BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF039F16

Length=477
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009801071.1|  PREDICTED: EIN3-binding F-box protein 1            197   6e-56   Nicotiana sylvestris
ref|XP_009614726.1|  PREDICTED: EIN3-binding F-box protein 1-like       196   1e-55   Nicotiana tomentosiformis
emb|CDP13516.1|  unnamed protein product                                190   3e-54   Coffea canephora [robusta coffee]
ref|XP_006364926.1|  PREDICTED: EIN3-binding F-box protein 1-like       190   2e-53   Solanum tuberosum [potatoes]
ref|XP_009376923.1|  PREDICTED: EIN3-binding F-box protein 1-like       187   1e-52   Pyrus x bretschneideri [bai li]
ref|XP_009376911.1|  PREDICTED: EIN3-binding F-box protein 1-like       187   2e-52   Pyrus x bretschneideri [bai li]
ref|XP_006483363.1|  PREDICTED: EIN3-binding F-box protein 1-like       186   3e-52   Citrus sinensis [apfelsine]
ref|XP_006450435.1|  hypothetical protein CICLE_v10007708mg             186   3e-52   Citrus clementina [clementine]
ref|XP_010048202.1|  PREDICTED: EIN3-binding F-box protein 1-like       186   3e-52   
ref|XP_008219497.1|  PREDICTED: LOW QUALITY PROTEIN: EIN3-binding...    185   6e-52   Prunus mume [ume]
ref|XP_010696236.1|  PREDICTED: EIN3-binding F-box protein 1            185   1e-51   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011020134.1|  PREDICTED: EIN3-binding F-box protein 1-like       184   2e-51   Populus euphratica
ref|XP_007225116.1|  hypothetical protein PRUPE_ppa002673mg             184   2e-51   Prunus persica
gb|AFT92041.1|  EIN3 binding F-box 1                                    184   3e-51   Malus domestica [apple tree]
gb|KCW81401.1|  hypothetical protein EUGRSUZ_C02778                     183   3e-51   Eucalyptus grandis [rose gum]
ref|XP_010048972.1|  PREDICTED: LOW QUALITY PROTEIN: EIN3-binding...    184   3e-51   Eucalyptus grandis [rose gum]
ref|NP_001234864.1|  EIN3-binding F-box protein 2                       184   3e-51   
gb|KDP32417.1|  hypothetical protein JCGZ_13342                         183   4e-51   Jatropha curcas
ref|XP_002325221.1|  hypothetical protein POPTR_0018s13070g             183   4e-51   
ref|XP_011017769.1|  PREDICTED: EIN3-binding F-box protein 1-like       183   4e-51   Populus euphratica
ref|XP_010250120.1|  PREDICTED: EIN3-binding F-box protein 1-like       183   5e-51   Nelumbo nucifera [Indian lotus]
ref|XP_008394083.1|  PREDICTED: EIN3-binding F-box protein 1-like       183   5e-51   
ref|XP_008365190.1|  PREDICTED: EIN3-binding F-box protein 1-like...    183   6e-51   
ref|XP_009355743.1|  PREDICTED: EIN3-binding F-box protein 1-like       182   6e-51   Pyrus x bretschneideri [bai li]
ref|XP_008378375.1|  PREDICTED: EIN3-binding F-box protein 1-like...    182   6e-51   
ref|XP_008378376.1|  PREDICTED: EIN3-binding F-box protein 1-like...    183   7e-51   
ref|XP_008365191.1|  PREDICTED: EIN3-binding F-box protein 1-like...    183   7e-51   
ref|XP_007161212.1|  hypothetical protein PHAVU_001G051300g             182   8e-51   Phaseolus vulgaris [French bean]
ref|XP_011078374.1|  PREDICTED: EIN3-binding F-box protein 1-like       182   1e-50   Sesamum indicum [beniseed]
ref|XP_002308982.2|  hypothetical protein POPTR_0006s06770g             182   2e-50   
ref|XP_010254418.1|  PREDICTED: EIN3-binding F-box protein 1-like       182   2e-50   Nelumbo nucifera [Indian lotus]
ref|XP_003588766.1|  Ein3-binding f-box protein                         181   2e-50   Medicago truncatula
ref|XP_002285126.1|  PREDICTED: EIN3-binding F-box protein 1-like       181   4e-50   Vitis vinifera
ref|XP_004498740.1|  PREDICTED: EIN3-binding F-box protein 1-like       180   4e-50   Cicer arietinum [garbanzo]
gb|KDP33594.1|  hypothetical protein JCGZ_07165                         180   5e-50   Jatropha curcas
ref|XP_002524506.1|  grr1, plant, putative                              180   6e-50   Ricinus communis
ref|XP_007013466.1|  Ein3-binding f-box protein 4                       180   7e-50   
ref|XP_004508488.1|  PREDICTED: EIN3-binding F-box protein 2-like       179   9e-50   Cicer arietinum [garbanzo]
gb|KJB27084.1|  hypothetical protein B456_004G276800                    179   2e-49   Gossypium raimondii
gb|KHG15742.1|  EIN3-binding F-box 1 -like protein                      179   2e-49   Gossypium arboreum [tree cotton]
ref|XP_002515516.1|  grr1, plant, putative                              178   2e-49   Ricinus communis
gb|KHN33913.1|  EIN3-binding F-box protein 1                            178   3e-49   Glycine soja [wild soybean]
gb|EYU20264.1|  hypothetical protein MIMGU_mgv1a002548mg                178   3e-49   Erythranthe guttata [common monkey flower]
ref|XP_003544614.1|  PREDICTED: EIN3-binding F-box protein 1-like...    177   4e-49   Glycine max [soybeans]
gb|KJB54023.1|  hypothetical protein B456_009G017100                    177   9e-49   Gossypium raimondii
ref|XP_002308665.2|  grr1 family protein                                176   2e-48   
ref|XP_009625259.1|  PREDICTED: EIN3-binding F-box protein 1-like       175   3e-48   Nicotiana tomentosiformis
ref|XP_011069870.1|  PREDICTED: EIN3-binding F-box protein 1            175   4e-48   Sesamum indicum [beniseed]
ref|XP_002324298.2|  hypothetical protein POPTR_0018s01710g             175   4e-48   Populus trichocarpa [western balsam poplar]
ref|XP_007011864.1|  EIN3-binding F box protein 1                       175   5e-48   
gb|KHG24906.1|  EIN3-binding F-box 1 -like protein                      174   6e-48   Gossypium arboreum [tree cotton]
ref|XP_004242782.1|  PREDICTED: EIN3-binding F-box protein 1-like       174   8e-48   Solanum lycopersicum
gb|KHG14715.1|  EIN3-binding F-box 1 -like protein                      174   9e-48   Gossypium arboreum [tree cotton]
ref|XP_008362900.1|  PREDICTED: EIN3-binding F-box protein 1-like       174   1e-47   
gb|KJB55011.1|  hypothetical protein B456_009G058000                    174   1e-47   Gossypium raimondii
gb|KJB65824.1|  hypothetical protein B456_010G114900                    173   1e-47   Gossypium raimondii
ref|XP_011081561.1|  PREDICTED: EIN3-binding F-box protein 1-like       173   2e-47   Sesamum indicum [beniseed]
ref|XP_011016246.1|  PREDICTED: EIN3-binding F-box protein 1-like       172   2e-47   Populus euphratica
ref|XP_011036551.1|  PREDICTED: EIN3-binding F-box protein 1-like       172   2e-47   Populus euphratica
ref|XP_009758784.1|  PREDICTED: EIN3-binding F-box protein 1-like       172   3e-47   Nicotiana sylvestris
gb|KJB07737.1|  hypothetical protein B456_001G042600                    172   3e-47   Gossypium raimondii
ref|XP_006358273.1|  PREDICTED: EIN3-binding F-box protein 1-like       172   3e-47   Solanum tuberosum [potatoes]
ref|XP_003549759.1|  PREDICTED: EIN3-binding F-box protein 1-like       172   4e-47   Glycine max [soybeans]
ref|XP_004138725.1|  PREDICTED: EIN3-binding F-box protein 1-like       172   5e-47   Cucumis sativus [cucumbers]
ref|XP_007204219.1|  hypothetical protein PRUPE_ppa003009mg             171   6e-47   
ref|XP_008337284.1|  PREDICTED: EIN3-binding F-box protein 1-like       171   7e-47   
ref|XP_010102671.1|  EIN3-binding F-box protein 1                       171   1e-46   
ref|XP_006450916.1|  hypothetical protein CICLE_v10007739mg             171   1e-46   
gb|EPS63879.1|  f-box family protein                                    171   1e-46   Genlisea aurea
gb|KDO80236.1|  hypothetical protein CISIN_1g006749mg                   171   1e-46   Citrus sinensis [apfelsine]
ref|XP_004291457.1|  PREDICTED: EIN3-binding F-box protein 1-like       170   2e-46   Fragaria vesca subsp. vesca
ref|XP_006475854.1|  PREDICTED: EIN3-binding F-box protein 2-like       171   2e-46   
gb|AFU61111.1|  F-box protein                                           169   3e-46   Capsicum annuum
ref|XP_003542675.1|  PREDICTED: EIN3-binding F-box protein 1-like       169   3e-46   Glycine max [soybeans]
ref|XP_003522913.1|  PREDICTED: EIN3-binding F-box protein 1-like       169   7e-46   Glycine max [soybeans]
gb|KHG28503.1|  EIN3-binding F-box 1 -like protein                      167   2e-45   Gossypium arboreum [tree cotton]
ref|XP_008445218.1|  PREDICTED: EIN3-binding F-box protein 1            167   2e-45   Cucumis melo [Oriental melon]
ref|XP_008457494.1|  PREDICTED: EIN3-binding F-box protein 1-like       167   3e-45   Cucumis melo [Oriental melon]
gb|KJB82811.1|  hypothetical protein B456_013G215000                    166   4e-45   Gossypium raimondii
ref|XP_009368857.1|  PREDICTED: EIN3-binding F-box protein 1-like       166   4e-45   Pyrus x bretschneideri [bai li]
gb|KHM99176.1|  EIN3-binding F-box protein 1                            156   6e-45   Glycine soja [wild soybean]
ref|XP_010526214.1|  PREDICTED: EIN3-binding F-box protein 1-like       166   6e-45   Tarenaya hassleriana [spider flower]
ref|XP_007138419.1|  hypothetical protein PHAVU_009G207300g             166   7e-45   Phaseolus vulgaris [French bean]
gb|KJB65823.1|  hypothetical protein B456_010G114900                    166   7e-45   Gossypium raimondii
ref|XP_009403463.1|  PREDICTED: EIN3-binding F-box protein 1-like       165   1e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009364023.1|  PREDICTED: EIN3-binding F-box protein 1-like       165   1e-44   Pyrus x bretschneideri [bai li]
gb|EYU32346.1|  hypothetical protein MIMGU_mgv1a002758mg                165   1e-44   Erythranthe guttata [common monkey flower]
ref|XP_008466405.1|  PREDICTED: EIN3-binding F-box protein 1 isof...    165   1e-44   
ref|XP_004139306.1|  PREDICTED: EIN3-binding F-box protein 1-like       165   2e-44   Cucumis sativus [cucumbers]
ref|XP_008466407.1|  PREDICTED: EIN3-binding F-box protein 1 isof...    164   2e-44   
ref|XP_009791397.1|  PREDICTED: EIN3-binding F-box protein 2-like       164   2e-44   Nicotiana sylvestris
ref|XP_009607234.1|  PREDICTED: EIN3-binding F-box protein 2-like       164   3e-44   Nicotiana tomentosiformis
ref|XP_007137020.1|  hypothetical protein PHAVU_009G093200g             164   3e-44   Phaseolus vulgaris [French bean]
ref|XP_003522614.1|  PREDICTED: EIN3-binding F-box protein 1-like...    164   4e-44   Glycine max [soybeans]
ref|XP_004287307.1|  PREDICTED: EIN3-binding F-box protein 1-like       163   5e-44   Fragaria vesca subsp. vesca
gb|KEH32121.1|  EIN3-binding F-box-like protein                         163   9e-44   Medicago truncatula
gb|KEH32122.1|  EIN3-binding F-box-like protein                         163   9e-44   Medicago truncatula
ref|XP_002285249.2|  PREDICTED: EIN3-binding F-box protein 1-like       162   1e-43   Vitis vinifera
gb|KCW80001.1|  hypothetical protein EUGRSUZ_C01334                     162   1e-43   Eucalyptus grandis [rose gum]
ref|XP_003609344.1|  Ein3-binding f-box protein                         163   1e-43   
ref|XP_011039690.1|  PREDICTED: EIN3-binding F-box protein 1-like       162   1e-43   Populus euphratica
ref|XP_010047961.1|  PREDICTED: EIN3-binding F-box protein 1-like       162   2e-43   Eucalyptus grandis [rose gum]
ref|XP_007155011.1|  hypothetical protein PHAVU_003G165500g             162   2e-43   Phaseolus vulgaris [French bean]
ref|XP_004173614.1|  PREDICTED: EIN3-binding F-box protein 1-like       162   2e-43   
ref|XP_010048082.1|  PREDICTED: EIN3-binding F-box protein 1-like       161   2e-43   Eucalyptus grandis [rose gum]
ref|XP_008792024.1|  PREDICTED: EIN3-binding F-box protein 1-like       161   2e-43   
ref|NP_001281254.1|  EIN3-binding F-box protein 1-like                  161   3e-43   Cucumis sativus [cucumbers]
ref|XP_010533156.1|  PREDICTED: EIN3-binding F-box protein 1-like       160   6e-43   Tarenaya hassleriana [spider flower]
ref|XP_010525963.1|  PREDICTED: EIN3-binding F-box protein 1-like       160   7e-43   Tarenaya hassleriana [spider flower]
ref|XP_009388655.1|  PREDICTED: EIN3-binding F-box protein 1-like       160   7e-43   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADW83728.1|  EIN3-binding F-box protein 1                            158   7e-43   Musa acuminata AAA Group [Cavendish banana]
ref|XP_010687976.1|  PREDICTED: EIN3-binding F-box protein 2-like       160   9e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006345227.1|  PREDICTED: EIN3-binding F-box protein 1-like       159   1e-42   Solanum tuberosum [potatoes]
ref|XP_010907279.1|  PREDICTED: EIN3-binding F-box protein 1-like       159   2e-42   Elaeis guineensis
ref|XP_008805624.1|  PREDICTED: EIN3-binding F-box protein 1-like       159   2e-42   Phoenix dactylifera
gb|KHN07078.1|  EIN3-binding F-box protein 1                            158   3e-42   Glycine soja [wild soybean]
gb|ABK25485.1|  unknown                                                 155   2e-41   Picea sitchensis
ref|XP_008805623.1|  PREDICTED: EIN3-binding F-box protein 1-like       156   2e-41   Phoenix dactylifera
gb|EYU23011.1|  hypothetical protein MIMGU_mgv1a002803mg                156   2e-41   Erythranthe guttata [common monkey flower]
dbj|BAJ34438.1|  unnamed protein product                                154   3e-41   Eutrema halophilum
ref|NP_001234858.1|  EIN3-binding F-box protein 1                       155   3e-41   Solanum lycopersicum
ref|XP_010907280.1|  PREDICTED: EIN3-binding F-box protein 1-like       155   3e-41   Elaeis guineensis
gb|EPS63568.1|  ein3-binding f-box protein 3                            155   4e-41   Genlisea aurea
ref|XP_010429542.1|  PREDICTED: EIN3-binding F-box protein 1            155   5e-41   Camelina sativa [gold-of-pleasure]
gb|AES91540.2|  EIN3-binding F-box-like protein                         155   5e-41   Medicago truncatula
dbj|BAF01819.1|  putative glucose regulated repressor protein           152   6e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010541915.1|  PREDICTED: EIN3-binding F-box protein 1-like       154   7e-41   Tarenaya hassleriana [spider flower]
ref|XP_006842065.1|  hypothetical protein AMTR_s00078p00046140          154   9e-41   Amborella trichopoda
ref|XP_006405190.1|  hypothetical protein EUTSA_v10000087mg             154   1e-40   Eutrema salsugineum [saltwater cress]
ref|XP_010454859.1|  PREDICTED: EIN3-binding F-box protein 2            154   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010493788.1|  PREDICTED: EIN3-binding F-box protein 2-like       153   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_006394785.1|  hypothetical protein EUTSA_v10003828mg             153   2e-40   Eutrema salsugineum [saltwater cress]
ref|XP_010086585.1|  hypothetical protein L484_002248                   153   2e-40   Morus notabilis
ref|XP_003609343.1|  Ein3-binding f-box protein                         155   3e-40   
emb|CAN83761.1|  hypothetical protein VITISV_043743                     153   3e-40   Vitis vinifera
ref|XP_006287278.1|  hypothetical protein CARUB_v10000473mg             152   3e-40   Capsella rubella
emb|CDX88173.1|  BnaA06g27640D                                          152   4e-40   
ref|XP_009419280.1|  PREDICTED: EIN3-binding F-box protein 1-like       152   4e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_565597.1|  EIN3-binding F-box protein 1                          152   5e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010421385.1|  PREDICTED: EIN3-binding F-box protein 2-like       152   5e-40   Camelina sativa [gold-of-pleasure]
gb|ACF81449.1|  unknown                                                 145   5e-40   Zea mays [maize]
dbj|BAH20224.1|  AT2G25490                                              152   5e-40   Arabidopsis thaliana [mouse-ear cress]
emb|CDX87090.1|  BnaC09g04050D                                          151   7e-40   
ref|XP_010541601.1|  PREDICTED: EIN3-binding F-box protein 2            151   7e-40   Tarenaya hassleriana [spider flower]
gb|KJB07621.1|  hypothetical protein B456_001G033400                    151   9e-40   Gossypium raimondii
ref|XP_002874252.1|  ein3-binding F box protein 2                       151   9e-40   
ref|XP_009140675.1|  PREDICTED: EIN3-binding F-box protein 1            151   1e-39   Brassica rapa
gb|AES73649.2|  EIN3-binding F-box-like protein                         151   1e-39   Medicago truncatula
emb|CDX80503.1|  BnaC07g29410D                                          151   1e-39   
ref|XP_008443991.1|  PREDICTED: EIN3-binding F-box protein 1-like       150   2e-39   Cucumis melo [Oriental melon]
emb|CDY35358.1|  BnaA04g14890D                                          150   2e-39   Brassica napus [oilseed rape]
ref|NP_197917.1|  EIN3-binding F-box protein 2                          150   2e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009397481.1|  PREDICTED: EIN3-binding F-box protein 1-like       150   2e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009151059.1|  PREDICTED: EIN3-binding F-box protein 2            149   5e-39   Brassica rapa
gb|KFK32577.1|  hypothetical protein AALP_AA6G261300                    149   5e-39   Arabis alpina [alpine rockcress]
ref|XP_006648432.1|  PREDICTED: EIN3-binding F-box protein 1-like       148   5e-39   
ref|XP_010472548.1|  PREDICTED: EIN3-binding F-box protein 1            149   6e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010555012.1|  PREDICTED: EIN3-binding F-box protein 2-like       148   1e-38   Tarenaya hassleriana [spider flower]
ref|NP_001132560.1|  F-box family member                                145   2e-38   
ref|XP_009381112.1|  PREDICTED: EIN3-binding F-box protein 1-like       147   2e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006293838.1|  hypothetical protein CARUB_v10022822mg             147   3e-38   Capsella rubella
emb|CDY19807.1|  BnaA09g04600D                                          147   4e-38   Brassica napus [oilseed rape]
ref|XP_002880682.1|  ein3-binding F box protein 1                       147   4e-38   
ref|XP_009111664.1|  PREDICTED: EIN3-binding F-box protein 2-like       146   6e-38   Brassica rapa
ref|XP_002437255.1|  hypothetical protein SORBIDRAFT_10g023670          142   6e-38   
ref|XP_004170235.1|  PREDICTED: LOW QUALITY PROTEIN: EIN3-binding...    145   8e-38   
gb|ACR35519.1|  unknown                                                 145   9e-38   Zea mays [maize]
ref|XP_008681226.1|  PREDICTED: F-box family member isoform X1          145   1e-37   
gb|AEK81539.1|  EIN3 binding F-box 1                                    145   1e-37   Dianthus caryophyllus [carnation]
ref|XP_004150592.1|  PREDICTED: EIN3-binding F-box protein 1-like       145   2e-37   Cucumis sativus [cucumbers]
ref|XP_004951542.1|  PREDICTED: EIN3-binding F-box protein 1-like       145   2e-37   Setaria italica
ref|XP_010417316.1|  PREDICTED: EIN3-binding F-box protein 1-like       144   3e-37   Camelina sativa [gold-of-pleasure]
emb|CBI21043.3|  unnamed protein product                                144   4e-37   Vitis vinifera
ref|XP_010322126.1|  PREDICTED: EIN3-binding F-box protein 1-like       143   6e-37   
ref|XP_002453497.1|  hypothetical protein SORBIDRAFT_04g006870          143   1e-36   Sorghum bicolor [broomcorn]
ref|NP_001046222.1|  Os02g0200900                                       140   7e-36   
ref|XP_004965933.1|  PREDICTED: EIN3-binding F-box protein 1-like       140   8e-36   Setaria italica
gb|EAY84905.1|  hypothetical protein OsI_06273                          140   1e-35   Oryza sativa Indica Group [Indian rice]
dbj|BAD15849.1|  putative F-box protein                                 140   1e-35   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001147557.1|  LOC100281166                                       139   2e-35   Zea mays [maize]
ref|NP_001145991.1|  uncharacterized protein LOC100279520               137   4e-35   
ref|XP_006657116.1|  PREDICTED: EIN3-binding F-box protein 1-like       137   8e-35   Oryza brachyantha
ref|XP_008677099.1|  PREDICTED: uncharacterized protein LOC100279...    137   9e-35   
dbj|BAD35544.1|  putative F-box protein Fbl2                            137   1e-34   Oryza sativa Japonica Group [Japonica rice]
gb|ACB59221.1|  F-box protein                                           137   2e-34   Brassica oleracea
gb|EAZ01599.1|  hypothetical protein OsI_23635                          137   2e-34   Oryza sativa Indica Group [Indian rice]
gb|AFW66152.1|  hypothetical protein ZEAMMB73_923849                    137   2e-34   
gb|EMS45959.1|  hypothetical protein TRIUR3_29988                       133   8e-34   Triticum urartu
gb|EMT32544.1|  hypothetical protein F775_30491                         133   1e-33   
gb|AFA36487.1|  EIN3-binding F-box protein                              130   1e-33   Lolium perenne [perennial ryegrass]
ref|XP_003603398.1|  Ein3-binding f-box protein                         132   6e-33   
ref|XP_003563656.1|  PREDICTED: EIN3-binding F-box protein 1            132   9e-33   Brachypodium distachyon [annual false brome]
gb|AFW87207.1|  hypothetical protein ZEAMMB73_795948                    131   2e-32   
emb|CDP10419.1|  unnamed protein product                                130   6e-32   Coffea canephora [robusta coffee]
ref|XP_003571400.1|  PREDICTED: EIN3-binding F-box protein 1-like       129   2e-31   Brachypodium distachyon [annual false brome]
dbj|BAJ88579.1|  predicted protein                                      125   2e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAN82790.1|  hypothetical protein VITISV_030601                     124   1e-29   Vitis vinifera
gb|EMS68820.1|  hypothetical protein TRIUR3_29831                       122   1e-29   Triticum urartu
gb|EMT19526.1|  hypothetical protein F775_07091                         120   6e-28   
ref|NP_001237471.1|  grr1 protein                                       112   2e-25   
emb|CDX76980.1|  BnaC04g37750D                                          111   2e-25   
ref|NP_001058023.1|  Os06g0605900                                       103   8e-25   
ref|XP_010264613.1|  PREDICTED: EIN3-binding F-box protein 2-like     99.8    4e-21   Nelumbo nucifera [Indian lotus]
ref|XP_002981899.1|  hypothetical protein SELMODRAFT_233861           96.7    5e-20   
ref|XP_006849175.1|  hypothetical protein AMTR_s00027p00189050        95.5    1e-19   
ref|XP_010251723.1|  PREDICTED: EIN3-binding F-box protein 1-like     95.5    1e-19   Nelumbo nucifera [Indian lotus]
ref|XP_002986021.1|  hypothetical protein SELMODRAFT_123441           94.4    3e-19   
ref|XP_007136869.1|  hypothetical protein PHAVU_009G080700g           91.7    3e-18   Phaseolus vulgaris [French bean]
emb|CBI28209.3|  unnamed protein product                              88.6    3e-17   Vitis vinifera
ref|XP_001783097.1|  predicted protein                                89.0    3e-17   
ref|XP_002974778.1|  hypothetical protein SELMODRAFT_442539           88.6    3e-17   Selaginella moellendorffii
ref|XP_002963689.1|  hypothetical protein SELMODRAFT_62165            88.2    3e-17   
ref|XP_001775242.1|  predicted protein                                85.5    4e-16   
ref|NP_001172897.1|  Os02g0281150                                     75.5    4e-13   
ref|XP_009032915.1|  hypothetical protein AURANDRAFT_11299            73.9    8e-13   Aureococcus anophagefferens
ref|XP_009386195.1|  PREDICTED: EIN3-binding F-box protein 1-like     74.3    2e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010908612.1|  PREDICTED: EIN3-binding F-box protein 1-like     74.3    2e-12   Elaeis guineensis
gb|AAL67490.1|AF459405_1  putative glucose-induced repressor-like...  68.6    5e-12   Narcissus pseudonarcissus
ref|XP_001630901.1|  predicted protein                                68.2    3e-11   Nematostella vectensis
emb|CBJ28117.1|  Hypothetical leucine rich repeat calmodulin bind...  71.2    4e-11   Ectocarpus siliculosus
ref|XP_006492816.1|  PREDICTED: F-box protein At3g58530-like isof...  69.3    5e-11   Citrus sinensis [apfelsine]
ref|XP_003727308.1|  PREDICTED: protein AMN1 homolog                  66.2    2e-10   Strongylocentrotus purpuratus [purple urchin]
gb|EMC86555.1|  F-box/LRR-repeat protein 13                           68.2    3e-10   
ref|XP_005498171.1|  PREDICTED: LOW QUALITY PROTEIN: F-box/LRR-re...  68.6    3e-10   
gb|KDO70837.1|  hypothetical protein CISIN_1g018439mg                 67.4    3e-10   Citrus sinensis [apfelsine]
ref|XP_010243424.1|  PREDICTED: F-box protein At3g58530               66.6    4e-10   Nelumbo nucifera [Indian lotus]
gb|EFX86579.1|  hypothetical protein DAPPUDRAFT_208061                67.0    5e-10   Daphnia pulex
gb|ETE73360.1|  F-box/LRR-repeat protein 7                            67.0    5e-10   Ophiophagus hannah
dbj|GAN11538.1|  conserved hypothetical protein                       67.4    6e-10   Mucor ambiguus
