNSLTGKIPEVIGLMQALAVLDLSDNELVGPIPPILGNLSYTGKLYLHGNKLTGPI  328

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  329  PPELGNMSKLSYLQLNDNQLVG  350


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  +  L+QL  L L NN L GPIP+ +S    L  L++  N LSG I
Sbjct  341  LQLNDNQLVGRIPPELGMLEQLFELNLANNHLEGPIPNNISSCRALNQLNVYGNHLSGII  400

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
                   E L YL L  N+  G
Sbjct  401  ASGFKGLESLTYLNLSSNDFKG  422


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N+L GPIP  L  +  L  L L  N+L G I
Sbjct  293  LDLSDNELVGPIPPILGNLSYTGKLYLHGNKLTGPIPPELGNMSKLSYLQLNDNQLVGRI  352

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N+L G
Sbjct  353  PPELGMLEQLFELNLANNHLEG  374



>ref|XP_011041677.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Populus euphratica]
Length=982

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFS+SKLKQL+TL LKNN+L GPIPSTL+QIPNLK LDLA+N+L+GEI
Sbjct  129  LDLSGNLLYGDIPFSLSKLKQLDTLNLKNNQLTGPIPSTLTQIPNLKTLDLAKNQLTGEI  188

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN L G
Sbjct  189  PRLIYWNEVLQYLGLRGNLLTG  210


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +NELVG IP  L ++  L  L+LA N L G I
Sbjct  320  LYLHGNKLTGPIPPELGNMSKLSYLQLNDNELVGSIPPELGKLGQLFELNLANNHLEGPI  379

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I +   L    + GN+L G
Sbjct  380  PHNISFCRALNQFNVHGNHLNG  401


 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G IP  + KL QL  L L NN L GPIP  +S    L   ++  N L+G I
Sbjct  344  LQLNDNELVGSIPPELGKLGQLFELNLANNHLEGPIPHNISFCRALNQFNVHGNHLNGII  403

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  N+  G
Sbjct  404  PSGFKDLESLTYLNLSSNDFKG  425


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L +NEL GPIP+ L  +     L L  NKL+G I
Sbjct  272  LSLQGNNLTGRIPEVIGLMQALAVLDLSDNELAGPIPAILGNLSYTGKLYLHGNKLTGPI  331

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  332  PPELGNMSKLSYLQLNDNELVG  353


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G +   I +L  L    +++N+L G IPS++    + ++LD++ N+ +GEI
Sbjct  201  LGLRGNLLTGTLSEDICQLTGLWYFDVRDNKLTGTIPSSIGNCTSFEILDISYNQFTGEI  260

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GNNL G
Sbjct  261  PYNIGFLQVAT-LSLQGNNLTG  281


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 39/77 (51%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N L G IP     L+ L  L L +N+  G +P  L +I NL  LDL+ N  SG IP L  
Sbjct  397  NHLNGIIPSGFKDLESLTYLNLSSNDFKGSVPVELGRIINLDTLDLSSNNFSGPIPALFG  456

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  NNL G
Sbjct  457  DLEHLLTLNLSRNNLHG  473



>ref|XP_006588387.1| PREDICTED: ERECTA-like kinase isoform X1 [Glycine max]
 gb|KHN02765.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Glycine 
soja]
Length=993

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+LYGDIPFS+SKLKQLE L LK+N+L GPIPSTLSQIPNLK LDLA+N+LSGEI
Sbjct  136  LDLSDNQLYGDIPFSLSKLKQLELLNLKSNQLTGPIPSTLSQIPNLKTLDLARNRLSGEI  195

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR++YWNEVLQYLGLRGN L G
Sbjct  196  PRILYWNEVLQYLGLRGNMLSG  217


 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 44/76 (58%), Gaps = 2/76 (3%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN + G IP  I +L+ L +L + +N+L G IP  L+   +L  L+L+ N LSG I
Sbjct  495  LDLSFNNISGSIPPEIGQLQNLMSLFMNHNDLRGKIPDQLTNCFSLTSLNLSYNNLSGVI  554

Query  182  PRL--IYWNEVLQYLG  223
            P +    W     +LG
Sbjct  555  PSMKNFSWFSADSFLG  570


 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G +P S+  L+ L TL L +N L G +P+    + ++++LDL+ N +SG I
Sbjct  447  LDLSSNNFSGHVPASVGYLEHLLTLNLSHNHLDGSLPAEFGNLRSIEILDLSFNNISGSI  506

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I   + L  L +  N+L G
Sbjct  507  PPEIGQLQNLMSLFMNHNDLRG  528


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 40/82 (49%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N L G+IP    KL+ L  L L NN L G IP  +S    L   ++  N+LSG I
Sbjct  351  LQLNDNGLVGNIPNEFGKLEHLFELNLANNHLDGTIPHNISSCTALNQFNVHGNQLSGSI  410

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L  L L  NN  G
Sbjct  411  PLSFRSLESLTCLNLSSNNFKG  432



>ref|XP_004496653.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like [Cicer arietinum]
Length=986

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFSISKLKQLE L LKNN+L GPIPSTL+QIPNLK LDLA+N+L+GEI
Sbjct  141  LDLSDNLLYGDIPFSISKLKQLEFLNLKNNQLTGPIPSTLTQIPNLKTLDLARNRLTGEI  200

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQYLGLRGN L G
Sbjct  201  PRLLYWNEVLQYLGLRGNMLTG  222


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+SFN L G IP  I +L+ L +LIL NN+L G IP  LS   +L  L+ + N  +G +
Sbjct  500  IDMSFNNLSGSIPPEIGQLQNLASLILNNNDLHGKIPDQLSNCFSLSSLNFSYNNFTGVV  559

Query  182  PRL  190
            P +
Sbjct  560  PSM  562


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G +P S+  L+ L TL L +N L GP+ +    + +++++D++ N LSG I
Sbjct  452  LDLSSNNFSGHVPASVGYLEHLLTLNLSHNHLDGPLSAEFGNLRSIQIIDMSFNNLSGSI  511

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I   + L  L L  N+L G
Sbjct  512  PPEIGQLQNLASLILNNNDLHG  533


 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP    KL+ L  L L NN L G IP  +S    L   ++  N+LSG I
Sbjct  356  LQLNDNQLVGKIPNEFGKLELLFELNLANNRLDGSIPHNISSCTALNQFNVHGNQLSGSI  415

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  NN  G
Sbjct  416  PLSFRSLESLTYLNLSANNFKG  437


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NELVGPIP  L  +     L L  NKL+G I
Sbjct  284  LSLQGNRLTGKIPDVIGLMQALAILDLSENELVGPIPPILGNLSFTGKLYLHGNKLTGSI  343

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  344  PPELGNMSKLSYLQLNDNQLVG  365


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +N+LVG IP+   ++  L  L+LA N+L G I
Sbjct  332  LYLHGNKLTGSIPPELGNMSKLSYLQLNDNQLVGKIPNEFGKLELLFELNLANNRLDGSI  391

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GN L G
Sbjct  392  PHNISSCTALNQFNVHGNQLSG  413


 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G +   I +L  L    ++ N L G IP ++    N ++LD++ N++SGEI
Sbjct  213  LGLRGNMLTGTLSPDICQLTGLWYFDVRGNNLTGTIPESIGNCTNFEILDISYNQISGEI  272

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN L G
Sbjct  273  PYNIGFLQVAT-LSLQGNRLTG  293



>ref|XP_006588388.1| PREDICTED: ERECTA-like kinase isoform X2 [Glycine max]
Length=989

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+LYGDIPFS+SKLKQLE L LK+N+L GPIPSTLSQIPNLK LDLA+N+LSGEI
Sbjct  136  LDLSDNQLYGDIPFSLSKLKQLELLNLKSNQLTGPIPSTLSQIPNLKTLDLARNRLSGEI  195

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR++YWNEVLQYLGLRGN L G
Sbjct  196  PRILYWNEVLQYLGLRGNMLSG  217


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 44/76 (58%), Gaps = 2/76 (3%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN + G IP  I +L+ L +L + +N+L G IP  L+   +L  L+L+ N LSG I
Sbjct  495  LDLSFNNISGSIPPEIGQLQNLMSLFMNHNDLRGKIPDQLTNCFSLTSLNLSYNNLSGVI  554

Query  182  PRL--IYWNEVLQYLG  223
            P +    W     +LG
Sbjct  555  PSMKNFSWFSADSFLG  570


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G +P S+  L+ L TL L +N L G +P+    + ++++LDL+ N +SG I
Sbjct  447  LDLSSNNFSGHVPASVGYLEHLLTLNLSHNHLDGSLPAEFGNLRSIEILDLSFNNISGSI  506

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I   + L  L +  N+L G
Sbjct  507  PPEIGQLQNLMSLFMNHNDLRG  528


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 40/82 (49%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N L G+IP    KL+ L  L L NN L G IP  +S    L   ++  N+LSG I
Sbjct  351  LQLNDNGLVGNIPNEFGKLEHLFELNLANNHLDGTIPHNISSCTALNQFNVHGNQLSGSI  410

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L  L L  NN  G
Sbjct  411  PLSFRSLESLTCLNLSSNNFKG  432



>ref|XP_006649092.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Oryza brachyantha]
Length=999

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N L GDIPFS+SKLK LE LILKNN+LVG IPSTLSQ+PNLK+LDLAQNKL+GEI
Sbjct  132  LDLSSNNLEGDIPFSMSKLKHLENLILKNNQLVGMIPSTLSQLPNLKILDLAQNKLNGEI  191

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLR NNL G
Sbjct  192  PRLIYWNEVLQYLGLRSNNLEG  213


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP  + KL  L  L L  N L GPIP+ +S   NL   +   NKL+G I
Sbjct  347  LELNDNKLTGFIPSELGKLTGLFDLNLAKNNLEGPIPNNISSCINLISFNAYGNKLNGTI  406

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR ++  E + YL L  NN  G
Sbjct  407  PRSLHKLESITYLNLSSNNFSG  428


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N+L G IP S+ KL+ +  L L +N   G IP  L+++ NL  LDL+ N + G IP +I 
Sbjct  400  NKLNGTIPRSLHKLESITYLNLSSNNFSGAIPIELARMKNLDTLDLSCNMVDGSIPSVIG  459

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  NNLVG
Sbjct  460  SLEHLLRLNLSYNNLVG  476


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G +   I +L  L    +KNN L G IP T+    + +VLDL+ N+L+GEI
Sbjct  204  LGLRSNNLEGSLSPEICQLTGLWYFDVKNNSLTGKIPDTIGNCTSFQVLDLSYNRLTGEI  263

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GNN  G
Sbjct  264  PFNIGFLQVAT-LSLQGNNFSG  284


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN+L G IP  +  L   E L L+ N L G IP  L  +  L  L+L  NKL+G I
Sbjct  299  LDLSFNQLSGPIPSILGNLTYTEKLYLQGNRLTGSIPPELGNMSTLHYLELNDNKLTGFI  358

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L L  NNL G
Sbjct  359  PSELGKLTGLFDLNLAKNNLEG  380


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N + G IP  I  L+ L  L L  N LVG IP+    + ++  +DL+ N L G I
Sbjct  443  LDLSCNMVDGSIPSVIGSLEHLLRLNLSYNNLVGYIPAEFGNLRSIMEIDLSSNHLGGLI  502

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + L  L L  NNL G
Sbjct  503  PQEVGMLQNLILLKLESNNLTG  524


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 47/105 (45%), Gaps = 23/105 (22%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLK-----------------------QLETLILKNNELVGPIP  112
            LDLS+N L G+IPF+I  L+                        L  L L  N+L GPIP
Sbjct  252  LDLSYNRLTGEIPFNIGFLQVATLSLQGNNFSGPIPSVIGLMQALAVLDLSFNQLSGPIP  311

Query  113  STLSQIPNLKVLDLAQNKLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
            S L  +   + L L  N+L+G IP  +     L YL L  N L G
Sbjct  312  SILGNLTYTEKLYLQGNRLTGSIPPELGNMSTLHYLELNDNKLTG  356



>ref|XP_010940921.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Elaeis guineensis]
Length=988

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFSISKLKQLE L LKNN+L+GPIPSTLSQIP+LK LDLAQN+L+G+I
Sbjct  136  LDLSGNALYGDIPFSISKLKQLEELNLKNNQLIGPIPSTLSQIPSLKTLDLAQNQLTGDI  195

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+LIYWNEVLQYLGLRGN L G
Sbjct  196  PQLIYWNEVLQYLGLRGNLLSG  217


 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+S+N+L G IP  + +L+ ++TLIL NN+L G IP  L+   +L  L+L+ N  SG++
Sbjct  495  IDISYNKLSGPIPEELGQLQTIDTLILNNNDLYGEIPVQLTNCFSLSSLNLSFNNFSGDV  554

Query  182  P  184
            P
Sbjct  555  P  555


 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G IP SI  L+ L  L L  N L GP+P+    + +++ +D++ NKLSG I
Sbjct  447  LDLSNNHFSGPIPDSIGDLEHLLELNLSRNNLNGPLPAEFGNLRSVQTIDISYNKLSGPI  506

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + +  L L  N+L G
Sbjct  507  PEELGQLQTIDTLILNNNDLYG  528


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL++L  L L NN L GPIP  +S    L   ++  N+L+G I
Sbjct  351  LQLNDNKLVGTIPAELGKLEELFELNLANNNLEGPIPQNISLCTALNKFNVHGNRLNGSI  410

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL    NN  G
Sbjct  411  PLQFQKLESLTYLNFSSNNFKG  432


 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N+L GPIP  L  +  L  L L  NKL G I
Sbjct  303  LDLSENELVGTIPPILGNLSYTGKLYLHGNKLTGPIPPELGNMTKLSYLQLNDNKLVGTI  362

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  NNL G
Sbjct  363  PAELGKLEELFELNLANNNLEG  384


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 43/80 (54%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    LSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPR  187
            L  N+L G IP  +  + +L  L L +N+LVG IP+ L ++  L  L+LA N L G IP+
Sbjct  329  LHGNKLTGPIPPELGNMTKLSYLQLNDNKLVGTIPAELGKLEELFELNLANNNLEGPIPQ  388

Query  188  LIYWNEVLQYLGLRGNNLVG  247
             I     L    + GN L G
Sbjct  389  NISLCTALNKFNVHGNRLNG  408


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 38/77 (49%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N L G IP    KL+ L  L   +N   G +P  L +I NL  LDL+ N  SG IP  I 
Sbjct  404  NRLNGSIPLQFQKLESLTYLNFSSNNFKGKVPWELGRIINLDTLDLSNNHFSGPIPDSIG  463

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  NNL G
Sbjct  464  DLEHLLELNLSRNNLNG  480


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G +P     L+ ++T+ +  N+L GPIP  L Q+  +  L L  N L GEI
Sbjct  471  LNLSRNNLNGPLPAEFGNLRSVQTIDISYNKLSGPIPEELGQLQTIDTLILNNNDLYGEI  530

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L L  NN  G
Sbjct  531  PVQLTNCFSLSSLNLSFNNFSG  552


 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+ S N   G +P+ + ++  L+TL L NN   GPIP ++  + +L  L+L++N L+G +
Sbjct  423  LNFSSNNFKGKVPWELGRIINLDTLDLSNNHFSGPIPDSIGDLEHLLELNLSRNNLNGPL  482

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +Q + +  N L G
Sbjct  483  PAEFGNLRSVQTIDISYNKLSG  504



>ref|XP_006421768.1| hypothetical protein CICLE_v10004259mg [Citrus clementina]
 gb|ESR35008.1| hypothetical protein CICLE_v10004259mg [Citrus clementina]
Length=943

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            ++LS N LYGDIPFS+SKLKQLE L LKNN+L GPIPSTL+QIPNLK LDLA+N+L+GEI
Sbjct  91   IELSDNSLYGDIPFSMSKLKQLEFLNLKNNQLTGPIPSTLTQIPNLKTLDLARNQLTGEI  150

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN L G
Sbjct  151  PRLIYWNEVLQYLGLRGNALTG  172


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  + KL+QL  L L +N L GP+P  +S    L   ++  N+LSG I
Sbjct  306  LQLQNNQLVGTIPAELGKLEQLFELNLADNNLEGPVPHNISSCTALNQFNVHGNRLSGAI  365

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        L YL L  NN  G
Sbjct  366  PSSFRNLGSLTYLNLSRNNFKG  387


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L+NN+LVG IP+ L ++  L  L+LA N L G +
Sbjct  282  LYLHGNKLTGPIPPELGNMSKLSYLQLQNNQLVGTIPAELGKLEQLFELNLADNNLEGPV  341

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GN L G
Sbjct  342  PHNISSCTALNQFNVHGNRLSG  363


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  I  ++ L  L L  NELVGPIP  L  +     L L  NKL+G I
Sbjct  234  LSLQGNKLTGKIPEVIGLMQALAVLDLSENELVGPIPPILGNLSYTGKLYLHGNKLTGPI  293

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L+ N LVG
Sbjct  294  PPELGNMSKLSYLQLQNNQLVG  315


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+SFN+L   IP  + +L+ + +LIL NN L G IP  LS   +L  L+++ N LSG I
Sbjct  450  IDMSFNQLSASIPAELGQLQNVISLILNNNNLQGGIPDQLSNCFSLSNLNVSYNNLSGII  509

Query  182  P  184
            P
Sbjct  510  P  510


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N+L GPIP  L  +  L  L L  N+L G I
Sbjct  258  LDLSENELVGPIPPILGNLSYTGKLYLHGNKLTGPIPPELGNMSKLSYLQLQNNQLVGTI  317

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  NNL G
Sbjct  318  PAELGKLEQLFELNLADNNLEG  339



>ref|XP_007038488.1| ERECTA-like 1 [Theobroma cacao]
 gb|EOY22989.1| ERECTA-like 1 [Theobroma cacao]
Length=991

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFSISKLKQLE L LKNN+L GPIPSTL+QIP LK+LDLA+N+L+GEI
Sbjct  134  LDLSDNLLYGDIPFSISKLKQLEFLNLKNNQLTGPIPSTLTQIPYLKILDLARNQLTGEI  193

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN L G
Sbjct  194  PRLIYWNEVLQYLGLRGNKLTG  215


 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDL+ N+  G IP SI  L+ L TL L +NEL GP+P+    + +++++DL+ N L G I
Sbjct  445  LDLTGNKFSGAIPASIGDLEHLLTLNLSSNELNGPLPAECGNLRSIQIMDLSFNSLCGNI  504

Query  182  P  184
            P
Sbjct  505  P  505


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLSFN L G+IP  + +L+ + +LIL NN+L G IP  L+   +L  L+++ N LSG I
Sbjct  493  MDLSFNSLCGNIPAELGQLQNIVSLILNNNKLQGEIPEQLTNCFSLANLNVSYNNLSGII  552

Query  182  P  184
            P
Sbjct  553  P  553


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  I  ++ L  L L  NELVGPIPS L  +     L L  NKL+G I
Sbjct  277  LSLQGNKLTGKIPEVIGLMQALAVLDLSENELVGPIPSILGNLSYTGKLYLHGNKLTGPI  336

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  337  PPELGNMSKLSYLQLNDNQLVG  358


 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL QL  L L NN L GPIP  +S    L   ++  N+L+G I
Sbjct  349  LQLNDNQLVGTIPAELGKLVQLFELNLANNYLEGPIPHNISSCTALNQFNVHGNRLNGSI  408

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  N+  G
Sbjct  409  PLGFRTLESLTYLNLSMNDFKG  430


 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS NEL G +P     L+ ++ + L  N L G IP+ L Q+ N+  L L  NKL GEI
Sbjct  469  LNLSSNELNGPLPAECGNLRSIQIMDLSFNSLCGNIPAELGQLQNIVSLILNNNKLQGEI  528

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L +  NNL G
Sbjct  529  PEQLTNCFSLANLNVSYNNLSG  550


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +N+LVG IP+ L ++  L  L+LA N L G I
Sbjct  325  LYLHGNKLTGPIPPELGNMSKLSYLQLNDNQLVGTIPAELGKLVQLFELNLANNYLEGPI  384

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GN L G
Sbjct  385  PHNISSCTALNQFNVHGNRLNG  406



>gb|ADM86148.1| leucine-rich repeat receptor-like kinase [Populus nigra x Populus 
x canadensis]
Length=947

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFSISKLKQL+TL LKNN+L GPIPSTL+QIPNLK L+LA+N+L+GEI
Sbjct  91   LDLSDNLLYGDIPFSISKLKQLDTLNLKNNQLTGPIPSTLTQIPNLKTLNLAKNQLTGEI  150

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN L G
Sbjct  151  PRLIYWNEVLQYLGLRGNLLTG  172


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+SFN + G IP  + +L+ + TLIL NN+L G IP  L+   +L  L+ + N LSG +
Sbjct  450  IDMSFNNVTGSIPVELGQLQNIVTLILNNNDLQGEIPDQLTNCFSLANLNFSYNNLSGIV  509

Query  182  P  184
            P
Sbjct  510  P  510


 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L +NELVGPIP  L  +     L L  NKL+G I
Sbjct  234  LSLQGNSLTGKIPEVIGLMQALAVLDLSDNELVGPIPPILGNLSYTGKLYLHGNKLTGPI  293

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  294  PPELGNMSKLSYLQLNDNQLVG  315


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  +  L+QL  L L NN L GPIP+ +S    L  L++  N LSG I
Sbjct  306  LQLNDNQLVGRIPPELGMLEQLFELNLANNHLEGPIPNNISSCRALNQLNVYGNHLSGII  365

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
                   E L YL L  N+  G
Sbjct  366  ASGFKGLESLTYLNLSSNDFKG  387


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N+L GPIP  L  +  L  L L  N+L G I
Sbjct  258  LDLSDNELVGPIPPILGNLSYTGKLYLHGNKLTGPIPPELGNMSKLSYLQLNDNQLVGRI  317

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N+L G
Sbjct  318  PPELGMLEQLFELNLANNHLEG  339



>gb|KJB39364.1| hypothetical protein B456_007G009000 [Gossypium raimondii]
 gb|KJB39365.1| hypothetical protein B456_007G009000 [Gossypium raimondii]
Length=993

 Score =   134 bits (337),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFSIS+LK+LE L LKNN+L GPIPSTL+QIPNLK LDLA+N+L GEI
Sbjct  134  LDLSDNLLYGDIPFSISRLKRLEFLNLKNNQLTGPIPSTLTQIPNLKTLDLARNQLKGEI  193

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN L+G
Sbjct  194  PRLIYWNEVLQYLGLRGNMLIG  215


 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL+QL  L L NN L GPIP  +S    L   ++  N+L+G I
Sbjct  349  LQLNDNQLVGSIPAELGKLEQLFELNLANNHLEGPIPHNISSCTALNKFNVHGNRLNGSI  408

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  NN  G
Sbjct  409  PPGFQNLESLTYLNLSLNNFKG  430


 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLSFN + G+IP    +L+ + +LILKNN+L G IP  L+   +L  L+++ N LSG +
Sbjct  493  IDLSFNSITGNIPVEFGQLQNIVSLILKNNKLQGEIPEQLTNCFSLTNLNVSYNNLSGVV  552

Query  182  P  184
            P
Sbjct  553  P  553


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +N+LVG IP+ L ++  L  L+LA N L G I
Sbjct  325  LYLHGNKLTGPIPPELGNMSKLSYLQLNDNQLVGSIPAELGKLEQLFELNLANNHLEGPI  384

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GN L G
Sbjct  385  PHNISSCTALNKFNVHGNRLNG  406


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N   G +P  +  +  L+TL L  N   GP+P+++ ++ +L  L+L+ NKL G++
Sbjct  421  LNLSLNNFKGWVPIELGHIINLDTLDLSGNNFSGPLPASIGELEHLLTLNLSDNKLDGQL  480

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +Q + L  N++ G
Sbjct  481  PAEFGNLRSIQIIDLSFNSITG  502


 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N+L GPIP  L  +  L  L L  N+L G I
Sbjct  301  LDLSENELVGHIPPILGNLSFTGKLYLHGNKLTGPIPPELGNMSKLSYLQLNDNQLVGSI  360

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N+L G
Sbjct  361  PAELGKLEQLFELNLANNHLEG  382


 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G+IP  I  ++ L  L L  NELVG IP  L  +     L L  NKL+G I
Sbjct  277  LSLQGNKLTGNIPEVIGLMQALAVLDLSENELVGHIPPILGNLSFTGKLYLHGNKLTGPI  336

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  337  PPELGNMSKLSYLQLNDNQLVG  358



>ref|XP_004149628.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like [Cucumis sativus]
 ref|XP_004166661.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like [Cucumis sativus]
Length=950

 Score =   134 bits (337),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPF++SKLKQLE L +KNN+L GPIPSTL+QIPNLK LDLA+N+L+GEI
Sbjct  91   LDLSDNLLYGDIPFTVSKLKQLEFLNMKNNQLTGPIPSTLTQIPNLKTLDLARNQLTGEI  150

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN L G
Sbjct  151  PRLIYWNEVLQYLGLRGNFLTG  172


 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G +P SI  L+ L +L L NN+LVGP+P+    + +++++D++ N LSG I
Sbjct  402  LDLSCNHFLGPVPASIGDLEHLLSLNLSNNQLVGPLPAEFGNLRSVQMIDMSFNNLSGSI  461

Query  182  P  184
            P
Sbjct  462  P  462


 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL QL  L L NN L GPIP  +S    L   ++  N L+G I
Sbjct  306  LQLNDNQLVGTIPSELGKLDQLFELNLANNYLEGPIPHNISSCTALNQFNVHGNNLNGSI  365

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  NN  G
Sbjct  366  PLGFQNLESLTYLNLSANNFKG  387


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +N+LVG IPS L ++  L  L+LA N L G I
Sbjct  282  LYLHGNKLTGPIPPELGNMSKLSYLQLNDNQLVGTIPSELGKLDQLFELNLANNYLEGPI  341

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GNNL G
Sbjct  342  PHNISSCTALNQFNVHGNNLNG  363


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+SFN L G IP  +  L+ + +LIL NN   G IP  L+   +L  L+L+ N LSG +
Sbjct  450  IDMSFNNLSGSIPMELGLLQNIISLILNNNHFQGKIPDRLTNCFSLANLNLSYNNLSGIL  509

Query  182  P  184
            P
Sbjct  510  P  510


 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 40/82 (49%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NEL GPIP  L  +     L L  NKL+G I
Sbjct  234  LSLQGNRLTGKIPDVIGLMQALAVLDLSENELDGPIPPILGNLSYTGKLYLHGNKLTGPI  293

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  294  PPELGNMSKLSYLQLNDNQLVG  315



>gb|KGN49592.1| hypothetical protein Csa_5G014290 [Cucumis sativus]
Length=994

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPF++SKLKQLE L +KNN+L GPIPSTL+QIPNLK LDLA+N+L+GEI
Sbjct  135  LDLSDNLLYGDIPFTVSKLKQLEFLNMKNNQLTGPIPSTLTQIPNLKTLDLARNQLTGEI  194

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN L G
Sbjct  195  PRLIYWNEVLQYLGLRGNFLTG  216


 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G +P SI  L+ L +L L NN+LVGP+P+    + +++++D++ N LSG I
Sbjct  446  LDLSCNHFLGPVPASIGDLEHLLSLNLSNNQLVGPLPAEFGNLRSVQMIDMSFNNLSGSI  505

Query  182  P  184
            P
Sbjct  506  P  506


 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL QL  L L NN L GPIP  +S    L   ++  N L+G I
Sbjct  350  LQLNDNQLVGTIPSELGKLDQLFELNLANNYLEGPIPHNISSCTALNQFNVHGNNLNGSI  409

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  NN  G
Sbjct  410  PLGFQNLESLTYLNLSANNFKG  431


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +N+LVG IPS L ++  L  L+LA N L G I
Sbjct  326  LYLHGNKLTGPIPPELGNMSKLSYLQLNDNQLVGTIPSELGKLDQLFELNLANNYLEGPI  385

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GNNL G
Sbjct  386  PHNISSCTALNQFNVHGNNLNG  407


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+SFN L G IP  +  L+ + +LIL NN   G IP  L+   +L  L+L+ N LSG +
Sbjct  494  IDMSFNNLSGSIPMELGLLQNIISLILNNNHFQGKIPDRLTNCFSLANLNLSYNNLSGIL  553

Query  182  P  184
            P
Sbjct  554  P  554


 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 40/82 (49%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NEL GPIP  L  +     L L  NKL+G I
Sbjct  278  LSLQGNRLTGKIPDVIGLMQALAVLDLSENELDGPIPPILGNLSYTGKLYLHGNKLTGPI  337

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  338  PPELGNMSKLSYLQLNDNQLVG  359



>ref|XP_006348052.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like isoform X2 [Solanum tuberosum]
Length=973

 Score =   134 bits (336),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFSISKLKQLE L LKNN+L GPIPSTL+QIPNLK LDLA+N+L GEI
Sbjct  126  LDLSDNLLYGDIPFSISKLKQLELLNLKNNQLSGPIPSTLTQIPNLKTLDLARNQLIGEI  185

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN L G
Sbjct  186  PRLIYWNEVLQYLGLRGNMLTG  207


 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NE  G IP SI  L+ L TL L +N L G IP     + +++ +D++ NK+SG I
Sbjct  435  LDLSGNEFSGSIPGSIGDLEHLLTLNLSSNHLDGQIPVEFGNLKSIQTIDMSCNKISGAI  494

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + +  L L  N+L G
Sbjct  495  PKELGQLQTMITLTLTANDLSG  516


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    LSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPR  187
            L  N+L G IP  +  + +L  L L +N+L+G IPS L ++  L  L+LA NKL G IP 
Sbjct  317  LHGNKLTGPIPPELGNMSKLSYLQLNDNQLMGRIPSELGKLDQLFELNLANNKLEGPIPE  376

Query  188  LIYWNEVLQYLGLRGNNLVG  247
             I     L  L + GNNL G
Sbjct  377  NISSCSALNQLNVHGNNLNG  396


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL QL  L L NN+L GPIP  +S    L  L++  N L+G I
Sbjct  339  LQLNDNQLMGRIPSELGKLDQLFELNLANNKLEGPIPENISSCSALNQLNVHGNNLNGSI  398

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  N   G
Sbjct  399  PSGFKNLESLTYLNLSANKFKG  420


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N L G IP     L+ L  L L  N+  G IPS L +I NL  LDL+ N+ SG I
Sbjct  387  LNVHGNNLNGSIPSGFKNLESLTYLNLSANKFKGHIPSQLGRIINLDTLDLSGNEFSGSI  446

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I   E L  L L  N+L G
Sbjct  447  PGSIGDLEHLLTLNLSSNHLDG  468


 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 40/82 (49%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NELVGPIP     +     L L  NKL+G I
Sbjct  267  LSLQGNRLTGKIPEVIGLMQALAVLDLSENELVGPIPPIFGNLSYTGKLYLHGNKLTGPI  326

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N L+G
Sbjct  327  PPELGNMSKLSYLQLNDNQLMG  348



>ref|XP_002981099.1| hypothetical protein SELMODRAFT_114051 [Selaginella moellendorffii]
 gb|EFJ17800.1| hypothetical protein SELMODRAFT_114051 [Selaginella moellendorffii]
Length=976

 Score =   134 bits (336),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLSFN  +GDIPFSIS+LKQLE LILKNN+L GPIPSTLSQ+PNLK LDLAQNKL+GEI
Sbjct  108  IDLSFNAFHGDIPFSISQLKQLENLILKNNQLTGPIPSTLSQLPNLKTLDLAQNKLTGEI  167

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P L+YW+EVLQYLGLR N L G
Sbjct  168  PTLLYWSEVLQYLGLRDNLLTG  189


 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLS N L G IP SI  L+ L TL+LK+N+L G IPS    + ++  +DL++N LSG I
Sbjct  419  MDLSENILTGHIPRSIGNLEHLLTLVLKHNKLTGGIPSEFGSLKSIYAMDLSENNLSGSI  478

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L  L L  N+L G
Sbjct  479  PPELGQLQTLNALLLEKNSLSG  500


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 55/106 (52%), Gaps = 25/106 (24%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G+IPF+I  L Q+ TL L+ N+LVG IP  +  +  L VLDL+ N L G I
Sbjct  228  LDLSYNQLTGEIPFNIGFL-QVATLSLQGNKLVGKIPDVIGLMQALAVLDLSNNFLEGSI  286

Query  182  PRLI-----------YWNEV-------------LQYLGLRGNNLVG  247
            P ++           + N +             L YL L  NNL G
Sbjct  287  PSILGNLTFTGKLYLHGNMLTGVIPPELGNMTKLSYLQLNDNNLTG  332


 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 39/68 (57%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLS N L G IP  + +L+ L  L+L+ N L G IP  L    +L  L+L+ N LSGEI
Sbjct  467  MDLSENNLSGSIPPELGQLQTLNALLLEKNSLSGSIPPQLGNCFSLSTLNLSYNNLSGEI  526

Query  182  PRLIYWNE  205
            P    +N 
Sbjct  527  PASSIFNR  534


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  +  + +L  L L +N L G IP  L  +  L  LDL+ NK SG  
Sbjct  299  LYLHGNMLTGVIPPELGNMTKLSYLQLNDNNLTGQIPPELGSLSELFELDLSNNKFSGPF  358

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ + +   L Y+ + GN L G
Sbjct  359  PKNVSYCSSLNYINVHGNMLNG  380


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 40/77 (52%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N L G +P  +  L  L  L L +N   G IP  L  I NL  +DL++N L+G IPR I 
Sbjct  376  NMLNGTVPPELQDLGSLTYLNLSSNSFSGRIPEELGHIVNLDTMDLSENILTGHIPRSIG  435

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L+ N L G
Sbjct  436  NLEHLLTLVLKHNKLTG  452


 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G++   + +L  L    +++N + GPIP  +    + ++LDL+ N+L+GEI
Sbjct  180  LGLRDNLLTGNLSPDMCRLTGLWYFDIRSNNITGPIPENIGNCTSYEILDLSYNQLTGEI  239

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN LVG
Sbjct  240  PFNIGFLQVAT-LSLQGNKLVG  260



>ref|XP_002982573.1| hypothetical protein SELMODRAFT_155267 [Selaginella moellendorffii]
 gb|EFJ16326.1| hypothetical protein SELMODRAFT_155267 [Selaginella moellendorffii]
Length=977

 Score =   134 bits (336),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLSFN  +GDIPFSIS+LKQLE LILKNN+L GPIPSTLSQ+PNLK LDLAQNKL+GEI
Sbjct  108  IDLSFNAFHGDIPFSISQLKQLENLILKNNQLTGPIPSTLSQLPNLKTLDLAQNKLTGEI  167

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P L+YW+EVLQYLGLR N L G
Sbjct  168  PTLLYWSEVLQYLGLRDNLLTG  189


 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLS N L G IP SI  L+ L TL+LK+N+L G IPS    + ++  +DL++N LSG I
Sbjct  419  MDLSENILTGHIPRSIGNLEHLLTLVLKHNKLTGGIPSEFGSLKSIYAMDLSENNLSGSI  478

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L  L L  N+L G
Sbjct  479  PPELGQLQTLNALLLEKNSLSG  500


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 55/106 (52%), Gaps = 25/106 (24%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G+IPF+I  L Q+ TL L+ N+LVG IP  +  +  L VLDL+ N L G I
Sbjct  228  LDLSYNQLTGEIPFNIGFL-QVATLSLQGNKLVGKIPDVIGLMQALAVLDLSNNFLEGSI  286

Query  182  PRLI-----------YWNEV-------------LQYLGLRGNNLVG  247
            P ++           + N +             L YL L  NNL G
Sbjct  287  PSILGNLTFTGKLYLHGNMLTGVIPPELGNMTKLSYLQLNDNNLTG  332


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 42/80 (53%), Gaps = 6/80 (8%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLS N L G IP  + +L+ L  L+L+ N L G IP  L    +L  L+L+ N LSGEI
Sbjct  467  MDLSENNLSGSIPPELGQLQTLNALLLEKNSLSGSIPPQLGNCFSLSTLNLSYNNLSGEI  526

Query  182  P------RLIYWNEVLQYLG  223
            P      R  +      Y+G
Sbjct  527  PASSIFNRFSFDRHTCSYVG  546


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  +  + +L  L L +N L G IP  L  +  L  LDL+ NK SG  
Sbjct  299  LYLHGNMLTGVIPPELGNMTKLSYLQLNDNNLTGQIPPELGSLSELFELDLSNNKFSGPF  358

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ + +   L Y+ + GN L G
Sbjct  359  PKNVSYCSSLNYINVHGNMLNG  380


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 40/77 (52%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N L G +P  +  L  L  L L +N   G IP  L  I NL  +DL++N L+G IPR I 
Sbjct  376  NMLNGTVPPELQDLGSLTYLNLSSNSFSGRIPEELGHIVNLDTMDLSENILTGHIPRSIG  435

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L+ N L G
Sbjct  436  NLEHLLTLVLKHNKLTG  452


 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G++   + +L  L    +++N + GPIP  +    + ++LDL+ N+L+GEI
Sbjct  180  LGLRDNLLTGNLSPDMCRLTGLWYFDIRSNNITGPIPENIGNCTSYEILDLSYNQLTGEI  239

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN LVG
Sbjct  240  PFNIGFLQVAT-LSLQGNKLVG  260



>ref|XP_006348051.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like isoform X1 [Solanum tuberosum]
Length=975

 Score =   134 bits (336),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFSISKLKQLE L LKNN+L GPIPSTL+QIPNLK LDLA+N+L GEI
Sbjct  126  LDLSDNLLYGDIPFSISKLKQLELLNLKNNQLSGPIPSTLTQIPNLKTLDLARNQLIGEI  185

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN L G
Sbjct  186  PRLIYWNEVLQYLGLRGNMLTG  207


 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NE  G IP SI  L+ L TL L +N L G IP     + +++ +D++ NK+SG I
Sbjct  437  LDLSGNEFSGSIPGSIGDLEHLLTLNLSSNHLDGQIPVEFGNLKSIQTIDMSCNKISGAI  496

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + +  L L  N+L G
Sbjct  497  PKELGQLQTMITLTLTANDLSG  518


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    LSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPR  187
            L  N+L G IP  +  + +L  L L +N+L+G IPS L ++  L  L+LA NKL G IP 
Sbjct  319  LHGNKLTGPIPPELGNMSKLSYLQLNDNQLMGRIPSELGKLDQLFELNLANNKLEGPIPE  378

Query  188  LIYWNEVLQYLGLRGNNLVG  247
             I     L  L + GNNL G
Sbjct  379  NISSCSALNQLNVHGNNLNG  398


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL QL  L L NN+L GPIP  +S    L  L++  N L+G I
Sbjct  341  LQLNDNQLMGRIPSELGKLDQLFELNLANNKLEGPIPENISSCSALNQLNVHGNNLNGSI  400

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  N   G
Sbjct  401  PSGFKNLESLTYLNLSANKFKG  422


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N L G IP     L+ L  L L  N+  G IPS L +I NL  LDL+ N+ SG I
Sbjct  389  LNVHGNNLNGSIPSGFKNLESLTYLNLSANKFKGHIPSQLGRIINLDTLDLSGNEFSGSI  448

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I   E L  L L  N+L G
Sbjct  449  PGSIGDLEHLLTLNLSSNHLDG  470


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 40/82 (49%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NELVGPIP     +     L L  NKL+G I
Sbjct  269  LSLQGNRLTGKIPEVIGLMQALAVLDLSENELVGPIPPIFGNLSYTGKLYLHGNKLTGPI  328

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N L+G
Sbjct  329  PPELGNMSKLSYLQLNDNQLMG  350



>ref|XP_009757535.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Nicotiana sylvestris]
Length=964

 Score =   134 bits (336),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N L+GDIPFSISKLKQLE L LKNN+L GPIPSTL+QIPNLK LDLA+N+L GEI
Sbjct  120  LDLSDNLLFGDIPFSISKLKQLELLTLKNNQLTGPIPSTLTQIPNLKTLDLARNQLIGEI  179

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN L G
Sbjct  180  PRLIYWNEVLQYLGLRGNLLTG  201


 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NE  G +P SI  L+ L TL L +N L G IP     + +++ LDL+ NK+SG I
Sbjct  431  LDLSNNEFSGSVPGSIGDLEHLLTLNLSSNHLNGQIPVEFGNLKSIQTLDLSCNKISGGI  490

Query  182  PR  187
            P+
Sbjct  491  PK  492


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +N+LVG IP  L ++  L  L+LA NKL G I
Sbjct  311  LYLHGNKLTGPIPAELGNMSKLSYLQLNDNQLVGQIPPELGKLDQLFELNLANNKLEGPI  370

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GNNL G
Sbjct  371  PENISSCTALNQFNVHGNNLNG  392


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N+  G IP ++ ++  L+TL L NNE  G +P ++  + +L  L+L+ N L+G+I
Sbjct  407  LNLSLNKFKGRIPSALGRIINLDTLDLSNNEFSGSVPGSIGDLEHLLTLNLSSNHLNGQI  466

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      + +Q L L  N + G
Sbjct  467  PVEFGNLKSIQTLDLSCNKISG  488


 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL QL  L L NN+L GPIP  +S    L   ++  N L+G I
Sbjct  335  LQLNDNQLVGQIPPELGKLDQLFELNLANNKLEGPIPENISSCTALNQFNVHGNNLNGSI  394

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  N   G
Sbjct  395  PSGFKNLESLTYLNLSLNKFKG  416


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 40/77 (52%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N L G IP     L+ L  L L  N+  G IPS L +I NL  LDL+ N+ SG +P  I 
Sbjct  388  NNLNGSIPSGFKNLESLTYLNLSLNKFKGRIPSALGRIINLDTLDLSNNEFSGSVPGSIG  447

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N+L G
Sbjct  448  DLEHLLTLNLSSNHLNG  464


 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP     L     L L  N+L GPIP+ L  +  L  L L  N+L G+I
Sbjct  287  LDLSENELVGAIPPIFGNLSYTGKLYLHGNKLTGPIPAELGNMSKLSYLQLNDNQLVGQI  346

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L  L L  N L G
Sbjct  347  PPELGKLDQLFELNLANNKLEG  368



>ref|XP_006606082.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like isoform X1 [Glycine max]
Length=993

 Score =   134 bits (336),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+LYGDIPFS+SKLKQLE L LK+N+L GPIPSTL+QIPNLK LDLA+N+L+GEI
Sbjct  136  LDLSDNQLYGDIPFSLSKLKQLEFLNLKSNQLTGPIPSTLTQIPNLKTLDLARNRLTGEI  195

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR++YWNEVLQYLGLRGN L G
Sbjct  196  PRILYWNEVLQYLGLRGNMLSG  217


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN L G IP  I +L+ L +LI+ NN+L G IP  L+   +L  L+L+ N LSG I
Sbjct  495  LDLSFNNLSGIIPPEIGQLQNLMSLIMNNNDLHGKIPDQLTNCFSLTSLNLSYNNLSGVI  554

Query  182  PRL  190
            P +
Sbjct  555  PSM  557


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G++P S+  L+ L TL L +N L GP+P+    + ++++LDL+ N LSG I
Sbjct  447  LDLSSNNFSGNVPASVGFLEHLLTLNLSHNHLDGPLPAEFGNLRSIQILDLSFNNLSGII  506

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I   + L  L +  N+L G
Sbjct  507  PPEIGQLQNLMSLIMNNNDLHG  528


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N L G+IP    KL+ L  L L NN L G IP  +S    L   ++  N+LSG I
Sbjct  351  LQLNDNHLEGNIPNEFGKLEHLFELNLANNHLDGTIPHNISSCTALNQFNVHGNQLSGSI  410

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  NN  G
Sbjct  411  PLSFRSLESLTYLNLSANNFKG  432



>gb|KHN15712.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Glycine 
soja]
Length=993

 Score =   134 bits (336),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+LYGDIPFS+SKLKQLE L LK+N+L GPIPSTL+QIPNLK LDLA+N+L+GEI
Sbjct  136  LDLSDNQLYGDIPFSLSKLKQLEFLNLKSNQLTGPIPSTLTQIPNLKTLDLARNRLTGEI  195

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR++YWNEVLQYLGLRGN L G
Sbjct  196  PRILYWNEVLQYLGLRGNMLSG  217


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN L G IP  I +L+ L +LI+ NN+L G IP  L+   +L  L+L+ N LSG I
Sbjct  495  LDLSFNNLSGIIPPEIGQLQNLMSLIMNNNDLHGKIPDQLTNCFSLTSLNLSYNNLSGVI  554

Query  182  PRL  190
            P +
Sbjct  555  PSM  557


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N L G+IP    KL+ L  L L NN L G IP  +S    L   ++  N+LSG I
Sbjct  351  LQLNDNHLEGNIPNEFGKLEHLFELNLANNHLDGTIPHNISSCTALNQFNVHGNQLSGSI  410

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  NN  G
Sbjct  411  PLSFRSLESLTYLNLSANNFKG  432


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G +P S+  L+ L TL L +N L GP+P+    + ++++LDL+ N LSG I
Sbjct  447  LDLSSNNFSGIVPASVGFLEHLLTLNLSHNHLDGPLPAEFGNLRSIQILDLSFNNLSGII  506

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I   + L  L +  N+L G
Sbjct  507  PPEIGQLQNLMSLIMNNNDLHG  528



>ref|XP_009757534.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Nicotiana sylvestris]
Length=967

 Score =   133 bits (335),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N L+GDIPFSISKLKQLE L LKNN+L GPIPSTL+QIPNLK LDLA+N+L GEI
Sbjct  120  LDLSDNLLFGDIPFSISKLKQLELLTLKNNQLTGPIPSTLTQIPNLKTLDLARNQLIGEI  179

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN L G
Sbjct  180  PRLIYWNEVLQYLGLRGNLLTG  201


 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NE  G +P SI  L+ L TL L +N L G IP     + +++ LDL+ NK+SG I
Sbjct  431  LDLSNNEFSGSVPGSIGDLEHLLTLNLSSNHLNGQIPVEFGNLKSIQTLDLSCNKISGGI  490

Query  182  PR  187
            P+
Sbjct  491  PK  492


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +N+LVG IP  L ++  L  L+LA NKL G I
Sbjct  311  LYLHGNKLTGPIPAELGNMSKLSYLQLNDNQLVGQIPPELGKLDQLFELNLANNKLEGPI  370

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GNNL G
Sbjct  371  PENISSCTALNQFNVHGNNLNG  392


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N+  G IP ++ ++  L+TL L NNE  G +P ++  + +L  L+L+ N L+G+I
Sbjct  407  LNLSLNKFKGRIPSALGRIINLDTLDLSNNEFSGSVPGSIGDLEHLLTLNLSSNHLNGQI  466

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      + +Q L L  N + G
Sbjct  467  PVEFGNLKSIQTLDLSCNKISG  488


 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL QL  L L NN+L GPIP  +S    L   ++  N L+G I
Sbjct  335  LQLNDNQLVGQIPPELGKLDQLFELNLANNKLEGPIPENISSCTALNQFNVHGNNLNGSI  394

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  N   G
Sbjct  395  PSGFKNLESLTYLNLSLNKFKG  416


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 40/77 (52%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N L G IP     L+ L  L L  N+  G IPS L +I NL  LDL+ N+ SG +P  I 
Sbjct  388  NNLNGSIPSGFKNLESLTYLNLSLNKFKGRIPSALGRIINLDTLDLSNNEFSGSVPGSIG  447

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N+L G
Sbjct  448  DLEHLLTLNLSSNHLNG  464


 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP     L     L L  N+L GPIP+ L  +  L  L L  N+L G+I
Sbjct  287  LDLSENELVGAIPPIFGNLSYTGKLYLHGNKLTGPIPAELGNMSKLSYLQLNDNQLVGQI  346

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L  L L  N L G
Sbjct  347  PPELGKLDQLFELNLANNKLEG  368



>ref|XP_007143329.1| hypothetical protein PHAVU_007G063200g [Phaseolus vulgaris]
 gb|ESW15323.1| hypothetical protein PHAVU_007G063200g [Phaseolus vulgaris]
Length=987

 Score =   133 bits (335),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+LYGDIPFS+SKLKQLE L LK+N++ GPIPSTL+QIPNLK LDLA+N+L+GEI
Sbjct  136  LDLSDNQLYGDIPFSLSKLKQLEFLNLKSNQITGPIPSTLTQIPNLKTLDLARNRLTGEI  195

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQYLGLRGN L G
Sbjct  196  PRLLYWNEVLQYLGLRGNMLSG  217


 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+SFN L G IP  I +L+ L +LI+ NN+L G IP  L+   +L +L+L+ N LSG I
Sbjct  495  LDMSFNNLSGSIPPEIGQLQNLMSLIMNNNDLRGKIPDQLTNCFSLTLLNLSYNNLSGVI  554

Query  182  PRL  190
            P +
Sbjct  555  PSM  557


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G +P S+  L+ L TL L +N L G +P+    + ++++LD++ N LSG I
Sbjct  447  LDLSSNNFSGHVPASVGYLEHLLTLNLSHNHLGGSLPAEFGNLRSIQILDMSFNNLSGSI  506

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I   + L  L +  N+L G
Sbjct  507  PPEIGQLQNLMSLIMNNNDLRG  528



>ref|XP_006606083.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like isoform X2 [Glycine max]
Length=989

 Score =   133 bits (335),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+LYGDIPFS+SKLKQLE L LK+N+L GPIPSTL+QIPNLK LDLA+N+L+GEI
Sbjct  136  LDLSDNQLYGDIPFSLSKLKQLEFLNLKSNQLTGPIPSTLTQIPNLKTLDLARNRLTGEI  195

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR++YWNEVLQYLGLRGN L G
Sbjct  196  PRILYWNEVLQYLGLRGNMLSG  217


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN L G IP  I +L+ L +LI+ NN+L G IP  L+   +L  L+L+ N LSG I
Sbjct  495  LDLSFNNLSGIIPPEIGQLQNLMSLIMNNNDLHGKIPDQLTNCFSLTSLNLSYNNLSGVI  554

Query  182  PRL  190
            P +
Sbjct  555  PSM  557


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G++P S+  L+ L TL L +N L GP+P+    + ++++LDL+ N LSG I
Sbjct  447  LDLSSNNFSGNVPASVGFLEHLLTLNLSHNHLDGPLPAEFGNLRSIQILDLSFNNLSGII  506

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I   + L  L +  N+L G
Sbjct  507  PPEIGQLQNLMSLIMNNNDLHG  528


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N L G+IP    KL+ L  L L NN L G IP  +S    L   ++  N+LSG I
Sbjct  351  LQLNDNHLEGNIPNEFGKLEHLFELNLANNHLDGTIPHNISSCTALNQFNVHGNQLSGSI  410

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  NN  G
Sbjct  411  PLSFRSLESLTYLNLSANNFKG  432



>ref|XP_002975149.1| hypothetical protein SELMODRAFT_102522, partial [Selaginella 
moellendorffii]
 gb|EFJ23934.1| hypothetical protein SELMODRAFT_102522, partial [Selaginella 
moellendorffii]
Length=944

 Score =   133 bits (335),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLSFN L GDIPFS+S+LKQLETLILK+N+L GPIPSTLSQ+PNLK LDLAQN+L+GEI
Sbjct  95   IDLSFNALVGDIPFSVSQLKQLETLILKSNQLTGPIPSTLSQLPNLKTLDLAQNQLTGEI  154

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P L+YW+EVLQYLGLR N+L G
Sbjct  155  PTLLYWSEVLQYLGLRDNSLSG  176


 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S N + G IP S+  L+ L TLIL+NN++ G IPS    + ++ +LDL+QNKLSG I
Sbjct  406  LDVSDNYISGSIPSSVGDLEHLLTLILRNNDISGKIPSEFGNLRSIDLLDLSQNKLSGNI  465

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L  L L+ N L G
Sbjct  466  PPELGQLQTLNTLFLQHNKLSG  487


 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDL++N L G+IP++I  L Q+ TL L+ N+  G IP  +  +  L VLDL+ N+L G+I
Sbjct  215  LDLAYNRLNGEIPYNIGFL-QVATLSLQGNQFSGKIPEVIGLMQALAVLDLSDNRLVGDI  273

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P L+        L L GN L G
Sbjct  274  PALLGNLTYTGKLYLHGNLLTG  295


 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+L G+IP  + +L+ L TL L++N+L G IP  L+   +L +L+++ N LSGE+
Sbjct  454  LDLSQNKLSGNIPPELGQLQTLNTLFLQHNKLSGAIPVQLTNCFSLNILNVSYNNLSGEV  513

Query  182  P  184
            P
Sbjct  514  P  514


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 42/80 (53%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    LSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPR  187
            L  N L G IP  +  + +L  L L +N+L G IPS L  +  L  L+LA N+L G IP 
Sbjct  288  LHGNLLTGTIPPELGNMTKLSYLQLNDNQLTGEIPSELGSLSELFELNLANNQLYGRIPE  347

Query  188  LIYWNEVLQYLGLRGNNLVG  247
             I     L YL + GN L G
Sbjct  348  NISSCNALNYLNVHGNRLNG  367


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G+IP  +  L +L  L L NN+L G IP  +S    L  L++  N+L+G I
Sbjct  310  LQLNDNQLTGEIPSELGSLSELFELNLANNQLYGRIPENISSCNALNYLNVHGNRLNGSI  369

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L YL L  N   G
Sbjct  370  PPQLKKLDSLTYLNLSSNLFSG  391



>gb|AAL68842.1|AF466199_1 putative receptor protein kinase [Sorghum bicolor]
Length=921

 Score =   133 bits (335),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD SFN L GDIPFSISKLK LE LILKNN+L+G IPSTLSQ+PNLK+LDLAQNKL+GEI
Sbjct  114  LDFSFNNLDGDIPFSISKLKHLENLILKNNQLIGAIPSTLSQLPNLKILDLAQNKLTGEI  173

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYL ++ N+L G
Sbjct  174  PRLIYWNEVLQYLDVKNNSLTG  195


 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N   G IPF+I  L Q+ TL L+ N+  GPIPS +  +  L VLDL+ N+LSG I
Sbjct  210  LDLSYNRFTGPIPFNIGFL-QVATLSLQGNKFTGPIPSVIGLMQALAVLDLSYNQLSGPI  268

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L ++GN L G
Sbjct  269  PSILGNLTYTEKLYIQGNKLTG  290


 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP  + +L  L  L L NN L GPIP  LS   NL   +   NKL+G I
Sbjct  305  LELNDNQLTGSIPPELGRLTGLFDLNLANNHLEGPIPDNLSSCVNLNSFNAYGNKLNGTI  364

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR +   E + YL L  N + G
Sbjct  365  PRSLRKLESMTYLNLSSNFISG  386


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N+L G IP S+ KL+ +  L L +N + G IP  LS+I NL  LDL+ N ++G IP  I 
Sbjct  358  NKLNGTIPRSLRKLESMTYLNLSSNFISGSIPIELSRINNLDTLDLSCNMMTGPIPSSIG  417

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N LVG
Sbjct  418  SLEHLLRLNLSKNGLVG  434


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N + G IP SI  L+ L  L L  N LVG IP+    + ++  +DL+ N L G I
Sbjct  401  LDLSCNMMTGPIPSSIGSLEHLLRLNLSKNGLVGFIPAEFGNLRSVMEIDLSYNHLGGLI  460

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + L  L +  NNL G
Sbjct  461  PQELEMLQNLMLLNVSYNNLAG  482


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N + G IP  +S++  L+TL L  N + GPIPS++  + +L  L+L++N L G I
Sbjct  377  LNLSSNFISGSIPIELSRINNLDTLDLSCNMMTGPIPSSIGSLEHLLRLNLSKNGLVGFI  436

Query  182  P  184
            P
Sbjct  437  P  437


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 36/61 (59%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G IP  +  L   E L ++ N+L G IP  L  +  L  L+L  N+L+G I
Sbjct  257  LDLSYNQLSGPIPSILGNLTYTEKLYIQGNKLTGSIPPELGNMSTLHYLELNDNQLTGSI  316

Query  182  P  184
            P
Sbjct  317  P  317


 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+  G IP  I  ++ L  L L  N+L GPIPS L  +   + L +  NKL+G I
Sbjct  233  LSLQGNKFTGPIPSVIGLMQALAVLDLSYNQLSGPIPSILGNLTYTEKLYIQGNKLTGSI  292

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N L G
Sbjct  293  PPELGNMSTLHYLELNDNQLTG  314



>ref|XP_002452905.1| hypothetical protein SORBIDRAFT_04g034820 [Sorghum bicolor]
 gb|EES05881.1| hypothetical protein SORBIDRAFT_04g034820 [Sorghum bicolor]
Length=893

 Score =   133 bits (335),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N L GDIPFSISKLK LE LILKNN LVG IPSTLSQ+PNLK+LDLAQNKLSGEI
Sbjct  115  LDLSSNNLEGDIPFSISKLKHLENLILKNNNLVGVIPSTLSQLPNLKILDLAQNKLSGEI  174

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P LIYWNEVLQYLGLR N+L G
Sbjct  175  PNLIYWNEVLQYLGLRSNSLEG  196


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL +L  L L NN L+GPIP  LS   NL  L+L+ N LSG +
Sbjct  259  LELNDNLLTGFIPPDLGKLTELFELNLANNNLIGPIPENLSSCANLISLNLSSNHLSGAL  318

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L L  N + G
Sbjct  319  PIEVARMRNLDTLDLSCNMITG  340


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP ++S    L +L L +N L G +P  ++++ NL  LDL+ N ++G I
Sbjct  283  LNLANNNLIGPIPENLSSCANLISLNLSSNHLSGALPIEVARMRNLDTLDLSCNMITGSI  342

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I   E L  L L  NN+ G
Sbjct  343  PSAIGKLEHLLRLNLSKNNVGG  364


 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N + G IP +I KL+ L  L L  N + G IP+    + ++  +DL+ N L G I
Sbjct  331  LDLSCNMITGSIPSAIGKLEHLLRLNLSKNNVGGHIPAEFGNLRSIMEIDLSYNHLLGLI  390

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + L  L L  NN+ G
Sbjct  391  PQEVGMLQNLILLKLESNNITG  412



>dbj|BAJ87863.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=863

 Score =   133 bits (334),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L GDIPFSISKLK LE LILKNN+LVG IPSTLSQ+PNLK+LDLAQNKLSGEI
Sbjct  2    LNLSSNNLEGDIPFSISKLKHLENLILKNNQLVGVIPSTLSQLPNLKILDLAQNKLSGEI  61

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYW+EVLQYLGLR N L G
Sbjct  62   PRLIYWSEVLQYLGLRSNKLEG  83


 Score = 61.6 bits (148),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDL+ N+L G IP  + KL  L  L L NNELVGPIP  +S   NL   +   NKL+G I
Sbjct  217  LDLNDNKLTGLIPPELGKLTALYDLNLANNELVGPIPDNISSCTNLISFNAYGNKLNGTI  276

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR ++  + + YL L  N L G
Sbjct  277  PRSLHKLQSMTYLNLSSNYLNG  298


 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N+L G IP S+ KL+ +  L L +N L G IP  L+++ NL  LDL+ NK++G IP  + 
Sbjct  270  NKLNGTIPRSLHKLQSMTYLNLSSNYLNGAIPIELARMINLDTLDLSCNKIAGSIPSTVG  329

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  NNLVG
Sbjct  330  SLEHLLRLNLSKNNLVG  346


 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+L G IP  +  L   E L L+ N L GPIP  L  +  L  LDL  NKL+G I
Sbjct  169  LDLSLNQLSGPIPSILGNLTYTEKLYLQGNRLSGPIPPELGNLSALNYLDLNDNKLTGLI  228

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L L  N LVG
Sbjct  229  PPELGKLTALYDLNLANNELVG  250


 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N++ G IP ++  L+ L  L L  N LVG IP+    + ++  +DL+ N ++G I
Sbjct  313  LDLSCNKIAGSIPSTVGSLEHLLRLNLSKNNLVGHIPAEFVNLRSIMEIDLSNNHINGFI  372

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + L  L L  NN+ G
Sbjct  373  PQELGMLQNLILLKLESNNMTG  394


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G +   + +L  L    +KNN L+G IP T+    + +VLDL+ N+L+GEI
Sbjct  74   LGLRSNKLEGSLSPDMCQLTGLWYFDVKNNSLMGTIPDTIGNCTSFQVLDLSYNQLTGEI  133

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+ NN  G
Sbjct  134  PFNIGFLQVAT-LSLQRNNFSG  154


 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 50/106 (47%), Gaps = 25/106 (24%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNN------------------------ELVGPI  109
            LDLS+N+L G+IPF+I  L Q+ TL L+ N                        +L GPI
Sbjct  122  LDLSYNQLTGEIPFNIGFL-QVATLSLQRNNFSGPIPTVIGLMQALAVLDLSLNQLSGPI  180

Query  110  PSTLSQIPNLKVLDLAQNKLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
            PS L  +   + L L  N+LSG IP  +     L YL L  N L G
Sbjct  181  PSILGNLTYTEKLYLQGNRLSGPIPPELGNLSALNYLDLNDNKLTG  226



>ref|XP_010251324.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Nelumbo nucifera]
Length=371

 Score =   129 bits (325),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 71/81 (88%), Gaps = 3/81 (4%)
 Frame = +2

Query  5    DLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIP  184
            DL  N LYGDIPFSISKLKQLE LILKNN+L GPIPSTLSQIPNLK LDLAQN+L+GEIP
Sbjct  54   DLPGNSLYGDIPFSISKLKQLEDLILKNNQLTGPIPSTLSQIPNLKTLDLAQNQLTGEIP  113

Query  185  RLIYWNEVLQYLGLRGNNLVG  247
            RLIYW+EVLQYL   GNNL G
Sbjct  114  RLIYWSEVLQYL---GNNLTG  131


 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S+N++ G+IP++I  L Q+ TL L+ N L G IP  +  +  L VLDL++N+L G I
Sbjct  134  LDISYNQITGEIPYNIGFL-QVATLSLQGNRLTGKIPEVIGLMQALAVLDLSENELFGPI  192

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++        L L  N L G
Sbjct  193  PPILSNLSYTGKLYLHENKLTG  214


 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NEL GPIP  LS +     L L +NKL+G+I
Sbjct  157  LSLQGNRLTGKIPEVIGLMQALAVLDLSENELFGPIPPILSNLSYTGKLYLHENKLTGKI  216

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     + YL L  N LVG
Sbjct  217  PPELGNMSKVSYLQLNDNELVG  238



>ref|XP_002977553.1| hypothetical protein SELMODRAFT_107124, partial [Selaginella 
moellendorffii]
 gb|EFJ21557.1| hypothetical protein SELMODRAFT_107124, partial [Selaginella 
moellendorffii]
Length=944

 Score =   133 bits (334),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLSFN L GDIPFS+S+LKQLETLILK+N+L GPIPSTLSQ+PNLK LDLAQN+L+GEI
Sbjct  95   IDLSFNALVGDIPFSVSQLKQLETLILKSNQLTGPIPSTLSQLPNLKTLDLAQNQLTGEI  154

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P L+YW+EVLQYLGLR N+L G
Sbjct  155  PTLLYWSEVLQYLGLRDNSLSG  176


 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S N + G IP S+  L+ L TLIL+NN++ G IPS    + ++ +LDL+QNKL G I
Sbjct  406  LDVSDNYISGSIPSSVGDLEHLLTLILRNNDISGKIPSEFGNLRSIDLLDLSQNKLLGNI  465

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L  L L+ N L G
Sbjct  466  PPELGQLQTLNTLFLQHNKLSG  487


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDL++N L G+IP++I  L Q+ TL L+ N+  G IP  +  +  L VLDL+ N+L G+I
Sbjct  215  LDLAYNRLNGEIPYNIGFL-QVATLSLQGNQFSGKIPEVIGLMQALAVLDLSDNRLVGDI  273

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P L+        L L GN L G
Sbjct  274  PPLLGNLTYTGKLYLHGNLLTG  295


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+L G+IP  + +L+ L TL L++N+L G IP  L+   +L +L+++ N LSGE+
Sbjct  454  LDLSQNKLLGNIPPELGQLQTLNTLFLQHNKLSGAIPVQLTNCFSLNILNVSYNNLSGEV  513

Query  182  P  184
            P
Sbjct  514  P  514


 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 42/80 (53%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    LSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPR  187
            L  N L G IP  +  + +L  L L +N+L G IPS L  +  L  L+LA N+L G IP 
Sbjct  288  LHGNLLTGTIPPELGNMTKLSYLQLNDNQLTGEIPSELGSLSELFELNLANNQLYGRIPE  347

Query  188  LIYWNEVLQYLGLRGNNLVG  247
             I     L YL + GN L G
Sbjct  348  NISSCNALNYLNVHGNRLNG  367


 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G+IP  +  L +L  L L NN+L G IP  +S    L  L++  N+L+G I
Sbjct  310  LQLNDNQLTGEIPSELGSLSELFELNLANNQLYGRIPENISSCNALNYLNVHGNRLNGSI  369

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L YL L  N   G
Sbjct  370  PPQLKKLDSLTYLNLSSNLFSG  391



>ref|XP_010452673.1| PREDICTED: LOW QUALITY PROTEIN: LRR receptor-like serine/threonine-protein 
kinase ERL2 [Camelina sativa]
Length=923

 Score =   133 bits (334),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N L+GDIPFSISKLKQLE L LKNN+L GPIP+TL+Q+PNLK LDLA+N+L+GEI
Sbjct  126  LDLSTNLLFGDIPFSISKLKQLEFLNLKNNQLTGPIPATLTQVPNLKTLDLARNQLTGEI  185

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQYLGLRGN L G
Sbjct  186  PRLLYWNEVLQYLGLRGNMLTG  207


 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G IP  + KL+QL  L L NN LVGPIPS +S    L   ++  N LSG I
Sbjct  341  LQLNDNELVGTIPPELGKLEQLFELNLANNHLVGPIPSNISYCAALNQFNVHGNSLSGSI  400

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        L YL L  N+  G
Sbjct  401  PLEFRNLGSLTYLNLSSNSFKG  422


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S+N++ G IP++I  L Q+ TL L+ N L G IP  +  +  L VLDL+ N+L+G I
Sbjct  246  LDVSYNQITGVIPYNIGFL-QVATLSLQGNRLTGRIPEVIGLMQALAVLDLSDNELTGPI  304

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++        L L GN L G
Sbjct  305  PPILGNLSFTGKLYLHGNKLTG  326


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +NELVG IP  L ++  L  L+LA N L G I
Sbjct  317  LYLHGNKLTGPIPPELGNMSRLSYLQLNDNELVGTIPPELGKLEQLFELNLANNHLVGPI  376

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I +   L    + GN+L G
Sbjct  377  PSNISYCAALNQFNVHGNSLSG  398


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N+L GPIP  L  +  L  L L  N+L G I
Sbjct  293  LDLSDNELTGPIPPILGNLSFTGKLYLHGNKLTGPIPPELGNMSRLSYLQLNDNELVGTI  352

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N+LVG
Sbjct  353  PPELGKLEQLFELNLANNHLVG  374