ref|XP_002308350.2|  F-box family protein                             66.2    6e-10   Populus trichocarpa [western balsam poplar]
gb|KFO34898.1|  F-box/LRR-repeat protein 20                           67.4    7e-10   Fukomys damarensis [Damara mole rat]
ref|XP_007426934.1|  PREDICTED: F-box/LRR-repeat protein 7            66.2    8e-10   Python bivittatus
ref|XP_011047086.1|  PREDICTED: F-box protein At3g58530               65.9    9e-10   Populus euphratica
gb|EFA03310.1|  hypothetical protein TcasGA2_TC013252                 67.0    9e-10   
gb|EFX60588.1|  hypothetical protein DAPPUDRAFT_71291                 63.5    9e-10   Daphnia pulex
ref|XP_002414639.1|  fbxl20, putative                                 66.2    1e-09   Ixodes scapularis [blacklegged tick]
ref|XP_009059139.1|  hypothetical protein LOTGIDRAFT_164359           65.9    1e-09   Lottia gigantea
gb|KFQ73642.1|  F-box/LRR-repeat protein 20                           65.9    1e-09   Phoenicopterus ruber ruber
ref|XP_785847.3|  PREDICTED: F-box/LRR-repeat protein 7-like          65.9    1e-09   Strongylocentrotus purpuratus [purple urchin]
ref|XP_004611387.1|  PREDICTED: protein AMN1 homolog                  63.5    1e-09   Sorex araneus [Eurasian shrew]
ref|XP_007365012.1|  RNI-like protein                                 65.5    2e-09   Dichomitus squalens LYAD-421 SS1
gb|KDR06592.1|  F-box/LRR-repeat protein 7                            65.5    2e-09   Zootermopsis nevadensis
ref|XP_010653862.1|  PREDICTED: F-box protein At3g58530 isoform X3    64.3    2e-09   Vitis vinifera
ref|XP_006155944.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  65.1    2e-09   Tupaia chinensis
ref|XP_006155945.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  64.7    2e-09   
ref|XP_007029083.1|  RNI-like superfamily protein isoform 1           64.3    2e-09   
ref|XP_002276459.1|  PREDICTED: F-box protein At3g58530 isoform X2    64.7    2e-09   Vitis vinifera
ref|XP_008481415.1|  PREDICTED: F-box/LRR-repeat protein 7-like       63.2    3e-09   Diaphorina citri
ref|XP_793918.2|  PREDICTED: F-box/LRR-repeat protein 20-like         64.7    3e-09   Strongylocentrotus purpuratus [purple urchin]
ref|XP_009509760.1|  PREDICTED: F-box/LRR-repeat protein 13-like      63.2    3e-09   Phalacrocorax carbo [common cormorant]
gb|KFB45523.1|  Dsec\GM15616-PA-like protein                          64.7    3e-09   Anopheles sinensis
ref|XP_011418908.1|  PREDICTED: F-box/LRR-repeat protein 7-like i...  65.1    3e-09   Crassostrea gigas
ref|XP_010653859.1|  PREDICTED: F-box protein At3g58530 isoform X1    64.3    3e-09   Vitis vinifera
ref|XP_010722901.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  63.9    3e-09   Meleagris gallopavo [common turkey]
ref|XP_009080171.1|  PREDICTED: F-box/LRR-repeat protein 20           64.3    3e-09   Acanthisitta chloris
ref|XP_008922985.1|  PREDICTED: F-box/LRR-repeat protein 20           64.3    3e-09   
gb|EKC18517.1|  F-box/LRR-repeat protein 7                            65.1    3e-09   Crassostrea gigas
gb|KFW81651.1|  F-box/LRR-repeat protein 20                           64.3    4e-09   Manacus vitellinus
ref|XP_009575812.1|  PREDICTED: F-box/LRR-repeat protein 20           64.3    4e-09   Fulmarus glacialis
ref|XP_008870641.1|  hypothetical protein H310_07119                  65.1    4e-09   Aphanomyces invadans
ref|XP_011418884.1|  PREDICTED: F-box/LRR-repeat protein 7-like i...  64.7    4e-09   Crassostrea gigas
ref|XP_005658145.1|  PREDICTED: F-box/LRR-repeat protein 2-like       62.8    4e-09   
gb|KDP21897.1|  hypothetical protein JCGZ_03035                       63.9    4e-09   Jatropha curcas
ref|XP_010618356.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  63.5    4e-09   Fukomys damarensis [Damara mole rat]
ref|XP_011418917.1|  PREDICTED: F-box/LRR-repeat protein 7-like i...  64.3    5e-09   
ref|XP_011418878.1|  PREDICTED: F-box/LRR-repeat protein 7-like i...  64.7    5e-09   Crassostrea gigas
ref|XP_007422430.1|  PREDICTED: F-box/LRR-repeat protein 20           63.9    5e-09   Python bivittatus
ref|XP_011418892.1|  PREDICTED: F-box/LRR-repeat protein 7-like i...  64.3    5e-09   Crassostrea gigas
ref|XP_010130458.1|  PREDICTED: F-box/LRR-repeat protein 20           63.5    5e-09   Buceros rhinoceros silvestris
ref|XP_011418900.1|  PREDICTED: F-box/LRR-repeat protein 7-like i...  64.3    5e-09   
dbj|GAA54333.1|  F-box and leucine-rich repeat protein 2/20           64.7    5e-09   Clonorchis sinensis [oriental liver fluke]
ref|XP_003414736.2|  PREDICTED: F-box/LRR-repeat protein 20           63.9    5e-09   Loxodonta africana [African bush elephant]
ref|XP_001510661.3|  PREDICTED: protein AMN1 homolog                  62.4    5e-09   
ref|XP_001950086.2|  PREDICTED: F-box/LRR-repeat protein 7-like       63.9    5e-09   Acyrthosiphon pisum
ref|XP_009822550.1|  hypothetical protein H257_01174                  64.7    5e-09   Aphanomyces astaci
ref|XP_010189680.1|  PREDICTED: F-box/LRR-repeat protein 20           63.2    5e-09   Mesitornis unicolor
ref|XP_003213137.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  63.9    5e-09   Meleagris gallopavo [common turkey]
gb|KFO87286.1|  F-box/LRR-repeat protein 20                           63.9    5e-09   Buceros rhinoceros silvestris
ref|XP_010722900.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  63.9    6e-09   Meleagris gallopavo [common turkey]
ref|XP_008111533.1|  PREDICTED: F-box/LRR-repeat protein 20           63.9    6e-09   
ref|XP_009944408.1|  PREDICTED: F-box/LRR-repeat protein 20           63.5    6e-09   
ref|XP_002531168.1|  ubiquitin-protein ligase, putative               63.5    6e-09   
dbj|BAF84533.1|  unnamed protein product                              63.9    6e-09   
gb|KFQ17114.1|  F-box/LRR-repeat protein 20                           63.5    6e-09   
ref|XP_006747015.1|  PREDICTED: F-box/LRR-repeat protein 20           63.5    6e-09   
ref|XP_009633416.1|  PREDICTED: F-box/LRR-repeat protein 20           63.5    6e-09   
gb|KFB36222.1|  AGAP003285-PA-like protein                            63.5    6e-09   
gb|EGW10826.1|  Protein AMN1-like                                     61.6    6e-09   
ref|XP_004395114.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  63.5    6e-09   
tpg|DAA18590.1|  TPA: F-box/LRR-repeat protein 20                     63.5    6e-09   
ref|NP_116264.2|  F-box/LRR-repeat protein 20 isoform 1               63.5    6e-09   
gb|KFQ40153.1|  F-box/LRR-repeat protein 20                           62.8    6e-09   
ref|NP_001030268.1|  F-box/LRR-repeat protein 20                      63.5    6e-09   
ref|XP_008946933.1|  PREDICTED: F-box/LRR-repeat protein 20           63.5    6e-09   
gb|KFQ06121.1|  F-box/LRR-repeat protein 20                           63.2    6e-09   
ref|XP_007202298.1|  hypothetical protein PRUPE_ppa007870mg           63.2    7e-09   
ref|XP_007177599.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  63.5    7e-09   
ref|XP_005394360.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  63.5    7e-09   
ref|XP_007618499.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  63.5    7e-09   
ref|XP_006903146.1|  PREDICTED: F-box/LRR-repeat protein 20-like      63.5    7e-09   
ref|XP_003278353.2|  PREDICTED: F-box/LRR-repeat protein 20           63.5    7e-09   
ref|XP_006100835.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  63.5    7e-09   
ref|XP_010080364.1|  PREDICTED: F-box/LRR-repeat protein 20           63.5    7e-09   
ref|XP_008687375.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  63.5    7e-09   
ref|XP_005394359.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  63.5    7e-09   
ref|XP_008011063.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  63.5    7e-09   
ref|XP_005368353.1|  PREDICTED: F-box/LRR-repeat protein 20           63.5    7e-09   
ref|XP_004186202.1|  PREDICTED: LOW QUALITY PROTEIN: F-box and le...  63.2    7e-09   
ref|XP_006275039.1|  PREDICTED: F-box/LRR-repeat protein 20           63.5    7e-09   
ref|XP_002719383.2|  PREDICTED: F-box/LRR-repeat protein 20           63.5    7e-09   
ref|XP_009935688.1|  PREDICTED: F-box/LRR-repeat protein 20           63.5    7e-09   
ref|XP_009273124.1|  PREDICTED: F-box/LRR-repeat protein 20           63.5    7e-09   
ref|XP_005232720.1|  PREDICTED: F-box/LRR-repeat protein 20           63.5    7e-09   
ref|XP_004608784.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  63.5    7e-09   
ref|XP_005861962.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  63.5    7e-09   
ref|XP_009592242.1|  PREDICTED: F-box/LRR-repeat protein 2            63.5    7e-09   
ref|XP_001917600.2|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  63.5    7e-09   
gb|KFO97482.1|  F-box/LRR-repeat protein 20                           63.2    7e-09   
ref|XP_006889440.1|  PREDICTED: F-box/LRR-repeat protein 20-like ...  63.5    7e-09   
dbj|BAG53862.1|  unnamed protein product                              63.5    7e-09   
ref|XP_004395115.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  63.5    7e-09   
ref|XP_011220083.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  63.5    7e-09   
ref|XP_009188752.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  63.5    7e-09   
ref|XP_009695601.1|  PREDICTED: F-box/LRR-repeat protein 20           63.5    7e-09   
ref|XP_005508301.1|  PREDICTED: F-box/LRR-repeat protein 20           63.5    7e-09   
ref|XP_009968197.1|  PREDICTED: F-box/LRR-repeat protein 20           63.5    7e-09   
ref|XP_002827704.2|  PREDICTED: F-box/LRR-repeat protein 20           63.5    7e-09   
ref|XP_008503871.1|  PREDICTED: F-box/LRR-repeat protein 20           63.5    7e-09   
dbj|BAG35499.1|  unnamed protein product                              63.5    7e-09   
ref|XP_006774359.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  63.5    7e-09   
ref|XP_004378080.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  63.5    8e-09   
ref|XP_004327345.1|  PREDICTED: F-box/LRR-repeat protein 20           63.2    8e-09   
ref|XP_010166270.1|  PREDICTED: F-box/LRR-repeat protein 20           63.5    8e-09   
ref|XP_010119165.1|  PREDICTED: LOW QUALITY PROTEIN: F-box/LRR-re...  63.2    8e-09   
ref|XP_008521487.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  63.2    8e-09   
ref|XP_006022657.1|  PREDICTED: F-box/LRR-repeat protein 20           63.5    8e-09   
gb|KFP42166.1|  F-box/LRR-repeat protein 20                           63.2    8e-09   
emb|CEI94275.1|  hypothetical protein RMCBS344292_08489               62.8    8e-09   
gb|EOA93203.1|  F-box/LRR-repeat protein 20                           63.2    8e-09   
gb|KFV14114.1|  F-box/LRR-repeat protein 20                           63.2    8e-09   
ref|XP_008241166.1|  PREDICTED: F-box protein At3g58530               63.2    8e-09   
gb|EFB19926.1|  hypothetical protein PANDA_004954                     63.2    8e-09   
gb|KFV55236.1|  F-box/LRR-repeat protein 20                           63.2    9e-09   
ref|XP_007908058.1|  PREDICTED: F-box/LRR-repeat protein 20           63.2    9e-09   
ref|XP_005031145.1|  PREDICTED: F-box/LRR-repeat protein 20           63.2    9e-09   
ref|XP_005364687.1|  PREDICTED: protein AMN1 homolog                  62.0    9e-09   
gb|ETE70898.1|  F-box/LRR-repeat protein 20                           63.2    9e-09   
ref|XP_005073009.1|  PREDICTED: protein AMN1 homolog                  61.6    9e-09   
gb|ELK01573.1|  F-box/LRR-repeat protein 20                           63.5    9e-09   
gb|KFQ75863.1|  F-box/LRR-repeat protein 13                           63.5    9e-09   
ref|XP_008797210.1|  PREDICTED: F-box/LRR-repeat protein 20           63.2    9e-09   
ref|XP_004434635.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  63.2    1e-08   
ref|XP_009414462.1|  PREDICTED: EIN3-binding F-box protein 1-like     63.5    1e-08   
ref|XP_005531467.1|  PREDICTED: F-box/LRR-repeat protein 20           63.2    1e-08   
ref|XP_001598990.1|  PREDICTED: F-box/LRR-repeat protein 2-like       61.6    1e-08   
ref|XP_009985327.1|  PREDICTED: F-box/LRR-repeat protein 20           62.8    1e-08   
ref|XP_005595808.1|  PREDICTED: F-box/LRR-repeat protein 2-like       61.2    1e-08   
gb|ERE66582.1|  putative protein AMN1 like protein                    61.6    1e-08   
ref|XP_009474114.1|  PREDICTED: F-box/LRR-repeat protein 20           62.8    1e-08   
gb|KFV18535.1|  F-box/LRR-repeat protein 20                           62.8    1e-08   
ref|XP_007644174.1|  PREDICTED: protein AMN1 homolog isoform X1       61.6    1e-08   
ref|XP_004918730.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  63.2    1e-08   
ref|XP_002908196.1|  conserved hypothetical protein                   63.5    1e-08   
gb|ETN67361.1|  partner of paired                                     63.2    1e-08   
ref|XP_002940984.2|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  63.2    1e-08   
ref|XP_007482382.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  62.8    1e-08   
ref|XP_007482383.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  62.8    1e-08   
ref|XP_007482381.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  62.8    1e-08   
ref|XP_009173095.1|  hypothetical protein T265_08903                  63.2    1e-08   
ref|XP_011506576.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  62.8    1e-08   
ref|XP_004948638.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  62.8    1e-08   
ref|XP_007191583.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  62.8    1e-08   
ref|XP_003768320.1|  PREDICTED: F-box/LRR-repeat protein 20           62.8    1e-08   
ref|XP_009509877.1|  PREDICTED: F-box/LRR-repeat protein 20           62.4    1e-08   
gb|KFP89734.1|  F-box/LRR-repeat protein 20                           62.0    1e-08   
ref|XP_004684312.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  62.8    1e-08   
ref|XP_003786473.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  62.8    1e-08   
ref|XP_007447757.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  62.0    1e-08   
ref|XP_009572061.1|  PREDICTED: LOW QUALITY PROTEIN: F-box/LRR-re...  62.4    1e-08   
ref|XP_004855098.1|  PREDICTED: protein AMN1 homolog isoform X6       60.5    1e-08   
ref|XP_004707168.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  62.4    2e-08   
ref|XP_001235091.2|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  62.4    2e-08   
ref|XP_004604014.1|  PREDICTED: F-box/LRR-repeat protein 2            62.8    2e-08   
ref|XP_008387209.1|  PREDICTED: F-box protein At3g58530-like          62.0    2e-08   
ref|XP_004948637.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  62.8    2e-08   
ref|XP_004676400.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  62.0    2e-08   
ref|XP_004455014.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  62.4    2e-08   
ref|XP_011506568.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  62.8    2e-08   
ref|XP_004455013.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  62.4    2e-08   
ref|XP_004497244.1|  PREDICTED: F-box/LRR-repeat protein 4-like       62.4    2e-08   
ref|XP_004855100.1|  PREDICTED: protein AMN1 homolog isoform X8       60.5    2e-08   
gb|EDM05910.1|  F-box and leucine-rich repeat protein 20, isoform...  61.2    2e-08   
ref|XP_009869314.1|  PREDICTED: F-box/LRR-repeat protein 20           62.0    2e-08   
ref|XP_006995974.1|  PREDICTED: protein AMN1 homolog isoform X2       60.8    2e-08   
ref|XP_006995975.1|  PREDICTED: protein AMN1 homolog isoform X3       60.5    2e-08   
ref|XP_007125300.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  62.0    2e-08   
ref|NP_071608.1|  F-box/LRR-repeat protein 20                         61.2    2e-08   
ref|XP_005317386.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  61.6    2e-08   
ref|XP_004675991.1|  PREDICTED: protein AMN1 homolog                  60.1    2e-08   
ref|XP_006822465.1|  PREDICTED: F-box/LRR-repeat protein 13-like      62.8    2e-08   
ref|XP_009926075.1|  PREDICTED: F-box/LRR-repeat protein 20           62.0    2e-08   
ref|XP_004855096.1|  PREDICTED: protein AMN1 homolog isoform X4       60.5    2e-08   
gb|ERL95549.1|  hypothetical protein D910_12810                       62.4    2e-08   
ref|XP_001112815.1|  PREDICTED: f-box/LRR-repeat protein 20-like      60.5    2e-08   
ref|XP_004409032.1|  PREDICTED: F-box/LRR-repeat protein 2 isoform 3  61.6    2e-08   
ref|XP_010371270.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  61.6    2e-08   
ref|XP_010212900.1|  PREDICTED: F-box/LRR-repeat protein 20           62.0    2e-08   
ref|XP_010076280.1|  PREDICTED: LOW QUALITY PROTEIN: F-box/LRR-re...  62.8    2e-08   
ref|XP_006737657.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  61.6    2e-08   
ref|XP_009806846.1|  PREDICTED: F-box/LRR-repeat protein 20           62.0    2e-08   
gb|EPB81854.1|  hypothetical protein HMPREF1544_11403                 62.8    2e-08   
ref|XP_010157665.1|  PREDICTED: F-box/LRR-repeat protein 20           60.1    2e-08   
ref|XP_006126277.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  62.0    2e-08   
ref|XP_004635333.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  61.6    2e-08   
ref|XP_008571816.1|  PREDICTED: F-box/LRR-repeat protein 20           62.0    2e-08   
dbj|BAG50882.1|  unnamed protein product                              62.0    2e-08   
ref|XP_006126276.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  62.0    2e-08   
ref|XP_002606244.1|  hypothetical protein BRAFLDRAFT_84015            62.0    2e-08   
gb|ENN74314.1|  hypothetical protein YQE_09285                        62.4    2e-08   
gb|KFV10761.1|  F-box/LRR-repeat protein 13                           62.0    2e-08   
emb|CDQ91138.1|  unnamed protein product                              61.6    2e-08   
ref|XP_004676399.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  61.6    3e-08   
ref|XP_008329845.1|  PREDICTED: F-box/LRR-repeat protein 2            62.0    3e-08   
ref|XP_004855094.1|  PREDICTED: protein AMN1 homolog isoform X2       60.5    3e-08   
ref|XP_008107062.1|  PREDICTED: F-box/LRR-repeat protein 7 isofor...  62.0    3e-08   
ref|XP_009487783.1|  PREDICTED: F-box/LRR-repeat protein 20           61.6    3e-08   
ref|XP_008481301.1|  PREDICTED: F-box/LRR-repeat protein 7-like       62.0    3e-08   
ref|XP_008160940.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  62.0    3e-08   
ref|XP_006995973.1|  PREDICTED: protein AMN1 homolog isoform X1       60.5    3e-08   
ref|XP_009287376.1|  PREDICTED: F-box/LRR-repeat protein 13           62.4    3e-08   
ref|XP_001997322.1|  GH23299                                          62.4    3e-08   
ref|XP_008160941.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  61.6    3e-08   
ref|XP_006172020.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  61.2    3e-08   
ref|XP_010391457.1|  PREDICTED: LOW QUALITY PROTEIN: F-box/LRR-re...  61.6    3e-08   
gb|EDL16116.1|  mCG21897, isoform CRA_a                               61.2    3e-08   
gb|KFO52586.1|  F-box/LRR-repeat protein 20                           61.6    3e-08   
ref|XP_006172018.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  61.2    3e-08   
ref|XP_011053675.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  61.6    3e-08   
ref|XP_004933942.1|  PREDICTED: F-box/LRR-repeat protein 7-like       59.3    3e-08   
ref|XP_004881083.1|  PREDICTED: protein AMN1 homolog                  60.5    3e-08   
ref|XP_005430439.1|  PREDICTED: F-box/LRR-repeat protein 20           61.6    3e-08   
gb|AFK44520.1|  unknown                                               61.6    3e-08   
ref|XP_010036517.1|  PREDICTED: F-box protein At3g58530 isoform X2    60.8    3e-08   
gb|EZA48578.1|  F-box/LRR-repeat protein                              61.6    3e-08   
gb|EUB63603.1|  F-box/LRR-repeat protein 2                            62.0    3e-08   
ref|XP_008633279.1|  PREDICTED: F-box/LRR-repeat protein 20           61.6    3e-08   
gb|EGI65879.1|  F-box/LRR-repeat protein 20                           61.6    3e-08   
ref|XP_005383695.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  61.2    3e-08   
gb|KFM14078.1|  F-box/LRR-repeat protein 13                           62.0    3e-08   
ref|XP_001812041.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  61.6    3e-08   
ref|XP_008193982.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  61.6    3e-08   
ref|XP_006200684.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  61.2    3e-08   
ref|XP_010778984.1|  PREDICTED: F-box/LRR-repeat protein 14-like      62.0    3e-08   
ref|XP_008193983.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  61.6    3e-08   
ref|XP_011347997.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  61.6    3e-08   
ref|XP_004074238.1|  PREDICTED: F-box/LRR-repeat protein 2            61.6    3e-08   
dbj|BAB28039.1|  unnamed protein product                              61.6    3e-08   
emb|CDS16257.1|  fbxl20                                               61.6    3e-08   
dbj|GAN09211.1|  hypothetical protein MAM1_0250c08733                 61.6    3e-08   
ref|XP_004279749.1|  PREDICTED: F-box/LRR-repeat protein 2 isoform 2  61.2    3e-08   
gb|ELT99813.1|  hypothetical protein CAPTEDRAFT_133834                61.2    3e-08   
ref|XP_004240354.1|  PREDICTED: F-box protein At3g58530               61.2    3e-08   
ref|XP_009081836.1|  PREDICTED: F-box/LRR-repeat protein 2            60.8    3e-08   
ref|XP_004377400.1|  PREDICTED: F-box/LRR-repeat protein 2            61.2    3e-08   
ref|XP_004548103.1|  PREDICTED: F-box/LRR-repeat protein 20-like      61.6    3e-08   
ref|XP_008035164.1|  RNI-like protein                                 62.0    3e-08   
ref|XP_004409031.1|  PREDICTED: F-box/LRR-repeat protein 2 isoform 2  61.2    3e-08   
ref|XP_006172021.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  60.8    3e-08   
ref|XP_006172019.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  61.2    3e-08   
dbj|BAG57520.1|  unnamed protein product                              61.2    4e-08   
ref|XP_005301877.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  61.6    4e-08   
ref|XP_008160942.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  61.6    4e-08   
ref|NP_082425.1|  F-box/LRR-repeat protein 20                         61.6    4e-08   
gb|KFP73034.1|  F-box/LRR-repeat protein 2                            60.8    4e-08   
ref|XP_006247483.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  61.2    4e-08   
ref|XP_006890675.1|  PREDICTED: F-box/LRR-repeat protein 2            61.2    4e-08   
emb|CDX96592.1|  BnaA08g21350D                                        61.2    4e-08   
ref|XP_002017043.1|  GL22080                                          62.0    4e-08   
ref|XP_007447755.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  61.2    4e-08   
ref|XP_006534362.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  61.2    4e-08   
ref|XP_009110186.1|  PREDICTED: F-box protein SKP2A                   61.2    4e-08   
ref|XP_003968885.1|  PREDICTED: F-box/LRR-repeat protein 20-like      61.2    4e-08   
ref|XP_001652226.1|  AAEL006797-PA                                    61.6    4e-08   
ref|XP_001994207.1|  GH23468                                          62.0    4e-08   
ref|XP_010197160.1|  PREDICTED: F-box/LRR-repeat protein 2            60.1    4e-08   
ref|XP_001359268.2|  GA18044                                          62.0    4e-08   
dbj|BAD90157.1|  mKIAA4147 protein                                    61.6    4e-08   
ref|XP_003781826.1|  PREDICTED: F-box/LRR-repeat protein 2 isoform 2  60.8    4e-08   
ref|XP_009554979.1|  PREDICTED: F-box/LRR-repeat protein 20           61.2    4e-08   
ref|XP_008766332.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  61.2    4e-08   
ref|XP_011506238.1|  PREDICTED: F-box/LRR-repeat protein 14-like      61.6    4e-08   
ref|XP_004676398.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  61.2    4e-08   
ref|XP_011053674.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  61.2    4e-08   
gb|KFP30490.1|  F-box/LRR-repeat protein 2                            60.1    4e-08   
ref|XP_006189316.1|  PREDICTED: F-box/LRR-repeat protein 2            60.8    4e-08   
ref|XP_004822225.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  60.8    4e-08   
ref|XP_542692.2|  PREDICTED: F-box/LRR-repeat protein 2               61.2    4e-08   
ref|XP_011353333.1|  PREDICTED: F-box/LRR-repeat protein 2            61.2    4e-08   
ref|XP_008766333.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  61.2    4e-08   
gb|EPB83733.1|  hypothetical protein HMPREF1544_09527                 61.2    4e-08   