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L +NEL GPIP  L  +     L L  NKL+G I
Sbjct  269  LSLQGNRLTGRIPEVIGLMQALAVLDLSDNELTGPIPPILGNLSFTGKLYLHGNKLTGPI  328

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  329  PPELGNMSRLSYLQLNDNELVG  350



>gb|AFW73724.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=999

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N L GDIPFS+SKLK LE LILKNN+LVG IPSTLSQ+PNLK+LDLAQNKLSGEI
Sbjct  122  LDLSSNNLEGDIPFSMSKLKHLENLILKNNKLVGVIPSTLSQLPNLKILDLAQNKLSGEI  181

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P LIYWNEVLQYLGLR N+L G
Sbjct  182  PNLIYWNEVLQYLGLRSNSLEG  203


 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N L G+IPF+I  L Q+ TL L+ N+  GPIPS +  +  L VLDL+ N+LSG I
Sbjct  242  LDLSNNHLTGEIPFNIGFL-QVATLSLQGNKFSGPIPSVIGLMQALAVLDLSFNELSGPI  300

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L L+GN L G
Sbjct  301  PSILGNLTYTEKLYLQGNRLTG  322


 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL +L  L L NN L+GPIP  LS   NL   +   NKL+G I
Sbjct  337  LELNDNLLTGFIPPDLGKLTELFELNLANNNLIGPIPENLSSCANLISFNAYGNKLNGTI  396

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR  +  E L YL L  N+L G
Sbjct  397  PRSFHKLESLTYLNLSSNHLSG  418


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 44/77 (57%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N+L G IP S  KL+ L  L L +N L G +P  ++++ NL  LDL+ N ++G IP  I 
Sbjct  390  NKLNGTIPRSFHKLESLTYLNLSSNHLSGALPIEVARMRNLDTLDLSCNMITGSIPSAIG  449

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  NN+ G
Sbjct  450  KLEHLLRLNLSKNNVAG  466


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N + G IP +I KL+ L  L L  N + G IP+    + ++  +DL+ N LSG I
Sbjct  433  LDLSCNMITGSIPSAIGKLEHLLRLNLSKNNVAGHIPAEFGNLRSIMEIDLSYNHLSGLI  492

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + L  L L  NN+ G
Sbjct  493  PQEVGMLQNLILLKLESNNITG  514


 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNEL G IP  +  L   E L L+ N L G IP  L  +  L  L+L  N L+G I
Sbjct  289  LDLSFNELSGPIPSILGNLTYTEKLYLQGNRLTGLIPPELGNMSTLHYLELNDNLLTGFI  348

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L L  NNL+G
Sbjct  349  PPDLGKLTELFELNLANNNLIG  370


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G +   + +L  L    +KNN L G IP T+    + +VLDL+ N L+GEI
Sbjct  194  LGLRSNSLEGSLSPDMCQLTGLWYFDVKNNSLTGAIPETIGNCTSFQVLDLSNNHLTGEI  253

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN   G
Sbjct  254  PFNIGFLQVAT-LSLQGNKFSG  274



>ref|XP_008465055.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Cucumis melo]
Length=1000

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPF++SKLKQLE L +KNN+L GPIPST +QIPNLK LDLA+N+L+GEI
Sbjct  138  LDLSDNLLYGDIPFTVSKLKQLEFLNMKNNQLTGPIPSTFTQIPNLKTLDLARNQLTGEI  197

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN L G
Sbjct  198  PRLIYWNEVLQYLGLRGNFLTG  219


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G +P SI  L+ L +L L NN LVGP+P+    + +++++D++ N LSG I
Sbjct  449  LDLSCNYFLGPVPPSIGDLEHLLSLNLSNNRLVGPLPAEFGNLRSVQMIDMSFNNLSGSI  508

Query  182  P  184
            P
Sbjct  509  P  509


 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL QL  L L NN L GPIP  +S    L   ++  N L+G I
Sbjct  353  LQLNDNQLVGTIPSELGKLDQLFELNLANNYLEGPIPHNISSCTALNQFNVHGNNLNGSI  412

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  NN  G
Sbjct  413  PLGFQNLESLTYLNLSANNFKG  434


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +N+LVG IPS L ++  L  L+LA N L G I
Sbjct  329  LYLHGNKLTGPIPPELGNMSKLSYLQLNDNQLVGTIPSELGKLDQLFELNLANNYLEGPI  388

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GNNL G
Sbjct  389  PHNISSCTALNQFNVHGNNLNG  410


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+SFN L G IP  + +L+ + +LIL NN   G IP  L+   +L  L+L+ N LSG +
Sbjct  497  IDMSFNNLSGSIPMELGQLQNIISLILNNNHFQGKIPDRLTNCFSLANLNLSYNNLSGTL  556

Query  182  P  184
            P
Sbjct  557  P  557


 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 40/82 (49%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NEL GPIP  L  +     L L  NKL+G I
Sbjct  281  LSLQGNRLTGKIPDVIGLMQALAVLDLSENELEGPIPPILGNLSYTGKLYLHGNKLTGPI  340

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  341  PPELGNMSKLSYLQLNDNQLVG  362


 Score = 47.0 bits (110),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N   G IP  + ++  L+TL L  N  +GP+P ++  + +L  L+L+ N+L G +
Sbjct  425  LNLSANNFKGRIPVELGRIVNLDTLDLSCNYFLGPVPPSIGDLEHLLSLNLSNNRLVGPL  484

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +Q + +  NNL G
Sbjct  485  PAEFGNLRSVQMIDMSFNNLSG  506



>emb|CDX99001.1| BnaC09g48340D [Brassica napus]
Length=964

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD S N L+GDIPFSISKLKQLE L LKNN+L GPIP+TL+QIPNLK LDLA+N+L+GEI
Sbjct  118  LDFSTNCLFGDIPFSISKLKQLEFLNLKNNQLTGPIPATLTQIPNLKTLDLAKNQLTGEI  177

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQYLGLRGN L G
Sbjct  178  PRLLYWNEVLQYLGLRGNMLTG  199


 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S+N++ G IP++I  L Q+ TL L+ N L G IP  +  +  L VLDL+ N+L G I
Sbjct  238  LDVSYNQITGVIPYNIGFL-QVATLSLQGNRLTGRIPEVIGLMQALAVLDLSDNELVGPI  296

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++        L L GN L G
Sbjct  297  PPILGNLSFTGKLYLHGNKLTG  318


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G IP  + KL+QL  L L NN LVGPIP+ +S    L   ++  N L+G I
Sbjct  333  LQLNDNELVGTIPPELGKLEQLFELNLANNHLVGPIPANISSCAALNQFNVHGNFLNGSI  392

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        L YL L  N+  G
Sbjct  393  PIGFRNLGSLTYLNLSSNSFKG  414


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L +NELVGPIP  L  +     L L  NKL+G I
Sbjct  261  LSLQGNRLTGRIPEVIGLMQALAVLDLSDNELVGPIPPILGNLSFTGKLYLHGNKLTGPI  320

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  321  PPELGNMSRLSYLQLNDNELVG  342


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N+L GPIP  L  +  L  L L  N+L G I
Sbjct  285  LDLSDNELVGPIPPILGNLSFTGKLYLHGNKLTGPIPPELGNMSRLSYLQLNDNELVGTI  344

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N+LVG
Sbjct  345  PPELGKLEQLFELNLANNHLVG  366


 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +NELVG IP  L ++  L  L+LA N L G I
Sbjct  309  LYLHGNKLTGPIPPELGNMSRLSYLQLNDNELVGTIPPELGKLEQLFELNLANNHLVGPI  368

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GN L G
Sbjct  369  PANISSCAALNQFNVHGNFLNG  390



>ref|XP_002873299.1| hypothetical protein ARALYDRAFT_908657 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49558.1| hypothetical protein ARALYDRAFT_908657 [Arabidopsis lyrata subsp. 
lyrata]
Length=966

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D S N L+GDIPFSISKLKQLE L LKNN+L GPIP+TL+QIPNLK LDLA+N+L+GEI
Sbjct  125  VDFSTNSLFGDIPFSISKLKQLEFLNLKNNQLTGPIPATLTQIPNLKTLDLARNQLTGEI  184

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQYLGLRGN L G
Sbjct  185  PRLLYWNEVLQYLGLRGNMLTG  206


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G+IP  + KL+QL  L L NN LVGPIPS +S    L   ++  N LSG I
Sbjct  340  LQLNDNELVGNIPPELGKLEQLFELNLANNYLVGPIPSNISSCAALNQFNVHGNFLSGSI  399

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        L YL L  N+  G
Sbjct  400  PLEFRNLGSLTYLNLSSNSFKG  421


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S+N++ G IP++I  L Q+ TL L+ N L G IP  +  +  L VLDL+ N+L+G I
Sbjct  245  LDVSYNQITGVIPYNIGFL-QVATLSLQGNRLTGRIPEVIGLMQALAVLDLSDNELTGPI  303

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++        L L GN   G
Sbjct  304  PPILGNLSFTGKLYLHGNKFTG  325


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L +NEL GPIP  L  +     L L  NK +G+I
Sbjct  268  LSLQGNRLTGRIPEVIGLMQALAVLDLSDNELTGPIPPILGNLSFTGKLYLHGNKFTGQI  327

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  328  PPELGNMSRLSYLQLNDNELVG  349


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+SFN L G IP  + +L+ + ++IL NN++ G IP  L+   +L  L+++ N LSG I
Sbjct  484  IDVSFNFLAGVIPTELGQLQNINSMILNNNKIHGKIPDQLTNCFSLANLNISFNNLSGII  543

Query  182  P  184
            P
Sbjct  544  P  544



>ref|XP_010423243.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 isoform X1 [Camelina sativa]
Length=967

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLS N L+GDIPFSISKLKQLE L LKNN+L GPIP+TL+QIPNLK LDLA+N+L+GEI
Sbjct  126  VDLSTNLLFGDIPFSISKLKQLEFLNLKNNQLTGPIPATLTQIPNLKTLDLARNQLTGEI  185

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQYLGLRGN L G
Sbjct  186  PRLLYWNEVLQYLGLRGNMLTG  207


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S+N++ G IP++I  L Q+ TL L+ N L G IP  +  +  L VLDL+ N+L+G I
Sbjct  246  LDVSYNQITGVIPYNIGFL-QVATLSLQGNRLTGRIPEVIGLMQALAVLDLSDNELTGPI  304

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++        L L GN L G
Sbjct  305  PPILGNLSFTGKLYLHGNKLTG  326


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G IP  + KL+QL  L L NN LVGPIPS +S    L   ++  N LS  I
Sbjct  341  LQLNDNELVGTIPPELGKLEQLFELNLANNHLVGPIPSNISFCAALNQFNVHGNSLSDSI  400

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        L YL L  N+  G
Sbjct  401  PLEFRNLGSLTYLNLSSNSFKG  422


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 43/80 (54%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +NELVG IP  L ++  L  L+LA N L G I
Sbjct  317  LYLHGNKLTGPIPPELGNMSRLSYLQLNDNELVGTIPPELGKLEQLFELNLANNHLVGPI  376

Query  182  PRLIYWNEVLQYLGLRGNNL  241
            P  I +   L    + GN+L
Sbjct  377  PSNISFCAALNQFNVHGNSL  396


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N+L GPIP  L  +  L  L L  N+L G I
Sbjct  293  LDLSDNELTGPIPPILGNLSFTGKLYLHGNKLTGPIPPELGNMSRLSYLQLNDNELVGTI  352

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N+LVG
Sbjct  353  PPELGKLEQLFELNLANNHLVG  374


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L +NEL GPIP  L  +     L L  NKL+G I
Sbjct  269  LSLQGNRLTGRIPEVIGLMQALAVLDLSDNELTGPIPPILGNLSFTGKLYLHGNKLTGPI  328

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  329  PPELGNMSRLSYLQLNDNELVG  350



>ref|XP_010423244.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 isoform X2 [Camelina sativa]
Length=852

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    DLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIP  184
            DLS N L+GDIPFSISKLKQLE L LKNN+L GPIP+TL+QIPNLK LDLA+N+L+GEIP
Sbjct  12   DLSTNLLFGDIPFSISKLKQLEFLNLKNNQLTGPIPATLTQIPNLKTLDLARNQLTGEIP  71

Query  185  RLIYWNEVLQYLGLRGNNLVG  247
            RL+YWNEVLQYLGLRGN L G
Sbjct  72   RLLYWNEVLQYLGLRGNMLTG  92


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S+N++ G IP++I  L Q+ TL L+ N L G IP  +  +  L VLDL+ N+L+G I
Sbjct  131  LDVSYNQITGVIPYNIGFL-QVATLSLQGNRLTGRIPEVIGLMQALAVLDLSDNELTGPI  189

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++        L L GN L G
Sbjct  190  PPILGNLSFTGKLYLHGNKLTG  211


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G IP  + KL+QL  L L NN LVGPIPS +S    L   ++  N LS  I
Sbjct  226  LQLNDNELVGTIPPELGKLEQLFELNLANNHLVGPIPSNISFCAALNQFNVHGNSLSDSI  285

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        L YL L  N+  G
Sbjct  286  PLEFRNLGSLTYLNLSSNSFKG  307


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 43/80 (54%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +NELVG IP  L ++  L  L+LA N L G I
Sbjct  202  LYLHGNKLTGPIPPELGNMSRLSYLQLNDNELVGTIPPELGKLEQLFELNLANNHLVGPI  261

Query  182  PRLIYWNEVLQYLGLRGNNL  241
            P  I +   L    + GN+L
Sbjct  262  PSNISFCAALNQFNVHGNSL  281


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N+L GPIP  L  +  L  L L  N+L G I
Sbjct  178  LDLSDNELTGPIPPILGNLSFTGKLYLHGNKLTGPIPPELGNMSRLSYLQLNDNELVGTI  237

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N+LVG
Sbjct  238  PPELGKLEQLFELNLANNHLVG  259


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L +NEL GPIP  L  +     L L  NKL+G I
Sbjct  154  LSLQGNRLTGRIPEVIGLMQALAVLDLSDNELTGPIPPILGNLSFTGKLYLHGNKLTGPI  213

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  214  PPELGNMSRLSYLQLNDNELVG  235



>ref|XP_010491322.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Camelina sativa]
Length=961

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLS N L+GDIPFSISKLKQLE L LKNN+L GPIP+TL+QIPNLK LDLA+N+L+GEI
Sbjct  120  VDLSTNLLFGDIPFSISKLKQLEFLNLKNNQLTGPIPATLTQIPNLKTLDLARNQLTGEI  179

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQYLGLRGN L G
Sbjct  180  PRLLYWNEVLQYLGLRGNMLTG  201


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S+N++ G IP++I  L Q+ TL L+ N L G IP  +  +  L VLDL+ N+L+G I
Sbjct  240  LDVSYNQITGVIPYNIGFL-QVATLSLQGNRLTGGIPDVIGLMQALAVLDLSDNELTGTI  298

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++        L L GN L G
Sbjct  299  PPILGNLSFTGKLYLHGNKLTG  320


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G IP  + KL+QL  L L NN LVGPIPS +S    L   ++  N LSG I
Sbjct  335  LQLNDNELVGTIPPELGKLEQLFELNLANNHLVGPIPSNISSCAALNQFNVHGNSLSGSI  394

Query  182  P  184
            P
Sbjct  395  P  395


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +NELVG IP  L ++  L  L+LA N L G I
Sbjct  311  LYLHGNKLTGPIPPELGNMSRLSYLQLNDNELVGTIPPELGKLEQLFELNLANNHLVGPI  370

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GN+L G
Sbjct  371  PSNISSCAALNQFNVHGNSLSG  392


 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N+L GPIP  L  +  L  L L  N+L G I
Sbjct  287  LDLSDNELTGTIPPILGNLSFTGKLYLHGNKLTGPIPPELGNMSRLSYLQLNDNELVGTI  346

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N+LVG
Sbjct  347  PPELGKLEQLFELNLANNHLVG  368


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 38/77 (49%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N L G IP     L  L +L L +N   G IP+ L  I NL  LDL+ N  SG IP  + 
Sbjct  388  NSLSGSIPLEFRNLGSLTSLNLSSNSFKGKIPAELGHIINLDTLDLSGNNFSGSIPLTLG  447

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N+L G
Sbjct  448  DLEHLLILNLSRNHLNG  464



>ref|XP_009600406.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Nicotiana tomentosiformis]
Length=967

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N L+GDIPFSISKLKQLE L LKNN+L GPIPSTL+QIPNLK LDLA+N+L GEI
Sbjct  120  LDLSDNLLFGDIPFSISKLKQLELLNLKNNQLTGPIPSTLTQIPNLKTLDLARNQLIGEI  179

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN L G
Sbjct  180  PRLIYWNEVLQYLGLRGNLLTG  201


 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NE  G +P SI  L+ L TL L +N L G IP     + +++ LDL+ NK+SG I
Sbjct  431  LDLSNNEFSGSVPGSIGDLEHLLTLNLSSNRLNGQIPVEFGNLKSIQTLDLSCNKISGGI  490

Query  182  PR  187
            P+
Sbjct  491  PK  492


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +N+LVG IP  L ++  L  L+LA NKL G I
Sbjct  311  LYLHGNKLTGPIPAELGNMSKLSYLQLNDNQLVGQIPPELGKLDQLFELNLANNKLEGPI  370

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GNNL G
Sbjct  371  PENISSCTALNQFNVHGNNLNG  392


 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N+  G I  ++ ++  L+TL L NNE  G +P ++  + +L  L+L+ N+L+G+I
Sbjct  407  LNLSLNKFKGHISSALGRIINLDTLDLSNNEFSGSVPGSIGDLEHLLTLNLSSNRLNGQI  466

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      + +Q L L  N + G
Sbjct  467  PVEFGNLKSIQTLDLSCNKISG  488


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL QL  L L NN+L GPIP  +S    L   ++  N L+G I
Sbjct  335  LQLNDNQLVGQIPPELGKLDQLFELNLANNKLEGPIPENISSCTALNQFNVHGNNLNGSI  394

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  N   G
Sbjct  395  PSGFKNLESLTYLNLSLNKFKG  416


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 40/82 (49%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NELVGPIP     +     L L  NKL+G I
Sbjct  263  LSLQGNRLTGKIPEVIGLMQALAVLDLSENELVGPIPPIFGNLSFTGKLYLHGNKLTGPI  322

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  323  PAELGNMSKLSYLQLNDNQLVG  344



>gb|EPS66497.1| hypothetical protein M569_08274, partial [Genlisea aurea]
Length=941

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLS N + GDIPFSISKLKQLE L LKNN+L GPIPSTL+QIPNLK LDLA+N+L+GEI
Sbjct  91   IDLSDNLIEGDIPFSISKLKQLEILNLKNNQLTGPIPSTLTQIPNLKTLDLARNQLTGEI  150

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN L G
Sbjct  151  PRLIYWNEVLQYLGLRGNMLTG  172


 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N+L G IP     LK ++T+ +  N+L G IP  L Q+ NL  L L+ N LSG+I
Sbjct  426  LNLSHNDLNGHIPPEFGSLKSIQTMDMSANKLAGHIPDQLGQLQNLATLILSSNDLSGQI  485

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L+ L +  NNL G
Sbjct  486  PDQLTNCLSLENLNVSYNNLTG  507


 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL+QL  L L NN L GPIP  +S    L  L++  N+L+G I
Sbjct  306  LQLNDNQLSGSIPSELGKLEQLFELNLSNNNLEGPIPENISSCTALNQLNVHGNRLNGSI  365

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L YL L  N   G
Sbjct  366  PSGLKHLESLTYLNLSSNRFRG  387


 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDL+ NE  G +P SI +L+ L TL L +N+L G IP     + +++ +D++ NKL+G I
Sbjct  402  LDLASNEFSGPVPASIGELEHLLTLNLSHNDLNGHIPPEFGSLKSIQTMDMSANKLAGHI  461

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L  L L  N+L G
Sbjct  462  PDQLGQLQNLATLILSSNDLSG  483


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N   G++P  +  +  L+TL L +NE  GP+P+++ ++ +L  L+L+ N L+G I
Sbjct  378  LNLSSNRFRGNVPLELGHIVNLDTLDLASNEFSGPVPASIGELEHLLTLNLSHNDLNGHI  437

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      + +Q + +  N L G
Sbjct  438  PPEFGSLKSIQTMDMSANKLAG  459


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N+L GPIP  L  +  L  L L  N+LSG I
Sbjct  258  LDLSENELVGPIPPILGNLSYTGKLYLHGNKLTGPIPPELGNMTRLSYLQLNDNQLSGSI  317

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  NNL G
Sbjct  318  PSELGKLEQLFELNLSNNNLEG  339


 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+S N+L G IP  + +L+ L TLIL +N+L G IP  L+   +L+ L+++ N L+G I
Sbjct  450  MDMSANKLAGHIPDQLGQLQNLATLILSSNDLSGQIPDQLTNCLSLENLNVSYNNLTGTI  509

Query  182  P  184
            P
Sbjct  510  P  510


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 42/80 (53%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    LSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPR  187
            L  N+L G IP  +  + +L  L L +N+L G IPS L ++  L  L+L+ N L G IP 
Sbjct  284  LHGNKLTGPIPPELGNMTRLSYLQLNDNQLSGSIPSELGKLEQLFELNLSNNNLEGPIPE  343

Query  188  LIYWNEVLQYLGLRGNNLVG  247
             I     L  L + GN L G
Sbjct  344  NISSCTALNQLNVHGNRLNG  363



>ref|XP_010035002.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Eucalyptus grandis]
 gb|KCW46259.1| hypothetical protein EUGRSUZ_K00138 [Eucalyptus grandis]
Length=948

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIP+SISKLKQLE L LKNN+L GPIPSTL+QIPNLK LDLA+N+ +GEI
Sbjct  91   LDLSDNLLYGDIPYSISKLKQLELLNLKNNQLTGPIPSTLTQIPNLKTLDLARNQFTGEI  150

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN L G
Sbjct  151  PRLIYWNEVLQYLGLRGNLLSG  172


 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL+QL  L L NN L GPIP  LS    L  L++  N+LSG +
Sbjct  306  LQLNDNQLVGPIPPELGKLEQLFELNLANNNLEGPIPDNLSSCTALNQLNVHGNRLSGSV  365

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  NN  G
Sbjct  366  PSGFRNLESLTYLNLSANNFNG  387


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+SFN + G IP  +S+L+ + +LIL NN L G IP  LS+  +L +L+++ N LSG +
Sbjct  450  IDMSFNNVSGTIPAELSQLQNIVSLILNNNNLHGEIPEQLSKCFSLTILNVSYNNLSGVV  509

Query  182  PRL  190
            P L
Sbjct  510  PPL  512


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +N+LVGPIP  L ++  L  L+LA N L G I
Sbjct  282  LYLHGNKLSGPIPPELGNMSRLSYLQLNDNQLVGPIPPELGKLEQLFELNLANNNLEGPI  341

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L + GN L G
Sbjct  342  PDNLSSCTALNQLNVHGNRLSG  363


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NELVGPIP  +  +     L L  NKLSG I
Sbjct  234  LSLQGNRLTGKIPEVIGLMQALAVLDLSENELVGPIPPIIGNLSYTGKLYLHGNKLSGPI  293

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  294  PPELGNMSRLSYLQLNDNQLVG  315


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+  G +P SI  L+ L  L L  N L GP+P+    + +++++D++ N +SG I
Sbjct  402  LDLSRNKFTGVVPPSIGDLEHLLMLNLSRNHLDGPLPAEFGNLRSIQIIDMSFNNVSGTI  461

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + +  L L  NNL G
Sbjct  462  PAELSQLQNIVSLILNNNNLHG  483


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  I  L     L L  N+L GPIP  L  +  L  L L  N+L G I
Sbjct  258  LDLSENELVGPIPPIIGNLSYTGKLYLHGNKLSGPIPPELGNMSRLSYLQLNDNQLVGPI  317

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  NNL G
Sbjct  318  PPELGKLEQLFELNLANNNLEG  339



>ref|XP_004234153.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Solanum lycopersicum]
Length=976

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N  YGDIPFSISKLKQLE L  KNN+L GPIPSTL+QIPNLK LDLA+N+L GEI
Sbjct  127  LDLSDNLFYGDIPFSISKLKQLELLNFKNNQLSGPIPSTLTQIPNLKTLDLARNQLIGEI  186

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN L G
Sbjct  187  PRLIYWNEVLQYLGLRGNMLTG  208


 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G IP SI  L+ L TL L +N L G IP     + +++ +D++ NK+SG I
Sbjct  438  LDLSGNNFSGSIPGSIGDLEHLLTLNLSSNHLDGQIPVEFGNLKSIQTIDMSSNKISGGI  497

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + +  L L GN L G
Sbjct  498  PKELGQLQTMITLTLTGNYLTG  519


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 44/80 (55%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G +P  +  + +L  L L +N+L+G IP  L ++  L  L+LA NKL G I
Sbjct  318  LYLHGNKLTGPVPPELGNMSKLSYLQLNDNQLMGRIPPELGKLDQLFELNLANNKLEGPI  377

Query  182  PRLIYWNEVLQYLGLRGNNL  241
            P  I     L  L + GNNL
Sbjct  378  PENISSCSALNQLNVHGNNL  397


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL QL  L L NN+L GPIP  +S    L  L++  N L+  I
Sbjct  342  LQLNDNQLMGRIPPELGKLDQLFELNLANNKLEGPIPENISSCSALNQLNVHGNNLNESI  401

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  N   G
Sbjct  402  PSGFKNLESLTYLNLSANKFKG  423


 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 40/82 (49%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NELVGPIP     +     L L  NKL+G +
Sbjct  270  LSLQGNRLTGRIPEVIGLMQALAVLDLSENELVGPIPPIFGNLSYTGKLYLHGNKLTGPV  329

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N L+G
Sbjct  330  PPELGNMSKLSYLQLNDNQLMG  351



>ref|XP_009122365.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Brassica rapa]
Length=963

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S N L GDIPFSISKLKQLE L LKNN+L GPIP+TL+QIPNLK LDLA+N+L+GEI
Sbjct  121  LDISTNCLVGDIPFSISKLKQLEYLNLKNNQLTGPIPATLTQIPNLKTLDLAKNQLTGEI  180

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQYLGLRGN L G
Sbjct  181  PRLLYWNEVLQYLGLRGNMLTG  202


 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G IP  + KL+QL  L L NN LVGPIP+ +S    L   ++  N L+G I
Sbjct  336  LQLNDNELVGTIPPELGKLEQLFELNLANNHLVGPIPANISSCAALNQFNVHGNLLNGSI  395

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        L YL L  N+  G
Sbjct  396  PLGFRNLGSLTYLNLSANSFKG  417


 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S+N++ G IP++I  L Q+ TL L+ N L G IP  +  +  L VLDL+ N+L G I
Sbjct  241  LDISYNQITGVIPYNIGFL-QVATLSLQENRLTGRIPEVIGLMQALAVLDLSGNELVGPI  299

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++        L L GN L G
Sbjct  300  PPILGNLSFTGKLYLHGNKLTG  321


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N+L GPIPS L  +  L  L L  N+L G I
Sbjct  288  LDLSGNELVGPIPPILGNLSFTGKLYLHGNKLTGPIPSELGNMSRLSYLQLNDNELVGTI  347

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N+LVG
Sbjct  348  PPELGKLEQLFELNLANNHLVG  369


 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NELVGPIP  L  +     L L  NKL+G I
Sbjct  264  LSLQENRLTGRIPEVIGLMQALAVLDLSGNELVGPIPPILGNLSFTGKLYLHGNKLTGPI  323

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  324  PSELGNMSRLSYLQLNDNELVG  345


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS   L G+I  ++  L+ L+++ L+ N L G IP  L    +L  LD++ N L G+I
Sbjct  73   LNLSNLNLGGEISPALGDLRSLQSIDLQGNNLGGQIPDELGNCASLAYLDISTNCLVGDI  132

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I   + L+YL L+ N L G
Sbjct  133  PFSISKLKQLEYLNLKNNQLTG  154


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +NELVG IP  L ++  L  L+LA N L G I
Sbjct  312  LYLHGNKLTGPIPSELGNMSRLSYLQLNDNELVGTIPPELGKLEQLFELNLANNHLVGPI  371

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GN L G
Sbjct  372  PANISSCAALNQFNVHGNLLNG  393



>ref|NP_196335.2| LRR receptor-like serine/threonine-protein kinase ERL2 [Arabidopsis 
thaliana]
 sp|Q6XAT2.1|ERL2_ARATH RecName: Full=LRR receptor-like serine/threonine-protein kinase 
ERL2; AltName: Full=Protein ERECTA-like kinase 2; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAP69764.1| ERECTA-like kinase 2 [Arabidopsis thaliana]
 gb|ACN59363.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED91118.1| LRR receptor-like serine/threonine-protein kinase ERL2 [Arabidopsis 
thaliana]
Length=967

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D S N L+GDIPFSISKLKQLE L LKNN+L GPIP+TL+QIPNLK LDLA+N+L+GEI
Sbjct  126  VDFSTNLLFGDIPFSISKLKQLEFLNLKNNQLTGPIPATLTQIPNLKTLDLARNQLTGEI  185

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQYLGLRGN L G
Sbjct  186  PRLLYWNEVLQYLGLRGNMLTG  207


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S+N++ G IP++I  L Q+ TL L+ N+L G IP  +  +  L VLDL+ N+L+G I
Sbjct  246  LDVSYNQITGVIPYNIGFL-QVATLSLQGNKLTGRIPEVIGLMQALAVLDLSDNELTGPI  304

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++        L L GN L G
Sbjct  305  PPILGNLSFTGKLYLHGNKLTG  326


 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G IP  + KL+QL  L L NN LVG IPS +S    L   ++  N LSG +
Sbjct  341  LQLNDNELVGKIPPELGKLEQLFELNLANNNLVGLIPSNISSCAALNQFNVHGNFLSGAV  400

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        L YL L  N+  G
Sbjct  401  PLEFRNLGSLTYLNLSSNSFKG  422


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  I  ++ L  L L +NEL GPIP  L  +     L L  NKL+G+I
Sbjct  269  LSLQGNKLTGRIPEVIGLMQALAVLDLSDNELTGPIPPILGNLSFTGKLYLHGNKLTGQI  328

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  329  PPELGNMSRLSYLQLNDNELVG  350


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +NELVG IP  L ++  L  L+LA N L G I
Sbjct  317  LYLHGNKLTGQIPPELGNMSRLSYLQLNDNELVGKIPPELGKLEQLFELNLANNNLVGLI  376

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GN L G
Sbjct  377  PSNISSCAALNQFNVHGNFLSG  398


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N+L G IP  L  +  L  L L  N+L G+I
Sbjct  293  LDLSDNELTGPIPPILGNLSFTGKLYLHGNKLTGQIPPELGNMSRLSYLQLNDNELVGKI  352

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  NNLVG
Sbjct  353  PPELGKLEQLFELNLANNNLVG  374



>emb|CDX70013.1| BnaA10g23620D [Brassica napus]
Length=963

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S N L GDIPFSISKLKQLE L LKNN+L GPIP+TL+QIPNLK LDLA+N+L+GEI
Sbjct  121  LDISTNCLVGDIPFSISKLKQLEYLNLKNNQLTGPIPATLTQIPNLKTLDLAKNQLTGEI  180

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQYLGLRGN L G
Sbjct  181  PRLLYWNEVLQYLGLRGNMLTG  202


 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S+N++ G IP++I  L Q+ TL L+ N L G IP  +  +  L VLDL+ N+L G I
Sbjct  241  LDISYNQITGVIPYNIGFL-QVATLSLQENRLTGRIPEVIGLMQALAVLDLSGNELVGPI  299

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++        L L GN L G
Sbjct  300  PPILGNLSFTGKLYLHGNKLTG  321


 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G IP  + KL+QL  L L NN LVGPIP+ +S    L   ++  N L+G I
Sbjct  336  LQLNDNELVGTIPPELGKLEQLFELNLANNHLVGPIPANISSCAALNQFNVHGNLLNGSI  395

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        L YL L  N+  G
Sbjct  396  PLGFRNLGSLTYLNLSANSFKG  417


 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NELVGPIP  L  +     L L  NKL+G I
Sbjct  264  LSLQENRLTGRIPEVIGLMQALAVLDLSGNELVGPIPPILGNLSFTGKLYLHGNKLTGPI  323

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  324  PPELGNMSRLSYLQLNDNELVG  345


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N+L GPIP  L  +  L  L L  N+L G I
Sbjct  288  LDLSGNELVGPIPPILGNLSFTGKLYLHGNKLTGPIPPELGNMSRLSYLQLNDNELVGTI  347

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N+LVG
Sbjct  348  PPELGKLEQLFELNLANNHLVG  369


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS   L G+I  ++  L+ L+++ L+ N L G IP  L    +L  LD++ N L G+I
Sbjct  73   LNLSNLNLGGEISPALGDLRSLQSIDLQGNNLGGQIPDELGNCASLAYLDISTNCLVGDI  132

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I   + L+YL L+ N L G
Sbjct  133  PFSISKLKQLEYLNLKNNQLTG  154


 Score = 46.6 bits (109),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +NELVG IP  L ++  L  L+LA N L G I
Sbjct  312  LYLHGNKLTGPIPPELGNMSRLSYLQLNDNELVGTIPPELGKLEQLFELNLANNHLVGPI  371

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GN L G
Sbjct  372  PANISSCAALNQFNVHGNLLNG  393



>ref|XP_004308156.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Fragaria vesca subsp. vesca]
Length=989

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N L GDIPFS SKLK+LE L LKNN+L GPIP+TL+QIPNLK LDLA+N+L+GEI
Sbjct  134  LDLSDNNLSGDIPFSFSKLKKLEVLNLKNNQLTGPIPTTLTQIPNLKSLDLARNQLTGEI  193

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  194  PRLIYWNEVLQYLGLRGNSLTG  215


 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S N   G +P S+  L+ L TL L  N L GP+P+    + +++++D++ N LSG I
Sbjct  445  LDMSSNNFSGTVPTSVGNLEHLLTLNLSGNHLDGPLPAEFGNLMSVQIIDMSFNNLSGNI  504

Query  182  P  184
            P
Sbjct  505  P  505


 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NELVGPIP  L  +     L L  N L+G I
Sbjct  277  LSLQGNRLTGKIPEVIGLMQALAVLDLSENELVGPIPPILGNLSYTGKLYLHGNNLTGTI  336

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  NNLVG
Sbjct  337  PPELGNMSKLSYLQLNDNNLVG  358


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  +  + +L  L L +N LVG IP+ L ++  L  L+LA N L G I
Sbjct  325  LYLHGNNLTGTIPPELGNMSKLSYLQLNDNNLVGSIPAELGKLNQLFELNLASNDLEGPI  384

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GN+L G
Sbjct  385  PHDIGSCTALNQFNVHGNHLTG  406


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N L G IP  + KL QL  L L +N+L GPIP  +     L   ++  N L+G I
Sbjct  349  LQLNDNNLVGSIPAELGKLNQLFELNLASNDLEGPIPHDIGSCTALNQFNVHGNHLTGSI  408

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L YL L  N   G
Sbjct  409  PLALRNLQSLTYLNLSANAFSG  430



>emb|CAB87274.1| receptor-like protein kinase [Arabidopsis thaliana]
Length=932

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D S N L+GDIPFSISKLKQLE L LKNN+L GPIP+TL+QIPNLK LDLA+N+L+GEI
Sbjct  91   VDFSTNLLFGDIPFSISKLKQLEFLNLKNNQLTGPIPATLTQIPNLKTLDLARNQLTGEI  150

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQYLGLRGN L G
Sbjct  151  PRLLYWNEVLQYLGLRGNMLTG  172


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S+N++ G IP++I  L Q+ TL L+ N+L G IP  +  +  L VLDL+ N+L+G I
Sbjct  211  LDVSYNQITGVIPYNIGFL-QVATLSLQGNKLTGRIPEVIGLMQALAVLDLSDNELTGPI  269

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++        L L GN L G
Sbjct  270  PPILGNLSFTGKLYLHGNKLTG  291


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G IP  + KL+QL  L L NN LVG IPS +S    L   ++  N LSG +
Sbjct  306  LQLNDNELVGKIPPELGKLEQLFELNLANNNLVGLIPSNISSCAALNQFNVHGNFLSGAV  365

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        L YL L  N+  G
Sbjct  366  PLEFRNLGSLTYLNLSSNSFKG  387


 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  I  ++ L  L L +NEL GPIP  L  +     L L  NKL+G+I
Sbjct  234  LSLQGNKLTGRIPEVIGLMQALAVLDLSDNELTGPIPPILGNLSFTGKLYLHGNKLTGQI  293

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  294  PPELGNMSRLSYLQLNDNELVG  315


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +NELVG IP  L ++  L  L+LA N L G I
Sbjct  282  LYLHGNKLTGQIPPELGNMSRLSYLQLNDNELVGKIPPELGKLEQLFELNLANNNLVGLI  341

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GN L G
Sbjct  342  PSNISSCAALNQFNVHGNFLSG  363


 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N+L G IP  L  +  L  L L  N+L G+I
Sbjct  258  LDLSDNELTGPIPPILGNLSFTGKLYLHGNKLTGQIPPELGNMSRLSYLQLNDNELVGKI  317

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  NNLVG
Sbjct  318  PPELGKLEQLFELNLANNNLVG  339



>ref|NP_001190595.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Arabidopsis 
thaliana]
 gb|AED97584.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Arabidopsis 
thaliana]
Length=918

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFSISKLKQLETL LKNN+L GP+P+TL+QIPNLK LDLA N L+GEI
Sbjct  124  LDLSENLLYGDIPFSISKLKQLETLNLKNNQLTGPVPATLTQIPNLKRLDLAGNHLTGEI  183

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
             RL+YWNEVLQYLGLRGN L G
Sbjct  184  SRLLYWNEVLQYLGLRGNMLTG  205


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 40/82 (49%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N L GPIPS L  +  L  L L  NKL G I
Sbjct  291  LDLSDNELVGPIPPILGNLSFTGKLYLHGNMLTGPIPSELGNMSRLSYLQLNDNKLVGTI  350

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  NN  G
Sbjct  351  PPELGKLEQLFELNLSSNNFKG  372


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L +NELVGPIP  L  +     L L  N L+G I
Sbjct  267  LSLQGNRLTGRIPEVIGLMQALAVLDLSDNELVGPIPPILGNLSFTGKLYLHGNMLTGPI  326

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  327  PSELGNMSRLSYLQLNDNKLVG  348



>dbj|BAA97187.1| receptor-like protein kinase [Arabidopsis thaliana]
Length=938

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFSISKLKQLETL LKNN+L GP+P+TL+QIPNLK LDLA N L+GEI
Sbjct  124  LDLSENLLYGDIPFSISKLKQLETLNLKNNQLTGPVPATLTQIPNLKRLDLAGNHLTGEI  183

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
             RL+YWNEVLQYLGLRGN L G
Sbjct  184  SRLLYWNEVLQYLGLRGNMLTG  205


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N L GPIPS L  +  L  L L  NKL G I
Sbjct  291  LDLSDNELVGPIPPILGNLSFTGKLYLHGNMLTGPIPSELGNMSRLSYLQLNDNKLVGTI  350

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L + GN L G
Sbjct  351  PPELGKLEQLFELNVHGNLLSG  372


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L +NELVGPIP  L  +     L L  N L+G I
Sbjct  267  LSLQGNRLTGRIPEVIGLMQALAVLDLSDNELVGPIPPILGNLSFTGKLYLHGNMLTGPI  326

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  327  PSELGNMSRLSYLQLNDNKLVG  348



>ref|XP_006587379.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like [Glycine max]
Length=984

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+LYGD+PFSISKLKQL  L LK+N+L GPIPSTL+QIPNLK LDLA+N+L+GEI
Sbjct  136  LDLSDNQLYGDLPFSISKLKQLVFLNLKSNQLTGPIPSTLTQIPNLKTLDLARNRLTGEI  195

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQYLGLRGN L G
Sbjct  196  PRLLYWNEVLQYLGLRGNMLSG  217


 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 44/76 (58%), Gaps = 2/76 (3%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
             D++FN L G IP  I +L+ L +LIL NN+L G IP  L+   +L  L+++ N LSG I
Sbjct  495  FDMAFNYLSGSIPPEIGQLQNLASLILNNNDLSGKIPDQLTNCLSLNFLNVSYNNLSGVI  554

Query  182  PRL--IYWNEVLQYLG  223
            P +    W     ++G
Sbjct  555  PLMKNFSWFSADSFMG  570


 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G +P S+  L+ L TL L +N L GP+P+    + ++++ D+A N LSG I
Sbjct  447  LDLSSNNFSGYVPGSVGYLEHLLTLNLSHNSLEGPLPAEFGNLRSIQIFDMAFNYLSGSI  506

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I   + L  L L  N+L G
Sbjct  507  PPEIGQLQNLASLILNNNDLSG  528


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 40/82 (49%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N++ G IP  + KLK L  L L NN L G IP  +S    +   ++  N LSG I
Sbjct  351  LQLNDNQVVGQIPDELGKLKHLFELNLANNHLEGSIPLNISSCTAMNKFNVHGNHLSGSI  410

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        L YL L  NN  G
Sbjct  411  PLSFSSLGSLTYLNLSANNFKG  432


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G +   I +L  L    ++ N L G IP ++    N  +LDL+ N++SGEI
Sbjct  208  LGLRGNMLSGTLSSDICQLTGLWYFDVRGNNLTGTIPDSIGNCTNFAILDLSYNQISGEI  267

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN L G
Sbjct  268  PYNIGFLQVAT-LSLQGNRLTG  288



>gb|AAP69763.1| ERECTA-like kinase 1 [Arabidopsis thaliana]
Length=966

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFSISKLKQLETL LKNN+L GP+P+TL+QIPNLK LDLA N L+GEI
Sbjct  124  LDLSENLLYGDIPFSISKLKQLETLNLKNNQLTGPVPATLTQIPNLKRLDLAGNHLTGEI  183

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
             RL+YWNEVLQYLGLRGN L G
Sbjct  184  SRLLYWNEVLQYLGLRGNMLTG  205


 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL+QL  L L N+ LVGPIPS +S    L   ++  N LSG I
Sbjct  339  LQLNDNKLVGTIPPELGKLEQLFELNLANSRLVGPIPSNISSCAALNQFNVHGNLLSGSI  398

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        L YL L  NN  G
Sbjct  399  PLAFRNLGSLTYLNLSSNNFKG  420


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N L GPIPS L  +  L  L L  NKL G I
Sbjct  291  LDLSDNELVGPIPPILGNLSFTGKLYLHGNMLTGPIPSELGNMSRLSYLQLNDNKLVGTI  350

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  + LVG
Sbjct  351  PPELGKLEQLFELNLANSRLVG  372


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L +NELVGPIP  L  +     L L  N L+G I
Sbjct  267  LSLQGNRLTGRIPEVIGLMQALAVLDLSDNELVGPIPPILGNLSFTGKLYLHGNMLTGPI  326

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  327  PSELGNMSRLSYLQLNDNKLVG  348



>gb|KHN27841.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Glycine 
soja]
Length=940

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+LYGD+PFSISKLKQL  L LK+N+L GPIPSTL+QIPNLK LDLA+N+L+GEI
Sbjct  136  LDLSDNQLYGDLPFSISKLKQLVFLNLKSNQLTGPIPSTLTQIPNLKTLDLARNRLTGEI  195

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQYLGLRGN L G
Sbjct  196  PRLLYWNEVLQYLGLRGNMLSG  217


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 44/76 (58%), Gaps = 2/76 (3%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
             D++FN L G IP  I +L+ L +LIL NN+L G IP  L+   +L  L+++ N LSG I
Sbjct  495  FDMAFNYLSGSIPPEIGQLQNLASLILNNNDLSGKIPDQLTNCLSLNFLNVSYNNLSGVI  554

Query  182  PRL--IYWNEVLQYLG  223
            P +    W     ++G
Sbjct  555  PLMKNFSWFSADSFIG  570


 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G +P S+  L+ L TL L +N L GP+P+    + ++++ D+A N LSG I
Sbjct  447  LDLSSNNFSGYVPGSVGYLEHLLTLNLSHNSLEGPLPAEFGNLRSIQIFDMAFNYLSGSI  506

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I   + L  L L  N+L G
Sbjct  507  PPEIGQLQNLASLILNNNDLSG  528


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 40/82 (49%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N++ G IP  + KLK L  L L NN L G IP  +S    +   ++  N LSG I
Sbjct  351  LQLNDNQVVGQIPDELGKLKHLFELNLANNHLEGSIPLNISSCTAMNKFNVHGNHLSGSI  410

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        L YL L  NN  G
Sbjct  411  PLSFSSLGSLTYLNLSANNFKG  432


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G +   I +L  L    ++ N L G IP ++    N  +LDL+ N++SGEI
Sbjct  208  LGLRGNMLSGTLSSDICQLTGLWYFDVRGNNLTGTIPDSIGNCTNFAILDLSYNQISGEI  267

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN L G
Sbjct  268  PYNIGFLQVAT-LSLQGNRLTG  288



>ref|XP_002864777.1| hypothetical protein ARALYDRAFT_496399 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41036.1| hypothetical protein ARALYDRAFT_496399 [Arabidopsis lyrata subsp. 
lyrata]
Length=966

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFSISKLKQLETL LKNN+L GP+P+TL+QIPNLK LDLA N L+GEI
Sbjct  124  LDLSDNLLYGDIPFSISKLKQLETLNLKNNQLTGPVPATLTQIPNLKRLDLAGNHLTGEI  183

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
             RL+YWNEVLQYLGLRGN L G
Sbjct  184  SRLLYWNEVLQYLGLRGNMLTG  205


 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL+QL  L L NN LVGPIPS +S    L   ++  N LSG I
Sbjct  339  LQLNDNKLVGTIPPELGKLEQLFELNLANNRLVGPIPSNISSCAALNQFNVHGNLLSGSI  398

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        L YL L  NN  G
Sbjct  399  PLAFRNLGSLTYLNLSSNNFKG  420


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N+L GPIPS L  +  L  L L  NKL G I
Sbjct  291  LDLSDNELVGPIPPILGNLSFTGKLYLHGNKLTGPIPSELGNMSRLSYLQLNDNKLVGTI  350

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N LVG
Sbjct  351  PPELGKLEQLFELNLANNRLVG  372


 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L +NELVGPIP  L  +     L L  NKL+G I
Sbjct  267  LSLQGNRLTGRIPEVIGLMQALAVLDLSDNELVGPIPPILGNLSFTGKLYLHGNKLTGPI  326

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  327  PSELGNMSRLSYLQLNDNKLVG  348


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +N+LVG IP  L ++  L  L+LA N+L G I
Sbjct  315  LYLHGNKLTGPIPSELGNMSRLSYLQLNDNKLVGTIPPELGKLEQLFELNLANNRLVGPI  374

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GN L G
Sbjct  375  PSNISSCAALNQFNVHGNLLSG  396



>ref|NP_201029.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Arabidopsis 
thaliana]
 sp|C0LGW6.1|ERL1_ARATH RecName: Full=LRR receptor-like serine/threonine-protein kinase 
ERL1; AltName: Full=Protein ERECTA-like kinase 1; Flags: 
Precursor [Arabidopsis thaliana]
 gb|ACN59401.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED97583.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Arabidopsis 
thaliana]
Length=966

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFSISKLKQLETL LKNN+L GP+P+TL+QIPNLK LDLA N L+GEI
Sbjct  124  LDLSENLLYGDIPFSISKLKQLETLNLKNNQLTGPVPATLTQIPNLKRLDLAGNHLTGEI  183

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
             RL+YWNEVLQYLGLRGN L G
Sbjct  184  SRLLYWNEVLQYLGLRGNMLTG  205


 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL+QL  L L NN LVGPIPS +S    L   ++  N LSG I
Sbjct  339  LQLNDNKLVGTIPPELGKLEQLFELNLANNRLVGPIPSNISSCAALNQFNVHGNLLSGSI  398

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        L YL L  NN  G
Sbjct  399  PLAFRNLGSLTYLNLSSNNFKG  420


 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N L GPIPS L  +  L  L L  NKL G I
Sbjct  291  LDLSDNELVGPIPPILGNLSFTGKLYLHGNMLTGPIPSELGNMSRLSYLQLNDNKLVGTI  350

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N LVG
Sbjct  351  PPELGKLEQLFELNLANNRLVG  372


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L +NELVGPIP  L  +     L L  N L+G I
Sbjct  267  LSLQGNRLTGRIPEVIGLMQALAVLDLSDNELVGPIPPILGNLSFTGKLYLHGNMLTGPI  326

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  327  PSELGNMSRLSYLQLNDNKLVG  348



>emb|CDY00268.1| BnaA06g21690D [Brassica napus]
Length=967

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD S N LYGDIPFSISKLKQL+TL LKNN+L GP+P+TL+QIPNLK+LDLA N ++GEI
Sbjct  120  LDFSDNLLYGDIPFSISKLKQLDTLNLKNNQLTGPLPATLTQIPNLKILDLAGNHITGEI  179

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQY GLRGN L G
Sbjct  180  PRLLYWNEVLQYFGLRGNMLTG  201


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL+QL  L L NN LVGPIPS +S    L   ++  N L+G I
Sbjct  335  LQLNDNQLVGSIPPELGKLEQLFELNLANNRLVGPIPSNISSCAALNQFNVHGNLLNGSI  394

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        L YL L  NN  G
Sbjct  395  PLAFRNLGSLTYLNLSSNNFKG  416


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L +NELVGPIP  L  +     L L  NKL+G I
Sbjct  263  LSLQGNRLTGKIPEVIGLMQALAVLDLSDNELVGPIPPILGNLSFTGKLYLHGNKLTGSI  322

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  323  PPELGNMSRLSYLQLNDNQLVG  344


 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +N+LVG IP  L ++  L  L+LA N+L G I
Sbjct  311  LYLHGNKLTGSIPPELGNMSRLSYLQLNDNQLVGSIPPELGKLEQLFELNLANNRLVGPI  370

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GN L G
Sbjct  371  PSNISSCAALNQFNVHGNLLNG  392



>emb|CDX86913.1| BnaC03g51830D [Brassica napus]
Length=970

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD S N LYGDIPFSISKLKQL+TL LKNN+L GP+P+TL+QIPNLK+LDLA N ++GEI
Sbjct  119  LDFSDNLLYGDIPFSISKLKQLDTLNLKNNQLTGPLPATLTQIPNLKILDLAGNHITGEI  178

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQY GLRGN L G
Sbjct  179  PRLLYWNEVLQYFGLRGNMLTG  200


 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL+QL  L L NN LVGPIPS +S    L   ++  N L+G I
Sbjct  334  LQLNDNQLVGSIPLELGKLEQLFELNLANNRLVGPIPSNISSCAALNQFNVHGNLLNGSI  393

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        L YL L  NN  G
Sbjct  394  PLAFRNLGSLTYLNLSSNNFKG  415


 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S+N++ G+IP++I  L Q+ TL L+ N L G IP  +  +  L VLDL+ N+L G I
Sbjct  239  LDISYNQITGEIPYNIGFL-QVATLSLQGNRLTGKIPEVIGLMQALAVLDLSDNELVGPI  297

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++        L L GN L G
Sbjct  298  PPILGNLSFTGKLYLHGNKLTG  319


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L +NELVGPIP  L  +     L L  NKL+G I
Sbjct  262  LSLQGNRLTGKIPEVIGLMQALAVLDLSDNELVGPIPPILGNLSFTGKLYLHGNKLTGPI  321

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  322  PPELGNMSRLSYLQLNDNQLVG  343


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N+L GPIP  L  +  L  L L  N+L G I
Sbjct  286  LDLSDNELVGPIPPILGNLSFTGKLYLHGNKLTGPIPPELGNMSRLSYLQLNDNQLVGSI  345

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N LVG
Sbjct  346  PLELGKLEQLFELNLANNRLVG  367



>ref|XP_006399198.1| hypothetical protein EUTSA_v10012600mg [Eutrema salsugineum]
 gb|ESQ40651.1| hypothetical protein EUTSA_v10012600mg [Eutrema salsugineum]
Length=935

 Score =   130 bits (328),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLS N L+GDIPFSISKLKQLE L LK+N+L GPIP+TL+QIPNLK LDLA+N+L+GEI
Sbjct  120  VDLSTNFLFGDIPFSISKLKQLEFLNLKSNQLTGPIPATLTQIPNLKTLDLARNQLTGEI  179

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQYLGLRGN L G
Sbjct  180  PRLLYWNEVLQYLGLRGNMLTG  201


 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G IP  + KL+QL  L L NN LVGPIPS +S    L   ++  N L+G I
Sbjct  335  LQLNDNELVGTIPPELGKLEQLFELNLANNHLVGPIPSNISSCAALNQFNVHGNFLNGSI  394

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        L YL L GNN  G
Sbjct  395  PLGFRNLGSLTYLDLSGNNFSG  416


 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S+N++ G IP++I  L Q+ TL L+ N L G IP  +  +  L VLDL+ N+L G I
Sbjct  240  LDVSYNQITGVIPYNIGFL-QVATLSLQGNRLTGRIPEVIGLMQALAVLDLSDNELIGPI  298

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++        L L GN L G
Sbjct  299  PPILGNLSFTGKLYLHGNKLTG  320


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L +NEL+GPIP  L  +     L L  NKL+G I
Sbjct  263  LSLQGNRLTGRIPEVIGLMQALAVLDLSDNELIGPIPPILGNLSFTGKLYLHGNKLTGPI  322

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  323  PPNLGNMSRLSYLQLNDNELVG  344


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N+L GPIP  L  +  L  L L  N+L G I
Sbjct  287  LDLSDNELIGPIPPILGNLSFTGKLYLHGNKLTGPIPPNLGNMSRLSYLQLNDNELVGTI  346

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N+LVG
Sbjct  347  PPELGKLEQLFELNLANNHLVG  368


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G IP ++  L+ L TL L  N+L GP+P+    + +++++D++ N L+G I
Sbjct  407  LDLSGNNFSGSIPSTLGDLEHLLTLNLSRNQLNGPLPAEFGNLRSIQIIDVSFNFLAGVI  466

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + +  L L  N + G
Sbjct  467  PSELGLLQTINSLILNNNKIHG  488


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP ++  + +L  L L +NELVG IP  L ++  L  L+LA N L G I
Sbjct  311  LYLHGNKLTGPIPPNLGNMSRLSYLQLNDNELVGTIPPELGKLEQLFELNLANNHLVGPI  370

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GN L G
Sbjct  371  PSNISSCAALNQFNVHGNFLNG  392



>ref|XP_010483915.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Camelina sativa]
Length=965

 Score =   130 bits (328),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDL+ N LYGDIPFSISKLKQL+TL LKNN+L GP+P+TL+QIPNLK+LDLA N L+GEI
Sbjct  122  LDLTDNLLYGDIPFSISKLKQLDTLNLKNNQLTGPVPATLTQIPNLKILDLAGNHLTGEI  181

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
             RL+YWNEVLQYLGLRGN L G
Sbjct  182  SRLLYWNEVLQYLGLRGNMLTG  203


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L +NELVGPIP  L  +     L L  NKL+G I
Sbjct  265  LSLQGNRLTGRIPEVIGLMQALAVLDLSDNELVGPIPPILGNLSFTGKLYLHGNKLTGPI  324

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  325  PSELGNMSRLSYLQLNDNKLVG  346


 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL++L  L L NN L GPIPS +S    L   ++  N L+G I
Sbjct  337  LQLNDNKLVGTIPPELGKLEKLFELNLANNRLEGPIPSNISSCAALNQFNVHGNFLNGSI  396

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        L YL L  NN  G
Sbjct  397  PLTFRNLGSLTYLNLSSNNFKG  418


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N+L GPIPS L  +  L  L L  NKL G I
Sbjct  289  LDLSDNELVGPIPPILGNLSFTGKLYLHGNKLTGPIPSELGNMSRLSYLQLNDNKLVGTI  348

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N L G
Sbjct  349  PPELGKLEKLFELNLANNRLEG  370


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +N+LVG IP  L ++  L  L+LA N+L G I
Sbjct  313  LYLHGNKLTGPIPSELGNMSRLSYLQLNDNKLVGTIPPELGKLEKLFELNLANNRLEGPI  372

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GN L G
Sbjct  373  PSNISSCAALNQFNVHGNFLNG  394



>ref|XP_010483916.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Camelina sativa]
Length=964

 Score =   130 bits (328),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDL+ N LYGDIPFSISKLKQL+TL LKNN+L GP+P+TL+QIPNLK+LDLA N L+GEI
Sbjct  122  LDLTDNLLYGDIPFSISKLKQLDTLNLKNNQLTGPVPATLTQIPNLKILDLAGNHLTGEI  181

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
             RL+YWNEVLQYLGLRGN L G
Sbjct  182  SRLLYWNEVLQYLGLRGNMLTG  203


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L +NELVGPIP  L  +     L L  NKL+G I
Sbjct  265  LSLQGNRLTGRIPEVIGLMQALAVLDLSDNELVGPIPPILGNLSFTGKLYLHGNKLTGPI  324

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  325  PSELGNMSRLSYLQLNDNKLVG  346


 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL++L  L L NN L GPIPS +S    L   ++  N L+G I
Sbjct  337  LQLNDNKLVGTIPPELGKLEKLFELNLANNRLEGPIPSNISSCAALNQFNVHGNFLNGSI  396

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        L YL L  NN  G
Sbjct  397  PLTFRNLGSLTYLNLSSNNFKG  418


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N+L GPIPS L  +  L  L L  NKL G I
Sbjct  289  LDLSDNELVGPIPPILGNLSFTGKLYLHGNKLTGPIPSELGNMSRLSYLQLNDNKLVGTI  348

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N L G
Sbjct  349  PPELGKLEKLFELNLANNRLEG  370


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +N+LVG IP  L ++  L  L+LA N+L G I
Sbjct  313  LYLHGNKLTGPIPSELGNMSRLSYLQLNDNKLVGTIPPELGKLEKLFELNLANNRLEGPI  372

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GN L G
Sbjct  373  PSNISSCAALNQFNVHGNFLNG  394



>gb|EYU25015.1| hypothetical protein MIMGU_mgv1a000865mg [Erythranthe guttata]
Length=955

 Score =   130 bits (327),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N L GDIPFSISKLKQLE L LK+N+L GPIPSTL+QIPNLK LDLA+N+L GEI
Sbjct  91   LDLSDNMLEGDIPFSISKLKQLELLNLKDNQLTGPIPSTLTQIPNLKTLDLARNQLVGEI  150

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN L G
Sbjct  151  PRLIYWNEVLQYLGLRGNMLTG  172


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G +P S+  L+ L TL L +N L G IPS    + +++ +D++ NKLSG I
Sbjct  402  LDLSSNYFSGSVPASVGDLEHLLTLNLSHNHLSGSIPSEFGNLKSIQTMDMSFNKLSGSI  461

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L  L L  N L G
Sbjct  462  PEELGQVQNLASLILNNNALSG  483


 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP     LK ++T+ +  N+L G IP  L Q+ NL  L L  N LSG+I
Sbjct  426  LNLSHNHLSGSIPSEFGNLKSIQTMDMSFNKLSGSIPEELGQVQNLASLILNNNALSGKI  485

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L+ L    NN  G
Sbjct  486  PEQLSNCLSLEKLNFSYNNFTG  507


 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+SFN+L G IP  + +++ L +LIL NN L G IP  LS   +L+ L+ + N  +G +
Sbjct  450  MDMSFNKLSGSIPEELGQVQNLASLILNNNALSGKIPEQLSNCLSLEKLNFSYNNFTGLV  509

Query  182  P  184
            P
Sbjct  510  P  510


 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N+L GPIP  L  +  L  L L  N L+G I
Sbjct  258  LDLSENELVGPIPPILGNLSYTGKLYLHGNKLTGPIPPELGNMSKLSYLQLNDNHLTGGI  317

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L  L L  NNL G
Sbjct  318  PAELGNLDQLFELNLANNNLEG  339


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NELVGPIP  L  +     L L  NKL+G I
Sbjct  234  LSLQGNMLTGKIPEVIGLMQALAVLDLSENELVGPIPPILGNLSYTGKLYLHGNKLTGPI  293

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N+L G
Sbjct  294  PPELGNMSKLSYLQLNDNHLTG  315


 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 39/82 (48%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N L G IP  +  L QL  L L NN L GPIP  +S    L   ++  N L+G I
Sbjct  306  LQLNDNHLTGGIPAELGNLDQLFELNLANNNLEGPIPENISSCTALNQFNVHGNLLNGSI  365

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L YL    N   G
Sbjct  366  PYGLKHLDSLTYLNFSSNQFRG  387



>ref|XP_006279954.1| hypothetical protein CARUB_v10025821mg [Capsella rubella]
 gb|EOA12852.1| hypothetical protein CARUB_v10025821mg [Capsella rubella]
Length=970

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFSISKLKQLETL LKNN+L GP+P+TL+QIPNL+ LDLA N L+GEI
Sbjct  125  LDLSDNLLYGDIPFSISKLKQLETLNLKNNQLTGPVPATLTQIPNLRRLDLAGNHLTGEI  184

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
             RL+YWNEVLQYLGLRGN L G
Sbjct  185  SRLLYWNEVLQYLGLRGNMLTG  206


 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL+QL  L L NN L GPIPS +S    L    +  N L+G I
Sbjct  340  LQLNDNKLVGTIPPELGKLEQLFELNLANNRLEGPIPSNISSCAALNQFIVHGNFLNGSI  399

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        L YL L  NN  G
Sbjct  400  PLTFRNLGSLTYLNLSSNNFKG  421


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  I  ++ L  L L +NELVGPIP  L  +     L L  N L+G I
Sbjct  268  LSLQGNKLTGRIPEVIGLMQALAVLDLSDNELVGPIPPILGNLSFTGKLYLHGNMLTGPI  327

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  328  PPELGNMSRLSYLQLNDNKLVG  349



>ref|XP_010458423.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Camelina sativa]
Length=1007

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDL+ N LYGDIPFSISKLKQL+TL LKNN+L GP+P+TL+QIPNLK LDLA N L+GEI
Sbjct  122  LDLTDNLLYGDIPFSISKLKQLDTLNLKNNQLTGPVPATLTQIPNLKTLDLAGNHLTGEI  181

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
             RL+YWNEVLQYLGLRGN L G
Sbjct  182  SRLLYWNEVLQYLGLRGNMLTG  203


 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL+QL  L L NN L GPIPS +S    L   ++  N L+G I
Sbjct  337  LQLNDNKLVGTIPPELGKLEQLFELNLANNRLEGPIPSNISSCAALNQFNVHGNFLNGSI  396

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        L YL L  NN  G
Sbjct  397  PLTFRNLGSLTYLNLSSNNFTG  418


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L +NELVGPIP  L  +     L L  NKL+G I
Sbjct  265  LSLQGNRLTGTIPEVIGLMQALAVLDLSDNELVGPIPPILGNLSFTGKLYLHGNKLTGPI  324

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  325  PSELGNMSRLSYLQLNDNKLVG  346


 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N+L GPIPS L  +  L  L L  NKL G I
Sbjct  289  LDLSDNELVGPIPPILGNLSFTGKLYLHGNKLTGPIPSELGNMSRLSYLQLNDNKLVGTI  348

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N L G
Sbjct  349  PPELGKLEQLFELNLANNRLEG  370


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +N+LVG IP  L ++  L  L+LA N+L G I
Sbjct  313  LYLHGNKLTGPIPSELGNMSRLSYLQLNDNKLVGTIPPELGKLEQLFELNLANNRLEGPI  372

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GN L G
Sbjct  373  PSNISSCAALNQFNVHGNFLNG  394


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N   G IP  +  +  L+ L L  N   G IPSTL  + +L +L+L++N LSG++
Sbjct  409  LNLSSNNFTGKIPAELGHIINLDKLDLSGNNFSGSIPSTLGDLEHLLILNLSRNHLSGQL  468

Query  182  P  184
            P
Sbjct  469  P  469


 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 38/77 (49%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N L G IP +   L  L  L L +N   G IP+ L  I NL  LDL+ N  SG IP  + 
Sbjct  390  NFLNGSIPLTFRNLGSLTYLNLSSNNFTGKIPAELGHIINLDKLDLSGNNFSGSIPSTLG  449

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N+L G
Sbjct  450  DLEHLLILNLSRNHLSG  466



>ref|XP_007152392.1| hypothetical protein PHAVU_004G126100g [Phaseolus vulgaris]
 gb|ESW24386.1| hypothetical protein PHAVU_004G126100g [Phaseolus vulgaris]
Length=989

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+LYGDIPFSISKLKQL  L LK+N+L GPIPS L+QIPNLK LDLA+N+L+GEI
Sbjct  134  LDLSDNQLYGDIPFSISKLKQLVFLNLKSNQLTGPIPSILTQIPNLKTLDLARNRLTGEI  193

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQYLGLRGN L G
Sbjct  194  PRLLYWNEVLQYLGLRGNMLSG  215


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+SFN L G IP  I +L+ L +LIL NN+L G IP  L+   +L  L+++ N LSG I
Sbjct  493  IDISFNHLLGSIPPEIGQLQNLVSLILNNNDLRGKIPDQLTNCLSLNFLNVSYNNLSGVI  552

Query  182  P  184
            P
Sbjct  553  P  553


 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G +P S+  L+ L TL L +N L GP+P+    + +++++D++ N L G I
Sbjct  445  LDLSSNNFSGHVPGSVGYLEHLLTLNLSHNSLQGPLPAEFGNLRSIQIIDISFNHLLGSI  504

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I   + L  L L  N+L G
Sbjct  505  PPEIGQLQNLVSLILNNNDLRG  526


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL+ L  L L NN L G IP  +S    L   ++  N L+G I
Sbjct  349  LQLNDNQLVGQIPDELGKLEHLFELNLANNHLEGSIPLNISSCTALNKFNVHGNHLNGSI  408

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  NN  G
Sbjct  409  PLSFSSLESLTYLNLSANNFKG  430


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G +   I +L  L    ++ N L G IP ++    N ++LDL+ N++SGEI
Sbjct  206  LGLRGNMLSGTLSPDICQLTGLWYFDVRGNNLTGTIPDSIGNCTNFEILDLSYNQISGEI  265

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN L G
Sbjct  266  PYNIGFLQV-ATLSLQGNKLTG  286



>gb|AGL91671.1| erecta leucine-rich-repeat receptor-like kinase [Triticum aestivum]
Length=939

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 74/92 (80%), Gaps = 10/92 (11%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVL----------D  151
            LDLSFN L GDIPFS+SKLK LETLILKNN+LVG IPSTLSQ+PNLK+L          D
Sbjct  120  LDLSFNNLDGDIPFSVSKLKHLETLILKNNQLVGAIPSTLSQLPNLKILISNFMCMHPRD  179

Query  152  LAQNKLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
            LAQNKLSGEIPRLIYWNEVLQYL L  N+L G
Sbjct  180  LAQNKLSGEIPRLIYWNEVLQYLDLSYNHLTG  211