>ref|XP_009801071.1| PREDICTED: EIN3-binding F-box protein 1 [Nicotiana sylvestris]
Length=669

 Score =   197 bits (500),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 126/154 (82%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GL P VQSC+AGLVKVNLSGC+NVTDK++SAI +LHG +LE LN++GC  VTDA+L
Sbjct  518  ITDEGLFPLVQSCEAGLVKVNLSGCVNVTDKSVSAITELHGGSLEFLNVDGCKYVTDATL  577

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AI++ C +L +LD+SK  ++D GIA+LAG  A+Q +LQILSLSGC + S+K LP+L KL
Sbjct  578  VAISNNCWLLSELDLSKCGITDSGIASLAG--AVQLNLQILSLSGCSMLSNKSLPFLQKL  635

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLNIQ+C GIS   VDLL+E+LWRCDIL+
Sbjct  636  GQTLMGLNIQHCNGISSSAVDLLLEQLWRCDILA  669



>ref|XP_009614726.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana tomentosiformis]
Length=669

 Score =   196 bits (497),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 126/154 (82%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GL P +QSC+AGLVK+NLSGC+NVTDK++SAI +LHG +LE LN++GC  VTDA+L
Sbjct  518  ITDEGLFPLMQSCEAGLVKMNLSGCVNVTDKSVSAITELHGGSLEFLNVDGCRYVTDATL  577

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AI++ C +L +LD+SK  ++D GIA+LAG  A+Q +LQILSLSGC + SDK LP+L KL
Sbjct  578  VAISNNCWLLSELDLSKCGITDSGIASLAG--AVQLNLQILSLSGCSMLSDKSLPFLQKL  635

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLNIQ+C GIS   VDLL+E+LWRCDIL+
Sbjct  636  GQTLMGLNIQHCNGISSSAVDLLLEQLWRCDILA  669



>emb|CDP13516.1| unnamed protein product [Coffea canephora]
Length=540

 Score =   190 bits (483),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 122/153 (80%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLLP V+S +AGLVKVNLSGC+N+TDK  +AIAKLHG TLE LNL+GC CVTDA+L
Sbjct  389  ITDEGLLPLVESSEAGLVKVNLSGCVNLTDKVTAAIAKLHGCTLEELNLDGCKCVTDATL  448

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA++CS+L +LD+SKSR++D G AALAG  A Q  L+ILSLSGC L S++ L  + KL
Sbjct  449  FAIAEHCSLLSELDVSKSRITDAGTAALAG--ADQLCLRILSLSGCNLVSNRGLLSVEKL  506

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLNIQ+C G+    +DLL ERLWRCDIL
Sbjct  507  GQTLMGLNIQHCYGVKSDALDLLAERLWRCDIL  539



>ref|XP_006364926.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=669

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 125/154 (81%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD GL P VQSC+AGLVKVNLSGC+NVTD+++S I +LHG +LE LN++ C  VTDA+L
Sbjct  518  VTDEGLFPLVQSCEAGLVKVNLSGCVNVTDRSVSFITELHGGSLESLNVDECPYVTDATL  577

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AI++ C +L++LDISK  ++D GIA+LA  S ++ +LQILSLSGC + SDK +P+L KL
Sbjct  578  LAISNNCWLLKELDISKCGITDSGIASLA--STVRLNLQILSLSGCSMLSDKSVPFLQKL  635

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLNIQ+C G+S R VDLL+E+LWRCDILS
Sbjct  636  GQTLVGLNIQHCNGVSSRCVDLLLEQLWRCDILS  669



>ref|XP_009376923.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 121/154 (79%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G LP V++C+AGLVKVNLSGC+N+TDK +S++A LHG TLE+LNL GC  V+DA L
Sbjct  496  ITDVGFLPLVENCEAGLVKVNLSGCVNLTDKVVSSMAGLHGWTLEVLNLEGCRMVSDAGL  555

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
            AAIA  C++L DLD+S+  ++DFGIA+L  G A Q +LQILS+SGC L SDK LP L K+
Sbjct  556  AAIAGNCTLLSDLDVSRCAITDFGIASL--GHADQLNLQILSVSGCPLVSDKSLPALVKM  613

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+Q+C  IS   VD LVE+LWRCDILS
Sbjct  614  GQTLHGLNLQHCNAISSSTVDRLVEQLWRCDILS  647



>ref|XP_009376911.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=651

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 121/154 (79%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G LP V++C+AGLVKVNLSGC+N+TDK +S++A LHG TLE+LNL GC  V+DA L
Sbjct  500  ITDVGFLPLVENCEAGLVKVNLSGCVNLTDKVVSSMAGLHGWTLEVLNLEGCRMVSDAGL  559

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
            AAIA  C++L DLD+S+  ++DFGIA+L  G A Q +LQILS+SGC L SDK LP L K+
Sbjct  560  AAIAGNCTLLSDLDVSRCAITDFGIASL--GHADQLNLQILSVSGCPLVSDKSLPALVKM  617

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+Q+C  IS   VD LVE+LWRCDILS
Sbjct  618  GQTLHGLNLQHCNAISSSTVDRLVEQLWRCDILS  651



>ref|XP_006483363.1| PREDICTED: EIN3-binding F-box protein 1-like [Citrus sinensis]
 gb|KDO61730.1| hypothetical protein CISIN_1g006426mg [Citrus sinensis]
Length=645

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 122/154 (79%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD G LP ++SC+AGL KVNLSGC+N+TDK +S +A+LHG TLE+LNL+GC  ++DASL
Sbjct  494  VTDAGFLPVLESCEAGLAKVNLSGCVNLTDKVVSTMAELHGWTLEMLNLDGCRKISDASL  553

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIAD C +L DLD+SK  V+DFGIA+LA G+ +  +LQILSLSGC + SDK L  L KL
Sbjct  554  MAIADNCPLLCDLDVSKCAVTDFGIASLAHGNYL--NLQILSLSGCSMVSDKSLGALRKL  611

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+Q+C  IS   VD+LVE+LWRCD+LS
Sbjct  612  GQTLLGLNLQHCNAISTNSVDMLVEQLWRCDVLS  645



>ref|XP_006450435.1| hypothetical protein CICLE_v10007708mg [Citrus clementina]
 gb|ESR63675.1| hypothetical protein CICLE_v10007708mg [Citrus clementina]
Length=645

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 122/154 (79%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD G LP ++SC+AGL KVNLSGC+N+TDK +S +A+LHG TLE+LNL+GC  ++DASL
Sbjct  494  VTDAGFLPVLESCEAGLAKVNLSGCVNLTDKVVSTMAELHGWTLEMLNLDGCRKISDASL  553

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIAD C +L DLD+SK  V+DFGIA+LA G+ +  +LQILSLSGC + SDK L  L KL
Sbjct  554  MAIADNCPLLCDLDVSKCAVTDFGIASLAHGNYL--NLQILSLSGCSMVSDKSLGALRKL  611

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+Q+C  IS   VD+LVE+LWRCD+LS
Sbjct  612  GQTLLGLNLQHCNAISTNSVDMLVEQLWRCDVLS  645



>ref|XP_010048202.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
 gb|KCW80383.1| hypothetical protein EUGRSUZ_C01744 [Eucalyptus grandis]
Length=643

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 120/154 (78%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLL  ++ C+AGLVKVNLSGCIN+TD+ +SA+AKLHG TLE+L L+GC  V+D  L
Sbjct  492  ITDEGLLRLLECCEAGLVKVNLSGCINLTDQVVSAMAKLHGRTLEVLILDGCTKVSDLGL  551

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA+ C +L DLD+SK  +SDFG+ ALA  S  Q SLQ+LS+SGC L SDKCLP L K+
Sbjct  552  LAIAENCQLLSDLDVSKCAISDFGLMALARSS--QLSLQVLSVSGCSLVSDKCLPALKKV  609

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+Q+C  IS R VDLL+E LWRCDIL+
Sbjct  610  GRTLLGLNLQHCTAISTRSVDLLLEELWRCDILA  643



>ref|XP_008219497.1| PREDICTED: LOW QUALITY PROTEIN: EIN3-binding F-box protein 1-like 
[Prunus mume]
Length=630

 Score =   185 bits (470),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 120/154 (78%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G LP +++C+AGLVKVNLSGC+NVTDK +S++AKLHG TLE++NL GC  ++DA L
Sbjct  479  ITDAGFLPLLENCEAGLVKVNLSGCVNVTDKMVSSMAKLHGWTLEMVNLEGCKMISDAGL  538

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA  C +L DLD+S+  ++DFGIA+LA   A Q +LQIL++SGC L SDK LP L K+
Sbjct  539  VAIAGNCPLLSDLDVSRCAITDFGIASLA--CADQLNLQILAMSGCPLVSDKSLPALVKM  596

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+Q+C  IS   VD LVE+LWRCDILS
Sbjct  597  GQTLLGLNLQHCKAISSSTVDRLVEQLWRCDILS  630



>ref|XP_010696236.1| PREDICTED: EIN3-binding F-box protein 1 [Beta vulgaris subsp. 
vulgaris]
Length=641

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 119/156 (76%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAG--LVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDA  175
            +TD GLL  ++SCDAG  LVKV LSGC+NVTD  + A+AK HG TLE+LNL GCG VTDA
Sbjct  488  ITDAGLLSLIESCDAGAGLVKVGLSGCVNVTDNVVIALAKYHGGTLEVLNLEGCGKVTDA  547

Query  176  SLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLH  355
             L AIAD C VL +LD+SK  ++DFG+A LA   + Q SLQILSLSGC + SDKCLP+L 
Sbjct  548  GLVAIADDCLVLNELDVSKCAITDFGVATLA--RSKQLSLQILSLSGCSMLSDKCLPFLV  605

Query  356  KLGNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            KLG SL G+N+QNC  IS   +D+LV RL+RCDILS
Sbjct  606  KLGQSLMGMNLQNCNSISSSVIDMLVGRLFRCDILS  641



>ref|XP_011020134.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=656

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 121/154 (79%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G+LP ++SC+AGLVKVNLSGC+++TD+ +SA+A+LHG TLELLNL+GC  +TDASL
Sbjct  505  ITDSGILPLLESCEAGLVKVNLSGCMSLTDEVVSALARLHGGTLELLNLDGCRKITDASL  564

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA+ C  L DLD+SK  V+D GIA ++  SA Q +LQ+LSLSGC   S+K LP L K+
Sbjct  565  VAIAENCLFLSDLDLSKCAVTDSGIAVMS--SAEQLNLQVLSLSGCSEVSNKSLPCLKKM  622

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+QNC  IS   V+LLVE LWRCDILS
Sbjct  623  GRTLVGLNLQNCSSISSSTVELLVESLWRCDILS  656



>ref|XP_007225116.1| hypothetical protein PRUPE_ppa002673mg [Prunus persica]
 gb|EMJ26315.1| hypothetical protein PRUPE_ppa002673mg [Prunus persica]
Length=646

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 119/154 (77%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G LP +++C+AGLVKVNLSGC+NVTDK +S++AKLHG TLE++NL GC  ++DA L
Sbjct  495  ITDAGFLPLLENCEAGLVKVNLSGCVNVTDKMVSSMAKLHGWTLEMVNLEGCKMISDAGL  554

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AI   C +L DLD+S+  ++DFGIA+LA   A Q +LQIL++SGC L SDK LP L K+
Sbjct  555  VAITGNCPLLSDLDVSRCAITDFGIASLA--CADQLNLQILAMSGCPLVSDKSLPALVKM  612

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+Q+C  IS   VD LVE+LWRCDILS
Sbjct  613  GQTLLGLNLQHCKAISSSTVDRLVEQLWRCDILS  646



>gb|AFT92041.1| EIN3 binding F-box 1 [Malus domestica]
Length=646

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 121/154 (79%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G LP V++C+AGLVKVNLSGC+N+TDK +S++A LHG T+E+LNL GC  V+DA L
Sbjct  495  ITDVGFLPLVENCEAGLVKVNLSGCVNLTDKVVSSMADLHGWTMEVLNLEGCRLVSDAGL  554

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
            AAIA  C++L DLD+S+  +++FGIA+LA   A Q +LQ+LS+SGC L SDK LP L K+
Sbjct  555  AAIAGNCTLLSDLDVSRCAITNFGIASLA--HADQLNLQMLSISGCPLVSDKSLPALVKM  612

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+Q+C  IS   VD LVE+LWRCDILS
Sbjct  613  GQTLLGLNLQHCNAISSSTVDRLVEQLWRCDILS  646



>gb|KCW81401.1| hypothetical protein EUGRSUZ_C02778 [Eucalyptus grandis]
Length=635