 Score = 65.1 bits (157),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N L G IPF+I  L Q+ TL L+ N   GPIPS +  +  L VLDL+ N+LSG I
Sbjct  202  LDLSYNHLTGSIPFNIGFL-QVATLSLQGNRFTGPIPSVIGLMQALAVLDLSYNQLSGPI  260

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L ++GN L G
Sbjct  261  PSILGNLTYTEKLYMQGNKLTG  282


 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N+L G IP S+ KL+ + +L L +N L GPIP  LS+I NL +LDL+ N ++G IP  I 
Sbjct  350  NKLNGTIPRSLCKLESMTSLNLSSNHLSGPIPIELSRINNLDILDLSCNMITGPIPSAIG  409

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N LVG
Sbjct  410  SLEHLLKLNLSKNALVG  426


 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP  + KL  L  L L NN L GPIP+ +S   NL   +   NKL+G I
Sbjct  297  LELNDNQLTGSIPAELGKLTGLYDLNLANNSLEGPIPNNISSCVNLNSFNAHGNKLNGTI  356

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR +   E +  L L  N+L G
Sbjct  357  PRSLCKLESMTSLNLSSNHLSG  378


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N + G IP +I  L+ L  L L  N LVG IP+    + ++  +DL+ N L G I
Sbjct  393  LDLSCNMITGPIPSAIGSLEHLLKLNLSKNALVGFIPAEFGNLRSIGEIDLSNNHLGGLI  452

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + L  L L  NN+ G
Sbjct  453  PQELGMLQNLMLLKLENNNITG  474


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G IP  +  L   E L ++ N+L G IP  L  +  L  L+L  N+L+G I
Sbjct  249  LDLSYNQLSGPIPSILGNLTYTEKLYMQGNKLTGTIPPELGNMSTLHYLELNDNQLTGSI  308

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L L  N+L G
Sbjct  309  PAELGKLTGLYDLNLANNSLEG  330


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+ L L  N + GPIPS +  + +L  L+L++N L G I
Sbjct  369  LNLSSNHLSGPIPIELSRINNLDILDLSCNMITGPIPSAIGSLEHLLKLNLSKNALVGFI  428

Query  182  P  184
            P
Sbjct  429  P  429



>gb|EMS63677.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Triticum 
urartu]
Length=922

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 74/92 (80%), Gaps = 10/92 (11%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVL----------D  151
            LDLSFN L GDIPFS+SKLK LETLILKNN+LVG IPSTLSQ+PNLK+L          D
Sbjct  103  LDLSFNNLDGDIPFSVSKLKHLETLILKNNQLVGAIPSTLSQLPNLKILISNFMCMHPRD  162

Query  152  LAQNKLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
            LAQNKLSGEIPRLIYWNEVLQYL L  N+L G
Sbjct  163  LAQNKLSGEIPRLIYWNEVLQYLDLSYNHLTG  194


 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N L G IPF+I  L Q+ TL L+ N   GPIPS +  +  L VLDL+ N+LSG I
Sbjct  185  LDLSYNHLTGSIPFNIGFL-QVATLSLQGNRFTGPIPSVIGLMQALAVLDLSYNQLSGPI  243

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L ++GN L G
Sbjct  244  PSILGNLTYTEKLYMQGNKLTG  265


 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N+L G IP S+ KL+ + +L L +N L GPIP  LS+I NL +LDL+ N ++G IP  I 
Sbjct  333  NKLNGTIPRSLCKLESMTSLNLSSNHLSGPIPIELSRINNLDILDLSCNMITGPIPSAIG  392

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N LVG
Sbjct  393  SLEHLLKLNLSKNALVG  409


 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP  + KL  L  L L NN L GPIP+ +S   NL   +   NKL+G I
Sbjct  280  LELNDNQLTGSIPAELGKLTGLYDLNLANNSLEGPIPNNISSCVNLNSFNAHGNKLNGTI  339

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR +   E +  L L  N+L G
Sbjct  340  PRSLCKLESMTSLNLSSNHLSG  361


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N + G IP +I  L+ L  L L  N LVG IP+    + ++  +DL+ N L G I
Sbjct  376  LDLSCNMITGPIPSAIGSLEHLLKLNLSKNALVGFIPAEFGNLRSIGEIDLSNNHLGGLI  435

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + L  L L  NN+ G
Sbjct  436  PQELGMLQNLMLLKLENNNITG  457


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G IP  +  L   E L ++ N+L G IP  L  +  L  L+L  N+L+G I
Sbjct  232  LDLSYNQLSGPIPSILGNLTYTEKLYMQGNKLTGTIPPELGNMSTLHYLELNDNQLTGSI  291

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L L  N+L G
Sbjct  292  PAELGKLTGLYDLNLANNSLEG  313


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+ L L  N + GPIPS +  + +L  L+L++N L G I
Sbjct  352  LNLSSNHLSGPIPIELSRINNLDILDLSCNMITGPIPSAIGSLEHLLKLNLSKNALVGFI  411

Query  182  P  184
            P
Sbjct  412  P  412



>gb|KHN24405.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Glycine 
soja]
Length=949

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+LYGDIPFSISKLKQL  L LK+N+L GPIPSTL+QI NLK LDLA+N+L+GEI
Sbjct  135  LDLSDNQLYGDIPFSISKLKQLVFLNLKSNQLTGPIPSTLTQISNLKTLDLARNRLTGEI  194

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQYLGLRGN L G
Sbjct  195  PRLLYWNEVLQYLGLRGNMLSG  216


 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+SFN L G IP  I +L+ L +LIL NN+L G IP  L+   +L  L+++ N LSG I
Sbjct  494  IDMSFNYLLGSIPPEIGQLQNLVSLILNNNDLRGKIPDQLTNCLSLNFLNVSYNSLSGVI  553

Query  182  P  184
            P
Sbjct  554  P  554


 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL+ L  L L NN L G IP  +S    L   ++  N LSG I
Sbjct  350  LQLNDNQLVGQIPDELGKLEHLFELNLANNHLEGSIPLNISSCTALNKFNVHGNHLSGSI  409

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  NN  G
Sbjct  410  PLSFSRLESLTYLNLSANNFKG  431


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G +P S+  L+ L TL L +N L GP+P+    + +++++D++ N L G I
Sbjct  446  LDLSSNNFSGHVPGSVGYLEHLLTLNLSHNSLQGPLPAEFGNLRSIQIIDMSFNYLLGSI  505

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I   + L  L L  N+L G
Sbjct  506  PPEIGQLQNLVSLILNNNDLRG  527


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G +   I +L  L    ++ N L G IP ++    N  +LDL+ N++SGEI
Sbjct  207  LGLRGNMLSGTLSSDICQLTGLWYFDVRGNNLTGTIPDSIGNCTNFAILDLSYNQISGEI  266

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN L G
Sbjct  267  PYNIGFLQVAT-LSLQGNRLTG  287


 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N L GPIP  L  +  L  L L  N+L G+I
Sbjct  302  LDLSDNELIGPIPPILGNLSYTGKLYLHGNMLTGPIPPELGNMSRLSYLQLNDNQLVGQI  361

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N+L G
Sbjct  362  PDELGKLEHLFELNLANNHLEG  383


 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L +NEL+GPIP  L  +     L L  N L+G I
Sbjct  278  LSLQGNRLTGKIPEVIGLMQALAILDLSDNELIGPIPPILGNLSYTGKLYLHGNMLTGPI  337

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  338  PPELGNMSRLSYLQLNDNQLVG  359



>ref|XP_009151345.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Brassica rapa]
Length=966

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD S N LYGDIPFSISKLKQL+TL LKNN L GP+P+TL+QIPNLK+LDLA N ++GEI
Sbjct  120  LDFSDNLLYGDIPFSISKLKQLDTLNLKNNLLTGPLPATLTQIPNLKILDLAGNHITGEI  179

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQY GLRGN L G
Sbjct  180  PRLLYWNEVLQYFGLRGNMLTG  201


 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S+N++ G+IP++I  L Q+ TL L+ N L G IP  +  +  L VLDL+ N+L G I
Sbjct  240  LDISYNQITGEIPYNIGFL-QVATLSLQGNRLTGKIPEVIGLMQALAVLDLSDNELVGPI  298

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++        L L GN L G
Sbjct  299  PPILGNLSFTGKLYLHGNKLTG  320


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL+QL  L L NN LVGPIPS +S    L   ++  N L+G I
Sbjct  335  LQLNDNQLVGSIPPELGKLEQLFELNLANNRLVGPIPSNISSCAALNQFNVHGNLLNGSI  394

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        L YL L  NN  G
Sbjct  395  PLAFRNLGSLTYLNLSSNNFKG  416


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L +NELVGPIP  L  +     L L  NKL+G I
Sbjct  263  LSLQGNRLTGKIPEVIGLMQALAVLDLSDNELVGPIPPILGNLSFTGKLYLHGNKLTGSI  322

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  323  PPELGNMSRLSYLQLNDNQLVG  344


 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +N+LVG IP  L ++  L  L+LA N+L G I
Sbjct  311  LYLHGNKLTGSIPPELGNMSRLSYLQLNDNQLVGSIPPELGKLEQLFELNLANNRLVGPI  370

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GN L G
Sbjct  371  PSNISSCAALNQFNVHGNLLNG  392



>ref|XP_009151343.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Brassica rapa]
Length=967

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD S N LYGDIPFSISKLKQL+TL LKNN L GP+P+TL+QIPNLK+LDLA N ++GEI
Sbjct  120  LDFSDNLLYGDIPFSISKLKQLDTLNLKNNLLTGPLPATLTQIPNLKILDLAGNHITGEI  179

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQY GLRGN L G
Sbjct  180  PRLLYWNEVLQYFGLRGNMLTG  201


 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S+N++ G+IP++I  L Q+ TL L+ N L G IP  +  +  L VLDL+ N+L G I
Sbjct  240  LDISYNQITGEIPYNIGFL-QVATLSLQGNRLTGKIPEVIGLMQALAVLDLSDNELVGPI  298

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++        L L GN L G
Sbjct  299  PPILGNLSFTGKLYLHGNKLTG  320


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL+QL  L L NN LVGPIPS +S    L   ++  N L+G I
Sbjct  335  LQLNDNQLVGSIPPELGKLEQLFELNLANNRLVGPIPSNISSCAALNQFNVHGNLLNGSI  394

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        L YL L  NN  G
Sbjct  395  PLAFRNLGSLTYLNLSSNNFKG  416


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L +NELVGPIP  L  +     L L  NKL+G I
Sbjct  263  LSLQGNRLTGKIPEVIGLMQALAVLDLSDNELVGPIPPILGNLSFTGKLYLHGNKLTGSI  322

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  323  PPELGNMSRLSYLQLNDNQLVG  344


 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +N+LVG IP  L ++  L  L+LA N+L G I
Sbjct  311  LYLHGNKLTGSIPPELGNMSRLSYLQLNDNQLVGSIPPELGKLEQLFELNLANNRLVGPI  370

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GN L G
Sbjct  371  PSNISSCAALNQFNVHGNLLNG  392



>gb|KFK27954.1| hypothetical protein AALP_AA8G452900 [Arabis alpina]
Length=975

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD S N LYGDIPFSISKLKQL+TL LKNN L GPIP+TL+QIPNLK LDLA N L+G+I
Sbjct  124  LDFSDNLLYGDIPFSISKLKQLDTLNLKNNLLTGPIPATLTQIPNLKRLDLAGNHLTGDI  183

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQYLGLRGN L G
Sbjct  184  PRLLYWNEVLQYLGLRGNMLTG  205


 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N L G IP  + KL++L  L L NN LVGPIPS +S    L   ++  N L+G I
Sbjct  339  LQLNDNRLVGTIPPELGKLEELFELNLANNRLVGPIPSNISSCAALNQFNVHGNLLNGSI  398

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        L YL L  NN  G
Sbjct  399  PLAFRNLGSLTYLNLSSNNFKG  420


 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N L GPIPS L  + +L  L L  N+L G I
Sbjct  291  LDLSDNELVGPIPPILGNLSFTGKLYLHGNMLTGPIPSELGNMSHLSYLQLNDNRLVGTI  350

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N LVG
Sbjct  351  PPELGKLEELFELNLANNRLVG  372


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L +NELVGPIP  L  +     L L  N L+G I
Sbjct  267  LSLQGNRLTGRIPEVIGLMQALAVLDLSDNELVGPIPPILGNLSFTGKLYLHGNMLTGPI  326

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  327  PSELGNMSHLSYLQLNDNRLVG  348



>ref|XP_002510897.1| erecta, putative [Ricinus communis]
 gb|EEF51499.1| erecta, putative [Ricinus communis]
Length=948

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N L GDIPFS+SKLKQLE L LKNN+L GPIP+TL+QIPNLK LDLA+N+L GEI
Sbjct  91   LDLSDNLLDGDIPFSVSKLKQLEFLNLKNNQLTGPIPATLTQIPNLKTLDLARNQLIGEI  150

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQYLGLRGN+L G
Sbjct  151  PRLLYWNEVLQYLGLRGNSLTG  172


 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G+IP  + KL+QL  L L NN+L GPIP  +S    L   ++  N+L+G I
Sbjct  306  LQLNDNQLVGNIPPELGKLEQLFELNLGNNDLEGPIPHNISSCTALNQFNVHGNRLNGTI  365

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  NN  G
Sbjct  366  PSGFKNLESLTYLNLSSNNFKG  387


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  I  ++ L  L L  NELVGPIP  L  +     L L  NKL+G I
Sbjct  234  LSLQGNKLTGKIPEVIGLMQALAVLDLSENELVGPIPPILGNLSFTGKLYLYGNKLTGPI  293

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  294  PPELGNMSKLSYLQLNDNQLVG  315


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+SFN + G IP  + +L+ + +LIL NN L G IP  L+   +L  L+ + N L+G I
Sbjct  450  LDISFNNVTGGIPAELGQLQNIVSLILNNNSLQGEIPDQLTNCFSLANLNFSYNNLTGII  509

Query  182  P  184
            P
Sbjct  510  P  510


 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N   G IP  +  +  L+TL L  N   GP+P ++  + +L  L+L++N+L G +
Sbjct  378  LNLSSNNFKGRIPLELGHIVNLDTLDLSANSFSGPVPVSIGGLEHLLTLNLSRNRLDGVL  437

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +Q L +  NN+ G
Sbjct  438  PAEFGNLRSIQILDISFNNVTG  459



>ref|XP_010444058.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Camelina sativa]
Length=968

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDL+ N LYGDIPFSISKLKQL+TL LKNN+L GP+P+TL+QIPNLK LDLA N L+GEI
Sbjct  125  LDLTDNLLYGDIPFSISKLKQLDTLNLKNNQLTGPVPATLTQIPNLKRLDLAGNHLTGEI  184

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
             RL+YWNEVLQYLGLRGN L G
Sbjct  185  SRLLYWNEVLQYLGLRGNMLTG  206


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL+QL  L L NN L GPIPS +S    L   ++  N L+G I
Sbjct  340  LQLNDNKLVGTIPPELGKLEQLFELNLANNRLEGPIPSNISSCAALNQFNVHGNFLNGSI  399

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        L YL L  NN  G
Sbjct  400  PLTFRNLGSLTYLNLSSNNFKG  421


 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L +NELVGPIP  L  +     L L  NKL+G I
Sbjct  268  LSLQGNRLTGRIPEVIGLMQALAVLDLSDNELVGPIPPILGNLSFTGKLYLHGNKLTGTI  327

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  328  PSELGNMSRLSYLQLNDNKLVG  349


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +N+LVG IP  L ++  L  L+LA N+L G I
Sbjct  316  LYLHGNKLTGTIPSELGNMSRLSYLQLNDNKLVGTIPPELGKLEQLFELNLANNRLEGPI  375

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GN L G
Sbjct  376  PSNISSCAALNQFNVHGNFLNG  397



>gb|EMT04765.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Aegilops 
tauschii]
Length=939

 Score =   128 bits (322),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L GDIPFSISKLK LE LILKNN+LVG IPSTLSQ+PNLK+LDLAQNKLSGEI
Sbjct  145  LNLSSNNLEGDIPFSISKLKHLENLILKNNQLVGVIPSTLSQLPNLKILDLAQNKLSGEI  204

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYW+EVLQY  ++ N+L+G
Sbjct  205  PRLIYWSEVLQYFDVKNNSLMG  226


 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDL+ N+L G IP  + KL  L  L L NNEL G IP  +S   +L   +   NKL+G I
Sbjct  312  LDLNDNKLTGLIPPELGKLTALYDLNLANNELEGTIPDNISSCTSLVSFNAYGNKLNGTI  371

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR ++  + + YL L  N L G
Sbjct  372  PRSLHKLQSMTYLNLSSNYLNG  393


 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  ++++  L+ L L  N LVG IP+  + + ++  +DL+ N ++G I
Sbjct  384  LNLSSNYLNGAIPTELARMINLDVLNLSKNNLVGHIPTEFANLRSITEIDLSYNHINGFI  443

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR     + L  L L  NN+ G
Sbjct  444  PREFGMLQNLILLKLESNNMTG  465


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+L G IP  +  L   E L L +N+L G IP  L ++  L  L+LA N+L G I
Sbjct  288  LDLSLNQLSGPIPSILGNLTYTEKLDLNDNKLTGLIPPELGKLTALYDLNLANNELEGTI  347

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L      GN L G
Sbjct  348  PDNISSCTSLVSFNAYGNKLNG  369



>ref|XP_010555314.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Tarenaya hassleriana]
Length=986

 Score =   128 bits (322),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD S N L+GDIPFSISKLKQLE L LKNN+L GPIP+TL+QIP+LK LDLA+N+L GEI
Sbjct  124  LDFSNNLLFGDIPFSISKLKQLEFLNLKNNQLTGPIPATLTQIPSLKTLDLARNQLIGEI  183

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQYLGLRGN L G
Sbjct  184  PRLLYWNEVLQYLGLRGNMLTG  205


 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S+N++ G+IP+++  L Q+ TL L+ N L G IP+ +  +  L VLDL+ N+L G I
Sbjct  244  LDISYNQITGEIPYNVGFL-QVATLSLQGNRLTGKIPAVIGLMQALAVLDLSDNELDGPI  302

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++        L L GN L G
Sbjct  303  PPILGNLSYTGKLYLHGNKLTG  324


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G IP  + KL+QL  L L NN LVGPIP  +S    L   ++  N LSG I
Sbjct  339  LQLNNNELVGSIPPELGKLEQLFELNLANNRLVGPIPYNISSCAALNQFNVHGNLLSGSI  398

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        L YL L  NN  G
Sbjct  399  PLGFRNLGSLTYLNLSANNFKG  420


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L NNELVG IP  L ++  L  L+LA N+L G I
Sbjct  315  LYLHGNKLTGPIPPELGNMSRLSYLQLNNNELVGSIPPELGKLEQLFELNLANNRLVGPI  374

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GN L G
Sbjct  375  PYNISSCAALNQFNVHGNLLSG  396


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L +NEL GPIP  L  +     L L  NKL+G I
Sbjct  267  LSLQGNRLTGKIPAVIGLMQALAVLDLSDNELDGPIPPILGNLSYTGKLYLHGNKLTGPI  326

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  327  PPELGNMSRLSYLQLNNNELVG  348


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 38/77 (49%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N L G IP     L  L  L L  N   G IP+ L  I NL  LDL+ N LSG IP  + 
Sbjct  392  NLLSGSIPLGFRNLGSLTYLNLSANNFKGKIPAELGHIINLDKLDLSGNNLSGSIPSTLG  451

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L GN+L G
Sbjct  452  DLEHLLILNLSGNHLNG  468


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N+L GPIP  L  +  L  L L  N+L G I
Sbjct  291  LDLSDNELDGPIPPILGNLSYTGKLYLHGNKLTGPIPPELGNMSRLSYLQLNNNELVGSI  350

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N LVG
Sbjct  351  PPELGKLEQLFELNLANNRLVG  372


 Score = 47.0 bits (110),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N L G IP ++  L+ L  L L  N L GP+P+    + +++++D++ N LSG I
Sbjct  435  LDLSGNNLSGSIPSTLGDLEHLLILNLSGNHLNGPLPADFGNLRSIQIVDVSFNILSGVI  494

Query  182  P  184
            P
Sbjct  495  P  495



>gb|KDP22376.1| hypothetical protein JCGZ_26207 [Jatropha curcas]
Length=992

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N L GDIPFSISKLKQLE L LK+N+L GPIP+TL+QIPNLK LDLA+N+L GEI
Sbjct  136  LDLSDNLLTGDIPFSISKLKQLEFLNLKSNQLTGPIPATLTQIPNLKTLDLARNQLIGEI  195

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQYLGLRGN+L G
Sbjct  196  PRLLYWNEVLQYLGLRGNSLTG  217


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL+QL  L L NN+L GPIP  +S    L   ++  N+L+G I
Sbjct  351  LQLNDNQLVGSIPPELGKLEQLFELNLANNDLEGPIPHNISSCTALNQFNVHGNRLNGTI  410

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  NN  G
Sbjct  411  PLGFRNLESLTYLNLSSNNFKG  432


 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLSFN + G IP  + +L+ + +L+L NN L G IP  L+   +L  L+ + N LSG +
Sbjct  495  IDLSFNNVTGSIPAELGQLQNIVSLVLNNNNLQGEIPEQLTNCFSLANLNFSHNNLSGVV  554

Query  182  P  184
            P
Sbjct  555  P  555


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  I  ++ L  L L  NELVGPIP  L  +     L L  NKL+G I
Sbjct  279  LSLQGNKLTGKIPEVIGLMQALAVLDLSENELVGPIPPILGNLSYTGKLYLYGNKLTGPI  338

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  339  PPELGNMSKLSYLQLNDNQLVG  360


 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G IP S+  L+ L TL    N L G +P+    + +++++DL+ N ++G I
Sbjct  447  LDLSGNGFSGPIPASVGDLEHLLTLNFSRNHLNGQLPAEFGNLRSIQIIDLSFNNVTGSI  506

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + +  L L  NNL G
Sbjct  507  PAELGQLQNIVSLVLNNNNLQG  528



>ref|XP_006289323.1| hypothetical protein CARUB_v10002808mg [Capsella rubella]
 gb|EOA22221.1| hypothetical protein CARUB_v10002808mg [Capsella rubella]
Length=967

 Score =   128 bits (321),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D S N L+GDIPFSISKLK LE L LKNN+L GPIP+TL+QIPNLK LDLA+N+L+GEI
Sbjct  126  VDFSTNLLFGDIPFSISKLKLLEFLNLKNNQLTGPIPATLTQIPNLKTLDLARNQLTGEI  185

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQYLGLRGN L G
Sbjct  186  PRLLYWNEVLQYLGLRGNMLTG  207


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S+N++ G IP++I  L Q+ TL L+ N L G IP  +  +  L VLDL+ N+L+G I
Sbjct  246  LDVSYNQITGVIPYNIGFL-QVATLSLQGNRLTGTIPEVIGLMQALAVLDLSDNELTGPI  304

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++        L L GN L G
Sbjct  305  PPILGNLSFTGKLYLHGNKLTG  326


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ NEL G IP  + KL+QL  L L NN LVGPIPS +S    L   ++  N LSG I
Sbjct  341  LQLNDNELVGTIPPELGKLEQLFELNLANNHLVGPIPSNISSCAALNQFNVHGNSLSGSI  400

Query  182  P  184
            P
Sbjct  401  P  401


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +NELVG IP  L ++  L  L+LA N L G I
Sbjct  317  LYLHGNKLTGPIPPELGNMSRLSYLQLNDNELVGTIPPELGKLEQLFELNLANNHLVGPI  376

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GN+L G
Sbjct  377  PSNISSCAALNQFNVHGNSLSG  398


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N+L GPIP  L  +  L  L L  N+L G I
Sbjct  293  LDLSDNELTGPIPPILGNLSFTGKLYLHGNKLTGPIPPELGNMSRLSYLQLNDNELVGTI  352

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N+LVG
Sbjct  353  PPELGKLEQLFELNLANNHLVG  374


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L +NEL GPIP  L  +     L L  NKL+G I
Sbjct  269  LSLQGNRLTGTIPEVIGLMQALAVLDLSDNELTGPIPPILGNLSFTGKLYLHGNKLTGPI  328

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  329  PPELGNMSRLSYLQLNDNELVG  350


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+SFN L G IP  + +L+ + +LIL NN++ G IP  L+   +L  L+++ N LSG I
Sbjct  485  IDVSFNFLAGVIPTELGQLQDINSLILNNNKIHGRIPDQLTNCFSLANLNISFNNLSGII  544

Query  182  P  184
            P
Sbjct  545  P  545



>gb|EMS68149.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Triticum 
urartu]
Length=847

 Score =   127 bits (319),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    DLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIP  184
            +LS N L GDIPFSISKLK LE LILKNN+LVG IPSTLSQ+PNLK+LDLAQNKLSGEIP
Sbjct  102  NLSSNNLEGDIPFSISKLKHLENLILKNNQLVGVIPSTLSQLPNLKILDLAQNKLSGEIP  161

Query  185  RLIYWNEVLQYLGLRGNNLVG  247
            RLIYW+EVLQY  ++ N+L+G
Sbjct  162  RLIYWSEVLQYFDVKNNSLMG  182


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N+L G IP S+ KL+ +  L L +N L G IP+ L+++ NL +LDL+ N ++G IPR + 
Sbjct  321  NKLNGTIPRSLHKLQSMTYLNLSSNYLNGAIPTELARMINLDILDLSYNHINGFIPRELG  380

Query  197  WNEVLQYLGLRGNNLVG  247
              + L  L L  NN+ G
Sbjct  381  MLQNLILLKLESNNMTG  397


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDL+ N+L G IP  + KL  L  L L NNEL G IP  +S   +L   +   NKL+G I
Sbjct  268  LDLNDNKLTGLIPPELGKLTALYDLNLANNELEGMIPDNISSCTSLVSFNAYGNKLNGTI  327

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR ++  + + YL L  N L G
Sbjct  328  PRSLHKLQSMTYLNLSSNYLNG  349


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+L G IP  +  L   E L L +N+L G IP  L ++  L  L+LA N+L G I
Sbjct  244  LDLSLNQLSGPIPSILGNLTYTEKLDLNDNKLTGLIPPELGKLTALYDLNLANNELEGMI  303

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L      GN L G
Sbjct  304  PDNISSCTSLVSFNAYGNKLNG  325



>ref|NP_001235330.1| ERECTA-like kinase [Glycine max]
 gb|ACM89560.1| ERECTA-like kinase [Glycine max]
Length=1009

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+LYGDIPFSIS LKQL  L LK+N+L GPIPSTL+QI NLK LDLA+N+L+GEI
Sbjct  135  LDLSDNQLYGDIPFSISNLKQLVFLNLKSNQLTGPIPSTLTQISNLKTLDLARNRLTGEI  194

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQYLGLRGN L G
Sbjct  195  PRLLYWNEVLQYLGLRGNMLSG  216


 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+SFN L G +P  I +L+ L +LIL NN+L G IP  L+   +L  L+++ N LSG I
Sbjct  494  IDMSFNYLLGSVPPEIGQLQNLVSLILNNNDLRGKIPDQLTNCLSLNFLNVSYNNLSGVI  553

Query  182  P  184
            P
Sbjct  554  P  554


 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL+ L  L L NN L G IP  +S    L   ++  N LSG I
Sbjct  350  LQLNDNQLVGQIPDELGKLEHLFELNLANNHLEGSIPLNISSCTALNKFNVHGNHLSGSI  409

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  NN  G
Sbjct  410  PLSFSRLESLTYLNLSANNFKG  431


 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G +P S+  L+ L TL L +N L GP+P+    + +++++D++ N L G +
Sbjct  446  LDLSSNNFSGHVPGSVGYLEHLLTLNLSHNSLQGPLPAEFGNLRSIQIIDMSFNYLLGSV  505

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I   + L  L L  N+L G
Sbjct  506  PPEIGQLQNLVSLILNNNDLRG  527


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G +   I +L  L    ++ N L G IP ++    N  +LDL+ N++SGEI
Sbjct  207  LGLRGNMLSGTLSSDICQLTGLWYFDVRGNNLTGTIPDSIGNCTNFAILDLSYNQISGEI  266

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN L G
Sbjct  267  PYNIGFLQVAT-LSLQGNRLTG  287


 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N L GPIP  L  +  L  L L  N+L G+I
Sbjct  302  LDLSDNELIGPIPPILGNLSYTGKLYLHGNMLTGPIPPELGNMSRLSYLQLNDNQLVGQI  361

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N+L G
Sbjct  362  PDELGKLEHLFELNLANNHLEG  383


 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L +NEL+GPIP  L  +     L L  N L+G I
Sbjct  278  LSLQGNRLTGKIPEVIGLMQALAILDLSDNELIGPIPPILGNLSYTGKLYLHGNMLTGPI  337

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  338  PPELGNMSRLSYLQLNDNQLVG  359



>ref|XP_006598682.1| PREDICTED: ERECTA-like kinase isoform X1 [Glycine max]
Length=993

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+LYGDIPFSIS LKQL  L LK+N+L GPIPSTL+QI NLK LDLA+N+L+GEI
Sbjct  135  LDLSDNQLYGDIPFSISNLKQLVFLNLKSNQLTGPIPSTLTQISNLKTLDLARNRLTGEI  194

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQYLGLRGN L G
Sbjct  195  PRLLYWNEVLQYLGLRGNMLSG  216


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+SFN L G +P  I +L+ L +LIL NN+L G IP  L+   +L  L+++ N LSG I
Sbjct  494  IDMSFNYLLGSVPPEIGQLQNLVSLILNNNDLRGKIPDQLTNCLSLNFLNVSYNNLSGVI  553

Query  182  P  184
            P
Sbjct  554  P  554


 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL+ L  L L NN L G IP  +S    L   ++  N LSG I
Sbjct  350  LQLNDNQLVGQIPDELGKLEHLFELNLANNHLEGSIPLNISSCTALNKFNVHGNHLSGSI  409

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  NN  G
Sbjct  410  PLSFSRLESLTYLNLSANNFKG  431


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G +P S+  L+ L TL L +N L GP+P+    + +++++D++ N L G +
Sbjct  446  LDLSSNNFSGHVPGSVGYLEHLLTLNLSHNSLQGPLPAEFGNLRSIQIIDMSFNYLLGSV  505

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I   + L  L L  N+L G
Sbjct  506  PPEIGQLQNLVSLILNNNDLRG  527


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G +   I +L  L    ++ N L G IP ++    N  +LDL+ N++SGEI
Sbjct  207  LGLRGNMLSGTLSSDICQLTGLWYFDVRGNNLTGTIPDSIGNCTNFAILDLSYNQISGEI  266

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN L G
Sbjct  267  PYNIGFLQVAT-LSLQGNRLTG  287


 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N L GPIP  L  +  L  L L  N+L G+I
Sbjct  302  LDLSDNELIGPIPPILGNLSYTGKLYLHGNMLTGPIPPELGNMSRLSYLQLNDNQLVGQI  361

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N+L G
Sbjct  362  PDELGKLEHLFELNLANNHLEG  383


 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L +NEL+GPIP  L  +     L L  N L+G I
Sbjct  278  LSLQGNRLTGKIPEVIGLMQALAILDLSDNELIGPIPPILGNLSYTGKLYLHGNMLTGPI  337

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  338  PPELGNMSRLSYLQLNDNQLVG  359



>ref|XP_006598683.1| PREDICTED: ERECTA-like kinase isoform X2 [Glycine max]
Length=949

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+LYGDIPFSIS LKQL  L LK+N+L GPIPSTL+QI NLK LDLA+N+L+GEI
Sbjct  91   LDLSDNQLYGDIPFSISNLKQLVFLNLKSNQLTGPIPSTLTQISNLKTLDLARNRLTGEI  150

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRL+YWNEVLQYLGLRGN L G
Sbjct  151  PRLLYWNEVLQYLGLRGNMLSG  172


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+SFN L G +P  I +L+ L +LIL NN+L G IP  L+   +L  L+++ N LSG I
Sbjct  450  IDMSFNYLLGSVPPEIGQLQNLVSLILNNNDLRGKIPDQLTNCLSLNFLNVSYNNLSGVI  509

Query  182  P  184
            P
Sbjct  510  P  510


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL+ L  L L NN L G IP  +S    L   ++  N LSG I
Sbjct  306  LQLNDNQLVGQIPDELGKLEHLFELNLANNHLEGSIPLNISSCTALNKFNVHGNHLSGSI  365

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  NN  G
Sbjct  366  PLSFSRLESLTYLNLSANNFKG  387


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G +P S+  L+ L TL L +N L GP+P+    + +++++D++ N L G +
Sbjct  402  LDLSSNNFSGHVPGSVGYLEHLLTLNLSHNSLQGPLPAEFGNLRSIQIIDMSFNYLLGSV  461

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I   + L  L L  N+L G
Sbjct  462  PPEIGQLQNLVSLILNNNDLRG  483


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G +   I +L  L    ++ N L G IP ++    N  +LDL+ N++SGEI
Sbjct  163  LGLRGNMLSGTLSSDICQLTGLWYFDVRGNNLTGTIPDSIGNCTNFAILDLSYNQISGEI  222

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN L G
Sbjct  223  PYNIGFLQVAT-LSLQGNRLTG  243


 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N L GPIP  L  +  L  L L  N+L G+I
Sbjct  258  LDLSDNELIGPIPPILGNLSYTGKLYLHGNMLTGPIPPELGNMSRLSYLQLNDNQLVGQI  317

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N+L G
Sbjct  318  PDELGKLEHLFELNLANNHLEG  339


 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L +NEL+GPIP  L  +     L L  N L+G I
Sbjct  234  LSLQGNRLTGKIPEVIGLMQALAILDLSDNELIGPIPPILGNLSYTGKLYLHGNMLTGPI  293

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  294  PPELGNMSRLSYLQLNDNQLVG  315



>ref|NP_001237639.1| ERECTA-like kinase [Glycine max]
 gb|ACM89517.1| ERECTA-like kinase [Glycine max]
Length=828

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+LYGDIPFS+SKLKQLE L LK+N+L GPIPSTLSQIPNLK LDLA+N+LSGEI
Sbjct  91   LDLSDNQLYGDIPFSLSKLKQLELLNLKSNQLTGPIPSTLSQIPNLKTLDLARNRLSGEI  150

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR++YWNEVLQYL +  N + G
Sbjct  151  PRILYWNEVLQYLDISYNQITG  172


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 44/76 (58%), Gaps = 2/76 (3%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN + G IP  I +L+ L +L + +N+L G IP  L+   +L  L+L+ N LSG I
Sbjct  330  LDLSFNNISGSIPPEIGQLQNLMSLFMNHNDLRGKIPDQLTNCFSLTSLNLSYNNLSGVI  389

Query  182  PRL--IYWNEVLQYLG  223
            P +    W     +LG
Sbjct  390  PSMKNFSWFSADSFLG  405


 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L +N LVG IP+   ++ +L  L+LA N L G I
Sbjct  210  LDLSENELVGSIPPILGNLTFTGKLQLNDNGLVGNIPNEFGKLEHLFELNLANNHLDGTI  269

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L  L L  NN  G
Sbjct  270  PHNISSCTALNQLNLSSNNFKG  291



>emb|CDP06164.1| unnamed protein product [Coffea canephora]
Length=344

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +2

Query  44   SISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIYWNEVLQYLG  223
            SISKLKQLE LILKNN+L+GPIPSTLSQIPNLKVLDLAQN LSGEIPRLIYWNEVLQYLG
Sbjct  21   SISKLKQLEFLILKNNQLIGPIPSTLSQIPNLKVLDLAQNSLSGEIPRLIYWNEVLQYLG  80

Query  224  LRGNNLVG  247
            LRGN L G
Sbjct  81   LRGNKLGG  88



>ref|XP_011076300.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 isoform X2 [Sesamum indicum]
Length=949

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +2

Query  29   GDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIYWNEV  208
            GDIPFSISKLKQLE L LKNN+L GPIPSTL+QIPNLK LDLA+N+L GEIPRLIYWNEV
Sbjct  100  GDIPFSISKLKQLELLNLKNNQLTGPIPSTLTQIPNLKTLDLARNQLIGEIPRLIYWNEV  159

Query  209  LQYLGLRGNNLVG  247
            LQYLGLRGN L G
Sbjct  160  LQYLGLRGNLLTG  172


 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL+QL  L L +N L GPIP  +S    L  L++  N+L+G I
Sbjct  306  LQLNGNQLTGAIPAELGKLEQLFELNLSSNNLEGPIPENISSCTALNQLNVHGNRLNGSI  365

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L YL L  N   G
Sbjct  366  PSGLKHLESLTYLNLSSNQFRG  387


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G +P S+  L+ L TL +  N L GPIP+    + +++++D++ N LSG I
Sbjct  402  LDLSSNNFSGSVPASVGDLEHLLTLNVSYNYLDGPIPAEFGNLRSIQMMDMSFNSLSGGI  461

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L  L L  N+L G
Sbjct  462  PEELGQLQNLASLILNNNDLSG  483


 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+SFN L G IP  + +L+ L +LIL NN+L G IP  LS   +L  L+++ N  +G +
Sbjct  450  MDMSFNSLSGGIPEELGQLQNLASLILNNNDLSGRIPEQLSNCLSLDKLNISYNNFTGLV  509

Query  182  P  184
            P
Sbjct  510  P  510


 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N+L GPIP  L  +  L  L L  N+L+G I
Sbjct  258  LDLSENELVGPIPPILGNLSYTGKLYLHGNKLTGPIPPELGNMTKLSYLQLNGNQLTGAI  317

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  NNL G
Sbjct  318  PAELGKLEQLFELNLSSNNLEG  339


 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NELVGPIP  L  +     L L  NKL+G I
Sbjct  234  LSLQGNMLTGKIPEVIGLMQALAVLDLSENELVGPIPPILGNLSYTGKLYLHGNKLTGPI  293

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L GN L G
Sbjct  294  PPELGNMTKLSYLQLNGNQLTG  315


 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++S+N L G IP     L+ ++ + +  N L G IP  L Q+ NL  L L  N LSG I
Sbjct  426  LNVSYNYLDGPIPAEFGNLRSIQMMDMSFNSLSGGIPEELGQLQNLASLILNNNDLSGRI  485

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L +  NN  G
Sbjct  486  PEQLSNCLSLDKLNISYNNFTG  507



>ref|XP_011076298.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Sesamum indicum]
Length=993

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +2

Query  29   GDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIYWNEV  208
            GDIPFSISKLKQLE L LKNN+L GPIPSTL+QIPNLK LDLA+N+L GEIPRLIYWNEV
Sbjct  144  GDIPFSISKLKQLELLNLKNNQLTGPIPSTLTQIPNLKTLDLARNQLIGEIPRLIYWNEV  203

Query  209  LQYLGLRGNNLVG  247
            LQYLGLRGN L G
Sbjct  204  LQYLGLRGNLLTG  216


 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL+QL  L L +N L GPIP  +S    L  L++  N+L+G I
Sbjct  350  LQLNGNQLTGAIPAELGKLEQLFELNLSSNNLEGPIPENISSCTALNQLNVHGNRLNGSI  409

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L YL L  N   G
Sbjct  410  PSGLKHLESLTYLNLSSNQFRG  431


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G +P S+  L+ L TL +  N L GPIP+    + +++++D++ N LSG I
Sbjct  446  LDLSSNNFSGSVPASVGDLEHLLTLNVSYNYLDGPIPAEFGNLRSIQMMDMSFNSLSGGI  505

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L  L L  N+L G
Sbjct  506  PEELGQLQNLASLILNNNDLSG  527


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+SFN L G IP  + +L+ L +LIL NN+L G IP  LS   +L  L+++ N  +G +
Sbjct  494  MDMSFNSLSGGIPEELGQLQNLASLILNNNDLSGRIPEQLSNCLSLDKLNISYNNFTGLV  553

Query  182  P  184
            P
Sbjct  554  P  554


 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N+L GPIP  L  +  L  L L  N+L+G I
Sbjct  302  LDLSENELVGPIPPILGNLSYTGKLYLHGNKLTGPIPPELGNMTKLSYLQLNGNQLTGAI  361

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  NNL G
Sbjct  362  PAELGKLEQLFELNLSSNNLEG  383


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NELVGPIP  L  +     L L  NKL+G I
Sbjct  278  LSLQGNMLTGKIPEVIGLMQALAVLDLSENELVGPIPPILGNLSYTGKLYLHGNKLTGPI  337

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L GN L G
Sbjct  338  PPELGNMTKLSYLQLNGNQLTG  359



>gb|EEE57902.1| hypothetical protein OsJ_08587 [Oryza sativa Japonica Group]
Length=913

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DL  NEL G IP  I     L+TLILKNN+LVG IPSTLSQ+PNLK+LDLAQNKL+GEI
Sbjct  96   IDLKSNELSGQIPDEIGDCTSLKTLILKNNQLVGMIPSTLSQLPNLKILDLAQNKLNGEI  155

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLR NNL G
Sbjct  156  PRLIYWNEVLQYLGLRSNNLEG  177


 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP +IS    L +L L +N L G IP  L+++ NL  LDL+ N ++G I
Sbjct  311  LNLANNNLEGPIPDNISSCMNLISLNLSSNYLSGAIPIELAKMKNLDTLDLSCNMVAGPI  370

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I   E L  L    NNLVG
Sbjct  371  PSAIGSLEHLLRLNFSNNNLVG  392


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN+L G IP  +  L   E L L+ N L G IP  L  +  L  L+LA N L G I
Sbjct  263  LDLSFNQLSGPIPSILGNLTYTEKLYLQGNRLTGSIPPELGNMSTLHYLNLANNNLEGPI  322

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L  L L  N L G
Sbjct  323  PDNISSCMNLISLNLSSNYLSG  344


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N + G IP +I  L+ L  L   NN LVG IP+    + ++  +DL+ N L G I
Sbjct  359  LDLSCNMVAGPIPSAIGSLEHLLRLNFSNNNLVGYIPAEFGNLRSIMEIDLSSNHLGGLI  418

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + L  L L  NN+ G
Sbjct  419  PQEVGMLQNLILLKLESNNITG  440


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G +   + +L  L    +KNN L G IP T+    + +VLDL+ N+L+GEI
Sbjct  168  LGLRSNNLEGSLSPEMCQLTGLWYFDVKNNSLTGIIPDTIGNCTSFQVLDLSYNRLTGEI  227

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GNN  G
Sbjct  228  PFNIGFLQVAT-LSLQGNNFSG  248


 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  ++K+K L+TL L  N + GPIPS +  + +L  L+ + N L G I
Sbjct  335  LNLSSNYLSGAIPIELAKMKNLDTLDLSCNMVAGPIPSAIGSLEHLLRLNFSNNNLVGYI  394

Query  182  P  184
            P
Sbjct  395  P  395


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 48/105 (46%), Gaps = 23/105 (22%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLK-----------------------QLETLILKNNELVGPIP  112
            LDLS+N L G+IPF+I  L+                        L  L L  N+L GPIP
Sbjct  216  LDLSYNRLTGEIPFNIGFLQVATLSLQGNNFSGPIPSVIGLMQALAVLDLSFNQLSGPIP  275

Query  113  STLSQIPNLKVLDLAQNKLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
            S L  +   + L L  N+L+G IP  +     L YL L  NNL G
Sbjct  276  SILGNLTYTEKLYLQGNRLTGSIPPELGNMSTLHYLNLANNNLEG  320


 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  +  +  L  L L NN L GPIP  +S   NL  L+L+ N LSG I
Sbjct  287  LYLQGNRLTGSIPPELGNMSTLHYLNLANNNLEGPIPDNISSCMNLISLNLSSNYLSGAI  346

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L  L L  N + G
Sbjct  347  PIELAKMKNLDTLDLSCNMVAG  368



>gb|EEC74102.1| hypothetical protein OsI_09151 [Oryza sativa Indica Group]
Length=913

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DL  NEL G IP  I     L+TLILKNN+LVG IPSTLSQ+PNLK+LDLAQNKL+GEI
Sbjct  96   IDLKSNELSGQIPDEIGDCTSLKTLILKNNQLVGMIPSTLSQLPNLKILDLAQNKLNGEI  155

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLR NNL G
Sbjct  156  PRLIYWNEVLQYLGLRSNNLEG  177


 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP +IS    L +L L +N L G IP  L+++ NL  LDL+ N ++G I
Sbjct  311  LNLANNNLEGPIPDNISSCMNLISLNLSSNYLSGAIPIELAKMKNLDTLDLSCNMVAGPI  370

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I   E L  L    NNLVG
Sbjct  371  PSAIGSLEHLLRLNFSNNNLVG  392


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFN+L G IP  +  L   E L L+ N L G IP  L  +  L  L+LA N L G I
Sbjct  263  LDLSFNQLSGPIPSILGNLTYTEKLYLQGNRLTGSIPPELGNMSTLHYLNLANNNLEGPI  322

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L  L L  N L G
Sbjct  323  PDNISSCMNLISLNLSSNYLSG  344


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N + G IP +I  L+ L  L   NN LVG IP+    + ++  +DL+ N L G I
Sbjct  359  LDLSCNMVAGPIPSAIGSLEHLLRLNFSNNNLVGYIPAEFGNLRSIMEIDLSSNHLGGLI  418

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + L  L L  NN+ G
Sbjct  419  PQEVGMLQNLILLKLESNNITG  440


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G +   + +L  L    +KNN L G IP T+    + +VLDL+ N+L+GEI
Sbjct  168  LGLRSNNLEGSLSPEMCQLTGLWYFDVKNNSLTGIIPDTIGNCTSFQVLDLSYNRLTGEI  227

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GNN  G
Sbjct  228  PFNIGFLQVAT-LSLQGNNFSG  248


 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  ++K+K L+TL L  N + GPIPS +  + +L  L+ + N L G I
Sbjct  335  LNLSSNYLSGAIPIELAKMKNLDTLDLSCNMVAGPIPSAIGSLEHLLRLNFSNNNLVGYI  394

Query  182  P  184
            P
Sbjct  395  P  395


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 48/105 (46%), Gaps = 23/105 (22%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLK-----------------------QLETLILKNNELVGPIP  112
            LDLS+N L G+IPF+I  L+                        L  L L  N+L GPIP
Sbjct  216  LDLSYNRLTGEIPFNIGFLQVATLSLQGNNFSGPIPSVIGLMQALAVLDLSFNQLSGPIP  275

Query  113  STLSQIPNLKVLDLAQNKLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
            S L  +   + L L  N+L+G IP  +     L YL L  NNL G
Sbjct  276  SILGNLTYTEKLYLQGNRLTGSIPPELGNMSTLHYLNLANNNLEG  320


 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  +  +  L  L L NN L GPIP  +S   NL  L+L+ N LSG I
Sbjct  287  LYLQGNRLTGSIPPELGNMSTLHYLNLANNNLEGPIPDNISSCMNLISLNLSSNYLSGAI  346

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L  L L  N + G
Sbjct  347  PIELAKMKNLDTLDLSCNMVAG  368



>gb|KHG04654.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Gossypium 
arboreum]
Length=503

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDL  N L G IP  I     L++L+LKNN+L+GPIPSTLSQIPNLKVLDL+QNKLSGEI
Sbjct  55   LDLRGNRLSGQIPDEIGDCSSLKSLVLKNNQLIGPIPSTLSQIPNLKVLDLSQNKLSGEI  114

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYL +R N+L G
Sbjct  115  PRLIYWNEVLQYLDVRNNSLTG  136


 Score = 52.4 bits (124),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 45/82 (55%), Gaps = 3/82 (4%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL +L    + NN L GPIP  LS   NL  L++  NKL+G I
Sbjct  198  LELNDNHLTGLIPPELGKLTELN---VANNHLEGPIPENLSSCTNLNSLNVHGNKLNGTI  254

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E + YL L  N++ G
Sbjct  255  PPAFERLESMTYLNLSSNDIKG  276


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S N++ G IP S+  L+ L  L L  N L G IP+    + ++  +DL+ N LSG I
Sbjct  291  LDISDNKISGSIPSSLGDLEHLLKLNLSRNNLTGVIPAEFGNLRSVLEIDLSNNHLSGII  350

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR +   + L  L +  NNL G
Sbjct  351  PRELAQLQDLYSLNVSHNNLAG  372


 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP +  +L+ +  L L +N++ G I   LS+I NL  LD++ NK+SG I
Sbjct  243  LNVHGNKLNGTIPPAFERLESMTYLNLSSNDIKGFIAIELSRIGNLDTLDISDNKISGSI  302

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  NNL G
Sbjct  303  PSSLGDLEHLLKLNLSRNNLTG  324



>ref|XP_009345019.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Pyrus x bretschneideri]
Length=955

 Score =   113 bits (283),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFS+SKLK+LE L LKNN+L GPIP+TL+QIPNLK +DLAQN+LSGEI
Sbjct  109  LDLSDNLLYGDIPFSVSKLKKLELLNLKNNQLTGPIPTTLTQIPNLKTIDLAQNELSGEI  168

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  169  PRLIYWNEVLQYLGLRGNSLTG  190


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 41/70 (59%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+SFN L G IP  + +L+ L  LIL NN L G IP  L+   +L  L+ + N LSG +
Sbjct  464  IDMSFNYLSGSIPGELGQLQNLAALILNNNFLNGTIPDQLTNCFSLATLNFSYNNLSGVV  523

Query  182  PRLIYWNEVL  211
            P +  ++  L
Sbjct  524  PPMRNFSRFL  533


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 40/82 (49%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NELVGPIP     +     L L  NKL+G I
Sbjct  252  LSLQGNRLTGKIPEVIGLMQALAVLDLSENELVGPIPPIFGNLSYTGKLYLHGNKLTGSI  311

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  312  PPELGNMSKLSYLQLNDNKLVG  333



>ref|XP_009346939.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Pyrus x bretschneideri]
Length=959

 Score =   113 bits (283),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFS+SKLK+LE L LKNN+L GPIP+TL+QIPNLK +DLAQN+LSGEI
Sbjct  109  LDLSDNLLYGDIPFSVSKLKKLELLNLKNNQLTGPIPTTLTQIPNLKTIDLAQNELSGEI  168

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  169  PRLIYWNEVLQYLGLRGNSLTG  190


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  NEL G IP  +  + +L  L L +N+LVG IP+ L ++  L  L+LA N L G I
Sbjct  300  LYLHGNELTGSIPPELGNMSKLSYLQLNDNKLVGRIPAELGKLEQLFELNLANNVLEGPI  359

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GN L G
Sbjct  360  PHDISSCTALNQFNVHGNRLTG  381


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 41/70 (59%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+SFN L G IP  + +L+ L  LIL NN L G IP  L+   +L  L+ + N LSG +
Sbjct  468  IDMSFNYLSGSIPGELGQLQNLAALILNNNFLNGTIPDQLTNCFSLATLNFSYNNLSGVV  527

Query  182  PRLIYWNEVL  211
            P +  ++  L
Sbjct  528  PPMRNFSRFL  537


 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL+QL  L L NN L GPIP  +S    L   ++  N+L+G I
Sbjct  324  LQLNDNKLVGRIPAELGKLEQLFELNLANNVLEGPIPHDISSCTALNQFNVHGNRLTGSI  383

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      + L YL L  N   G
Sbjct  384  PLTFRNLQSLTYLNLSRNYFSG  405


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 40/82 (49%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NELVGPIP     +     L L  N+L+G I
Sbjct  252  LSLQGNRLTGKIPEVIGLMQALAVLDLSENELVGPIPPIFGNLSYTGKLYLHGNELTGSI  311

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  312  PPELGNMSKLSYLQLNDNKLVG  333



>ref|XP_008376471.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Malus domestica]
Length=987

 Score =   113 bits (283),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFS+SKLK+LE L LKNN+L GPIP+TL+QIPNLK LDLAQN+L+GEI
Sbjct  130  LDLSDNLLYGDIPFSVSKLKKLELLNLKNNQLTGPIPTTLTQIPNLKTLDLAQNELTGEI  189

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  190  PRLIYWNEVLQYLGLRGNSLTG  211


 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL+QL  L L NN L GPIP  +S    L   ++  N+L+G I
Sbjct  345  LQLNDNKLVGRIPAELGKLEQLFELNLANNVLEGPIPHDISSCTALNQFNVHGNRLTGSI  404

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      + L YL L  N   G
Sbjct  405  PLTFRNLQSLTYLNLSRNYFSG  426


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +N+LVG IP+ L ++  L  L+LA N L G I
Sbjct  321  LYLHGNKLTGSIPPELGNMSKLSYLQLNDNKLVGRIPAELGKLEQLFELNLANNVLEGPI  380

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GN L G
Sbjct  381  PHDISSCTALNQFNVHGNRLTG  402


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 40/82 (49%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NELVGPIP     +     L L  NKL+G I
Sbjct  273  LSLQGNRLTGKIPEVIGLMQALAVLDLSENELVGPIPPIFGNLSYTGKLYLHGNKLTGSI  332

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  333  PPELGNMSKLSYLQLNDNKLVG  354


 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 36/61 (59%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G +P S+  L+ L TL L  N L G +P+    + +++ +D++ N LSG I
Sbjct  441  LDLSSNNFSGPVPASVGDLEHLLTLNLSGNHLNGSLPAEFGNLRSVQTIDMSFNNLSGSI  500

Query  182  P  184
            P
Sbjct  501  P  501



>emb|CBI24498.3| unnamed protein product [Vitis vinifera]
Length=930

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFSISKLK+LE L LKNN+L GPIPSTL+QIPNLK +DLA+N+L+GEI
Sbjct  91   LDLSDNLLYGDIPFSISKLKKLELLNLKNNQLTGPIPSTLTQIPNLKTIDLARNQLTGEI  150

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  151  PRLIYWNEVLQYLGLRGNSLTG  172


 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL+QL  L L NN+L GPIP  +S    L   ++  N LSG I
Sbjct  306  LQLNDNQLIGSIPAELGKLEQLFELNLANNDLEGPIPHNISSCTALNQFNVHGNHLSGSI  365

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  NN  G
Sbjct  366  PPGFQNLESLTYLNLSSNNFKG  387


 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G +P S+  L+ L TL L  N L GP+P+    + +++ +D++ NKLSG I
Sbjct  402  LDLSSNGFLGTVPASVGDLEHLLTLNLSRNNLDGPVPAEFGNLRSIQTIDMSFNKLSGGI  461

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR +   + +  L L  NNL G
Sbjct  462  PRELGQLQNIVSLILNNNNLDG  483


 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+SFN+L G IP  + +L+ + +LIL NN L G IP  L+   +L +L+++ N  SG +
Sbjct  450  IDMSFNKLSGGIPRELGQLQNIVSLILNNNNLDGEIPDQLTNCFSLTILNVSYNNFSGVV  509

Query  182  P  184
            P
Sbjct  510  P  510


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +N+L+G IP+ L ++  L  L+LA N L G I
Sbjct  282  LYLHGNKLTGPIPPELGNMSKLSYLQLNDNQLIGSIPAELGKLEQLFELNLANNDLEGPI  341

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GN+L G
Sbjct  342  PHNISSCTALNQFNVHGNHLSG  363



>ref|XP_008234344.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Prunus mume]
Length=951

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFS+SKLK+LE L LKNN+L GPIP+TL+QIPNLK LDLA+N+L+GEI
Sbjct  91   LDLSDNFLYGDIPFSVSKLKKLELLNLKNNQLTGPIPTTLTQIPNLKTLDLARNQLTGEI  150

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  151  PRLIYWNEVLQYLGLRGNSLTG  172


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 36/61 (59%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+SFN L G IP  + +L+ L  LIL NN L G IP  L+   +L  L+ + N  SG I
Sbjct  453  IDMSFNNLSGSIPAELGQLQNLVALILNNNYLHGRIPDQLTNCFSLATLNFSYNNFSGVI  512

Query  182  P  184
            P
Sbjct  513  P  513



>ref|XP_002269540.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Vitis vinifera]
Length=989

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGDIPFSISKLK+LE L LKNN+L GPIPSTL+QIPNLK +DLA+N+L+GEI
Sbjct  131  LDLSDNLLYGDIPFSISKLKKLELLNLKNNQLTGPIPSTLTQIPNLKTIDLARNQLTGEI  190

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  191  PRLIYWNEVLQYLGLRGNSLTG  212


 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL+QL  L L NN+L GPIP  +S    L   ++  N LSG I
Sbjct  346  LQLNDNQLIGSIPAELGKLEQLFELNLANNDLEGPIPHNISSCTALNQFNVHGNHLSGSI  405

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E L YL L  NN  G
Sbjct  406  PPGFQNLESLTYLNLSSNNFKG  427


 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G +P S+  L+ L TL L  N L GP+P+    + +++ +D++ NKLSG I
Sbjct  442  LDLSSNGFLGTVPASVGDLEHLLTLNLSRNNLDGPVPAEFGNLRSIQTIDMSFNKLSGGI  501

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR +   + +  L L  NNL G
Sbjct  502  PRELGQLQNIVSLILNNNNLDG  523


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+SFN+L G IP  + +L+ + +LIL NN L G IP  L+   +L +L+++ N  SG +
Sbjct  490  IDMSFNKLSGGIPRELGQLQNIVSLILNNNNLDGEIPDQLTNCFSLTILNVSYNNFSGVV  549

Query  182  P  184
            P
Sbjct  550  P  550


 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +N+L+G IP+ L ++  L  L+LA N L G I
Sbjct  322  LYLHGNKLTGPIPPELGNMSKLSYLQLNDNQLIGSIPAELGKLEQLFELNLANNDLEGPI  381

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GN+L G
Sbjct  382  PHNISSCTALNQFNVHGNHLSG  403



>ref|XP_007221096.1| hypothetical protein PRUPE_ppa017398mg [Prunus persica]
 gb|EMJ22295.1| hypothetical protein PRUPE_ppa017398mg [Prunus persica]
Length=992

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYGD+PFS+SKLK+LE L LKNN+L GPIP+TL+QIPNLK LDLA+N+L+GEI
Sbjct  144  LDLSDNFLYGDVPFSVSKLKKLELLNLKNNQLTGPIPTTLTQIPNLKTLDLARNQLTGEI  203

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYLGLRGN+L G
Sbjct  204  PRLIYWNEVLQYLGLRGNSLTG  225


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+SFN L G IP  + +L+ L  LIL NN L G IP  L+   +L  L+ + N LSG I
Sbjct  503  IDMSFNNLSGSIPAELGQLQNLVALILNNNSLHGRIPDQLTNCFSLATLNFSYNNLSGVI  562

Query  182  P  184
            P
Sbjct  563  P  563


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 42/78 (54%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL+QL  L L NNEL GPIP  +S    L   ++  N L+G I
Sbjct  359  LQLNDNKLLGTIPAELGKLQQLFELNLANNELEGPIPHEISFCTALNQFNVHGNHLTGSI  418

Query  182  PRLIYWNEVLQYLGLRGN  235
            P      + L YL L  N
Sbjct  419  PMAFRNLQSLTYLNLSSN  436


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L  NELVGPIP  L  +     L L  NKL+G I
Sbjct  287  LSLQGNRLTGKIPEVIGLMQALAVLDLSENELVGPIPPILGNLSYTGKLYLHGNKLTGPI  346

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N L+G
Sbjct  347  PPELGNMSKLSYLQLNDNKLLG  368



>gb|EEE65279.1| hypothetical protein OsJ_20503 [Oryza sativa Japonica Group]
Length=882

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DL  N L G IP  I     L+TLILKNN+L+G IPSTLSQ+PNLK+LDLAQNKLSGEI
Sbjct  94   IDLKSNGLSGQIPDEIGDCSSLKTLILKNNQLIGVIPSTLSQLPNLKILDLAQNKLSGEI  153

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PRLIYWNEVLQYL L  N L G
Sbjct  154  PRLIYWNEVLQYLDLSYNKLSG  175


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N+L G IP  +  L   E L ++ N+L GPIP  L  +  L  L+L  N+LSG I
Sbjct  213  LDLSYNQLSGPIPSILGNLTYTEKLYMQGNKLTGPIPPELGNMSTLHYLELNDNQLSGFI  272

Query  182  P  184
            P
Sbjct  273  P  273


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP    KL  L  L L NN   GPIP  +S   NL   +   N+L+G I
Sbjct  261  LELNDNQLSGFIPPEFGKLTGLFDLNLANNNFEGPIPDNISSCVNLNSFNAYGNRLNGTI  320

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  ++  E + YL L  N L G
Sbjct  321  PPSLHKLESMTYLNLSSNFLSG  342


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 52/105 (50%), Gaps = 23/105 (22%)
 Frame = +2

Query  2    LDLSFNELYGDIP-------------FSISKLK----------QLETLILKNNELVGPIP  112
            LDL+ N+L G+IP              S +KL           Q+ TL L+ N   GPIP
Sbjct  142  LDLAQNKLSGEIPRLIYWNEVLQYLDLSYNKLSGSIPFNIGFLQVATLSLQGNMFTGPIP  201

Query  113  STLSQIPNLKVLDLAQNKLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
            S +  +  L VLDL+ N+LSG IP ++      + L ++GN L G
Sbjct  202  SVIGLMQALAVLDLSYNQLSGPIPSILGNLTYTEKLYMQGNKLTG  246


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+T  L NN LVG IP+ +  + ++  +D++ N L G I
Sbjct  333  LNLSSNFLSGSIPIELSRINNLDTFNLSNNGLVGFIPAEIGNLRSIMEIDMSNNHLGGLI  392

Query  182  PR  187
            P+
Sbjct  393  PQ  394



>ref|XP_004955237.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Setaria italica]
Length=975

 Score =   110 bits (276),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 66/91 (73%), Gaps = 9/91 (10%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLI---------LKNNELVGPIPSTLSQIPNLKVLDL  154
            +DL  N L G IP  I     LETLI         LKNN+LVG IPSTLSQ+PNLK+LDL
Sbjct  94   IDLKSNGLSGQIPDEIGDCSLLETLIWVIESDPWILKNNQLVGVIPSTLSQLPNLKILDL  153

Query  155  AQNKLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
            AQNKLSGEIP LIYWNEVLQYLGLR NNL G
Sbjct  154  AQNKLSGEIPNLIYWNEVLQYLGLRSNNLEG  184


 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 53/82 (65%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+L G+IPF+I  L Q+ TL L+ N+  GPIPS +  +  L VLDL+ N+LSG I
Sbjct  223  LDLSNNQLTGEIPFNIGFL-QVATLSLQGNKFSGPIPSVIGLMQALAVLDLSFNELSGPI  281

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++      + L L+GN L G
Sbjct  282  PSILGNLTYTEKLYLQGNRLTG  303


 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP  + KL +L  L L NN L GPIP  +S   NL  L+   NKL+G I
Sbjct  318  LELNDNLLTGFIPPDLGKLTELFDLNLANNNLGGPIPDNISSCINLISLNAYDNKLNGTI  377

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR     E L YL L  N+L G
Sbjct  378  PRSFQKLESLTYLNLSSNHLSG  399


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 44/77 (57%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N+L G IP S  KL+ L  L L +N L G +P  ++++ NL  LDL+ N ++G IP  I 
Sbjct  371  NKLNGTIPRSFQKLESLTYLNLSSNHLSGALPIEVARMRNLDTLDLSCNMITGSIPSAIG  430

Query  197  WNEVLQYLGLRGNNLVG  247
              E L  L L  N LVG
Sbjct  431  RLEHLLRLNLSKNALVG  447


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G +   + +L  L    +KNN L+G IP T+    + +VLDL+ N+L+GEI
Sbjct  175  LGLRSNNLEGSLSPDMCQLTGLWYFDVKNNSLMGTIPETIGNCTSFQVLDLSNNQLTGEI  234

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN   G
Sbjct  235  PFNIGFLQVAT-LSLQGNKFSG  255


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N + G IP +I +L+ L  L L  N LVG IP+    + ++  +DL+ N L G I
Sbjct  414  LDLSCNMITGSIPSAIGRLEHLLRLNLSKNALVGHIPAEFGNLRSIMEIDLSSNYLRGLI  473

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + L  L L  N++ G
Sbjct  474  PQEVGMLQNLILLKLENNSITG  495


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNEL G IP  +  L   E L L+ N L G IP  L  +  L  L+L  N L+G I
Sbjct  270  LDLSFNELSGPIPSILGNLTYTEKLYLQGNRLTGSIPPELGNMTTLHYLELNDNLLTGFI  329

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L L  NNL G
Sbjct  330  PPDLGKLTELFDLNLANNNLGG  351



>emb|CDP05285.1| unnamed protein product [Coffea canephora]
Length=948

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +2

Query  29   GDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIYWNEV  208
            GDIPFS+S+LK+LE L LK N+L GPIPSTL+QIPNLK LDLA+N+L GEIPRLIYWNEV
Sbjct  100  GDIPFSVSRLKKLELLNLKINQLTGPIPSTLTQIPNLKTLDLARNQLIGEIPRLIYWNEV  159

Query  209  LQYLGLRGNNLVG  247
            LQYLGLR N+L+G
Sbjct  160  LQYLGLRDNSLIG  172


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S+N++ G IP++I  L Q+ TL L+ N+L G IP  +  +  L VLDL+ N+L G I
Sbjct  211  LDISYNQITGGIPYNIGFL-QVATLSLQGNKLTGKIPDVIGLMQALAVLDLSDNELVGSI  269

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++        L L GN L G
Sbjct  270  PPILGNLSYTGKLYLHGNKLTG  291


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+  G +P S+  L+ L  L L  N L GPIP     + +++ +D++ NKLS  +
Sbjct  402  LDLSSNDFSGLLPASVGDLEHLLILNLSYNRLDGPIPEEFGNLRSIQTIDMSCNKLSCRM  461

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +   + L+ L L  NNL G
Sbjct  462  PKELGQLQNLESLILNNNNLSG  483


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS+N L G IP     L+ ++T+ +  N+L   +P  L Q+ NL+ L L  N LSGEI
Sbjct  426  LNLSYNRLDGPIPEEFGNLRSIQTIDMSCNKLSCRMPKELGQLQNLESLILNNNNLSGEI  485

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L +  NN  G
Sbjct  486  PGQLTNCLSLAILNVSYNNFTG  507


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+S N+L   +P  + +L+ LE+LIL NN L G IP  L+   +L +L+++ N  +G I
Sbjct  450  IDMSCNKLSCRMPKELGQLQNLESLILNNNNLSGEIPGQLTNCLSLAILNVSYNNFTGVI  509

Query  182  P  184
            P
Sbjct  510  P  510


 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 33/61 (54%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N+L GPIP  L  + NL  L L  N L G+I
Sbjct  258  LDLSDNELVGSIPPILGNLSYTGKLYLHGNKLTGPIPPQLGNMSNLSYLQLNDNLLIGQI  317

Query  182  P  184
            P
Sbjct  318  P  318



>emb|CDP06165.1| unnamed protein product [Coffea canephora]
Length=150

 Score = 95.9 bits (237),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  95   LVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
            L+GPIPSTLSQIPNLKVLDLAQN LSGEIPRLIYWNEVLQYLGLRGN L G
Sbjct  17   LIGPIPSTLSQIPNLKVLDLAQNSLSGEIPRLIYWNEVLQYLGLRGNKLGG  67