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 117/153 (76%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD   +P +++CD GLVK+N+SGC N+TDK ISA+A++HG TLE+LNL GC  V + SL
Sbjct  484  VTDASFIPLLENCDGGLVKINVSGCSNLTDKAISAVAEMHGWTLEVLNLEGCRKVGNTSL  543

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA+ C +L DLD+S   V+DFG+AALA   A Q +LQILSLSGC   S+KCLP L KL
Sbjct  544  VAIAENCPLLNDLDVSLCAVTDFGVAALA--RADQLNLQILSLSGCTEISEKCLPALRKL  601

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G  L GLN+Q+C GIS + VDLLVE+LWRCDIL
Sbjct  602  GQLLVGLNLQHCSGISKKSVDLLVEQLWRCDIL  634



>ref|XP_010048972.1| PREDICTED: LOW QUALITY PROTEIN: EIN3-binding F-box protein 1-like 
[Eucalyptus grandis]
Length=653

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 117/153 (76%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD   +P +++CD GLVK+N+SGC N+TDK ISA+A++HG TLE+LNL GC  V + SL
Sbjct  502  VTDASFIPLLENCDGGLVKINVSGCSNLTDKAISAVAEMHGWTLEVLNLEGCRKVGNTSL  561

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA+ C +L DLD+S   V+DFG+AALA   A Q +LQILSLSGC   S+KCLP L KL
Sbjct  562  VAIAENCPLLNDLDVSLCAVTDFGVAALA--RADQLNLQILSLSGCTEISEKCLPALRKL  619

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G  L GLN+Q+C GIS + VDLLVE+LWRCDIL
Sbjct  620  GQLLVGLNLQHCSGISKKSVDLLVEQLWRCDIL  652



>ref|NP_001234864.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
 gb|ABC24972.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
 gb|ACS44349.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
Length=665

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 123/154 (80%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD GL P VQSC+AGLVKVNLSGC+NVTD+++S I +LHG +LE LN++ C  VTD +L
Sbjct  514  VTDEGLFPLVQSCEAGLVKVNLSGCVNVTDRSVSFITELHGGSLESLNVDECRYVTDMTL  573

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AI++ C +L++LD+SK  ++D G+A+LA  S ++ +LQILSLSGC + SDK +P+L KL
Sbjct  574  LAISNNCWLLKELDVSKCGITDSGVASLA--STVRLNLQILSLSGCSMLSDKSVPFLQKL  631

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLNIQ+C G+S   VDLL+E+LWRCDILS
Sbjct  632  GQTLMGLNIQHCNGVSSSCVDLLLEQLWRCDILS  665



>gb|KDP32417.1| hypothetical protein JCGZ_13342 [Jatropha curcas]
Length=651

 Score =   183 bits (465),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 120/154 (78%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLLP ++SC+AGLVKVNLSGC+++TD+ +S +A+LHG TLELLNL+GC  +TD+S+
Sbjct  500  ITDSGLLPLLESCEAGLVKVNLSGCMSLTDEVVSVLARLHGGTLELLNLDGCRKITDSSV  559

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
            AAIA  C  L DLD+SK  V+D GIA LA  SA Q +LQ+LSLSGC   S+K  P+L KL
Sbjct  560  AAIARGCLFLSDLDLSKCAVTDSGIAVLA--SADQLNLQVLSLSGCSEVSNKSFPFLKKL  617

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+Q+C  IS   VDLLVE LWRCDILS
Sbjct  618  GRTLLGLNLQHCSAISSSTVDLLVENLWRCDILS  651



>ref|XP_002325221.1| hypothetical protein POPTR_0018s13070g [Populus trichocarpa]
 gb|EEF03786.1| hypothetical protein POPTR_0018s13070g [Populus trichocarpa]
Length=632

 Score =   183 bits (464),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 120/154 (78%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLLP ++SC+AGLVKVNLSGC+++TD+ +SA+A+LHG TLELLNL+GC  +TDASL
Sbjct  481  ITDAGLLPLLESCEAGLVKVNLSGCLSLTDEVVSALARLHGGTLELLNLDGCRKITDASL  540

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA+ C  L DLD+SK  V+D GI  L+  SA Q +LQ+LSLSGC   S+K LP L K+
Sbjct  541  LAIAENCLFLSDLDVSKCAVTDSGITILS--SAEQLNLQVLSLSGCSEVSNKILPCLKKM  598

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+QNC  IS   V+LLVE LWRCDILS
Sbjct  599  GRTLVGLNLQNCSSISSSTVELLVESLWRCDILS  632



>ref|XP_011017769.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=655

 Score =   183 bits (465),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 120/154 (78%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLLP ++SC+AGLVKVNLSGC+++TD+ +SA+A+LHG TLELLNL+GC  +TDASL
Sbjct  504  ITDAGLLPLLESCEAGLVKVNLSGCLSLTDEVVSALARLHGGTLELLNLDGCRKITDASL  563

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA+ C  L DLD+SK  V+D GI  L+  SA Q +LQ+LSLSGC   S+K LP L K+
Sbjct  564  LAIAENCLFLSDLDVSKCAVTDSGITMLS--SAEQLNLQVLSLSGCSEVSNKILPCLKKM  621

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+QNC  IS   V+LLVE LWRCDILS
Sbjct  622  GRTLVGLNLQNCCSISSSTVELLVESLWRCDILS  655



>ref|XP_010250120.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=671

 Score =   183 bits (464),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 118/154 (77%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLLP V++C+ GLVKVNLSGC+N+TD  ++ +AK HG TL+LLNL+GC  +TDASL
Sbjct  520  ITDAGLLPLVENCEPGLVKVNLSGCLNLTDAVVTTMAKHHGGTLQLLNLDGCRKITDASL  579

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA+ CSVLRDLDISK  ++D G+AA++  SA    LQILSLSGC   SDK +P+L  L
Sbjct  580  IAIANNCSVLRDLDISKCVITDLGVAAMS--SANLLDLQILSLSGCYQVSDKSMPFLKSL  637

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+Q C  IS   ++LL+E LWRCDILS
Sbjct  638  GQNLVGLNLQQCNSISSSTIELLMEHLWRCDILS  671



>ref|XP_008394083.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
 ref|XP_008352056.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=646

 Score =   183 bits (464),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 120/154 (78%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G LP V++C+AGLVKVNLSGC+N+TDK +S++A LHG TL+ +NL GC  V+DA L
Sbjct  495  ITDAGFLPLVENCEAGLVKVNLSGCVNLTDKVVSSLADLHGWTLKAVNLEGCRRVSDAGL  554

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
            AAIA  C++L DLD+SK  ++DFGIA+LA   A Q +LQILS+SGC L SDK LP L K+
Sbjct  555  AAIAGNCTLLSDLDVSKCAITDFGIASLA--HADQLNLQILSVSGCPLVSDKSLPALVKI  612

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+Q+C  IS   VD LVE+LWRCDILS
Sbjct  613  GQTLLGLNLQHCNAISSSTVDRLVEQLWRCDILS  646



>ref|XP_008365190.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X1 [Malus 
domestica]
Length=646

 Score =   183 bits (464),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 120/154 (78%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G LP V++C+AGLVKVNLSGC+N+TDK +S++A LHG T+E+LNL GC  V+DA L
Sbjct  495  ITDVGFLPLVENCEAGLVKVNLSGCVNLTDKVVSSMADLHGWTMEVLNLEGCRLVSDAGL  554

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
            AAIA  C++L DLD+S+  +++FGIA+LA   A Q +LQ LS+SGC L SDK LP L K+
Sbjct  555  AAIAGNCTLLSDLDVSRCAITNFGIASLA--HADQLNLQXLSISGCPLVSDKSLPALVKM  612

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+Q+C  IS   VD LVE+LWRCDILS
Sbjct  613  GQTLLGLNLQHCNAISSSTVDRLVEQLWRCDILS  646



>ref|XP_009355743.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=646

 Score =   182 bits (463),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 121/154 (79%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G LP V++C+AGLVKVNLSGC+N+TDK +S++A LHG TLE++NL+GC  V+DA L
Sbjct  495  ITDAGFLPLVENCEAGLVKVNLSGCVNLTDKVVSSLADLHGWTLEVVNLDGCRRVSDAGL  554

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
            AAIA  C++L DLD+SK  ++DFGIA+LA   A   +LQILS+SGC L SDK LP L K+
Sbjct  555  AAIAGNCTLLSDLDVSKCAITDFGIASLA--HADLLNLQILSVSGCPLVSDKSLPALVKM  612

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+Q+C  IS   VD LVE+LWRCDILS
Sbjct  613  GQTLLGLNLQHCNAISSSTVDRLVEQLWRCDILS  646



>ref|XP_008378375.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X1 [Malus 
domestica]
Length=646

 Score =   182 bits (463),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 120/154 (78%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G LP V++C+AGLVKVNLSGC+N+TDK +S++A LHG T+E+LNL GC  V+DA L
Sbjct  495  ITDVGFLPLVENCEAGLVKVNLSGCVNLTDKVVSSMADLHGWTMEVLNLEGCRLVSDAGL  554

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
            AAIA  C++L DLD+S+  +++FGIA+LA   A Q +LQ LS+SGC L SDK LP L K+
Sbjct  555  AAIAGNCTLLSDLDVSRCAITNFGIASLA--HADQLNLQXLSISGCPLVSDKSLPALVKM  612

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+Q+C  IS   VD LVE+LWRCDILS
Sbjct  613  GQTLLGLNLQHCNAISSSTVDRLVEQLWRCDILS  646



>ref|XP_008378376.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X2 [Malus 
domestica]
Length=694

 Score =   183 bits (464),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 120/154 (78%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G LP V++C+AGLVKVNLSGC+N+TDK +S++A LHG T+E+LNL GC  V+DA L
Sbjct  543  ITDVGFLPLVENCEAGLVKVNLSGCVNLTDKVVSSMADLHGWTMEVLNLEGCRLVSDAGL  602

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
            AAIA  C++L DLD+S+  +++FGIA+LA   A Q +LQ LS+SGC L SDK LP L K+
Sbjct  603  AAIAGNCTLLSDLDVSRCAITNFGIASLA--HADQLNLQXLSISGCPLVSDKSLPALVKM  660

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+Q+C  IS   VD LVE+LWRCDILS
Sbjct  661  GQTLLGLNLQHCNAISSSTVDRLVEQLWRCDILS  694



>ref|XP_008365191.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X2 [Malus 
domestica]
Length=694

 Score =   183 bits (464),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 120/154 (78%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G LP V++C+AGLVKVNLSGC+N+TDK +S++A LHG T+E+LNL GC  V+DA L
Sbjct  543  ITDVGFLPLVENCEAGLVKVNLSGCVNLTDKVVSSMADLHGWTMEVLNLEGCRLVSDAGL  602

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
            AAIA  C++L DLD+S+  +++FGIA+LA   A Q +LQ LS+SGC L SDK LP L K+
Sbjct  603  AAIAGNCTLLSDLDVSRCAITNFGIASLA--HADQLNLQXLSISGCPLVSDKSLPALVKM  660

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+Q+C  IS   VD LVE+LWRCDILS
Sbjct  661  GQTLLGLNLQHCNAISSSTVDRLVEQLWRCDILS  694



>ref|XP_007161212.1| hypothetical protein PHAVU_001G051300g [Phaseolus vulgaris]
 gb|ESW33206.1| hypothetical protein PHAVU_001G051300g [Phaseolus vulgaris]
Length=643

 Score =   182 bits (462),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 120/154 (78%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD GLLP ++S +AGLVKVNLSGC NVTDK +S++A LHG TLE LNL+GC  ++DASL
Sbjct  492  VTDAGLLPVLESSEAGLVKVNLSGCTNVTDKVVSSLANLHGWTLENLNLDGCKNISDASL  551

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA+ C++L DLD+SK  ++D GIAALA   A Q +LQILSLSGC L SD+ LP L K+
Sbjct  552  MAIAENCALLCDLDVSKCSITDAGIAALA--HAQQINLQILSLSGCALVSDRSLPALRKV  609

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLNIQ+C  I+   VD+LVE LWRCDILS
Sbjct  610  GRTLLGLNIQHCNAINSSTVDMLVELLWRCDILS  643



>ref|XP_011078374.1| PREDICTED: EIN3-binding F-box protein 1-like [Sesamum indicum]
Length=647

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 118/154 (77%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLLP ++SC+ GL KVNLS C N+TD+ + A+A+LHGETLELLNL+GC  +TDASL
Sbjct  496  ITDAGLLPLLESCETGLAKVNLSDCSNLTDEVVLALARLHGETLELLNLDGCQKITDASL  555

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
            AA+A+ C +L DLD+SK  ++D G+ AL+ GS  Q +LQILS SGC + S+KC P L +L
Sbjct  556  AALAESCPLLNDLDVSKCSITDTGVVALSHGS--QHNLQILSFSGCSMISNKCRPALEQL  613

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+Q+C  IS   ++LL E LWRCDILS
Sbjct  614  GRTLVGLNLQHCNSISSNSIELLTENLWRCDILS  647



>ref|XP_002308982.2| hypothetical protein POPTR_0006s06770g [Populus trichocarpa]
 gb|EEE92505.2| hypothetical protein POPTR_0006s06770g [Populus trichocarpa]
Length=656

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 120/154 (78%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G+LP ++SC+AGLVKVNLSGC+++TD+ +SA+A+LHG TLELLNL+GC  +TDASL
Sbjct  505  ITDSGILPLLESCEAGLVKVNLSGCMSLTDEVVSALARLHGGTLELLNLDGCRKITDASL  564

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA+ C  L DLD+SK  V+D GIA ++  SA Q +LQ+LSLSGC   S+K LP L K+
Sbjct  565  VAIAENCLFLSDLDLSKCAVTDSGIAVMS--SAEQLNLQVLSLSGCSEVSNKSLPCLKKM  622

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+Q C  IS   V+LLVE LWRCDILS
Sbjct  623  GRTLVGLNLQKCSSISSSTVELLVESLWRCDILS  656



>ref|XP_010254418.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=673

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 117/153 (76%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G+LP +++ + GLVKVNLSGC+N+TD  ++ +A+LHGETL+LLNL+GC  +TDASL
Sbjct  522  ITDAGILPLIENSELGLVKVNLSGCMNLTDVVVTTMARLHGETLQLLNLDGCRKITDASL  581

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA  C VLRDLDISK  ++DFGI AL+  S  Q  LQILSLSGC+  SDK +P+L  +
Sbjct  582  MAIASNCLVLRDLDISKCAITDFGIVALS--STKQLDLQILSLSGCLHVSDKSMPFLKNM  639

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLN+Q C  IS   +++LVE LWRCDIL
Sbjct  640  GQNLVGLNLQRCNSISSSTIEILVEHLWRCDIL  672



>ref|XP_003588766.1| Ein3-binding f-box protein [Medicago truncatula]
 gb|AES59017.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=643

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 119/154 (77%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD GLLP ++S +AGLVKVNLSGC+N+TDK +S++  LHG TLE+LNL GC  +++ASL
Sbjct  492  VTDAGLLPLLESSEAGLVKVNLSGCVNLTDKVVSSLVNLHGWTLEILNLEGCINISNASL  551

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
            AAIA++C +L DLD S   +SD GI ALA   A Q +LQILSLSGC L +D+ LP L KL
Sbjct  552  AAIAEHCQLLCDLDFSMCTISDSGITALA--HAKQINLQILSLSGCTLVTDRSLPALRKL  609

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G++L GLNIQ+C  IS   V++LVE LWRCDILS
Sbjct  610  GHTLLGLNIQHCNSISSSAVEMLVEHLWRCDILS  643



>ref|XP_002285126.1| PREDICTED: EIN3-binding F-box protein 1-like [Vitis vinifera]
Length=667

 Score =   181 bits (458),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 122/153 (80%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +T+ G LP ++SC+A L+KVNLSGC+N+TD  +SA+AK+HG TLE LNL+GC  +TDAS+
Sbjct  516  ITNAGFLPLLESCEASLIKVNLSGCMNLTDNVVSALAKVHGGTLEQLNLDGCQKITDASM  575

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA+ C++L DLD+SK+ ++D+G+AALA  SA   ++QILSLSGC L S++ +P+L KL
Sbjct  576  FAIAENCALLSDLDVSKTAITDYGVAALA--SAKHLNVQILSLSGCSLISNQSVPFLRKL  633

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLN+Q C  IS   V++LVE+LWRCDIL
Sbjct  634  GQTLLGLNLQQCNTISSSMVNMLVEQLWRCDIL  666



>ref|XP_004498740.1| PREDICTED: EIN3-binding F-box protein 1-like [Cicer arietinum]
Length=641

 Score =   180 bits (457),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 119/154 (77%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            V D GLLP ++S +AGL+KVNLSGC+N+TDK +S++  LHG TLELLNL GC  +++ASL
Sbjct  490  VNDAGLLPLLESSEAGLIKVNLSGCVNLTDKVVSSLVNLHGWTLELLNLEGCKNISNASL  549

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA++C +L DLD+S   +SD GIA+LA   A Q +LQ+LSLSGC L +D+ LP L KL
Sbjct  550  VAIAEHCQLLSDLDVSMCAISDAGIASLA--HAKQLNLQVLSLSGCTLVTDRSLPALRKL  607

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G++L GLNIQ+C  IS   V++LVE LWRCDILS
Sbjct  608  GHTLLGLNIQHCNSISSSAVEMLVELLWRCDILS  641



>gb|KDP33594.1| hypothetical protein JCGZ_07165 [Jatropha curcas]
Length=645

 Score =   180 bits (456),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 119/154 (77%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD G +P +++C+AGLVKVNLSGC+N+TDK +SA+ + HG TLE+LNL+GCG +TD SL
Sbjct  494  VTDAGFIPLLENCEAGLVKVNLSGCVNLTDKVVSALTEQHGWTLEVLNLDGCGKITDESL  553

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA+ C +L DLD+SK  +SD G+  LA   + Q +LQI S++GC + SDK LP + K+
Sbjct  554  TAIAENCLMLSDLDVSKCAISDSGLMVLA--RSNQLNLQIFSVAGCSMISDKSLPAIVKM  611

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G++L GLNIQ+C  IS   VDLLVERLWRCDILS
Sbjct  612  GHTLLGLNIQHCNAISSSTVDLLVERLWRCDILS  645



>ref|XP_002524506.1| grr1, plant, putative [Ricinus communis]
 gb|EEF37946.1| grr1, plant, putative [Ricinus communis]
Length=648

 Score =   180 bits (456),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 118/154 (77%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLLP ++S +AGLVKVNLSGC+N+TD+ ISA+A++HG +LELLNL+GC  +TDASL
Sbjct  497  ITDSGLLPLLESSEAGLVKVNLSGCMNLTDEVISALARIHGGSLELLNLDGCRKITDASL  556

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AI   C  L DLD+SK  V+D GIA L+  SA + +LQ+LSLSGC   S+K  P+L KL
Sbjct  557  KAITHNCLFLSDLDVSKCAVTDSGIATLS--SADRLNLQVLSLSGCSEVSNKSFPFLKKL  614

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+QNC  IS   V+LLVE LWRCDILS
Sbjct  615  GRTLMGLNLQNCSSISSNTVELLVESLWRCDILS  648



>ref|XP_007013466.1| Ein3-binding f-box protein 4 [Theobroma cacao]
 gb|EOY31085.1| Ein3-binding f-box protein 4 [Theobroma cacao]
Length=692

 Score =   180 bits (456),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 118/153 (77%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLLP ++SC+AGLVKVNLSGC+N+TD+ + A+ +LHG TLELLNL+GC  +TDASL
Sbjct  541  ITDAGLLPLLESCEAGLVKVNLSGCLNLTDEVVLALTRLHGGTLELLNLDGCRRITDASL  600

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             A+AD C  L DLD+S+  ++D G+AAL+   A Q +LQ+LS SGC   S+K +P+L KL
Sbjct  601  VAVADNCVFLSDLDVSRCAITDSGVAALS--HAEQLNLQVLSFSGCSGVSNKSMPFLKKL  658

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLN+Q+C  IS R V+LLVE LWRCD L
Sbjct  659  GKTLVGLNLQHCNSISSRTVELLVESLWRCDTL  691



>ref|XP_004508488.1| PREDICTED: EIN3-binding F-box protein 2-like [Cicer arietinum]
Length=639

 Score =   179 bits (455),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 119/154 (77%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLLP +++C+AGLVKVNL+GC N+TD  +SA+A+LHG TLELLNL+GC  +TDASL
Sbjct  488  ITDAGLLPLLENCEAGLVKVNLTGCWNLTDHIVSALARLHGGTLELLNLDGCWNITDASL  547

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
            AAIAD C +L DLD+S+  ++D GIA L+  +A   SLQ+LSLSGC   S+K  P+L  L
Sbjct  548  AAIADNCLLLNDLDVSRCAITDAGIAVLS--NANHLSLQVLSLSGCSEVSNKSSPFLTTL  605

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+QNC  IS   ++LLVE LWRCDIL+
Sbjct  606  GQTLLGLNLQNCNAISSNTIELLVENLWRCDILA  639



>gb|KJB27084.1| hypothetical protein B456_004G276800 [Gossypium raimondii]
Length=636

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 118/153 (77%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLLP ++SC+AGLVKVNLSGC+N+TDK + A+ +LHG TLELLNL+GC  +TDASL
Sbjct  485  ITDAGLLPLLESCEAGLVKVNLSGCLNITDKVVLALTRLHGGTLELLNLDGCRRITDASL  544

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA+ C  L DLD+S+S V+D G+AAL+   A Q +LQ+LS SGC   S+K L  L KL
Sbjct  545  MAIAESCVFLSDLDVSRSAVTDSGVAALS--RAEQLNLQVLSFSGCSRVSNKSLSSLKKL  602

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLN+Q+C  IS R V+LLVE LW+CDIL
Sbjct  603  GKTLLGLNLQHCNSISIRTVELLVETLWKCDIL  635