>dbj|BAK61880.1| LRR receptor-like serine/threonine-protein kinase [Citrus unshiu]
Length=933

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLSFNELYGDIPFSISKLKQLE LILKNN+L+GPIPSTLSQ+PNLKV  L  N L G +
Sbjct  121  LDLSFNELYGDIPFSISKLKQLEFLILKNNQLIGPIPSTLSQLPNLKVFGLRGNNLVGTL  180

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
               +     L Y  +R N+L G
Sbjct  181  SPDMCQLSGLWYFDVRNNSLTG  202


 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G IP ++ KL  L  L + NN L GPIP  LS   NL  L++  NKL+G I
Sbjct  312  LELNDNQLTGHIPPALGKLTDLFDLNVANNHLEGPIPDNLSSCTNLNSLNVHGNKLNGTI  371

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      E + YL L  NN+ G
Sbjct  372  PPAFQRLESMTYLNLSSNNIRG  393


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP +  +L+ +  L L +N + GPIP  LS+I NL  LD++ NK+SG I
Sbjct  360  LNVHGNKLNGTIPPAFQRLESMTYLNLSSNNIRGPIPVELSRIGNLDTLDMSNNKISGSI  419

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N L G
Sbjct  420  PSPLGDLEHLLKLNLSRNQLTG  441


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 52/106 (49%), Gaps = 25/106 (24%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLA--------  157
            LDLS+N+L G+IPF+I  L Q+ TL L+ N+L G IPS +  +  L VLDL+        
Sbjct  217  LDLSYNQLNGEIPFNIGFL-QIATLSLQGNQLTGKIPSVIGLMQALAVLDLSCNMLSGPI  275

Query  158  ----------------QNKLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
                             NKL+G IP  +     L YL L  N L G
Sbjct  276  PPILGNLSYTEKLYLHSNKLTGHIPPELGNMTKLHYLELNDNQLTG  321


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS   L G+I  ++  LK L+++ L+ N L G IP  +    +LK LDL+ N+L G+I
Sbjct  73   LNLSGLNLDGEISPAVGDLKDLQSIDLRGNRLSGQIPDEIGDCSSLKSLDLSFNELYGDI  132

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I   + L++L L+ N L+G
Sbjct  133  PFSISKLKQLEFLILKNNQLIG  154


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N + G IP  +S++  L+TL + NN++ G IPS L  + +L  L+L++N+L+G I
Sbjct  384  LNLSSNNIRGPIPVELSRIGNLDTLDMSNNKISGSIPSPLGDLEHLLKLNLSRNQLTGFI  443

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        +  + L  N+L G
Sbjct  444  PGEFGNLRSVMEIDLSHNHLTG  465



>emb|CDP21844.1| unnamed protein product, partial [Coffea canephora]
Length=150

 Score = 91.7 bits (226),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  95   LVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
            L+GPIPSTLSQIPNLKVL+L QN LSGEIPRLIYWNEVLQYLGLRGN L G
Sbjct  38   LIGPIPSTLSQIPNLKVLNLEQNSLSGEIPRLIYWNEVLQYLGLRGNKLGG  88



>gb|KDO73636.1| hypothetical protein CISIN_1g0023492mg, partial [Citrus sinensis]
Length=168

 Score = 89.0 bits (219),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKV  145
            LDLSFNELYGDIPFSISKLKQLE LILKNN+L+GPIPSTLSQ+PNLKV
Sbjct  121  LDLSFNELYGDIPFSISKLKQLEFLILKNNQLIGPIPSTLSQLPNLKV  168


 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS   L G+I  ++  LK L+++ L+ N L G IP  +    +LK LDL+ N+L G+I
Sbjct  73   LNLSGLNLDGEISPAVGDLKDLQSIDLRGNRLSGQIPDEIGDCSSLKSLDLSFNELYGDI  132

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I   + L++L L+ N L+G
Sbjct  133  PFSISKLKQLEFLILKNNQLIG  154



>ref|XP_001763775.1| ERL2a AtERECTA-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ71417.1| ERL2a AtERECTA-like receptor S/T protein kinase protein, partial 
[Physcomitrella patens]
Length=948

 Score = 94.0 bits (232),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L +N L G+IP+ +S+L+QLE L L  N L GPIPST S + NL+ LDL  N+LSG I
Sbjct  92   LNLQYNNLTGEIPYLMSQLQQLEFLALGYNHLNGPIPSTFSSLTNLEHLDLQMNELSGPI  151

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P LIYW+E LQYL LRGN L G
Sbjct  152  PSLIYWSESLQYLMLRGNYLTG  173


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
             DLS NE +G IP  + +L+++  + L  N L G IP  L+   NLK L+L+ N LSGE+
Sbjct  453  FDLSHNEFFGPIPIELGQLEEVNFIDLSFNNLSGSIPRQLNNCFNLKNLNLSYNHLSGEV  512

Query  182  P  184
            P
Sbjct  513  P  513


 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 43/77 (56%), Gaps = 1/77 (1%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N L G +   + +L QL    ++NN L GPIP  +    + ++LDL+ N L+GEIP  I 
Sbjct  169  NYLTGSLSADMCQLTQLAYFNVRNNNLTGPIPDGIGNCTSFQILDLSCNDLNGEIPYNIG  228

Query  197  WNEVLQYLGLRGNNLVG  247
            + +V   L L GN L G
Sbjct  229  YLQV-STLSLEGNRLSG  244


 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 42/77 (55%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N L G IP  +  + +L  L L NN+L G IPS L  + +L  L +++N+L+G IP  I 
Sbjct  288  NRLTGSIPAELGNMTRLNYLELNNNQLTGEIPSELGSLTDLFELKVSENELTGPIPGNIS  347

Query  197  WNEVLQYLGLRGNNLVG  247
                L  L L GN L G
Sbjct  348  SLAALNLLDLHGNRLNG  364


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N L G IP  +  L  +  L L NN L G IP+ L  +  L  L+L  N+L+GEI
Sbjct  259  LDLSSNHLEGPIPPILGNLTSVTKLYLYNNRLTGSIPAELGNMTRLNYLELNNNQLTGEI  318

Query  182  P  184
            P
Sbjct  319  P  319


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+L G+IP  +  L  L  L +  NEL GPIP  +S +  L +LDL  N+L+G I
Sbjct  307  LELNNNQLTGEIPSELGSLTDLFELKVSENELTGPIPGNISSLAALNLLDLHGNRLNGTI  366



>ref|XP_001770421.1| ERL2b AtERECTA-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ64758.1| ERL2b AtERECTA-like receptor S/T protein kinase protein, partial 
[Physcomitrella patens]
Length=947

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDL +N L G+IP+ + +L+QLE L L  N L+GPIPST S + NL+ LDL  N+LSG I
Sbjct  92   LDLQYNNLTGEIPYLMLQLQQLEYLALGYNHLIGPIPSTFSSLTNLRHLDLQMNELSGPI  151

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P LI+W+E LQYL L+GN L G
Sbjct  152  PALIFWSESLQYLMLKGNYLTG  173


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N LYG IP  + +L+++  +    N L GPIP  L+   NLK L+L+ N LSGE+
Sbjct  453  LDLSHNALYGPIPIELGQLEEVNFIDFSFNNLSGPIPRQLNNCFNLKNLNLSYNNLSGEV  512

Query  182  P  184
            P
Sbjct  513  P  513


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++S   L G+I  SI  L  L+ L +  N + G +P+ +S   +L  LDL  N L+GEI
Sbjct  44   LNISMLALTGEISPSIGNLHSLQYLDMSENNISGQLPTEISNCMSLVHLDLQYNNLTGEI  103

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P L+   + L+YL L  N+L+G
Sbjct  104  PYLMLQLQQLEYLALGYNHLIG  125


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDL  N+L G I   + KL  L  L L +N   G IP+ +  I NL  LDL++N L+G I
Sbjct  355  LDLHGNKLNGTILPELEKLTNLTNLNLSSNFFSGNIPNEVGLIFNLDKLDLSKNNLTGPI  414

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR I   E L YL L  N L G
Sbjct  415  PRSIGRLEHLLYLDLHDNKLSG  436


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L +N L G IP + S L  L  L L+ NEL GPIP+ +    +L+ L L  N L+G +
Sbjct  116  LALGYNHLIGPIPSTFSSLTNLRHLDLQMNELSGPIPALIFWSESLQYLMLKGNYLTGSL  175

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
               +     L Y  +R NNL G
Sbjct  176  SADMCQLTQLAYFNVRNNNLTG  197


 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N L G IP++I  L Q+ TL L+ N   G IP  L  +  L +LDL+ N+L G I
Sbjct  212  LDLSYNGLSGVIPYNIGYL-QVSTLSLEGNRFSGRIPEVLGLMQALVILDLSSNRLEGPI  270

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++     +  L L  N L G
Sbjct  271  PPILGNLTSVTKLYLYNNRLTG  292


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 42/77 (55%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N L G IP  +  + +L  L L NNEL G IPS L  + +L  L L++N+L+G +P  I 
Sbjct  288  NRLTGSIPPELGNMTRLNYLELNNNELTGRIPSELGCLTDLFELKLSENELTGPLPGNIS  347

Query  197  WNEVLQYLGLRGNNLVG  247
                L  L L GN L G
Sbjct  348  SLAALNLLDLHGNKLNG  364


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ NEL G IP  +  L  L  L L  NEL GP+P  +S +  L +LDL  NKL+G I
Sbjct  307  LELNNNELTGRIPSELGCLTDLFELKLSENELTGPLPGNISSLAALNLLDLHGNKLNGTI  366



>ref|XP_001755991.1| ERL1d AtERECTA-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ79276.1| ERL1d AtERECTA-like receptor S/T protein kinase protein, partial 
[Physcomitrella patens]
Length=864

 Score = 87.4 bits (215),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N L G+IP+ +S+L+ LE L L+NN L GPIPS+ + + NL+ LD+  N LSG I
Sbjct  93   LDLSSNNLGGEIPYLLSQLQLLEVLNLRNNRLSGPIPSSFAGLSNLRHLDMQFNSLSGPI  152

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P L+YW+E LQYL L+ N L G
Sbjct  153  PPLLYWSETLQYLMLKSNQLTG  174


 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N   G+IP++I  L Q+ TL L+ N+L G IP  L  +  L +LDL+ NKL G+I
Sbjct  213  LDLSYNSFSGEIPYNIGYL-QVSTLSLEANQLTGGIPDVLGLMQALVILDLSNNKLEGQI  271

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++     L  L L  NN+ G
Sbjct  272  PPILGNLTSLTKLYLYNNNISG  293


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+L G IP  +  L  L  L L NN + GPIP     +  L  L+L+ N+L+GEI
Sbjct  260  LDLSNNKLEGQIPPILGNLTSLTKLYLYNNNISGPIPVEFGNMSRLNYLELSGNRLTGEI  319

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  + +   L  L L GN L G
Sbjct  320  PSELSYLTGLFELNLHGNQLNG  341


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP SIS L+ L ++ L +N+L G IP  L  + +L  LDL+QN L G I
Sbjct  380  LNLSRNSLSGQIPSSISNLEHLLSIDLHDNKLNGTIPMALGNLKSLGFLDLSQNHLQGPI  439

Query  182  P  184
            P
Sbjct  440  P  440


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G +   + KL QL    +++N+L GP+P+ +    + ++LDL+ N  SGEI
Sbjct  165  LMLKSNQLTGGLSDDMCKLTQLAYFNVRDNKLAGPLPAGIGNCTSFQILDLSYNSFSGEI  224

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L  N L G
Sbjct  225  PYNIGYLQV-STLSLEANQLTG  245


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS   L G+I  SI  L  L+ L L  N + G IP  +    +L  LDL+ N L GEI
Sbjct  45   LNLSELALGGEISPSIGLLGSLQILDLSGNNISGQIPVEICNCTSLTHLDLSSNNLGGEI  104

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P L+   ++L+ L LR N L G
Sbjct  105  PYLLSQLQLLEVLNLRNNRLSG  126


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 45/82 (55%), Gaps = 4/82 (5%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DL  N+L G IP ++  LK L  L L  N L GPIP  L Q+  L  LDL   +LSG I
Sbjct  404  IDLHDNKLNGTIPMALGNLKSLGFLDLSQNHLQGPIPLELGQLLELSYLDLCFKRLSGPI  463

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
             +LI+      YL +  N+L G
Sbjct  464  -QLIH---SFTYLNISYNHLSG  481



>ref|XP_001783127.1| ERL1a AtERECTA-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ52064.1| ERL1a AtERECTA-like receptor S/T protein kinase protein, partial 
[Physcomitrella patens]
Length=946

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLS N L G+IP+ +S+L+ LE L L+NN+L GPIPS+ + + NL+ LD+  N LSG I
Sbjct  93   IDLSGNNLDGEIPYLLSQLQLLEFLNLRNNKLSGPIPSSFASLSNLRHLDMQINNLSGPI  152

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P L+YW+E LQYL L+ N L G
Sbjct  153  PPLLYWSETLQYLMLKSNQLTG  174


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N   G+IP++I  L Q+ TL L+ N L G IP  L  +  L +LDL+ N+L GEI
Sbjct  213  LDLSYNNFSGEIPYNIGYL-QVSTLSLEANMLSGGIPDVLGLMQALVILDLSNNQLEGEI  271

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++     L  L L  NN+ G
Sbjct  272  PPILGNLTSLTKLYLYNNNITG  293


 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N L G +P SIS L+ L T+ L  N+L G IP T   + +L  LDL+ N + G +
Sbjct  404  LDLSHNNLTGQLPASISTLEHLLTIDLHGNKLNGTIPMTFGNLKSLNFLDLSHNHIQGSL  463

Query  182  P  184
            P
Sbjct  464  P  464


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS + L G+I  SI  L+ L+ L L  N + G +P  +    +L  +DL+ N L GEI
Sbjct  45   LNLSDHALAGEISPSIGLLRSLQVLDLSQNNISGQLPIEICNCTSLTWIDLSGNNLDGEI  104

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P L+   ++L++L LR N L G
Sbjct  105  PYLLSQLQLLEFLNLRNNKLSG  126


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 39/77 (51%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N + G IP     + +L  L L  N L G IPS LS +  L  LDL+ N+LSG IP  I 
Sbjct  289  NNITGSIPMEFGNMSRLNYLELSGNSLSGQIPSELSYLTGLFELDLSDNQLSGSIPENIS  348

Query  197  WNEVLQYLGLRGNNLVG  247
                L  L + GN L G
Sbjct  349  SLTALNILNVHGNQLTG  365


 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+L G+IP  +  L  L  L L NN + G IP     +  L  L+L+ N LSG+I
Sbjct  260  LDLSNNQLEGEIPPILGNLTSLTKLYLYNNNITGSIPMEFGNMSRLNYLELSGNSLSGQI  319

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  + +   L  L L  N L G
Sbjct  320  PSELSYLTGLFELDLSDNQLSG  341


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 48/106 (45%), Gaps = 24/106 (23%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPI------------------------  109
            LDLS N+L G IP +IS L  L  L +  N+L G I                        
Sbjct  332  LDLSDNQLSGSIPENISSLTALNILNVHGNQLTGSIPPGLQQLTNLTLLNLSSNHFTGIV  391

Query  110  PSTLSQIPNLKVLDLAQNKLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
            P  +  I NL +LDL+ N L+G++P  I   E L  + L GN L G
Sbjct  392  PEEIGMIVNLDILDLSHNNLTGQLPASISTLEHLLTIDLHGNKLNG  437


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G +   + KL QL    ++ N L GP+P+ +    + ++LDL+ N  SGEI
Sbjct  165  LMLKSNQLTGGLSDDMCKLTQLAYFNVRENRLSGPLPAGIGNCTSFQILDLSYNNFSGEI  224

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L  N L G
Sbjct  225  PYNIGYLQV-STLSLEANMLSG  245



>ref|XP_001755734.1| ERL1b AtERECTA-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ79407.1| ERL1b AtERECTA-like receptor S/T protein kinase protein [Physcomitrella 
patens]
Length=907

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLS N L G+IP+ +S+L+ LE L L+NN+  GPIPS+ + + NL+ LD+  N LSG I
Sbjct  114  IDLSGNNLNGEIPYLLSQLQLLEVLNLRNNKFSGPIPSSFASLSNLRHLDMQINNLSGPI  173

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P L+YW+E LQYL L+ N L G
Sbjct  174  PPLLYWSETLQYLMLKSNQLTG  195


 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G+IP++I  L Q+ TL L+ N L G IP+ L  +  L +LDL+ N+L GEI
Sbjct  234  LDLSHNNFSGEIPYNIGYL-QVSTLSLEGNRLSGGIPNVLGLMQALVILDLSNNQLEGEI  292

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++     L  L L  NN+ G
Sbjct  293  PPILGNLTCLTKLYLYNNNITG  314


 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N++ G IP +IS L  L  L +  N+L G IP  L Q+ NL  L+L+ N  +G +
Sbjct  353  LDLSENQISGSIPVNISSLTALNILNVHGNQLNGSIPPGLQQLTNLTRLNLSSNHFTGSV  412

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L  L L  NNL G
Sbjct  413  PEEIGMIVNLDILDLSHNNLTG  434


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP  + +L  L  L L +N   G +P  +  I NL +LDL+ N L+G++
Sbjct  377  LNVHGNQLNGSIPPGLQQLTNLTRLNLSSNHFTGSVPEEIGMIVNLDILDLSHNNLTGQV  436

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I   E L  + L  NNL G
Sbjct  437  PSSISTLEHLVSIDLHENNLNG  458


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G +   + K  QL    ++ N+L GP+P+ +    + ++LDL+ N  SGEI
Sbjct  186  LMLKSNQLTGGLSDDMCKSTQLAYFNVRENKLSGPLPACIGNCTSFQILDLSHNNFSGEI  245

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L GN L G
Sbjct  246  PYNIGYLQV-STLSLEGNRLSG  266


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N L G +P SIS L+ L ++ L  N L G IP     + +L  LDL+ N + G I
Sbjct  425  LDLSHNNLTGQVPSSISTLEHLVSIDLHENNLNGSIPMAFGNLKSLNFLDLSHNHIQGPI  484

Query  182  P  184
            P
Sbjct  485  P  485


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 40/77 (52%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N + G IP     L +L  L L  N L G IPS LS +  L  LDL++N++SG IP  I 
Sbjct  310  NNITGHIPIEFGNLSRLNYLELSGNSLTGQIPSELSYLTGLFELDLSENQISGSIPVNIS  369

Query  197  WNEVLQYLGLRGNNLVG  247
                L  L + GN L G
Sbjct  370  SLTALNILNVHGNQLNG  386


 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N   G +P  I  +  L+ L L +N L G +PS++S + +L  +DL +N L+G I
Sbjct  401  LNLSSNHFTGSVPEEIGMIVNLDILDLSHNNLTGQVPSSISTLEHLVSIDLHENNLNGSI  460

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      + L +L L  N++ G
Sbjct  461  PMAFGNLKSLNFLDLSHNHIQG  482



>ref|XP_001770079.1| ERL1c AtERECTA-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ65061.1| ERL1c AtERECTA-like receptor S/T protein kinase protein [Physcomitrella 
patens]
Length=948

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+L G+IP+ +S+L+ LE L L++N+L G IPS+ + +PNL+ LD+  N LSG I
Sbjct  103  LDLSSNKLVGEIPYLLSQLQLLEFLNLRSNKLSGSIPSSFAGLPNLRHLDMQFNILSGPI  162

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P L++W+E LQYL L+ N L G
Sbjct  163  PPLLFWSETLQYLMLKSNQLTG  184


 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS+N   G+IP++I  L Q+ TL L++N L G IP  L  +  L +LDL+ NKL G+I
Sbjct  223  LDLSYNNFSGEIPYNIGYL-QVSTLSLESNNLTGVIPDVLGLMQALVILDLSNNKLEGQI  281

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR +     L  L L  NN+ G
Sbjct  282  PRSLGNLTSLTKLYLYNNNISG  303


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+L G IP S+  L  L  L L NN + GPIP     +  L  L+L+ N L GEI
Sbjct  270  LDLSNNKLEGQIPRSLGNLTSLTKLYLYNNNISGPIPKEFGNMSRLNYLELSANSLIGEI  329

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I +   L  L L  N L G
Sbjct  330  PSEICYLTGLFELDLSNNQLKG  351


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP SIS L+ L  + L+NN+L G IP  L  + +L  LDL+QN+L G I
Sbjct  414  LNLSKNSLTGQIPPSISNLEHLLEIDLQNNKLSGTIPIALGNLKSLGSLDLSQNQLQGPI  473

Query  182  P  184
            P
Sbjct  474  P  474


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS   L G+I   I  L+ L+ L L  N + G IP  +    NL  LDL+ NKL GEI
Sbjct  55   LNLSALALGGEISPLIGLLESLQVLDLSGNNISGQIPVGICNCTNLIHLDLSSNKLVGEI  114

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P L+   ++L++L LR N L G
Sbjct  115  PYLLSQLQLLEFLNLRSNKLSG  136


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G +   + KL QL    ++ N+L GP+P+ +    + ++LDL+ N  SGEI
Sbjct  175  LMLKSNQLTGGLSDDMCKLTQLAYFNVRENKLSGPLPAGIGNCTSFQILDLSYNNFSGEI  234

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L  NNL G
Sbjct  235  PYNIGYLQV-STLSLESNNLTG  255



>gb|AAT08020.1| putative receptor protein kinase [Zea mays]
Length=207

 Score = 78.6 bits (192),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVL  148
            LD SFN L GDIPFSISKLK LE LILKNN+L+G IPSTLSQ+PNLK+L
Sbjct  159  LDFSFNNLDGDIPFSISKLKHLENLILKNNQLIGAIPSTLSQLPNLKIL  207



>gb|ABR17329.1| unknown [Picea sitchensis]
Length=634

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 41/82 (50%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+L G IP S+SKL  LE L L +N+L GPIP ++S++P+L  LDL+ N+L+G I
Sbjct  440  LDLSSNQLSGSIPSSVSKLVHLEKLALASNKLSGPIPFSVSEMPSLVFLDLSSNQLNGSI  499

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L+YL L  NN  G
Sbjct  500  PEYLTELKSLRYLNLENNNFAG  521


 Score = 62.8 bits (151),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 38/82 (46%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLS N L G IP S+ +L  L TL L +N+L G IPS++S++ +L+ L LA NKLSG I
Sbjct  416  IDLSGNNLKGAIPSSMGRLVHLRTLDLSSNQLSGSIPSSVSKLVHLEKLALASNKLSGPI  475

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L +L L  N L G
Sbjct  476  PFSVSEMPSLVFLDLSSNQLNG  497


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 28/78 (36%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IPFS+S++  L  L L +N+L G IP  L+++ +L+ L+L  N  +G +
Sbjct  464  LALASNKLSGPIPFSVSEMPSLVFLDLSSNQLNGSIPEYLTELKSLRYLNLENNNFAGPV  523

Query  182  PRLIYWNEVLQYLGLRGN  235
            P    + + L    + GN
Sbjct  524  PFNATFIKKLSSFKISGN  541



>ref|XP_006394418.1| hypothetical protein EUTSA_v100036151mg, partial [Eutrema salsugineum]
 gb|ESQ31704.1| hypothetical protein EUTSA_v100036151mg, partial [Eutrema salsugineum]
Length=821

 Score = 79.3 bits (194),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +2

Query  104  PIPSTLSQIPNLKVLDLAQNKLSGEIPRLIYWNEVLQYLGLRGNNLVG  247
            P   TL+QIPNLK+LDLA N L+GEIPRL+YWNEVLQYLGLRGN L G
Sbjct  1    PHTGTLTQIPNLKILDLAGNHLTGEIPRLLYWNEVLQYLGLRGNMLTG  48


 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP  + KL+QL  L L NN LVGPIPS +S    L   ++  N LSG I
Sbjct  182  LQLNDNKLVGTIPPELGKLEQLFELNLANNRLVGPIPSNISSCAALNQFNVHGNLLSGSI  241

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  NN  G
Sbjct  242  PLALRNLRSLTYLNLSSNNFKG  263


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G IP  +  L     L L  N+L GPIPS L  +  L  L L  NKL G I
Sbjct  134  LDLSDNELVGPIPPILGNLSFTGKLYLHGNKLTGPIPSELGNMSRLSYLQLNDNKLVGTI  193

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  N LVG
Sbjct  194  PPELGKLEQLFELNLANNRLVG  215


 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP  I  ++ L  L L +NELVGPIP  L  +     L L  NKL+G I
Sbjct  110  LSLQGNRLTGRIPEVIGLMQALAVLDLSDNELVGPIPPILGNLSFTGKLYLHGNKLTGPI  169

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL L  N LVG
Sbjct  170  PSELGNMSRLSYLQLNDNKLVG  191


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+SFN L G IP  + +L+ L +LIL NN+L G IP  L+    L  L+++ N LSG +
Sbjct  326  IDVSFNLLSGVIPTELGQLQDLNSLILNNNKLHGKIPDQLTNCSTLINLNVSFNNLSGTV  385

Query  182  PRL  190
            P +
Sbjct  386  PSM  388


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G++ F + +L  L     + N L G IP ++    + ++LD++ N+++GEI
Sbjct  39   LGLRGNMLTGNLSFDMCQLTGLWYFDARGNSLTGTIPESIGNCTSFQILDISYNQITGEI  98

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I + +V   L L+GN L G
Sbjct  99   PYNIGFLQV-ATLSLQGNRLTG  119


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G IP  +  + +L  L L +N+LVG IP  L ++  L  L+LA N+L G I
Sbjct  158  LYLHGNKLTGPIPSELGNMSRLSYLQLNDNKLVGTIPPELGKLEQLFELNLANNRLVGPI  217

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L    + GN L G
Sbjct  218  PSNISSCAALNQFNVHGNLLSG  239



>gb|AIR08789.1| receptor-like kinase ERECTA [Medicago sativa]
Length=978

 Score = 79.3 bits (194),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 49/68 (72%), Gaps = 10/68 (15%)
 Frame = +2

Query  44   SISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIYWNEVLQYLG  223
            S+S   QLE L+L+NN+L+GPIPSTLSQIPNLK LDLA N LSGEI          QYLG
Sbjct  135  SVSPPPQLEFLVLRNNQLIGPIPSTLSQIPNLKYLDLAHNNLSGEI----------QYLG  184

Query  224  LRGNNLVG  247
            LRGN L G
Sbjct  185  LRGNLLTG  192


 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L++  N+L G IP +   L+ + +L L +N L GPIP  LS+I NL  LD++ NK+SG I
Sbjct  377  LNVHGNKLNGTIPATFHSLESMTSLNLSSNNLQGPIPIELSRIGNLDTLDISNNKISGPI  436

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   E L  L L  NNL G
Sbjct  437  PSSLGDLEHLLKLNLSRNNLTG  458


 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS NEL G+IPF+I  L Q+ TL L+ N L G IP  L  +  L VLDL+ N L+G I
Sbjct  241  LDLSSNELTGEIPFNIGFL-QIATLSLQGNNLSGHIPPVLGLMQALTVLDLSYNMLTGSI  299

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P ++        L L GN L G
Sbjct  300  PPILGNLTYTAKLYLHGNKLTG  321


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +S++  L+TL + NN++ GPIPS+L  + +L  L+L++N L+G I
Sbjct  401  LNLSSNNLQGPIPIELSRIGNLDTLDISNNKISGPIPSSLGDLEHLLKLNLSRNNLTGPI  460

Query  182  P  184
            P
Sbjct  461  P  461


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S N++ G IP S+  L+ L  L L  N L GPIP+    + ++  +DL+ N+LS  I
Sbjct  425  LDISNNKISGPIPSSLGDLEHLLKLNLSRNNLTGPIPAEFGNLKSIMEIDLSHNQLSEMI  484

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + +  L L  N+L G
Sbjct  485  PVELGQLQSIASLRLENNDLTG  506



>ref|XP_004143019.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Cucumis sativus]
 ref|XP_004156407.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Cucumis sativus]
Length=1017

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+S N  +G+IP SIS  K LE LI+ NNE  GPIP T   +  L++LDL+ N+LSG I
Sbjct  528  IDISNNHFFGNIPSSISGCKSLEALIMANNEFSGPIPRTFEDLRGLQILDLSSNRLSGPI  587

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR     + LQ L L  N+L G
Sbjct  588  PREFQQLKALQTLNLSFNDLEG  609


 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N  YG+IP +IS L+ L  L L +N L G IPS + ++  L++L LA+N+LSG IP  + 
Sbjct  388  NRFYGNIPSTISNLQGLSLLNLSDNSLSGEIPSQIGKLEKLQMLGLARNQLSGRIPTSLG  447

Query  197  WNEVLQYLGLRGNNLVG  247
               +L  + L GN+LVG
Sbjct  448  DLRMLNQIDLSGNDLVG  464


 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+LYG IP S   L  + T+ L  N + GP+P+ L+ +PNLK L +  N LSG +
Sbjct  182  LNLAQNQLYGSIPPSFGNLSSIVTINLGTNSINGPLPTQLAALPNLKHLIITINNLSGTV  241

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I+    L  L L  N L G
Sbjct  242  PPPIFNMSSLVTLALASNQLWG  263


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 45/83 (54%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKL-KQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGE  178
            L L  N   G IP SI  L K L  L +  N   G IPST+S +  L +L+L+ N LSGE
Sbjct  358  LALDGNNFEGVIPDSIGNLSKDLSKLYMGENRFYGNIPSTISNLQGLSLLNLSDNSLSGE  417

Query  179  IPRLIYWNEVLQYLGLRGNNLVG  247
            IP  I   E LQ LGL  N L G
Sbjct  418  IPSQIGKLEKLQMLGLARNQLSG  440


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP S+  L+ L  + L  N+LVG IP++     NL  LDL++NKL+G I
Sbjct  431  LGLARNQLSGRIPTSLGDLRMLNQIDLSGNDLVGNIPTSFGNYMNLLSLDLSKNKLNGSI  490

Query  182  PR  187
            PR
Sbjct  491  PR  492


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N   G +P  I  L+ + T+ + NN   G IPS++S   +L+ L +A N+ SG I
Sbjct  504  LNLSNNFFSGPLPEEIGSLENVVTIDISNNHFFGNIPSSISGCKSLEALIMANNEFSGPI  563

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR       LQ L L  N L G
Sbjct  564  PRTFEDLRGLQILDLSSNRLSG  585


 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N++ G IP  I+ L +L  L +  N L G +PS +S + +L++LDL  NK++G +
Sbjct  110  LQLQSNQITGQIPHQITNLFRLRVLNVSFNNLQGQLPSNISNMVDLEILDLTSNKINGRL  169

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     LQ L L  N L G
Sbjct  170  PDELSRLNKLQVLNLAQNQLYG  191


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G+IP  I KL++L+ L L  N+L G IP++L  +  L  +DL+ N L G I
Sbjct  407  LNLSDNSLSGEIPSQIGKLEKLQMLGLARNQLSGRIPTSLGDLRMLNQIDLSGNDLVGNI  466

Query  182  P  184
            P
Sbjct  467  P  467



>gb|KGN62469.1| hypothetical protein Csa_2G354950 [Cucumis sativus]
Length=1057

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +D+S N  +G+IP SIS  K LE LI+ NNE  GPIP T   +  L++LDL+ N+LSG I
Sbjct  568  IDISNNHFFGNIPSSISGCKSLEALIMANNEFSGPIPRTFEDLRGLQILDLSSNRLSGPI  627

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR     + LQ L L  N+L G
Sbjct  628  PREFQQLKALQTLNLSFNDLEG  649


 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N  YG+IP +IS L+ L  L L +N L G IPS + ++  L++L LA+N+LSG IP  + 
Sbjct  428  NRFYGNIPSTISNLQGLSLLNLSDNSLSGEIPSQIGKLEKLQMLGLARNQLSGRIPTSLG  487

Query  197  WNEVLQYLGLRGNNLVG  247
               +L  + L GN+LVG
Sbjct  488  DLRMLNQIDLSGNDLVG  504


 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N+LYG IP S   L  + T+ L  N + GP+P+ L+ +PNLK L +  N LSG +
Sbjct  222  LNLAQNQLYGSIPPSFGNLSSIVTINLGTNSINGPLPTQLAALPNLKHLIITINNLSGTV  281

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I+    L  L L  N L G
Sbjct  282  PPPIFNMSSLVTLALASNQLWG  303


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 45/83 (54%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKL-KQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGE  178
            L L  N   G IP SI  L K L  L +  N   G IPST+S +  L +L+L+ N LSGE
Sbjct  398  LALDGNNFEGVIPDSIGNLSKDLSKLYMGENRFYGNIPSTISNLQGLSLLNLSDNSLSGE  457

Query  179  IPRLIYWNEVLQYLGLRGNNLVG  247
            IP  I   E LQ LGL  N L G
Sbjct  458  IPSQIGKLEKLQMLGLARNQLSG  480


 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N+L G IP S+  L+ L  + L  N+LVG IP++     NL  LDL++NKL+G I
Sbjct  471  LGLARNQLSGRIPTSLGDLRMLNQIDLSGNDLVGNIPTSFGNYMNLLSLDLSKNKLNGSI  530

Query  182  PR  187
            PR
Sbjct  531  PR  532


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N   G +P  I  L+ + T+ + NN   G IPS++S   +L+ L +A N+ SG I
Sbjct  544  LNLSNNFFSGPLPEEIGSLENVVTIDISNNHFFGNIPSSISGCKSLEALIMANNEFSGPI  603