>gb|KHG15742.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=651

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 118/153 (77%), Gaps = 3/153 (2%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G+LP ++SC+AGL+KVNLSGC+N++DK +  I+ LHG TLELLNLNGC  ++DASL
Sbjct  501  ITDAGVLPLLESCEAGLLKVNLSGCVNLSDKVVQTISNLHGWTLELLNLNGCK-ISDASL  559

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AI + C +L DLDISK  ++D GIAALA  + I  +LQILS+SGC + SDK LP L KL
Sbjct  560  VAIGENCQLLTDLDISKCTITDSGIAALAHFNPI--NLQILSVSGCSMVSDKSLPSLGKL  617

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLN+Q C  IS R V+LL E+LWRCDIL
Sbjct  618  GETLLGLNLQQCKAISSRAVELLTEQLWRCDIL  650



>ref|XP_002515516.1| grr1, plant, putative [Ricinus communis]
 gb|EEF46965.1| grr1, plant, putative [Ricinus communis]
Length=651

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 117/154 (76%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD GL+P + SC AG+VKVNLSGC+N++DK +SA+ + HG TLE+LNL GC  +TDASL
Sbjct  500  VTDAGLIPLLDSCGAGMVKVNLSGCLNLSDKAVSALTEQHGWTLEVLNLEGCEKITDASL  559

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
            AAIA+ C +L +LD+SKS +SD G+  LA   + Q +LQI S SGC + SD+ LP L KL
Sbjct  560  AAIAENCFLLSELDVSKSAISDSGLMVLA--RSKQLNLQIFSASGCSMISDRSLPALVKL  617

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+Q+C  IS   +DLLVERLWRCDILS
Sbjct  618  GQTLLGLNLQHCNAISTSAIDLLVERLWRCDILS  651



>gb|KHN33913.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=644

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 119/154 (77%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD GLLP ++S +AGLVKVNLSGC N+TDK +S++A LHG TLE LNL+GC  ++DASL
Sbjct  493  VTDAGLLPLLESSEAGLVKVNLSGCTNITDKVVSSLANLHGWTLENLNLDGCKNISDASL  552

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA+ C++L DLD+SK  ++D GIA LA   A Q +LQILSLSGC L SD+ L  L KL
Sbjct  553  MAIAENCALLCDLDVSKCTITDAGIAVLA--HAEQINLQILSLSGCTLVSDRSLTALRKL  610

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G++L GLNIQ+C  I++  VD LVE LWRCDILS
Sbjct  611  GHTLLGLNIQHCNAINNSTVDTLVEFLWRCDILS  644



>gb|EYU20264.1| hypothetical protein MIMGU_mgv1a002548mg [Erythranthe guttata]
Length=660

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G+LPFVQ  DAGLVK+NLSGC N+TD  +  IAK+HGETLE+LNL+GC  VTD SL
Sbjct  509  ITDAGVLPFVQRADAGLVKLNLSGCANLTDNVVVEIAKVHGETLEVLNLDGCRFVTDVSL  568

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA  C  + +LD+S+  ++D+GIA LA   A Q SLQI S++GC L SDK L  L  L
Sbjct  569  MAIAKNCLFMSELDVSQCGITDYGIAVLA--RAEQLSLQIFSIAGCSLVSDKSLSSLGML  626

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G SL GLNIQ+C G+S+  V+LL+E+LWRCDILS
Sbjct  627  GKSLLGLNIQHCSGLSYGAVNLLLEKLWRCDILS  660



>ref|XP_003544614.1| PREDICTED: EIN3-binding F-box protein 1-like isoform 1 [Glycine 
max]
 gb|KHN13750.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=644

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 119/154 (77%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD GLLP ++S +AGLVKVNLSGC NVT+K +S++A LHG TLE LNL+GC  ++DASL
Sbjct  493  VTDAGLLPLLESSEAGLVKVNLSGCTNVTNKVVSSLANLHGWTLENLNLDGCKNISDASL  552

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA+ C++L DLD+SK  ++D GI ALA   A Q +LQ+LSLSGC L SD+ LP L +L
Sbjct  553  MAIAENCALLCDLDVSKCAITDAGIEALA--HAKQINLQVLSLSGCTLVSDRSLPALREL  610

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G++L GLNIQ+C  I+   VD LVE LWRCDILS
Sbjct  611  GHTLLGLNIQHCNAINSSTVDTLVELLWRCDILS  644



>gb|KJB54023.1| hypothetical protein B456_009G017100 [Gossypium raimondii]
Length=645

 Score =   177 bits (448),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 118/153 (77%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLLP +++C+AGLVKVNLSGC+N+TD+ +  + KLHG TLELLNLNGC  +TDASL
Sbjct  494  ITDAGLLPLLENCEAGLVKVNLSGCLNLTDEVVLHLTKLHGATLELLNLNGCRRITDASL  553

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
            AA+A+ C  L DLD+S+  ++D GIAAL+   A Q +LQ+LS SGC   S+K + +L KL
Sbjct  554  AAVAENCVFLSDLDVSRCAITDVGIAALS--HAEQLNLQVLSFSGCSGVSNKSMTFLKKL  611

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLN+Q+C  IS + ++LLVE LWRCDIL
Sbjct  612  GKTLVGLNLQHCNSISTQTIELLVESLWRCDIL  644



>ref|XP_002308665.2| grr1 family protein [Populus trichocarpa]
 gb|EEE92188.2| grr1 family protein [Populus trichocarpa]
Length=646

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 118/154 (77%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD G LP +++C+AGLVKVNLSGC+N++DK +S + + HG TLE+LNL+GC  +TDASL
Sbjct  495  VTDAGFLPVLENCEAGLVKVNLSGCVNLSDKVVSVMTEQHGWTLEVLNLDGCRRITDASL  554

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA+ C +L DLD+SK   +D GIAA+A  +  Q +LQ+LS+SGC + SDK L  L KL
Sbjct  555  VAIAENCFLLSDLDVSKCATTDSGIAAMARSN--QLNLQVLSMSGCSMISDKSLLALIKL  612

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+Q+C  IS   VD+LVERLWRCDILS
Sbjct  613  GRTLLGLNLQHCNAISSSTVDVLVERLWRCDILS  646



>ref|XP_009625259.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana tomentosiformis]
Length=646

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 121/155 (78%), Gaps = 3/155 (2%)
 Frame = +2

Query  2    VTDYGLLPFVQ-SCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDAS  178
            +TD GLLP ++ S  AGLVKVN++GC+N+TD+ + ++A+LH ETLE+LNL+GC  VTDAS
Sbjct  494  ITDAGLLPLLEMSSKAGLVKVNITGCLNLTDEVVLSLARLHSETLEVLNLDGCRKVTDAS  553

Query  179  LAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHK  358
            L AIAD C +L DLD+SK  ++D G+AAL+ G  +Q +LQILS+SGC + ++K +P L K
Sbjct  554  LVAIADNCPLLNDLDVSKCSITDSGVAALSHG--VQVNLQILSISGCSMVTNKSVPALKK  611

Query  359  LGNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            LG SL GLN+Q+C  IS   V++LVE LWRCDILS
Sbjct  612  LGESLVGLNLQHCNAISSSRVEILVEDLWRCDILS  646



>ref|XP_011069870.1| PREDICTED: EIN3-binding F-box protein 1 [Sesamum indicum]
Length=666

 Score =   175 bits (443),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 118/154 (77%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G+LP VQ+ DAGLVKVNLSG   +TD  + AI++LHGETLE+L+L+GC  +TD S+
Sbjct  515  ITDAGILPLVQNSDAGLVKVNLSGSAKLTDNVVMAISELHGETLEVLHLDGCQYITDLSM  574

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA  CSVL +LD+S+  ++D G+A LA  SA Q SLQI SL+GC L SDK LP+L  L
Sbjct  575  LAIARNCSVLSELDVSQCGITDSGVAVLA--SAEQLSLQIFSLAGCSLVSDKSLPFLVLL  632

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLNIQ+C GIS   VDLLV++LWRCDILS
Sbjct  633  GKTLVGLNIQHCRGISCGTVDLLVDQLWRCDILS  666



>ref|XP_002324298.2| hypothetical protein POPTR_0018s01710g [Populus trichocarpa]
 gb|EEF02863.2| hypothetical protein POPTR_0018s01710g [Populus trichocarpa]
Length=646

 Score =   175 bits (443),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 116/153 (76%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD G L  +++C+AGLVKVNLSGCIN++DK +S + + HG TLE+LNL+GC  +TDASL
Sbjct  495  VTDAGFLSVLENCEAGLVKVNLSGCINLSDKVVSVMTEQHGWTLEMLNLDGCRRITDASL  554

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA+ C +L DLD+SK   +D GIAA+A   + Q  LQ+LS+SGC + SDK LP L KL
Sbjct  555  VAIAENCFLLYDLDVSKCATTDSGIAAMA--RSKQLCLQVLSVSGCSMISDKSLPALVKL  612

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLN+Q+C  IS   VD+LVERLWRCDIL
Sbjct  613  GQTLLGLNLQHCNAISSSTVDILVERLWRCDIL  645



>ref|XP_007011864.1| EIN3-binding F box protein 1 [Theobroma cacao]
 gb|EOY29483.1| EIN3-binding F box protein 1 [Theobroma cacao]
Length=696

 Score =   175 bits (443),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 118/153 (77%), Gaps = 3/153 (2%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G+LP ++SC+AGLVKVNLSGC+N++DK +  +A LHG TLE++NL+GC  ++D S+
Sbjct  546  ITDAGILPLLESCEAGLVKVNLSGCVNLSDKAVCVMADLHGWTLEMINLDGCK-ISDGSV  604

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA+ C +L DLD+SK  ++D GIAALA   + Q +LQILS+SGC + SDK LP L KL
Sbjct  605  VAIAENCLLLSDLDVSKCSITDSGIAALA--RSNQINLQILSVSGCTMVSDKSLPSLGKL  662

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLN+Q C  IS   VDLLVE+LWRCDIL
Sbjct  663  GQTLLGLNLQQCKAISSSAVDLLVEQLWRCDIL  695



>gb|KHG24906.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=641

 Score =   174 bits (441),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 117/153 (76%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLLP ++SC  GL KVNLSGC+N+TD+ + A+ +LHG T+ELLNL+GC  +TDASL
Sbjct  490  ITDAGLLPLLESCKEGLAKVNLSGCLNLTDEVVLALTRLHGGTVELLNLDGCRRITDASL  549

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             A+AD C  L DLD+S+  +SD G+AAL+   A Q +LQ++S SGC+  S+K +P+L +L
Sbjct  550  VAVADNCVFLNDLDVSRCAISDSGVAALS--HAEQLNLQVVSFSGCLGVSNKSMPFLKQL  607

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLN+Q+C  IS R V+LLVE LWRCDIL
Sbjct  608  GKTLVGLNLQHCNSISARTVELLVECLWRCDIL  640



>ref|XP_004242782.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum lycopersicum]
Length=641

 Score =   174 bits (441),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLLP ++S  AGLVKVNL+ C+NVTD+ + ++A+LHGETLELLNL+GC  VTDASL
Sbjct  490  ITDAGLLPLLESSKAGLVKVNLTHCMNVTDEVVLSLARLHGETLELLNLDGCRKVTDASL  549

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIAD C +L DLD+SK  ++D G+AAL+ G  +Q +LQ+LSLSGC + ++K    L  L
Sbjct  550  VAIADNCLLLNDLDVSKCSITDSGVAALSQG--VQMNLQVLSLSGCSMVTNKSFSSLRTL  607

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G SL GLN+Q+C  I    V+ LVE LWRCDILS
Sbjct  608  GESLIGLNLQHCSSIGSSRVEALVEDLWRCDILS  641



>gb|KHG14715.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=645

 Score =   174 bits (440),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 116/153 (76%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLLP +++C+AGLVKVNLSGC+N+TD+ +  + KLHG TLELLNLNGC  +TDASL
Sbjct  494  ITDAGLLPLLENCEAGLVKVNLSGCLNLTDEVVLHLTKLHGATLELLNLNGCRRITDASL  553

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
            AA A+ C  L DLD+S   ++D GIAAL+   A Q +LQ+LS SGC   S+K + +L KL
Sbjct  554  AAAAENCVFLSDLDVSSCAITDVGIAALS--HAEQLNLQVLSFSGCSGVSNKSMTFLKKL  611

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLN+Q+C  IS + ++LLVE LWRCDIL
Sbjct  612  GKTLVGLNLQHCNSISTQTIELLVESLWRCDIL  644



>ref|XP_008362900.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=647

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 120/154 (78%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G+L  ++S + GLVKVNL+GC+N+TD+ + A+ +LHGETLE+LNL+GC  +TDASL
Sbjct  496  MTDAGVLSLLESLEEGLVKVNLNGCLNLTDEVVMALVRLHGETLEVLNLDGCRKITDASL  555

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
            A IA+ C  LR+LD+SK  ++D G+AAL+  SA Q +LQ+LS+SGC   S K LP L KL
Sbjct  556  ATIANNCLFLRELDVSKCAITDSGLAALS--SADQINLQVLSISGCSEISHKSLPSLKKL  613

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+Q+C  +S+R ++LLVE LWRCDIL+
Sbjct  614  GQTLVGLNLQHCTALSYRSIELLVESLWRCDILA  647



>gb|KJB55011.1| hypothetical protein B456_009G058000 [Gossypium raimondii]
Length=652

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 115/153 (75%), Gaps = 3/153 (2%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G LP ++SC+AGLVKVNLSGC N+ DK +  +A LHG TLE+LNL+GC  V+DA L
Sbjct  502  ITDVGFLPLLESCEAGLVKVNLSGCPNLGDKVVCKMADLHGWTLEMLNLDGCK-VSDAGL  560

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA+ C VL DLD+SK  ++D GIAALA  + I  +LQILS+SGC L SDK LP L KL
Sbjct  561  VAIAENCRVLSDLDVSKCTITDSGIAALACSNLI--NLQILSVSGCNLVSDKSLPSLGKL  618

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLN+Q C  IS   VDLLVE+LWRCDIL
Sbjct  619  GQTLLGLNLQQCKAISSGAVDLLVEQLWRCDIL  651



>gb|KJB65824.1| hypothetical protein B456_010G114900 [Gossypium raimondii]
Length=651

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 118/153 (77%), Gaps = 3/153 (2%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G+L  ++SC+AGL+KVNLSGC+N++DK +  I+ LHG TLELLNL+GC  ++DASL
Sbjct  501  ITDAGVLLLLESCEAGLLKVNLSGCVNLSDKVVQTISNLHGWTLELLNLDGCK-ISDASL  559

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA+ C +L DLDISK  ++D GIAALA  + I  +LQILS+SGC + SDK LP L KL
Sbjct  560  VAIAENCQLLTDLDISKCTITDSGIAALAHFNPI--NLQILSVSGCSMVSDKSLPSLGKL  617

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLN+Q C  IS R V+LL E+LWRCDIL
Sbjct  618  GETLLGLNLQQCKAISSRAVELLTEQLWRCDIL  650



>ref|XP_011081561.1| PREDICTED: EIN3-binding F-box protein 1-like [Sesamum indicum]
Length=669

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 115/154 (75%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G+LP VQ     LVKVNLSGC+N+TD  ++ I KLHG TLE+LNL+GC C+TD SL
Sbjct  518  ITDSGILPLVQRSGVDLVKVNLSGCVNLTDNLVAEITKLHGGTLEILNLDGCRCITDVSL  577

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA  CS+L +LD+S+ R++D GIA LAG  A Q  L++LS++GC L SDK LP+L  +
Sbjct  578  KAIARNCSLLSELDVSQCRITDSGIAILAG--AEQLFLRVLSVAGCSLVSDKSLPFLALV  635

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G SL GLNIQ+C GIS   V+ L+E LWRCDILS
Sbjct  636  GKSLVGLNIQHCCGISCGTVNQLLEHLWRCDILS  669



>ref|XP_011016246.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 115/153 (75%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G L  +++C+AGLVKVNLSGCIN++DK +  + + HG TLE+LNL+GC  +TDASL
Sbjct  495  ITDAGFLSVLENCEAGLVKVNLSGCINLSDKVVGVMTEQHGWTLEMLNLDGCKRITDASL  554

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA+ C +L DLD+SK   +D GIAA+A   + Q  LQ+LS+SGC + SDK LP L KL
Sbjct  555  VAIAENCFLLYDLDVSKCATTDSGIAAMA--RSQQLCLQVLSVSGCSMISDKSLPALVKL  612

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLN+Q+C  IS   VD+LVERLWRCDIL
Sbjct  613  GQTLLGLNLQHCNAISSSTVDILVERLWRCDIL  645



>ref|XP_011036551.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 115/153 (75%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G L  +++C+AGLVKVNLSGCIN++DK +  + + HG TLE+LNL+GC  +TDASL
Sbjct  495  ITDAGFLSVLENCEAGLVKVNLSGCINLSDKVVGVMTEQHGWTLEMLNLDGCKRITDASL  554

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA+ C +L DLD+SK   +D GIAA+A   + Q  LQ+LS+SGC + SDK LP L KL
Sbjct  555  VAIAENCFLLYDLDVSKCATTDSGIAAMA--RSQQLCLQVLSVSGCSMISDKSLPALVKL  612

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLN+Q+C  IS   VD+LVERLWRCDIL
Sbjct  613  GQTLLGLNLQHCNAISSSTVDILVERLWRCDIL  645



>ref|XP_009758784.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana sylvestris]
Length=645

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 120/155 (77%), Gaps = 3/155 (2%)
 Frame = +2

Query  2    VTDYGLLPFVQ-SCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDAS  178
            +TD GLLP ++ S  AGLVKVNL+ C+N+TD+ + ++A+LHGETLELLNL+GC  VTDAS
Sbjct  493  ITDAGLLPLLEMSSKAGLVKVNLTDCLNLTDEVVLSLARLHGETLELLNLDGCRKVTDAS  552

Query  179  LAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHK  358
            L AIA+ C +L DLD+SK  ++D G+AAL+ G  +Q +LQILS+SGC + + K +P L K
Sbjct  553  LVAIANNCPLLNDLDVSKCSITDSGVAALSHG--VQVNLQILSISGCSMVTKKSVPSLIK  610

Query  359  LGNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            LG SL GLN+Q+C  IS   V+++VE LWRCDILS
Sbjct  611  LGESLVGLNLQHCNAISSSRVEIIVEDLWRCDILS  645



>gb|KJB07737.1| hypothetical protein B456_001G042600 [Gossypium raimondii]
 gb|KJB07738.1| hypothetical protein B456_001G042600 [Gossypium raimondii]
Length=641

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 116/153 (76%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLLP ++SC  GL KVNLSGC+N+TD+ + A+ +LHG TLELLNL+G   +TDASL
Sbjct  490  ITDAGLLPLLESCREGLAKVNLSGCLNLTDEIVLALTRLHGGTLELLNLDGRPRITDASL  549

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             A+AD C  L DLD+S+  +SD G+AAL+   A Q +LQ++S SGC+  S+K +P+L +L
Sbjct  550  VAVADNCVFLSDLDVSRCAISDSGVAALS--HAEQLNLQVVSFSGCLGVSNKSMPFLKQL  607

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLN+Q+C  IS R V+LLVE LWRCDIL
Sbjct  608  GKTLVGLNLQHCNSISARTVELLVESLWRCDIL  640



>ref|XP_006358273.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=642

 Score =   172 bits (436),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLLP ++S  AGLVKVNL+ C+NVTD+ + ++A+LHGETLELLNL+GC  VTDASL
Sbjct  491  ITDAGLLPLLESSKAGLVKVNLTHCLNVTDEVVLSLARLHGETLELLNLDGCRRVTDASL  550

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIAD C +L DLD+SK  ++D G+AAL+ G  +Q +LQ+LSLSGC + ++K    L  L
Sbjct  551  VAIADNCLLLNDLDVSKCSITDSGLAALSQG--VQLNLQVLSLSGCSMVTNKSFSSLRTL  608

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G SL GLN+Q+C  I    ++ LVE LWRCDILS
Sbjct  609  GESLIGLNLQHCNAIGSSRIEALVEDLWRCDILS  642



>ref|XP_003549759.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN15084.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=639

 Score =   172 bits (436),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 117/154 (76%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLLP +++C+AGLV VNL+GC N+TDK +SA+A+LHG TLE+LNL+GC  +TDASL
Sbjct  488  ITDAGLLPLLENCEAGLVNVNLTGCWNLTDKVVSALARLHGGTLEVLNLDGCWKITDASL  547

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA+   VL DLD+SK  +SD GIA L+  S    SLQ+LSLSGC   S+K  P+L KL
Sbjct  548  VAIANNFLVLNDLDVSKCAISDAGIALLSRASLP--SLQVLSLSGCSDVSNKSAPFLTKL  605

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+QNC  I    ++LLVE+LWRCDIL+
Sbjct  606  GQTLLGLNLQNCNSIGSSTMELLVEKLWRCDILA  639



>ref|XP_004138725.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 ref|XP_004160764.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|KGN62950.1| hypothetical protein Csa_2G381760 [Cucumis sativus]
Length=646

 Score =   172 bits (435),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 118/153 (77%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLLP   +C AGLVKVNLSGC+N+TDK IS++ KLHG TLELLNL+GC  VTD+SL
Sbjct  495  ITDSGLLPLFMNCKAGLVKVNLSGCVNLTDKVISSLTKLHGWTLELLNLDGCLKVTDSSL  554

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA+ C +L DLD+SK  ++DFG+AALA   A QF+LQ+LS+ GC   +D+ L  L KL
Sbjct  555  VAIAENCPLLNDLDVSKCCITDFGVAALA--QANQFNLQLLSVYGCSALTDQSLLALVKL  612

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G+SL GLN+Q+C  IS R ++LL+ +L RCDIL
Sbjct  613  GDSLLGLNLQHCNSISTRSIELLLAQLHRCDIL  645