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR       LQ L L  N L G
Sbjct  604  PRTFEDLRGLQILDLSSNRLSG  625


 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N++ G IP  I+ L +L  L +  N L G +PS +S + +L++LDL  NK++G +
Sbjct  150  LQLQSNQITGQIPHQITNLFRLRVLNVSFNNLQGQLPSNISNMVDLEILDLTSNKINGRL  209

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     LQ L L  N L G
Sbjct  210  PDELSRLNKLQVLNLAQNQLYG  231


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G+IP  I KL++L+ L L  N+L G IP++L  +  L  +DL+ N L G I
Sbjct  447  LNLSDNSLSGEIPSQIGKLEKLQMLGLARNQLSGRIPTSLGDLRMLNQIDLSGNDLVGNI  506

Query  182  P  184
            P
Sbjct  507  P  507



>ref|XP_010917823.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Elaeis guineensis]
Length=1026

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 57/83 (69%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQL-ETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGE  178
            LDLS N+LYG +P  I+ L  L   L L +N L+GP+PS + ++ NL+ LD+++NKLSGE
Sbjct  478  LDLSHNKLYGSLPKEIADLAALTHYLNLSHNSLIGPLPSEVGRLKNLETLDVSENKLSGE  537

Query  179  IPRLIYWNEVLQYLGLRGNNLVG  247
            IP  +   +VLQYL ++GN   G
Sbjct  538  IPGALSECQVLQYLYMQGNYFQG  560


 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N+L G IP    +L  L+ LIL +N   G IP++L+   NL +L L  NKL GEI
Sbjct  93   LNLSSNQLQGCIPQEFGRLSNLQFLILMDNAFEGAIPTSLANCSNLVLLSLDGNKLVGEI  152

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L L GNNL G
Sbjct  153  PMELGSLPKLSALLLAGNNLTG  174


 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S N+L G+IP ++S+ + L+ L ++ N   G IP++LS   +  VLDL++N LSG I
Sbjct  527  LDVSENKLSGEIPGALSECQVLQYLYMQGNYFQGVIPTSLSSSNSFIVLDLSRNNLSGSI  586

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      + LQ L L  N+L G
Sbjct  587  PESFEGCQHLQLLNLSFNDLDG  608


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N+L G+IP  +  L +L  L+L  N L G IP +L  + +L  +DL +N LSG+I
Sbjct  141  LSLDGNKLVGEIPMELGSLPKLSALLLAGNNLTGVIPPSLGNLSHLVGIDLWENNLSGQI  200

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L+Y  +  N L G
Sbjct  201  PSSLGRLVRLKYFTVTSNRLAG  222


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 46/81 (57%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    LSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPR  187
            L+ N+  G +P S+  L QL  L L  N L G IPS+   +  L++LDL+ NKL G +P+
Sbjct  432  LNENQFTGALPSSLGDLTQLLELHLDQNSLQGGIPSSFKNLQKLELLDLSHNKLYGSLPK  491

Query  188  LIY-WNEVLQYLGLRGNNLVG  247
             I     +  YL L  N+L+G
Sbjct  492  EIADLAALTHYLNLSHNSLIG  512



>ref|XP_003567118.1| PREDICTED: leucine-rich repeat receptor-like protein FASCIATED 
EAR2 [Brachypodium distachyon]
Length=418

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 40/82 (49%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  I  L  L  L L NN L G IP TLS +P L+VL+L  N+L+G I
Sbjct  227  LNLSSNALNGSIPARIGDLISLAALDLSNNSLSGGIPDTLSTLPELQVLNLGSNRLNGSI  286

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR +   + L+ + L GNNL G
Sbjct  287  PRFLSGMKGLKEINLEGNNLDG  308


 Score = 53.5 bits (127),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G IP +++ L  + +L L +N L G IP+ +  + +L  LDL+ N LSG I
Sbjct  203  LDLSGNRFTGAIPDAVTLLGGITSLNLSSNALNGSIPARIGDLISLAALDLSNNSLSGGI  262

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     LQ L L  N L G
Sbjct  263  PDTLSTLPELQVLNLGSNRLNG  284



>ref|XP_007157942.1| hypothetical protein PHAVU_002G111100g [Phaseolus vulgaris]
 gb|ESW29936.1| hypothetical protein PHAVU_002G111100g [Phaseolus vulgaris]
Length=1131

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N L GD+P  ISK   L TL++ +N L G IP +L  +PNL +LDL+ N LSGEI
Sbjct  628  LDLSGNNLTGDVPAEISKCSGLTTLLVDHNRLSGDIPGSLWNLPNLTMLDLSSNNLSGEI  687

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L +L + GNNL G
Sbjct  688  PSNLSMIPSLVFLNVSGNNLDG  709


 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            ++LS+N   G+IP S+ +L+QL+ L L +N L G +PS L+    L  L +  N L+GEI
Sbjct  190  INLSYNHFSGEIPASLGELQQLQYLWLDHNLLGGTLPSALANCSALLHLSVEGNALTGEI  249

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     LQ + L  NN  G
Sbjct  250  PSAISVLPKLQVMSLSQNNFTG  271


 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S N L+G++P  I  L +LE L + NN   G IP  L +   L V+D   N+  GE+
Sbjct  340  LDVSNNALFGEVPPQIGNLVKLEVLKMANNSFTGTIPVELKKCGFLSVVDFEGNEFGGEV  399

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L+ L L GN+  G
Sbjct  400  PSFLGDVTGLRVLSLGGNHFSG  421


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N   G IP S+  L +L TL L    L G +P  LS +P+L+V+ L +NKLSG++
Sbjct  484  LNLSGNGFSGKIPSSLGNLFKLTTLDLSKQNLSGELPLELSGLPSLQVVALQENKLSGDV  543

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        LQY+ L  N   G
Sbjct  544  PEGFSSLTSLQYVNLSSNAFSG  565


 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G IP SI+ L QL+ + L  N   G IP++L ++  L+ L L  N L G +
Sbjct  166  LDLSSNAFSGAIPSSIANLYQLQLINLSYNHFSGEIPASLGELQQLQYLWLDHNLLGGTL  225

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L +L + GN L G
Sbjct  226  PSALANCSALLHLSVEGNALTG  247


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L  N L G IP  +S+L  L  L L  N L G +P+ +S+   L  L +  N+LSG+I
Sbjct  604  LELGSNSLAGRIPADLSRLTLLRMLDLSGNNLTGDVPAEISKCSGLTTLLVDHNRLSGDI  663

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  ++    L  L L  NNL G
Sbjct  664  PGSLWNLPNLTMLDLSSNNLSG  685


 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = +2

Query  8    LSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIP  184
            +  N L GDIP S+  L  L  L L +N L G IPS LS IP+L  L+++ N L GEIP
Sbjct  654  VDHNRLSGDIPGSLWNLPNLTMLDLSSNNLSGEIPSNLSMIPSLVFLNVSGNNLDGEIP  712


 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N   G +P S   L  LE L L+ N L G +P  + ++ NL +LDL+ NK +G++
Sbjct  412  LSLGGNHFSGSVPVSFGNLSFLEMLSLRGNRLNGSMPEMIMRLNNLTILDLSGNKFTGQV  471

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
               I     L +L L GN   G
Sbjct  472  YASIGNLNKLMFLNLSGNGFSG  493


 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+  G +  SI  L +L  L L  N   G IPS+L  +  L  LDL++  LSGE+
Sbjct  460  LDLSGNKFTGQVYASIGNLNKLMFLNLSGNGFSGKIPSSLGNLFKLTTLDLSKQNLSGEL  519

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     LQ + L+ N L G
Sbjct  520  PLELSGLPSLQVVALQENKLSG  541


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 43/77 (56%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N++ G IP  I     +E L L +N L G IP+ LS++  L++LDL+ N L+G++P  I 
Sbjct  585  NDITGAIPSEIGNCSGIEILELGSNSLAGRIPADLSRLTLLRMLDLSGNNLTGDVPAEIS  644

Query  197  WNEVLQYLGLRGNNLVG  247
                L  L +  N L G
Sbjct  645  KCSGLTTLLVDHNRLSG  661


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            + L  N   G IP S+SK   L +L L++N   G +P+ ++ +  LK+L++A N+LSG I
Sbjct  96   ISLRSNNFNGTIPSSLSKCTLLWSLFLQDNSFSGNLPTEIANLTGLKILNVALNRLSGSI  155

Query  182  PRLI  193
            P ++
Sbjct  156  PGIL  159



>ref|XP_008674100.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X1 [Zea mays]
 tpg|DAA54721.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1053

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 55/83 (66%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLI-LKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGE  178
            LDLS+N+  G IP  +  L  L   + L +N   GPIPS + ++ +L VLDL+ N+LSGE
Sbjct  513  LDLSYNKFSGMIPKQLVSLSSLTLFLNLSHNTFSGPIPSQVGRLSSLGVLDLSNNRLSGE  572

Query  179  IPRLIYWNEVLQYLGLRGNNLVG  247
            +PR ++  + ++YL L+GN LVG
Sbjct  573  VPRALFQCQAMEYLFLQGNQLVG  595


 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N L G++P ++ + + +E L L+ N+LVG IP +LS +  L+ LD+++N LSG I
Sbjct  562  LDLSNNRLSGEVPRALFQCQAMEYLFLQGNQLVGRIPQSLSSMKGLQYLDMSENNLSGSI  621

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L YL L  N   G
Sbjct  622  PDYLSTLQYLHYLNLSYNQFDG  643


 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 44/78 (56%), Gaps = 1/78 (1%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N++ G IP  I KL  L  L + +N L G IP T+  + N+  LD++ N LSGEIP L+ 
Sbjct  421  NKISGSIPTEIGKLSNLRVLAIADNALTGTIPDTIGGLHNMTGLDVSGNNLSGEIPSLLV  480

Query  197  WN-EVLQYLGLRGNNLVG  247
             N   L +L L  N L G
Sbjct  481  ANLTQLSFLDLSQNELEG  498


 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = +2

Query  2    LDLSFNELYGDIP-FSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGE  178
            LD+S N L G+IP   ++ L QL  L L  NEL G IP +   + N+ +LDL+ NK SG 
Sbjct  464  LDVSGNNLSGEIPSLLVANLTQLSFLDLSQNELEGSIPESFENMRNIAILDLSYNKFSGM  523

Query  179  IPR-LIYWNEVLQYLGLRGNNLVG  247
            IP+ L+  + +  +L L  N   G
Sbjct  524  IPKQLVSLSSLTLFLNLSHNTFSG  547


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            + L  N L G+IP S+S   +L  L L+ N L G IP+ LS    L+V +++ N LSG I
Sbjct  143  ISLGENSLTGEIPASLSNCARLTHLELQLNGLHGEIPANLSNCKELRVFNISVNTLSGGI  202

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        L++ GL  +NL G
Sbjct  203  PPSFGSLLKLEFFGLHRSNLTG  224


 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L  + L G I  S+S L  L TL L +N L G IPS L  +  L+V+ L +N L+GEI
Sbjct  95   LELMLSNLTGVISHSLSNLSFLHTLNLSSNRLSGSIPSELGILWRLQVISLGENSLTGEI  154

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L +L L+ N L G
Sbjct  155  PASLSNCARLTHLELQLNGLHG  176


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 48/83 (58%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLK-QLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGE  178
            L LS+N   G +P S+  L   ++ +++  N++ G IP+ + ++ NL+VL +A N L+G 
Sbjct  391  LSLSYNRFQGMLPPSLVNLTIWIQQILINGNKISGSIPTEIGKLSNLRVLAIADNALTGT  450

Query  179  IPRLIYWNEVLQYLGLRGNNLVG  247
            IP  I     +  L + GNNL G
Sbjct  451  IPDTIGGLHNMTGLDVSGNNLSG  473


 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +  L +L+ + L  N L G IP++LS    L  L+L  N L GEI
Sbjct  119  LNLSSNRLSGSIPSELGILWRLQVISLGENSLTGEIPASLSNCARLTHLELQLNGLHGEI  178

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L+   +  N L G
Sbjct  179  PANLSNCKELRVFNISVNTLSG  200



>ref|XP_009611275.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Nicotiana tomentosiformis]
Length=982

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 56/83 (67%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+L G IP + + L QL  L+L NN+L G IPS+L Q  NL++LDL+ N++SG+I
Sbjct  388  LDLSKNKLSGLIPDTFANLSQLRRLLLHNNQLSGTIPSSLGQCINLEILDLSHNRISGKI  447

Query  182  PRLIYWNEVLQ-YLGLRGNNLVG  247
            P  +     L+ YL L GNNL G
Sbjct  448  PSEVAGLSSLKIYLNLSGNNLHG  470


 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  + ++ +LE L L NN L G IPS    +P+L +LDL++NKLSG I
Sbjct  340  LNLSSNHLNGTIPLELCQIGKLERLYLSNNSLSGVIPSAFGNLPHLGLLDLSKNKLSGLI  399

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        L+ L L  N L G
Sbjct  400  PDTFANLSQLRRLLLHNNQLSG  421


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 46/84 (55%), Gaps = 2/84 (2%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N   G IP  +  L +L  L L +N L G IP  L  +  LK LDL  N LSGEI
Sbjct  111  LDLSGNLFEGKIPAELGYLLKLNQLSLSSNLLEGKIPVELGLLHKLKYLDLGSNNLSGEI  170

Query  182  PRLIYWN--EVLQYLGLRGNNLVG  247
            P  ++ N    LQY+ L  N+L G
Sbjct  171  PLPLFCNCSASLQYMDLSNNSLSG  194


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLS N L   +P  +     LE L L  N L G +PS++ ++P LK LD++ N L+GEI
Sbjct  485  IDLSSNNLSATVPSQLGSCIALEYLNLSRNALEGALPSSIGRLPYLKELDVSFNVLNGEI  544

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+    +  LQ L    N+  G
Sbjct  545  PQSFQASSTLQKLNFSYNHFSG  566


 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 45/83 (54%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLI-LKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGE  178
            LDLS N + G IP  ++ L  L+  + L  N L GPIP  LS++  +  +DL+ N LS  
Sbjct  436  LDLSHNRISGKIPSEVAGLSSLKIYLNLSGNNLHGPIPLELSKMDMVLAIDLSSNNLSAT  495

Query  179  IPRLIYWNEVLQYLGLRGNNLVG  247
            +P  +     L+YL L  N L G
Sbjct  496  VPSQLGSCIALEYLNLSRNALEG  518



>ref|XP_008674101.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X2 [Zea mays]
Length=983

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 55/83 (66%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLI-LKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGE  178
            LDLS+N+  G IP  +  L  L   + L +N   GPIPS + ++ +L VLDL+ N+LSGE
Sbjct  443  LDLSYNKFSGMIPKQLVSLSSLTLFLNLSHNTFSGPIPSQVGRLSSLGVLDLSNNRLSGE  502

Query  179  IPRLIYWNEVLQYLGLRGNNLVG  247
            +PR ++  + ++YL L+GN LVG
Sbjct  503  VPRALFQCQAMEYLFLQGNQLVG  525


 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N L G++P ++ + + +E L L+ N+LVG IP +LS +  L+ LD+++N LSG I
Sbjct  492  LDLSNNRLSGEVPRALFQCQAMEYLFLQGNQLVGRIPQSLSSMKGLQYLDMSENNLSGSI  551

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L YL L  N   G
Sbjct  552  PDYLSTLQYLHYLNLSYNQFDG  573


 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 44/78 (56%), Gaps = 1/78 (1%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N++ G IP  I KL  L  L + +N L G IP T+  + N+  LD++ N LSGEIP L+ 
Sbjct  351  NKISGSIPTEIGKLSNLRVLAIADNALTGTIPDTIGGLHNMTGLDVSGNNLSGEIPSLLV  410

Query  197  WN-EVLQYLGLRGNNLVG  247
             N   L +L L  N L G
Sbjct  411  ANLTQLSFLDLSQNELEG  428


 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = +2

Query  2    LDLSFNELYGDIP-FSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGE  178
            LD+S N L G+IP   ++ L QL  L L  NEL G IP +   + N+ +LDL+ NK SG 
Sbjct  394  LDVSGNNLSGEIPSLLVANLTQLSFLDLSQNELEGSIPESFENMRNIAILDLSYNKFSGM  453

Query  179  IPR-LIYWNEVLQYLGLRGNNLVG  247
            IP+ L+  + +  +L L  N   G
Sbjct  454  IPKQLVSLSSLTLFLNLSHNTFSG  477


 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            + L  N L G+IP S+S   +L  L L+ N L G IP+ LS    L+V +++ N LSG I
Sbjct  73   ISLGENSLTGEIPASLSNCARLTHLELQLNGLHGEIPANLSNCKELRVFNISVNTLSGGI  132

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        L++ GL  +NL G
Sbjct  133  PPSFGSLLKLEFFGLHRSNLTG  154


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L  + L G I  S+S L  L TL L +N L G IPS L  +  L+V+ L +N L+GEI
Sbjct  25   LELMLSNLTGVISHSLSNLSFLHTLNLSSNRLSGSIPSELGILWRLQVISLGENSLTGEI  84

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L +L L+ N L G
Sbjct  85   PASLSNCARLTHLELQLNGLHG  106


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 48/83 (58%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLK-QLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGE  178
            L LS+N   G +P S+  L   ++ +++  N++ G IP+ + ++ NL+VL +A N L+G 
Sbjct  321  LSLSYNRFQGMLPPSLVNLTIWIQQILINGNKISGSIPTEIGKLSNLRVLAIADNALTGT  380

Query  179  IPRLIYWNEVLQYLGLRGNNLVG  247
            IP  I     +  L + GNNL G
Sbjct  381  IPDTIGGLHNMTGLDVSGNNLSG  403


 Score = 47.0 bits (110),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N L G IP  +  L +L+ + L  N L G IP++LS    L  L+L  N L GEI
Sbjct  49   LNLSSNRLSGSIPSELGILWRLQVISLGENSLTGEIPASLSNCARLTHLELQLNGLHGEI  108

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L+   +  N L G
Sbjct  109  PANLSNCKELRVFNISVNTLSG  130



>dbj|BAK02654.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1039

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N L G IP S+  LKQL+ L+L  NEL+G IPS +S +  L+VLD+  N+L GE+
Sbjct  439  LDLSINWLTGPIPHSLGNLKQLKRLVLFFNELIGGIPSEISNMTELQVLDVNTNRLEGEL  498

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     LQYL L  NN  G
Sbjct  499  PTTITSLRNLQYLALFDNNFTG  520


 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S N+L G +    S+   L  L + NN +   IP+ L Q+ +L++LDL+ N+ +GE+
Sbjct  607  LDVSGNQLAGRLSPDWSRCTNLTVLSMNNNRMSASIPAALCQLTSLRLLDLSNNQFTGEL  666

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            PR  +  + L ++ +  N L G
Sbjct  667  PRCWWKLQALVFMDVSSNGLWG  688


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +2

Query  8    LSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPR  187
            L FNEL G IP  IS + +L+ L +  N L G +P+T++ + NL+ L L  N  +G IPR
Sbjct  465  LFFNELIGGIPSEISNMTELQVLDVNTNRLEGELPTTITSLRNLQYLALFDNNFTGTIPR  524


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSI-SKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGE  178
            L+L  N   GDIP  I + +  L  L L +N+  G IPS LS++ NL+VLD+++N  +G 
Sbjct  729  LNLGHNMFVGDIPSWIGTSVPLLRVLTLPSNKFSGVIPSELSKLSNLQVLDMSKNSFTGM  788

Query  179  IP  184
            IP
Sbjct  789  IP  790



>gb|EAY92716.1| hypothetical protein OsI_14467 [Oryza sativa Indica Group]
Length=374

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDL+ N L G IP S++ +  L +++L  N L GPIP +LSQI NL  LDL+ N+LSG +
Sbjct  92   LDLTGNLLSGRIPPSLANISSLSSILLGQNNLSGPIPESLSQIANLNKLDLSGNRLSGFV  151

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +Y    L++ G+  N+L+G
Sbjct  152  PVTLYNKSSLEFFGIGNNSLIG  173


 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 44/83 (53%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQ-IPNLKVLDLAQNKLSGE  178
            LDLS N L G +P ++     LE   + NN L+G IP  +   +PNLK L ++ N+  G 
Sbjct  140  LDLSGNRLSGFVPVTLYNKSSLEFFGIGNNSLIGKIPPDIGHTLPNLKSLVMSLNRFDGS  199

Query  179  IPRLIYWNEVLQYLGLRGNNLVG  247
            IP  +     LQ L L  N+L G
Sbjct  200  IPTSLANASNLQMLDLSSNHLSG  222


 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 46/77 (60%), Gaps = 1/77 (1%)
 Frame = +2

Query  20   ELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY-  196
            EL G +P  I  L  L++L+L  N L G IP +L++  +L  L+L++N LSGEIP   + 
Sbjct  2    ELTGVLPDCIGNLTSLQSLLLARNNLEGTIPESLARSSSLIELNLSRNNLSGEIPPSFFN  61

Query  197  WNEVLQYLGLRGNNLVG  247
             +  L  + L+ N+ VG
Sbjct  62   GSSKLVTVDLQTNSFVG  78



>ref|XP_006646325.1| PREDICTED: piriformospora indica-insensitive protein 2-like [Oryza 
brachyantha]
Length=396

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 37/82 (45%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N+L G+IP SI  L  L T+ L NN + G IP T+S +P L+VL+L  N+L+G I
Sbjct  204  LNLSSNDLNGNIPTSIGDLISLTTIDLSNNSISGGIPETISTLPELEVLNLGSNRLNGSI  263

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P+ +     L+ L L GN+  G
Sbjct  264  PQFLAEMRGLKELNLEGNDFDG  285


 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 31/82 (38%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N + G IP +++ L  +  L L +N+L G IP+++  + +L  +DL+ N +SG I
Sbjct  180  LDLSGNRITGAIPDTLTLLSAITHLNLSSNDLNGNIPTSIGDLISLTTIDLSNNSISGGI  239

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  I     L+ L L  N L G
Sbjct  240  PETISTLPELEVLNLGSNRLNG  261



>gb|EMT25935.1| LRR receptor-like serine/threonine-protein kinase FLS2 [Aegilops 
tauschii]
Length=419

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 38/82 (46%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N L G IP  ++  +QL +LIL+ N L G IP   + +P L VLDL+ N LSGEI
Sbjct  195  LDLSGNRLSGAIPAGLASCQQLASLILRRNSLAGEIPRPFATMPALSVLDLSNNLLSGEI  254

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +  +  L+ L +  NNL G
Sbjct  255  PSNLGSSPALEMLSVAHNNLTG  276


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLS N L   +P  I  +  L+T     NEL G +P  L     L  LDL+ N+LSG I
Sbjct  147  IDLSRNRLRSALPPRILSIPTLQTFAAAGNELTGGVPDELGGCRALSALDLSGNRLSGAI  206

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L  L LR N+L G
Sbjct  207  PAGLASCQQLASLILRRNSLAG  228


 Score = 48.9 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 34/61 (56%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G+IP   + +  L  L L NN L G IPS L   P L++L +A N L+G +
Sbjct  219  LILRRNSLAGEIPRPFATMPALSVLDLSNNLLSGEIPSNLGSSPALEMLSVAHNNLTGPV  278

Query  182  P  184
            P
Sbjct  279  P  279


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 30/77 (39%), Positives = 37/77 (48%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            NEL G +P  +   + L  L L  N L G IP+ L+    L  L L +N L+GEIPR   
Sbjct  176  NELTGGVPDELGGCRALSALDLSGNRLSGAIPAGLASCQQLASLILRRNSLAGEIPRPFA  235

Query  197  WNEVLQYLGLRGNNLVG  247
                L  L L  N L G
Sbjct  236  TMPALSVLDLSNNLLSG  252



>gb|EAZ01492.1| hypothetical protein OsI_23524 [Oryza sativa Indica Group]
Length=747

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L LS N L G IP SI  L  LE L L  N   G IPS+LS+IPNL+ LDL  N LSG +
Sbjct  307  LSLSQNNLSGSIPSSIENLSSLEILYLSQNNFQGTIPSSLSRIPNLQELDLTYNNLSGTV  366

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +Y    L YLG+  N L+G
Sbjct  367  PASLYNMSNLVYLGMGTNKLIG  388


 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L LS N L G+IPFS+     L  +IL NN L G IP  L+   +L +LDL  N+L GEI
Sbjct  211  LYLSNNNLSGNIPFSLGSNSFLNVVILTNNSLTGGIPPLLANSSSLILLDLTNNRLGGEI  270

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  ++ +  L  + L  NN VG
Sbjct  271  PFALFNSSSLNLISLAVNNFVG  292


 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            + L FN L G+IP  I  L++L  L L +N L G IP  LS   NL+++DL+ N + GEI
Sbjct  115  IHLPFNLLTGNIPPEIGHLRRLTYLNLTSNGLTGTIPEALSSCSNLQIIDLSNNTIDGEI  174

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     LQ + L  N L G
Sbjct  175  PSSMNKCSNLQAICLFDNKLQG  196


 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            +DLS N + G+IP S++K   L+ + L +N+L G IP  L  + NL VL L+ N LSG I
Sbjct  163  IDLSNNTIDGEIPSSMNKCSNLQAICLFDNKLQGVIPEGLGTLSNLSVLYLSNNNLSGNI  222

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +  N  L  + L  N+L G
Sbjct  223  PFSLGSNSFLNVVILTNNSLTG  244


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +2

Query  8    LSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIP  184
            L+ NE+ G IP  I KL  L  L ++ N L G +P +L  +PNL +L L+QNK+SG+IP
Sbjct  505  LTGNEISGTIPQEIEKLTSLTLLYMEKNLLTGNLPDSLGNLPNLFILSLSQNKISGQIP  563


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+L+ N L G IP ++S    L+ + L NN + G IPS++++  NL+ + L  NKL G I
Sbjct  139  LNLTSNGLTGTIPEALSSCSNLQIIDLSNNTIDGEIPSSMNKCSNLQAICLFDNKLQGVI  198

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L  L L  NNL G
Sbjct  199  PEGLGTLSNLSVLYLSNNNLSG  220


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 46/83 (55%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLS-QIPNLKVLDLAQNKLSGE  178
            LDL++N L G +P S+  +  L  L +  N+L+G IP  +   +PN+K L L  N+  G+
Sbjct  355  LDLTYNNLSGTVPASLYNMSNLVYLGMGTNKLIGEIPDNIGYTLPNIKTLILQGNQFQGQ  414

Query  179  IPRLIYWNEVLQYLGLRGNNLVG  247
            IP  +   + LQ + LR N   G
Sbjct  415  IPTSLGIAKNLQVINLRDNAFHG  437



>gb|KHN36048.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=868

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N L GD+P  ISK   L TL + +N L G IP +LS + NL +LDL+ N LSG I
Sbjct  367  LDLSGNNLTGDVPEEISKCSSLTTLFVDHNHLSGAIPGSLSDLSNLTMLDLSANNLSGVI  426

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L YL + GNNL G
Sbjct  427  PSNLSMISGLVYLNVSGNNLDG  448


 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L+LS N   G IP S+  L +L TL L    L G +P  LS +P+L+++ L +NKLSG++
Sbjct  223  LNLSGNGFSGKIPSSLGNLFRLTTLDLSKMNLSGELPLELSGLPSLQIVALQENKLSGDV  282

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        LQY+ L  N+  G
Sbjct  283  PEGFSSLMSLQYVNLSSNSFSG  304


 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 41/82 (50%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S N L G++P  +  L +LE L + NN   G IP  L +  +L V+D   N   GE+
Sbjct  79   LDVSRNALSGEVPPEVGNLIKLEELKMANNSFTGTIPVELKKCGSLSVVDFEGNDFGGEV  138

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P        L  L L GN+  G
Sbjct  139  PSFFGDMIGLNVLSLGGNHFSG  160


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 43/77 (56%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   NELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIY  196
            N + G IP  I     +E L L +N L G IP+ +S++  LKVLDL+ N L+G++P  I 
Sbjct  324  NHITGTIPSEIGNCSGIEILELGSNSLAGHIPADISRLTLLKVLDLSGNNLTGDVPEEIS  383

Query  197  WNEVLQYLGLRGNNLVG  247
                L  L +  N+L G
Sbjct  384  KCSSLTTLFVDHNHLSG  400


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 40/82 (49%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N   G +P S   L  LETL L+ N L G +P  +  + NL  LDL+ NK +G++
Sbjct  151  LSLGGNHFSGSVPVSFGNLSFLETLSLRGNRLNGSMPEMIMGLNNLTTLDLSGNKFTGQV  210

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
               I     L  L L GN   G
Sbjct  211  YANIGNLNRLMVLNLSGNGFSG  232


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 44/82 (54%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LDLS N+  G +  +I  L +L  L L  N   G IPS+L  +  L  LDL++  LSGE+
Sbjct  199  LDLSGNKFTGQVYANIGNLNRLMVLNLSGNGFSGKIPSSLGNLFRLTTLDLSKMNLSGEL  258

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     LQ + L+ N L G
Sbjct  259  PLELSGLPSLQIVALQENKLSG  280



>ref|XP_009395673.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Musa 
acuminata subsp. malaccensis]
Length=721

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 55/83 (66%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLI-LKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGE  178
             DLSFNEL G IP  +++L  L   + L +N L GP+PS    + NL+VLD++ N+LSGE
Sbjct  489  CDLSFNELEGSIPKELAELSSLTRYLNLSHNLLTGPLPSEFGSLKNLQVLDISDNRLSGE  548

Query  179  IPRLIYWNEVLQYLGLRGNNLVG  247
            IP  +   +VLQYL L+ N+L G
Sbjct  549  IPSTLGECQVLQYLYLQRNHLQG  571


 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            LD+S N L G+IP ++ + + L+ L L+ N L G IP +LS +  ++VLDL+ N LSG I
Sbjct  538  LDISDNRLSGEIPSTLGECQVLQYLYLQRNHLQGTIPDSLSSLGGIQVLDLSCNYLSGPI  597

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P      + +++L L  N+L G
Sbjct  598  PLTFERLQHMKFLNLSLNDLQG  619


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 46/83 (55%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L+ N L G +P ++  L QLE L L +N L G IP +   +  L V DL+ N+L G I
Sbjct  441  LSLNGNRLSGVLPSTVGNLTQLERLYLNDNSLQGEIPKSFHNLQRLTVCDLSFNELEGSI  500

Query  182  PR-LIYWNEVLQYLGLRGNNLVG  247
            P+ L   + + +YL L  N L G
Sbjct  501  PKELAELSSLTRYLNLSHNLLTG  523


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 47/83 (57%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLK-QLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGE  178
            LDL +N+L G +P +I+ L  QL+ L L  NE+ G IP+ +    +L  L L Q  L+G+
Sbjct  368  LDLGYNKLEGTLPAAIANLSTQLKWLGLGGNEIHGSIPAGIGSFTHLHRLYLDQMALAGD  427

Query  179  IPRLIYWNEVLQYLGLRGNNLVG  247
            IP  I   + L  L L GN L G
Sbjct  428  IPAAIGKLQNLHILSLNGNRLSG  450


 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            + L  N L G+IP ++  L +L+ L L  N++ G IP++L  + ++  +DL  N+++G I
Sbjct  169  ISLGSNRLAGEIPAALGALPKLQILSLHYNDIGGRIPASLGNLSSMTHIDLVGNRVTGTI  228

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +   + L ++ + GN+L G
Sbjct  229  PPSLGRLQSLVHISVTGNSLTG  250


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 42/82 (51%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  NE++G IP  I     L  L L    L G IP+ + ++ NL +L L  N+LSG +
Sbjct  393  LGLGGNEIHGSIPAGIGSFTHLHRLYLDQMALAGDIPAAIGKLQNLHILSLNGNRLSGVL  452

Query  182  PRLIYWNEVLQYLGLRGNNLVG  247
            P  +     L+ L L  N+L G
Sbjct  453  PSTVGNLTQLERLYLNDNSLQG  474


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 40/76 (53%), Gaps = 0/76 (0%)
 Frame = +2

Query  20   ELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEIPRLIYW  199
             L GDIP +I KL+ L  L L  N L G +PST+  +  L+ L L  N L GEIP+  + 
Sbjct  423  ALAGDIPAAIGKLQNLHILSLNGNRLSGVLPSTVGNLTQLERLYLNDNSLQGEIPKSFHN  482

Query  200  NEVLQYLGLRGNNLVG  247
             + L    L  N L G
Sbjct  483  LQRLTVCDLSFNELEG  498


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 47/87 (54%), Gaps = 7/87 (8%)
 Frame = +2

Query  8    LSFNELYGDIPFSISKLKQLETLILKNNELVGPIP------STLSQIPNLKVLDLAQNKL  169
            L +N L G +P  I +L+ L +L L++N L           ++L+   NL+ LDL  NKL
Sbjct  316  LPYNRLSGPLPRDIGRLRYLSSLSLRDNRLEAKKAEDWEFLASLANCSNLRTLDLGYNKL  375

Query  170  SGEIPRLIY-WNEVLQYLGLRGNNLVG  247
             G +P  I   +  L++LGL GN + G
Sbjct  376  EGTLPAAIANLSTQLKWLGLGGNEIHG  402


 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LDLSFNELYGDIPFSISKLKQLETLILKNNELVGPIPSTLSQIPNLKVLDLAQNKLSGEI  181
            L L  N L G IP S+S L  ++ L L  N L GPIP T  ++ ++K L+L+ N L G++
Sbjct  562  LYLQRNHLQGTIPDSLSSLGGIQVLDLSCNYLSGPIPLTFERLQHMKFLNLSLNDLQGQV  621

Query  182  P  184
            P
Sbjct  622  P  622



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557676237175