>ref|XP_007204219.1| hypothetical protein PRUPE_ppa003009mg [Prunus persica]
 gb|EMJ05418.1| hypothetical protein PRUPE_ppa003009mg [Prunus persica]
Length=612

 Score =   171 bits (434),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 119/154 (77%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G+L  ++S + GLVKVNL+GC+N+TD+ + A+A+LHGETLE+L+L+GC  +TDASL
Sbjct  461  MTDAGILSLLESLEEGLVKVNLNGCLNLTDEVVVALARLHGETLEVLSLDGCRKITDASL  520

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
            AAIAD C  LR+LD+SK  ++D G+A LA   A + +LQ+LS+SGC   S K L  L KL
Sbjct  521  AAIADNCLFLRELDVSKCAITDSGLAFLA--CADRINLQVLSISGCSEISHKSLSSLKKL  578

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+QNC  IS+R V+LLVE LWRCDIL+
Sbjct  579  GKTLVGLNLQNCTAISNRSVELLVESLWRCDILA  612



>ref|XP_008337284.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=647

 Score =   171 bits (434),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 119/154 (77%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G+L  ++S + GLVKVNL+GC+N+TDK + ++  LHGETLE+LNL+GC  +TDASL
Sbjct  496  MTDAGILSLLESSEEGLVKVNLNGCLNLTDKXVVSLVSLHGETLEVLNLDGCRKITDASL  555

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA+ C  LR+LD+SK  ++D G+AAL+  SA Q +LQ+LS+SGC   S K LP L KL
Sbjct  556  VAIANNCLFLRELDVSKCAITDSGLAALS--SAEQINLQVLSISGCSEISHKSLPSLKKL  613

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+Q+C  IS+R ++LLV+ LWRCDIL+
Sbjct  614  GXTLMGLNLQHCTAISNRSIELLVDSLWRCDILA  647



>ref|XP_010102671.1| EIN3-binding F-box protein 1 [Morus notabilis]
 gb|EXC46038.1| EIN3-binding F-box protein 1 [Morus notabilis]
Length=697

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 115/154 (75%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD GLL F++SC+AGL KVNLSGC+N+TDK +SA+A+ HG TLE+LNL GC  ++D  L
Sbjct  546  VTDSGLLSFLESCEAGLAKVNLSGCVNLTDKVVSAMAESHGWTLEMLNLEGCVKISDVGL  605

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIAD C +L +LD+S+  ++DFG+AALA   A   +LQILSLSGC L +DK +  L K 
Sbjct  606  VAIADDCPLLSELDVSRCAITDFGLAALA--RANHLNLQILSLSGCSLITDKSMAALGKT  663

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+Q+C  IS+  VD L+  LWRCDILS
Sbjct  664  GQTLVGLNLQHCKAISNSTVDRLLGELWRCDILS  697



>ref|XP_006450916.1| hypothetical protein CICLE_v10007739mg [Citrus clementina]
 gb|ESR64156.1| hypothetical protein CICLE_v10007739mg [Citrus clementina]
 gb|KDO80237.1| hypothetical protein CISIN_1g006749mg [Citrus sinensis]
Length=632

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 113/154 (73%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G+ P ++SC AGLVKVNLSGC+N+TD+ + A+A+LH ETLELLNL+GC  +TDASL
Sbjct  481  ITDVGIFPLLESCKAGLVKVNLSGCLNLTDEVVLALARLHSETLELLNLDGCRKITDASL  540

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AI + C  L  LD+SK  ++D GI+AL+   A Q +LQ+LSLS C   S+K +P L KL
Sbjct  541  VAIGNNCMFLSYLDVSKCAITDMGISALS--HAEQLNLQVLSLSSCSEVSNKSMPALKKL  598

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+QNC  I+   V  LVE LWRCDILS
Sbjct  599  GKTLVGLNLQNCNSINSSTVARLVESLWRCDILS  632



>gb|EPS63879.1| f-box family protein, partial [Genlisea aurea]
Length=680

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 114/152 (75%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G+LP V+S   GLVKVNLSGC NVTD  I++IA+LHG+TLE+LNL+GC  +TD SL
Sbjct  531  ITDAGILPLVRSSKIGLVKVNLSGCYNVTDDIIASIAELHGKTLEILNLDGCKSITDLSL  590

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
            AAIA+ CSVL +LDIS SR++D GI+ LA  +A Q S+QI SL GC   + K LP L  L
Sbjct  591  AAIAENCSVLSELDISTSRITDIGISTLA--AAKQLSMQIFSLGGCSSVTGKSLPSLVSL  648

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDI  457
            G +L GLNI+ C GIS   +D+L++ LWRC+I
Sbjct  649  GRTLIGLNIRQCDGISFETIDILLDDLWRCNI  680



>gb|KDO80236.1| hypothetical protein CISIN_1g006749mg [Citrus sinensis]
Length=631

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 113/154 (73%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G+ P ++SC AGLVKVNLSGC+N+TD+ + A+A+LH ETLELLNL+GC  +TDASL
Sbjct  480  ITDVGIFPLLESCKAGLVKVNLSGCLNLTDEVVLALARLHSETLELLNLDGCRKITDASL  539

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AI + C  L  LD+SK  ++D GI+AL+   A Q +LQ+LSLS C   S+K +P L KL
Sbjct  540  VAIGNNCMFLSYLDVSKCAITDMGISALS--HAEQLNLQVLSLSSCSEVSNKSMPALKKL  597

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+QNC  I+   V  LVE LWRCDILS
Sbjct  598  GKTLVGLNLQNCNSINSSTVARLVESLWRCDILS  631



>ref|XP_004291457.1| PREDICTED: EIN3-binding F-box protein 1-like [Fragaria vesca 
subsp. vesca]
Length=645

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 114/154 (74%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G L  ++S +AGLVKVNLSGC+N+TDK +S +A+LHG TLE +NL GC  ++D+ L
Sbjct  494  ITDAGFLKLLKSTEAGLVKVNLSGCVNLTDKAVSVMAELHGWTLEKVNLEGCRMISDSGL  553

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AI + C +L DLDIS+  ++DFGIA+LA   A Q +LQILS+SGC   SDK LP L K+
Sbjct  554  VAIGENCPLLSDLDISRCAITDFGIASLA--LAGQLNLQILSVSGCSCVSDKSLPALVKM  611

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+Q C  IS   VD LVE+LWRCDILS
Sbjct  612  GETLLGLNLQQCNAISSSTVDRLVEQLWRCDILS  645



>ref|XP_006475854.1| PREDICTED: EIN3-binding F-box protein 2-like [Citrus sinensis]
Length=729

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 113/154 (73%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G+ P ++SC AGLVKVNLSGC+N+TD+ + A+A+LH ETLELLNL+GC  +TDASL
Sbjct  578  ITDVGIFPLLESCKAGLVKVNLSGCLNLTDEVVLALARLHSETLELLNLDGCRKITDASL  637

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AI + C  L  LD+SK  ++D GI+AL+   A Q +LQ+LSLS C   S+K +P L KL
Sbjct  638  VAIGNNCMFLSYLDVSKCAITDMGISALS--HAEQLNLQVLSLSSCSEVSNKSMPALKKL  695

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+QNC  I+   V  LVE LWRCDILS
Sbjct  696  GKTLVGLNLQNCNSINSSTVARLVESLWRCDILS  729



>gb|AFU61111.1| F-box protein [Capsicum annuum]
Length=637

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 118/154 (77%), Gaps = 4/154 (3%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLLP ++SC+ GLVKVNLS C+N+TD+ + ++A  HGETLELLNL+GC  VTDASL
Sbjct  488  ITDAGLLPLLESCE-GLVKVNLSDCLNLTDQVVLSLAARHGETLELLNLDGCRKVTDASL  546

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIAD CS+L DLD+SK  ++D G+AAL+ G  +Q +LQ+LSLSGC + S+K +P L KL
Sbjct  547  VAIADNCSLLNDLDVSKCAITDSGVAALSRG--VQVNLQVLSLSGCSMVSNKSVPSLKKL  604

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G  L GLN+Q+C  IS   V+LL E LWRCDI S
Sbjct  605  GECLLGLNLQHC-SISCSSVELLAEDLWRCDIFS  637



>ref|XP_003542675.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN47145.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=639

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLLP +++C+AGLV VNL+GC N+TD  +SA+A+LHG TLE+LNL+GC  +TDASL
Sbjct  488  ITDAGLLPLLENCEAGLVNVNLTGCWNLTDNIVSALARLHGGTLEVLNLDGCWKITDASL  547

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA+   VL DLD+SK  ++D G+A L+  S    SLQ+LSLSGC   S+K  P+L KL
Sbjct  548  VAIANNFLVLNDLDVSKCAITDAGVAVLSRASLP--SLQVLSLSGCSDVSNKSAPFLTKL  605

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+QNC  I    ++LLVE+LWRCDIL+
Sbjct  606  GQTLLGLNLQNCNSIGSSTMELLVEKLWRCDILA  639



>ref|XP_003522913.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN36400.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=650

 Score =   169 bits (427),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 113/154 (73%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GL+P +++C+AGLVKVNL GC N+TD  +S +A LHG TLELLNL+GC  +TDASL
Sbjct  499  LTDAGLVPLLENCEAGLVKVNLVGCWNLTDNIVSVLATLHGGTLELLNLDGCRKITDASL  558

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIAD C +L DLD+SK  ++D GIA L+  SA Q +LQ+LSLS C   ++K  P L KL
Sbjct  559  VAIADNCLLLNDLDVSKCAITDAGIAVLS--SAKQLTLQVLSLSNCSGVTNKSAPSLKKL  616

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+QNC  I    V+ LVE LWRCDIL+
Sbjct  617  GQTLVGLNLQNCNSIGCNTVEFLVENLWRCDILA  650



>gb|KHG28503.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=652

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 113/153 (74%), Gaps = 3/153 (2%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +T  G  P ++SC+AGLVKVNLSGC N+ +K +  +A LHG TLE+LNL+GC  ++DA L
Sbjct  502  ITHVGFFPLLESCEAGLVKVNLSGCPNLGNKVVCKMADLHGWTLEMLNLDGCK-ISDAGL  560

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA+ C +L DLD+SK  ++D GIAALA  + I  +LQILS+SGC L SDK LP L KL
Sbjct  561  VAIAENCQLLSDLDVSKCTITDSGIAALARSNLI--NLQILSVSGCNLVSDKSLPSLGKL  618

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLN+Q C  IS   VDLLVE+LWRCDIL
Sbjct  619  GQTLLGLNLQQCKAISSGAVDLLVEQLWRCDIL  651



>ref|XP_008445218.1| PREDICTED: EIN3-binding F-box protein 1 [Cucumis melo]
Length=646

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 116/153 (76%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            + D GLLP   +C AGLV VNLSGC+N+TDK IS++ KLHG TLELLNL+GC  VTD+SL
Sbjct  495  IRDSGLLPLFMNCKAGLVNVNLSGCVNLTDKVISSLTKLHGWTLELLNLDGCLKVTDSSL  554

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA+ C +L DLD+SK  ++DFG+AALA   A QF+LQ+LS+ GC   +D+ L  L KL
Sbjct  555  VAIAENCPLLNDLDVSKCCITDFGVAALA--QANQFNLQLLSVFGCSALTDQSLLALVKL  612

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G+SL GLN+Q+C  IS R ++LL+ +L RCDIL
Sbjct  613  GDSLLGLNLQHCNSISTRSIELLLAQLHRCDIL  645



>ref|XP_008457494.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis melo]
Length=657

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 115/153 (75%), Gaps = 3/153 (2%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD  + P +++C+ GLVKVNLSGCIN+TD+T+S + +LHG T+E+LNL+GC  +TDASL
Sbjct  507  ITDASMFPLLETCE-GLVKVNLSGCINLTDETVSTLVRLHGGTIEVLNLDGCRKITDASL  565

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIAD C +L +LD SK  V+D G+A L+  S+ Q +LQ+LSLSGC   S+K LP+L +L
Sbjct  566  VAIADACLLLNELDASKCAVTDAGLAVLS--SSEQINLQVLSLSGCSEVSNKSLPFLERL  623

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G SL GLN++NC  IS   V  +VE LWRCDIL
Sbjct  624  GKSLVGLNLKNCHSISSGTVGTIVENLWRCDIL  656



>gb|KJB82811.1| hypothetical protein B456_013G215000 [Gossypium raimondii]
Length=639

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 112/153 (73%), Gaps = 3/153 (2%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            ++D GLLP +++ +A LVKVNLSGC+N++DK +  +A LHG TLE+LNL GC  ++DASL
Sbjct  489  ISDAGLLPLLETREADLVKVNLSGCVNLSDKAVCIMADLHGWTLEMLNLEGCK-ISDASL  547

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA  C +L DLD+SK  ++D GIAALA  +  Q  LQILS+SGC   SDK +P L KL
Sbjct  548  VAIAKNCQLLSDLDVSKCAITDSGIAALARSN--QIKLQILSMSGCSKVSDKSMPSLRKL  605

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLN+Q C  IS   VDL VE+LWRCDIL
Sbjct  606  GQTLLGLNLQQCKAISSSTVDLFVEQLWRCDIL  638


 Score = 48.1 bits (113),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 40/134 (30%), Positives = 68/134 (51%), Gaps = 4/134 (3%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +T +G    + +C A L  ++L  C  + D  +   + L  ++L  L++  C    DASL
Sbjct  409  ITQFGFFGSLLNCGAKLKAISLVNCYGIKDLNLGLPSVLPCKSLRSLSIRNCPGFGDASL  468

Query  182  AAIADYCSVLRDLDISKSR-VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHK  358
            AA+   C  L+ +++S    +SD G+  L      +  L  ++LSGCV  SDK +  +  
Sbjct  469  AALGKLCPQLQHVELSGLHGISDAGLLPLL--ETREADLVKVNLSGCVNLSDKAVCIMAD  526

Query  359  L-GNSLAGLNIQNC  397
            L G +L  LN++ C
Sbjct  527  LHGWTLEMLNLEGC  540



>ref|XP_009368857.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 117/154 (76%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G+L  ++S + GLVKVNL+GC+N+TDK + ++  LHG+TLE+LNL+GC  +TDASL
Sbjct  496  MTDAGILSLLESLEEGLVKVNLNGCLNLTDKVVVSLVSLHGDTLEVLNLDGCRKITDASL  555

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
              IA+ C  LR+LD+SK  ++D G+AAL+  SA Q +LQ+LS+S C   S K LP L KL
Sbjct  556  VTIANNCLFLRELDVSKCAITDSGLAALS--SAEQINLQVLSISSCSEISHKSLPSLKKL  613

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+Q+C  IS+R ++LLV+ LWRCDIL+
Sbjct  614  GQTLMGLNLQHCTAISNRSIELLVDSLWRCDILA  647



>gb|KHM99176.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=161

 Score =   156 bits (395),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 110/154 (71%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +T+ GLLP +Q+C+AGLV VNL GC N+    +SA+ K+HG TLELLNL+GC  +TDAS 
Sbjct  10   ITNVGLLPLLQNCEAGLVNVNLIGCWNLIANIVSALVKIHGGTLELLNLDGCWKITDASS  69

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA    V+ DLD+SK  +++ GIA L+   A Q SLQ+LSLSGC   S+K  P+L KL
Sbjct  70   VAIAKNFIVINDLDVSKCAITNAGIAILS--RANQPSLQVLSLSGCSDVSNKSAPFLTKL  127

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+QNC  I    ++LLVE+LWRC IL+
Sbjct  128  GQTLLGLNLQNCNSIGSDIMELLVEKLWRCHILA  161



>ref|XP_010526214.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=641

 Score =   166 bits (420),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 110/153 (72%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLL  VQ+    LVKVNLSGC N+TD+ +SAI+     TLE LNL GC  +TDASL
Sbjct  490  ITDSGLLQLVQTSQLSLVKVNLSGCSNLTDRVVSAISVQSDWTLEALNLEGCTKITDASL  549

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             +IA+ C +L DLD+S   V+DFG+  LA  S+ + SLQILSLSGC + +DK +P L KL
Sbjct  550  ISIAENCQILSDLDVSNCAVTDFGVQGLA--SSNKLSLQILSLSGCSMVTDKSMPALGKL  607

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLN+QNC  IS   VDLL+E+LWRCDIL
Sbjct  608  GRTLLGLNVQNCQSISTANVDLLIEQLWRCDIL  640



>ref|XP_007138419.1| hypothetical protein PHAVU_009G207300g [Phaseolus vulgaris]
 gb|ESW10413.1| hypothetical protein PHAVU_009G207300g [Phaseolus vulgaris]
Length=650

 Score =   166 bits (419),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 114/154 (74%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD GLLP +++ +AGLVKVNL+GC N++D  +S +A+LHG TLELLNL+GC  +TDASL
Sbjct  499  VTDAGLLPLLENSEAGLVKVNLAGCGNLSDNIVSELARLHGGTLELLNLDGCRKITDASL  558

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIADYC +L+DLD+SK  ++D GIA L+  +A Q +LQ+LSLS C   + K  P L  L
Sbjct  559  VAIADYCHLLKDLDVSKCGITDAGIAVLS--NARQLTLQVLSLSNCSGVTCKSGPSLTNL  616

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+Q C  I    V+LLVE LWRCDIL+
Sbjct  617  GQTLVGLNLQYCNSIGSNTVELLVENLWRCDILA  650



>gb|KJB65823.1| hypothetical protein B456_010G114900 [Gossypium raimondii]
Length=672

 Score =   166 bits (419),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 114/149 (77%), Gaps = 3/149 (2%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G+L  ++SC+AGL+KVNLSGC+N++DK +  I+ LHG TLELLNL+GC  ++DASL
Sbjct  501  ITDAGVLLLLESCEAGLLKVNLSGCVNLSDKVVQTISNLHGWTLELLNLDGCK-ISDASL  559

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA+ C +L DLDISK  ++D GIAALA  + I  +LQILS+SGC + SDK LP L KL
Sbjct  560  VAIAENCQLLTDLDISKCTITDSGIAALAHFNPI--NLQILSVSGCSMVSDKSLPSLGKL  617

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWR  448
            G +L GLN+Q C  IS R V+LL E+LWR
Sbjct  618  GETLLGLNLQQCKAISSRAVELLTEQLWR  646



>ref|XP_009403463.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=654

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 110/154 (71%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD  LLP ++S D G V+VNL+GC+NVTD  ++ + K HG TL++LNL GC  +TD SL
Sbjct  503  VTDTFLLPLIKSSDVGFVQVNLNGCVNVTDDLVTTLVKAHGSTLKMLNLRGCKKITDRSL  562

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIAD CSV+ DLD+S   VSD+G+A LA  SA Q  LQILSL+ C   + K LP+L  L
Sbjct  563  LAIADGCSVIEDLDLSSCSVSDYGVAVLA--SARQLQLQILSLASCSKVTVKSLPFLGNL  620

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G S+ GLN+Q+C  IS RG+ LL E+LW CDI+S
Sbjct  621  GQSMVGLNLQHCSLISTRGMKLLEEKLWWCDIIS  654



>ref|XP_009364023.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G+L  + S + GLVKVNL+GC+N+TD+ + A+ +LHGETLE+LNL+GC  +TDASL
Sbjct  496  MTDAGVLSLLGSLEEGLVKVNLNGCLNLTDEVVMALVRLHGETLEVLNLDGCRKITDASL  555

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
            A IA  C  LR+LD+SK  ++D G+AAL+  SA Q +LQ+LS+SGC   S K LP L KL
Sbjct  556  ATIASNCLFLRELDVSKCAITDSGLAALS--SADQINLQVLSVSGCSEISHKSLPSLKKL  613

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+Q+C  + +  ++LLVE LWRCDIL+
Sbjct  614  GQTLVGLNLQHCTALGNGSIELLVESLWRCDILA  647



>gb|EYU32346.1| hypothetical protein MIMGU_mgv1a002758mg [Erythranthe guttata]
Length=640

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 113/154 (73%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD  +LP V+S + GLV+V LSGC  +TD T++ IAKLHG+TL+LL L+GC CVTDASL
Sbjct  489  ITDACILPLVESSEDGLVEVKLSGCDKLTDNTVTVIAKLHGDTLDLLKLDGCRCVTDASL  548

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
              IA  C VL +LD+S+  ++D GI  LA   A+Q SL   S++GC L SD+ LP+L +L
Sbjct  549  IEIASNCMVLSELDVSRCGITDSGIKVLA--EAVQMSLLTFSIAGCSLVSDESLPFLVEL  606

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G ++ GLN+Q C GI+   VDLLV++LWRCDILS
Sbjct  607  GKTMVGLNVQYCGGITSGAVDLLVDQLWRCDILS  640



>ref|XP_008466405.1| PREDICTED: EIN3-binding F-box protein 1 isoform X1 [Cucumis melo]
 ref|XP_008466406.1| PREDICTED: EIN3-binding F-box protein 1 isoform X1 [Cucumis melo]
Length=640

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 114/154 (74%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            + D G L ++Q+C +GLVK+NLSGC+N+TD+ IS+I + HG TL++LNL+ C  +TDAS+
Sbjct  489  IDDCGFLAWLQNCQSGLVKINLSGCVNLTDEVISSIIEHHGWTLKVLNLDSCKKITDASM  548

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             +IA+ C +L DLD+SK  ++D GIA LA   A Q +LQI S+SGC   SDK L  L KL
Sbjct  549  TSIANNCPLLSDLDVSKCSITDSGIATLA--CAKQPNLQIFSISGCSFVSDKSLADLIKL  606

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLNIQ+C  IS   VDLLVE+LWRCDILS
Sbjct  607  GETLVGLNIQHCNAISSSTVDLLVEQLWRCDILS  640



>ref|XP_004139306.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 ref|XP_004169733.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|KGN60684.1| Grr1 [Cucumis sativus]
Length=661

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 115/153 (75%), Gaps = 3/153 (2%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD  + P +++C+ GLVKVNLSGCIN+TD+T+S + +LHG T+E+LNL+GC  ++DASL
Sbjct  511  ITDASMFPLLETCE-GLVKVNLSGCINLTDETVSTLVRLHGGTIEVLNLDGCRKISDASL  569

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIAD C +L +LD SK  ++D G+A L+  S+ Q +LQ+LSLSGC   S+K LP+L +L
Sbjct  570  VAIADACLLLNELDASKCAITDAGLAVLS--SSEQINLQVLSLSGCSEVSNKSLPFLERL  627

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G SL GLN++NC  IS   V  +VE LWRCDIL
Sbjct  628  GKSLVGLNLKNCHSISSGTVGTIVENLWRCDIL  660



>ref|XP_008466407.1| PREDICTED: EIN3-binding F-box protein 1 isoform X2 [Cucumis melo]
Length=690

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 114/154 (74%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            + D G L ++Q+C +GLVK+NLSGC+N+TD+ IS+I + HG TL++LNL+ C  +TDAS+
Sbjct  539  IDDCGFLAWLQNCQSGLVKINLSGCVNLTDEVISSIIEHHGWTLKVLNLDSCKKITDASM  598

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             +IA+ C +L DLD+SK  ++D GIA LA   A Q +LQI S+SGC   SDK L  L KL
Sbjct  599  TSIANNCPLLSDLDVSKCSITDSGIATLA--CAKQPNLQIFSISGCSFVSDKSLADLIKL  656

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLNIQ+C  IS   VDLLVE+LWRCDILS
Sbjct  657  GETLVGLNIQHCNAISSSTVDLLVEQLWRCDILS  690



>ref|XP_009791397.1| PREDICTED: EIN3-binding F-box protein 2-like [Nicotiana sylvestris]
Length=637

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 122/154 (79%), Gaps = 3/154 (2%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLLP ++SC+AGLVKVNLS C+N+TD+ + ++A+LHGETLELLNL+GC  VTDASL
Sbjct  487  ITDAGLLPLLESCEAGLVKVNLSDCLNLTDRVVLSLARLHGETLELLNLDGCRKVTDASL  546

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIAD C +L DLD+S   ++D G+AAL+ G  +Q +LQ+LSLSGC + S+K +P L KL
Sbjct  547  VAIADNCPLLNDLDVSTCAITDSGVAALSCG--VQANLQVLSLSGCSMVSNKSVPSLKKL  604

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+Q+C  +S   V+LLVE LWRCDILS
Sbjct  605  GENLLGLNLQHC-SVSCSAVELLVEDLWRCDILS  637



>ref|XP_009607234.1| PREDICTED: EIN3-binding F-box protein 2-like [Nicotiana tomentosiformis]
Length=637

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 121/154 (79%), Gaps = 3/154 (2%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLLP ++SC+AGLVKVNLS C+N+TD+ + ++A+LHGETLELLNL+GC  VTD SL
Sbjct  487  ITDAGLLPLLESCEAGLVKVNLSDCLNLTDQVVLSLARLHGETLELLNLDGCRKVTDESL  546

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIAD C +L DLD+S   ++D G+A L+ G  +Q +LQ+LSLSGC + S+K +PYL KL
Sbjct  547  MAIADNCPLLNDLDVSTCAITDSGVAGLSCG--VQVNLQVLSLSGCSMVSNKSVPYLKKL  604

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+Q+C  +S   V+LLVE LWRCDILS
Sbjct  605  GENLLGLNLQHC-SVSCSAVELLVEDLWRCDILS  637



>ref|XP_007137020.1| hypothetical protein PHAVU_009G093200g [Phaseolus vulgaris]
 gb|ESW09014.1| hypothetical protein PHAVU_009G093200g [Phaseolus vulgaris]
Length=643

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 107/153 (70%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD G LP ++  + GL  VNL GCINVTD+ +  I   HG TL++L L+GC  VTDAS+
Sbjct  492  VTDAGFLPLLECSETGLTTVNLRGCINVTDRVVLPIVNSHGWTLQVLCLDGCKRVTDASM  551

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA  C +L DLD+SK  ++D GIAALA G+  Q SL+ILSL+GC+  SDK +P L KL
Sbjct  552  MAIAGNCPMLSDLDVSKCAITDTGIAALARGN--QISLEILSLAGCISVSDKSMPALKKL  609

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G SLAGLNI+ C  IS RGV  L E LW CDIL
Sbjct  610  GQSLAGLNIKRCSAISSRGVSKLQEHLWTCDIL  642



>ref|XP_003522614.1| PREDICTED: EIN3-binding F-box protein 1-like isoform 1 [Glycine 
max]
 gb|KHN08132.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=636

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 113/153 (74%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD G LP ++S +AGLVKVNLSGC+N+TD+ + ++   HG TLE+L+L+GC  V+DASL
Sbjct  485  VTDAGFLPLLESSEAGLVKVNLSGCVNLTDRVVLSMVNSHGWTLEVLSLDGCKRVSDASL  544

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA  C VL DLD+S+  ++D GIAALA G   QF+L++LSL+GC L SDK +P L KL
Sbjct  545  MAIAGSCPVLADLDVSRCAITDTGIAALARGK--QFNLEVLSLAGCALVSDKSVPALKKL  602

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G SLAGLNI+ C  IS R VD L+  L  CDIL
Sbjct  603  GRSLAGLNIKLCNAISSRSVDKLLGHLCMCDIL  635



>ref|XP_004287307.1| PREDICTED: EIN3-binding F-box protein 1-like [Fragaria vesca 
subsp. vesca]
Length=640

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 115/154 (75%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G+L  ++S + GLVK+NLSGC+N+TD+   A A+LH ETLE+LNL+GC  +TDASL
Sbjct  489  MTDAGILSLLESLEDGLVKLNLSGCVNLTDEVAVAAARLHRETLEVLNLDGCRKITDASL  548

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA  C  LR+LD+SKS ++D G+A L+     Q +LQ+LS+SGC   S+K L  L ++
Sbjct  549  EAIAANCLFLRELDVSKSGITDSGLAVLS--CTEQVALQVLSISGCSEVSNKSLSSLKRM  606

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G SL GLN+Q+C  IS+R V+LL+E LWRCDIL+
Sbjct  607  GQSLLGLNLQHCTAISNRSVELLIESLWRCDILA  640



>gb|KEH32121.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=688

 Score =   163 bits (412),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 110/153 (72%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLLP +++C+AGLVKVNL GC N+TD  +S +A+LHG TLE+LNL+GC  +TDASL
Sbjct  452  ITDAGLLPLLENCEAGLVKVNLKGCCNLTDNIVSELARLHGGTLEILNLDGCQNITDASL  511

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             A+ D C +L DLD+SK  ++D GIA L    A   S+++LS+S C   S+ C+P+L KL
Sbjct  512  VAVEDNCLLLNDLDVSKCAITDAGIAVLT--RADHVSMRVLSMSDCSGISNNCVPFLMKL  569

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLNI+ C  I    ++ LVE LWRCDIL
Sbjct  570  GQALLGLNIKYCNAIGSNEIEFLVENLWRCDIL  602



>gb|KEH32122.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=684

 Score =   163 bits (412),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 110/153 (72%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLLP +++C+AGLVKVNL GC N+TD  +S +A+LHG TLE+LNL+GC  +TDASL
Sbjct  448  ITDAGLLPLLENCEAGLVKVNLKGCCNLTDNIVSELARLHGGTLEILNLDGCQNITDASL  507

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             A+ D C +L DLD+SK  ++D GIA L    A   S+++LS+S C   S+ C+P+L KL
Sbjct  508  VAVEDNCLLLNDLDVSKCAITDAGIAVLT--RADHVSMRVLSMSDCSGISNNCVPFLMKL  565

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLNI+ C  I    ++ LVE LWRCDIL
Sbjct  566  GQALLGLNIKYCNAIGSNEIEFLVENLWRCDIL  598



>ref|XP_002285249.2| PREDICTED: EIN3-binding F-box protein 1-like [Vitis vinifera]
Length=663

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 120/153 (78%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLLP ++SC+AGL KVNLSGC+N+TD+ + A+A+LHGETLELLNL+GC  +TDASL
Sbjct  512  MTDAGLLPLLESCEAGLAKVNLSGCLNLTDEVVLAMARLHGETLELLNLDGCRKITDASL  571

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIAD C +L DLD+SK  ++D GIAAL+ G   + +LQILS+SGC   S+K +P L KL
Sbjct  572  VAIADNCLLLNDLDLSKCAITDSGIAALSCGE--KLNLQILSVSGCSKVSNKSMPSLCKL  629

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLN+Q+C  IS   V+LL+E LWRCDIL
Sbjct  630  GKTLLGLNLQHCNKISSSSVELLMESLWRCDIL  662



>gb|KCW80001.1| hypothetical protein EUGRSUZ_C01334 [Eucalyptus grandis]
Length=584

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 114/154 (74%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GL P +++ +AGLVKVNLS C+N+TD+ +S + +LHG TLELLNL+GC  V+DASL
Sbjct  433  LTDAGLSPLLENSEAGLVKVNLSNCLNITDEAVSTLVRLHGGTLELLNLDGCRKVSDASL  492

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIAD C +L DLD+SK  ++D G++ L+   A   +LQ+LSL+GC + S+K +P+L KL
Sbjct  493  VAIADNCLLLNDLDMSKCSITDSGVSVLS--LAGHLNLQVLSLAGCSMVSNKSVPFLKKL  550

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
              SL GLN+Q+C  IS   V+ L E LWRCDILS
Sbjct  551  AGSLIGLNLQHCRSISSGMVEQLAESLWRCDILS  584



>ref|XP_003609344.1| Ein3-binding f-box protein [Medicago truncatula]
 gb|AES91541.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=739

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 110/153 (72%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLLP +++C+AGLVKVNL GC N+TD  +S +A+LHG TLE+LNL+GC  +TDASL
Sbjct  503  ITDAGLLPLLENCEAGLVKVNLKGCCNLTDNIVSELARLHGGTLEILNLDGCQNITDASL  562

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             A+ D C +L DLD+SK  ++D GIA L    A   S+++LS+S C   S+ C+P+L KL
Sbjct  563  VAVEDNCLLLNDLDVSKCAITDAGIAVLT--RADHVSMRVLSMSDCSGISNNCVPFLMKL  620

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLNI+ C  I    ++ LVE LWRCDIL
Sbjct  621  GQALLGLNIKYCNAIGSNEIEFLVENLWRCDIL  653



>ref|XP_011039690.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 119/154 (77%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD G LP +++C+AGLVKVNLSGC+N++DK +S + + HG TLE+LNL+GC  +TDASL
Sbjct  495  VTDAGFLPVLENCEAGLVKVNLSGCVNLSDKVVSVMTEQHGWTLEVLNLDGCRRITDASL  554

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA+ C +L DLD+SK   +D GIAA+A  +  Q +LQ+LS+SGC + SDK LP L KL
Sbjct  555  VAIAENCFLLSDLDVSKCAATDSGIAAMARSN--QLNLQVLSMSGCSMVSDKSLPALIKL  612

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+Q+C  IS   VD+LVERLWRCDILS
Sbjct  613  GGTLLGLNLQHCNAISSSTVDVLVERLWRCDILS  646



>ref|XP_010047961.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
Length=654

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 114/154 (74%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GL P +++ +AGLVKVNLS C+N+TD+ +S + +LHG TLELLNL+GC  V+DASL
Sbjct  503  LTDAGLSPLLENSEAGLVKVNLSNCLNITDEAVSTLVRLHGGTLELLNLDGCRKVSDASL  562

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIAD C +L DLD+SK  ++D G++ L+   A   +LQ+LSL+GC + S+K +P+L KL
Sbjct  563  VAIADNCLLLNDLDMSKCSITDSGVSVLS--LAGHLNLQVLSLAGCSMVSNKSVPFLKKL  620

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
              SL GLN+Q+C  IS   V+ L E LWRCDILS
Sbjct  621  AGSLIGLNLQHCRSISSGMVEQLAESLWRCDILS  654



>ref|XP_007155011.1| hypothetical protein PHAVU_003G165500g [Phaseolus vulgaris]
 gb|ESW27005.1| hypothetical protein PHAVU_003G165500g [Phaseolus vulgaris]
Length=639

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 117/153 (76%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLLP +++C+AGLV VNL+GC N+TD  +SA+A+LHG TLE+LNL+GC  +TDASL
Sbjct  488  ITDAGLLPLLENCEAGLVNVNLAGCWNLTDNIVSALARLHGGTLEVLNLDGCMKITDASL  547

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
              IA+ C VL DLD+SK  ++D GIA L+   A   SLQ+LSLSGC   S+KC+P+L  L
Sbjct  548  VTIANNCLVLNDLDVSKCAITDAGIAVLS--RASLLSLQVLSLSGCSDVSNKCVPFLTIL  605

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLNIQNC  IS   ++LLVE+LWRCDIL
Sbjct  606  GQTLIGLNIQNCNSISSSTMELLVEKLWRCDIL  638



>ref|XP_004173614.1| PREDICTED: EIN3-binding F-box protein 1-like, partial [Cucumis 
sativus]
Length=631

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 112/154 (73%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            + D G L ++Q+C  GLVK+NL+GC+N+TD+ +S+I + HG TL++LNL+ C  +TDAS+
Sbjct  480  IDDCGFLAWLQNCQLGLVKINLNGCVNLTDEVVSSIMEHHGSTLKMLNLDSCKKITDASM  539

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             +IA+ C +L DLD+SK  ++D GIA LA   A Q +LQI S+SGC   S+K L  L  L
Sbjct  540  TSIANNCPLLSDLDVSKCSITDSGIATLA--HAKQLNLQIFSISGCSFVSEKSLADLINL  597

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLNIQ+C  IS   VDLLVE+LWRCDILS
Sbjct  598  GETLVGLNIQHCNAISSSTVDLLVEQLWRCDILS  631



>ref|XP_010048082.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
 gb|KCW80181.1| hypothetical protein EUGRSUZ_C01524 [Eucalyptus grandis]
Length=657

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 114/154 (74%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GL P +++ +AGLVKVNLS C+N+TD+ +S + +LHG TLELLNL+GC  V+DASL
Sbjct  506  LTDAGLSPLLENSEAGLVKVNLSNCLNITDEAVSTLVRLHGGTLELLNLDGCRKVSDASL  565

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIAD C +L DLD+SK  ++D G++ L+   A   +LQ+LSL+GC + S+K +P+L KL
Sbjct  566  VAIADNCLLLNDLDMSKCSITDSGVSVLS--LAGHLNLQVLSLAGCSMVSNKSVPFLKKL  623

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
              SL GLN+Q+C  IS   V+ L E LWRCDILS
Sbjct  624  AGSLIGLNLQHCRSISSGMVEQLAESLWRCDILS  657



>ref|XP_008792024.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=673

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 109/152 (72%), Gaps = 2/152 (1%)
 Frame = +2

Query  5    TDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLA  184
            TD GLLP ++S +AGLV VNLSGC+++TD  ++A+ K HG TL++LNL GC  VTD SL 
Sbjct  523  TDAGLLPLIESSEAGLVTVNLSGCVDLTDAVVTALVKAHGTTLQMLNLEGCKKVTDKSLL  582

Query  185  AIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLG  364
             IAD CS+L DLD+S+  + D+G+A LA  SA Q  L++LSL+GC   + K LP L  +G
Sbjct  583  VIADSCSLLDDLDMSRCMIGDYGVAILA--SASQLKLRVLSLAGCSKLTQKSLPLLGNMG  640

Query  365  NSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
             SL GLN+QNC  IS +G+  L E+LW CDIL
Sbjct  641  RSLVGLNLQNCKLISTQGIGALEEKLWWCDIL  672



>ref|NP_001281254.1| EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|AHZ89385.1| EIN3-binding-Fbox protein 1 [Cucumis sativus]
 gb|KGN60100.1| Grr1 [Cucumis sativus]
Length=640

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 112/154 (73%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            + D G L ++Q+C  GLVK+NL+GC+N+TD+ +S++ + HG TL++LNL+ C  +TDAS+
Sbjct  489  IEDCGFLAWLQNCQLGLVKINLNGCVNLTDEVVSSLMEHHGSTLKMLNLDSCKKITDASM  548

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             +IA+ C +L DLD+SK  ++D GIA LA   A Q +LQI S+SGC   S+K L  L  L
Sbjct  549  TSIANNCPLLSDLDVSKCSITDSGIATLA--HAKQLNLQIFSISGCSFVSEKSLADLINL  606

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLNIQ+C  IS   VDLLVE+LWRCDILS
Sbjct  607  GETLVGLNIQHCNAISSSTVDLLVEQLWRCDILS  640



>ref|XP_010533156.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=632

 Score =   160 bits (405),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 112/154 (73%), Gaps = 1/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
             TD GLLP +++  AGLV VNLSGC N+TD+ +  +AK HGETLE+LNL GC  +TD+SL
Sbjct  480  TTDAGLLPIIENNRAGLVSVNLSGCFNLTDEVVYYLAKFHGETLEVLNLEGCRRITDSSL  539

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
            +AIA+ C  L+DLD+SK  ++D G+AAL+     + +LQ+LS+SGC   S+K L  L KL
Sbjct  540  SAIAESCLFLKDLDMSKCGITDSGVAALSRAEK-RLNLQVLSVSGCSEVSNKSLVPLKKL  598

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLNI+ C  I++R + LL E LWRCDILS
Sbjct  599  GRTLLGLNIRGCNSITNRIIQLLKESLWRCDILS  632



>ref|XP_010525963.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=640

 Score =   160 bits (405),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 106/153 (69%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G L  + S    LVKVNL+GC N+TDK +S I+   G TLE LNL GC  +TDA+L
Sbjct  489  ITDSGFLQLLHSTQLSLVKVNLAGCSNLTDKVVSVISAQSGWTLEALNLEGCTKITDATL  548

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             +IA  C +L DLD+S   ++DFG+ ALA  S+ Q +LQILSL+GC L +DK +P L KL
Sbjct  549  VSIAGSCQILSDLDVSNCSITDFGVQALA--SSNQLTLQILSLAGCPLVTDKSVPALRKL  606

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLN+Q C  IS   +DLL+E LWRCDIL
Sbjct  607  GRTLLGLNVQQCRSISSATIDLLIEHLWRCDIL  639



>ref|XP_009388655.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=655

 Score =   160 bits (405),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 110/154 (71%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD  L+P +QS + G V+VNLSGC+N+TD  ++ + K HG TL++LNL+GC  +TD SL
Sbjct  504  VTDASLIPLIQSSEVGFVEVNLSGCVNLTDALVTMLVKAHGSTLKMLNLDGCKRITDQSL  563

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIAD CSV  DLD+S S +SD+G+A LA  SA Q +L  LSL+ C   +DK LP+L  +
Sbjct  564  VAIADSCSVFDDLDLSCSSISDYGVAVLA--SARQLNLCTLSLASCSKVTDKSLPFLGNM  621

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G S+ GLN+Q+C  IS  G+ LL E+LW CDI+S
Sbjct  622  GKSMVGLNLQHCSLISIHGIGLLEEKLWWCDIIS  655



>gb|ADW83728.1| EIN3-binding F-box protein 1 [Musa acuminata AAA Group]
Length=453

 Score =   158 bits (400),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 110/154 (71%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD  L+P +QS + G V+VNLSGC+N+T+  ++ + K HG TL++LNL+GC  +TD SL
Sbjct  302  VTDASLIPLIQSSEVGFVEVNLSGCVNLTEALVTMLVKAHGSTLKMLNLDGCKRITDQSL  361

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIAD CSV  DLD+S S +SD+G+A LA  SA Q +L  LSL+ C   +DK LP+L  +
Sbjct  362  VAIADSCSVFDDLDLSCSSISDYGVAVLA--SARQLNLCTLSLASCSKVTDKSLPFLGNM  419

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G S+ GLN+Q+C  IS  G+ LL E+LW CDI+S
Sbjct  420  GKSMVGLNLQHCSLISIHGIGLLEEKLWWCDIIS  453



>ref|XP_010687976.1| PREDICTED: EIN3-binding F-box protein 2-like [Beta vulgaris subsp. 
vulgaris]
Length=615

 Score =   160 bits (404),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 114/153 (75%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G+   ++S  AGLVK+NL+GCIN++D+ ++A+A+LHGET+++LNL+GC  +TD SL
Sbjct  464  MTDEGIHSLLESSLAGLVKLNLNGCINLSDECVTAVARLHGETIKVLNLDGCRKITDVSL  523

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
            + IA  C +L DLD+S S V+D GIAAL+     Q +LQILS+SGC   S+K LPYL +L
Sbjct  524  STIASSCPLLSDLDVSNSAVTDSGIAALSCSE--QLNLQILSISGCSKISNKSLPYLIQL  581

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G SL GLN+Q C  +S   VD+L+  LWRCDIL
Sbjct  582  GKSLVGLNLQYCNSLSSSSVDMLMGNLWRCDIL  614



>ref|XP_006345227.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=637

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 121/154 (79%), Gaps = 4/154 (3%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLLP +++C+ GLVKVNLS C+N+TD+ + ++A  HGETLELLNL+GC  VTDASL
Sbjct  488  ITDAGLLPLLENCE-GLVKVNLSDCLNLTDQVVLSLATRHGETLELLNLDGCRKVTDASL  546

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIADYC +L DLD+SK  ++D G+AAL+ G  +Q +LQ+LSLSGC + S+K +P L KL
Sbjct  547  VAIADYCPLLNDLDVSKCAITDSGVAALSRG--VQVNLQVLSLSGCSMVSNKSVPSLKKL  604

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+Q+C  +S   V+LLVE LWRCDILS
Sbjct  605  GENLLGLNLQHC-SVSCSSVELLVEDLWRCDILS  637



>ref|XP_010907279.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=662

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 106/152 (70%), Gaps = 2/152 (1%)
 Frame = +2

Query  5    TDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLA  184
            TD GLLP ++S + GLV VNL GC+++TD  ++A+ K HG TL++LNL GC  VTD SL 
Sbjct  512  TDAGLLPLIESSEVGLVTVNLRGCVDLTDAVVTALVKAHGSTLQMLNLEGCKKVTDKSLL  571

Query  185  AIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLG  364
             IAD CS L DLD+S+  + D+GIA LA  SA Q  L++LSL+GC   + K LP+L  +G
Sbjct  572  VIADSCSFLDDLDMSRCMIGDYGIAVLA--SASQLKLRVLSLAGCSNLTQKILPFLGNMG  629

Query  365  NSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
             SL GLN+QNC  IS +G+  L E+LW CDI 
Sbjct  630  RSLVGLNLQNCKLISTQGIGALEEKLWWCDIF  661



>ref|XP_008805624.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=660

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 110/152 (72%), Gaps = 3/152 (2%)
 Frame = +2

Query  5    TDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLA  184
            TD GLLP ++S   GLV VNLSGC+++TD  I+A+AK HG TL++LNL  C  VTD SL 
Sbjct  511  TDAGLLPLIES-SVGLVTVNLSGCVDLTDAAITALAKAHGTTLQMLNLESCKNVTDKSLL  569

Query  185  AIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLG  364
            AIAD CS+L DLD+S+  +SD G+A LA  SA+Q  L++LSL+GC   + K LP+L  +G
Sbjct  570  AIADCCSLLDDLDMSRCTISDHGVADLA--SAMQLKLRVLSLAGCSTLTQKSLPFLGNMG  627

Query  365  NSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
             SL GLN+QNC  IS +G+  L E+LW CDIL
Sbjct  628  RSLVGLNLQNCNLISTQGIGALEEKLWWCDIL  659



>gb|KHN07078.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=635

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 112/153 (73%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD G LP ++S +AGLVKVNL+GC+N++D+ + ++   HG TLE+L+L+GC  V DASL
Sbjct  484  VTDAGFLPLLESSEAGLVKVNLNGCVNLSDRVVLSMVNSHGWTLEVLSLDGCKRVGDASL  543

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA  C +L DLD+S+  ++D GIAALA G   Q +L++LSL+GC L SDK +P L K+
Sbjct  544  MAIAGSCPLLADLDVSRCAITDTGIAALARGK--QINLEVLSLAGCALVSDKSVPALKKM  601

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G SLAGLNI+ C GIS R V+ L E L  CDIL
Sbjct  602  GCSLAGLNIKRCKGISSRSVNKLQEHLCMCDIL  634



>gb|ABK25485.1| unknown [Picea sitchensis]
Length=535

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 105/153 (69%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            ++D GL     SC   LVK+NLSGCI VTD+ +  I  L G+TL  LNL GC  VTD SL
Sbjct  384  ISDDGLFALFGSCKTSLVKLNLSGCIEVTDRAVFVIVNLFGKTLLSLNLEGCRKVTDQSL  443

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
              IA YC++L++LDISK  ++D G+ +LA  SA  + LQILSLSGC+  +DK LP++ K+
Sbjct  444  GFIAHYCAILQELDISKCGITDNGLVSLA--SAASYCLQILSLSGCMQITDKGLPFIGKI  501

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLN+Q C GIS R  DLL   LWRCD+L
Sbjct  502  GETLIGLNLQQCRGISSRARDLLATHLWRCDLL  534



>ref|XP_008805623.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=660

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 109/152 (72%), Gaps = 3/152 (2%)
 Frame = +2

Query  5    TDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLA  184
            TD GLLP ++S   GLV VNLSGC+++TD  I+A+AK HG TL++LNL  C  VTD SL 
Sbjct  511  TDAGLLPLIES-SVGLVTVNLSGCVDLTDAAITALAKAHGTTLQMLNLESCKNVTDKSLL  569

Query  185  AIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLG  364
            AIAD CS+L DLD+S+  +SD G+A LA   A+Q  L++LSL+GC   + K LP+L  +G
Sbjct  570  AIADCCSLLDDLDMSRCTISDHGVAVLA--YAMQLKLRVLSLAGCSGLTQKSLPFLGNMG  627

Query  365  NSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
             SL GLN+QNC  IS +G+  L E+LW CDIL
Sbjct  628  RSLVGLNLQNCNLISTQGIGALEEKLWWCDIL  659



>gb|EYU23011.1| hypothetical protein MIMGU_mgv1a002803mg [Erythranthe guttata]
Length=636

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 110/154 (71%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLLP ++SC  GL +VNLS C N+T++ + A+A+ HG TLELLNL  C  +TD SL
Sbjct  485  ITDGGLLPLLESCQTGLARVNLSHCSNLTEEVVFALARCHGGTLELLNLENCQKITDESL  544

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             A+AD C +L DLD+++  ++D G+ AL+ G  +  +LQILSLSGC + S++ +  L K+
Sbjct  545  TALADSCPLLNDLDLARCTITDAGVNALSRG--VHTNLQILSLSGCSMVSNESMHALEKM  602

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLNIQ+C  IS   +++L E LWRCDILS
Sbjct  603  GKTLLGLNIQHCNSISSGKIEILTENLWRCDILS  636



>dbj|BAJ34438.1| unnamed protein product [Thellungiella halophila]
Length=430

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 105/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD G+L  +QS + GLVKVNLSGCINV+D T+SAI+  HG  +E LNL+GC  +TDASL
Sbjct  278  VTDAGVLELLQSNNVGLVKVNLSGCINVSDNTVSAISMCHGRFMESLNLDGCKNITDASL  337

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             A+A  C  + DLDIS + VSD GI ALA  S    +LQ+LS+ GC   +DK    + KL
Sbjct  338  VAVAKNCYSVSDLDISNTLVSDHGIKALA-SSPNHLNLQVLSVGGCSAITDKSKACIQKL  396

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLNIQ C  IS   VD L+E LWRCDIL
Sbjct  397  GRTLLGLNIQRCGRISSSTVDNLLEHLWRCDIL  429



>ref|NP_001234858.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ABB89717.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ABC24971.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ACS44350.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
Length=637

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 121/154 (79%), Gaps = 4/154 (3%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLLP +++C+ GLVKVNLS C+N+TD+ + ++A  HGETLELLNL+GC  VTDASL
Sbjct  488  ITDAGLLPLLENCE-GLVKVNLSDCLNLTDQVVLSLAMRHGETLELLNLDGCRKVTDASL  546

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIADYC +L DLD+SKS ++D G+AAL+ G  +Q +LQ+LSLSGC + S+K +  L KL
Sbjct  547  VAIADYCPLLIDLDVSKSAITDSGVAALSRG--VQVNLQVLSLSGCSMVSNKSVLSLKKL  604

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+Q+C  +S   V+LLVE LWRCDILS
Sbjct  605  GENLLGLNLQHC-SVSCSSVELLVEALWRCDILS  637



>ref|XP_010907280.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=662

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 106/152 (70%), Gaps = 2/152 (1%)
 Frame = +2

Query  5    TDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLA  184
            TD GLLP ++S + GLV VNLSGC+++TD  ++A+ K HG TL++LNL GC  VTD SL 
Sbjct  512  TDAGLLPLIESSEVGLVTVNLSGCVDLTDAVVTALVKAHGSTLQMLNLEGCKKVTDKSLL  571

Query  185  AIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLG  364
             IAD CS L DLD+S+  + D+GIA LA  SA Q  +++LSL+GC   + K +P+L  +G
Sbjct  572  LIADSCSFLDDLDMSRCMIGDYGIAVLA--SASQLKMRVLSLAGCSNLTQKIVPFLGNMG  629

Query  365  NSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
             SL GLN+QNC  IS + +  L E+LW CDI 
Sbjct  630  RSLVGLNLQNCKLISTQEIGALEEKLWWCDIF  661



>gb|EPS63568.1| ein3-binding f-box protein 3, partial [Genlisea aurea]
Length=596

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 110/153 (72%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G+LP VQ    GLVKVNLSGC N+TD  +++I +LHGE LE+LNL+GCG +TD SL
Sbjct  445  ITDAGILPVVQVSGFGLVKVNLSGCHNLTDNAVASIVELHGENLEVLNLDGCGNITDLSL  504

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA  C  L +LDIS+ R++D GIA LA  +A + ++++LSL  C L +DK L  L  L
Sbjct  505  DAIARNCWSLNELDISRCRITDTGIAILA--AAKRLNMKVLSLGSCPLVTDKSLNSLIAL  562

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLNIQ+C GIS   + +L++ LWRCD+L
Sbjct  563  GRTLVGLNIQHCRGISSETISVLLDDLWRCDVL  595



>ref|XP_010429542.1| PREDICTED: EIN3-binding F-box protein 1 [Camelina sativa]
Length=636

 Score =   155 bits (391),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 111/154 (72%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +T+ G L  +Q+    LVKVN SGC N+TDK ISAI   +G TLE+LN++GC  ++DAS+
Sbjct  485  ITESGFLHLIQNSLNSLVKVNFSGCSNLTDKVISAITARNGWTLEVLNIDGCSNISDASM  544

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             +IA  C +L DLD+SK  +SD GI ALA  S+ +  LQILS++GC + +DK LP + +L
Sbjct  545  VSIAANCQILSDLDLSKCSISDSGIQALA--SSEKLKLQILSMAGCSMVTDKSLPAIVRL  602

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G++L GLN+Q C  IS+  VD LVERL++CDILS
Sbjct  603  GSTLLGLNLQQCRSISNSTVDFLVERLYKCDILS  636



>gb|AES91540.2| EIN3-binding F-box-like protein [Medicago truncatula]
Length=633

 Score =   155 bits (391),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 117/154 (76%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLLP +++C+AGLV+VNL+GC N+TD  +S +A+LHG TLE+LNL+GC  +TDASL
Sbjct  482  ITDAGLLPLLENCEAGLVEVNLTGCWNLTDYIVSKVARLHGGTLEILNLDGCQNITDASL  541

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             A+AD C +L DLD+SK  ++D GIA L+   A   S+++LS+S C   S+KC+P+L KL
Sbjct  542  VAVADDCLLLNDLDVSKCAITDAGIAVLS--RADHLSMRVLSMSDCSGISNKCVPFLVKL  599

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L+GLNI+NC  I    ++ LVE LWRCDIL+
Sbjct  600  GPALSGLNIKNCNSIDSNAIEFLVENLWRCDILA  633



>dbj|BAF01819.1| putative glucose regulated repressor protein [Arabidopsis thaliana]
Length=384

 Score =   152 bits (383),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 110/154 (71%), Gaps = 5/154 (3%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +T+ G L  +QS    LVK+N SGC N+TD+ ISAI   +G TLE+LN++GC  +TDASL
Sbjct  236  ITESGFLHLIQS---SLVKINFSGCSNLTDRVISAITARNGWTLEVLNIDGCSNITDASL  292

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             +IA  C +L DLDISK  +SD GI ALA  S+ +  LQILS++GC + +DK LP +  L
Sbjct  293  VSIAANCQILSDLDISKCAISDSGIQALA--SSDKLKLQILSVAGCSMVTDKSLPAIVGL  350

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G++L GLN+Q C  IS+  VD LVERL++CDILS
Sbjct  351  GSTLLGLNLQQCRSISNSTVDFLVERLYKCDILS  384


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 72/156 (46%), Gaps = 10/156 (6%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VT +G    + +C   L   +L  C+++ D T    A  H   L  L++  C    DA+L
Sbjct  156  VTQFGFFGSLLNCGEKLKAFSLVNCLSIRDLTTGLPASSHCSALRSLSIRNCPGFGDANL  215

Query  182  AAIADYCSVLRDLDISKSR-VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLH-  355
            AAI   C  L D+D+   + +++ G   L     IQ SL  ++ SGC   +D+ +  +  
Sbjct  216  AAIGKLCPQLEDIDLCGLKGITESGFLHL-----IQSSLVKINFSGCSNLTDRVISAITA  270

Query  356  KLGNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            + G +L  LNI  C  I+      LV     C ILS
Sbjct  271  RNGWTLEVLNIDGCSNITDAS---LVSIAANCQILS  303



>ref|XP_010541915.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=637

 Score =   154 bits (390),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 110/154 (71%), Gaps = 1/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
             TD GLLP +++  AGLV VNL+ C N+TD  + ++AKL G TLE+LNLNGC  +TD+SL
Sbjct  485  TTDAGLLPLIENNRAGLVTVNLTSCFNLTDGVVYSLAKLQGGTLEVLNLNGCRRITDSSL  544

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
            +A+A+ C  LRDLD+SK  ++D GIA+L+     + +LQ+LS+SGC   S+K L  L KL
Sbjct  545  SAMAENCMFLRDLDVSKCGITDSGIASLSRAEK-RLNLQVLSVSGCSEVSNKSLVSLKKL  603

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLNI+ C  I++  V  LVE LWRCDILS
Sbjct  604  GRTLLGLNIRGCDSITNETVQRLVESLWRCDILS  637



>ref|XP_006842065.1| hypothetical protein AMTR_s00078p00046140 [Amborella trichopoda]
 gb|ERN03740.1| hypothetical protein AMTR_s00078p00046140 [Amborella trichopoda]
Length=649

 Score =   154 bits (389),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 111/153 (73%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD G +  ++S +A L+K NLSGCIN+TD+++ A+AKLHGE+LELL+  GCG VTD+ L
Sbjct  498  VTDDGFVALLESREALLLKANLSGCINLTDRSVMALAKLHGESLELLSFEGCGKVTDSGL  557

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             A++ +C  L+DLDIS+  ++D G+A L+    ++  LQILSLS C+  +DK LP L   
Sbjct  558  MAVSSFCVCLKDLDISRCTITDNGLAYLSRAKGLR--LQILSLSACLGITDKSLPLLGNF  615

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
              SL GLN+QNC  +S+  V+LL E+LWRCDIL
Sbjct  616  AGSLVGLNLQNCKMVSNGAVELLGEQLWRCDIL  648



>ref|XP_006405190.1| hypothetical protein EUTSA_v10000087mg [Eutrema salsugineum]
 gb|ESQ46643.1| hypothetical protein EUTSA_v10000087mg [Eutrema salsugineum]
Length=633

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 111/154 (72%), Gaps = 5/154 (3%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +T+ G L  +Q+    LVKVN SGC N+TDK ISAI+  +G TLE+L ++GC  +TDASL
Sbjct  485  ITESGFLHLLQN---SLVKVNFSGCSNLTDKVISAISARNGWTLEVLTVDGCNKITDASL  541

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             +IA+ C +L DLD+SK  +SD GI ALA  S+ +  LQILS+SGC + +DK LP L +L
Sbjct  542  VSIAENCQILSDLDLSKCSISDIGIQALA--SSDKLKLQILSMSGCSMVTDKSLPALVRL  599

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G++L GLN+Q C  +S   VD LVERL++CDILS
Sbjct  600  GSTLLGLNLQQCRSVSSSTVDFLVERLYKCDILS  633



>ref|XP_010454859.1| PREDICTED: EIN3-binding F-box protein 2 [Camelina sativa]
Length=622

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 105/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD G+   +QS + GLVKVNLSGCINV+D T+SA++  HG TLE LNL+GC  +TDASL
Sbjct  470  VTDAGVRELLQSNNVGLVKVNLSGCINVSDNTVSAVSVCHGHTLESLNLDGCKNITDASL  529

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             A+A  C  + DLDIS + VSD GI ALA  S    +LQ+LS+ GC   +DK    + KL
Sbjct  530  VAVAKNCYSVNDLDISNTLVSDHGIKALA-SSPNHLNLQVLSVGGCSAITDKSKACIQKL  588

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLNIQ C  IS   VD  +E+LWRCDIL
Sbjct  589  GRTLLGLNIQRCGRISSSTVDTFLEQLWRCDIL  621



>ref|XP_010493788.1| PREDICTED: EIN3-binding F-box protein 2-like [Camelina sativa]
Length=622

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 105/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD G+   +QS + GLVKVNLSGCINV+D T+SA++  HG TLE LNL+GC  +TDASL
Sbjct  470  VTDAGVRELLQSNNVGLVKVNLSGCINVSDSTVSAVSVCHGHTLESLNLDGCKNITDASL  529

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             A+A  C  + DLDIS + VSD GI ALA  S    +LQ+LS+ GC   +DK    + KL
Sbjct  530  VAVAKNCYSVNDLDISNTLVSDHGIKALA-SSPNHLNLQVLSVGGCSAITDKSKACIQKL  588

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLNIQ C  IS   VD  +E+LWRCDIL
Sbjct  589  GRTLLGLNIQRCGRISSSTVDTFLEQLWRCDIL  621



>ref|XP_006394785.1| hypothetical protein EUTSA_v10003828mg [Eutrema salsugineum]
 gb|ESQ32071.1| hypothetical protein EUTSA_v10003828mg [Eutrema salsugineum]
Length=621

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 105/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD G+L  +QS + GLVKVNLSGCINV+D T+SAI+  HG  +E LNL+GC  +TDASL
Sbjct  469  VTDAGVLELLQSNNVGLVKVNLSGCINVSDNTVSAISMCHGRFMESLNLDGCKNITDASL  528

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             A+A  C  + DLDIS + VSD GI ALA  S    +LQ+LS+ GC   +DK    + KL
Sbjct  529  VAVAKNCYSVSDLDISNTLVSDHGIKALA-SSPNHLNLQVLSVGGCSAITDKSKACIQKL  587

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLNIQ C  IS   VD L+E LWRCDIL
Sbjct  588  GRTLLGLNIQRCGRISSSTVDNLLEHLWRCDIL  620



>ref|XP_010086585.1| hypothetical protein L484_002248 [Morus notabilis]
 gb|EXB21298.1| hypothetical protein L484_002248 [Morus notabilis]
Length=642

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G+LP ++  + GLV VNLSGC+N+TD+ + A+AKLHGETLE+LNL+GC  +TDASL
Sbjct  491  ITDAGILPLLERPEEGLVSVNLSGCLNLTDEVVVALAKLHGETLEMLNLDGCRKITDASL  550

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
            AAIA+ C +L DLD+SK  ++D  I+ALA  S+ + +LQ+LSLSGC   ++K    L KL
Sbjct  551  AAIAENCLLLSDLDLSKCAITDSSISALA--SSKKINLQVLSLSGCSDVTNKSASCLKKL  608

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G +L GLN+Q+C  IS    +LLVE LWRCDIL+
Sbjct  609  GETLVGLNLQHCNSISSSTAELLVESLWRCDILA  642



>ref|XP_003609343.1| Ein3-binding f-box protein [Medicago truncatula]
Length=1052

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 116/153 (76%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLLP +++C+AGLV+VNL+GC N+TD  +S +A+LHG TLE+LNL+GC  +TDASL
Sbjct  482  ITDAGLLPLLENCEAGLVEVNLTGCWNLTDYIVSKVARLHGGTLEILNLDGCQNITDASL  541

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             A+AD C +L DLD+SK  ++D GIA L+   A   S+++LS+S C   S+KC+P+L KL
Sbjct  542  VAVADDCLLLNDLDVSKCAITDAGIAVLS--RADHLSMRVLSMSDCSGISNKCVPFLVKL  599

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L+GLNI+NC  I    ++ LVE LWRCDIL
Sbjct  600  GPALSGLNIKNCNSIDSNAIEFLVENLWRCDIL  632



>emb|CAN83761.1| hypothetical protein VITISV_043743 [Vitis vinifera]
Length=669

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 117/153 (76%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLLP ++SC+AGL KVNLSGC+N+TD+ + A+A+LHG TLELLNL+GC  +TDASL
Sbjct  487  MTDAGLLPLLESCEAGLAKVNLSGCLNLTDEVVLAMARLHGXTLELLNLDGCRKITDASL  546

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIAD C +L DLD+SK  ++D GIAAL+ G   + +LQILS+SGC   S+K +P L KL
Sbjct  547  VAIADNCLLLNDLDLSKCAITDSGIAALSCGE--KLNLQILSVSGCSKVSNKSMPSLCKL  604

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLN+Q+C  IS   V+LL+E LWR  I+
Sbjct  605  GKTLLGLNLQHCNKISSSSVELLMESLWRFSII  637



>ref|XP_006287278.1| hypothetical protein CARUB_v10000473mg [Capsella rubella]
 gb|EOA20176.1| hypothetical protein CARUB_v10000473mg [Capsella rubella]
Length=621

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 105/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD G+   +QS + GLVKVNLSGCINV+D T+SA++  HG TLE LNL+GC  +TD SL
Sbjct  469  VTDAGVRELLQSNNVGLVKVNLSGCINVSDNTVSAVSVCHGHTLESLNLDGCKNITDTSL  528

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             A+A  C  + DLDIS + VSD GI ALA  S    +LQ+LS+ GC   +DK    + KL
Sbjct  529  VAVAKNCYSVNDLDISNTLVSDQGIKALA-SSPNHLNLQVLSVGGCSAITDKSKACIQKL  587

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLNIQ C  IS   VD L+E+LWRCDIL
Sbjct  588  GRTLLGLNIQRCGRISSSTVDTLLEQLWRCDIL  620



>emb|CDX88173.1| BnaA06g27640D [Brassica napus]
Length=622

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 104/153 (68%), Gaps = 1/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD G+   VQS   GLVKVNLSGCINV+D T+SA++  HG TLE LN++GC  +TDASL
Sbjct  470  VTDAGVFELVQSNSVGLVKVNLSGCINVSDNTVSAVSVCHGRTLESLNVDGCKNITDASL  529

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             A+A  C  + DLD+S + VSD G+ ALA  S    +LQ+LS+ GC   +DK    + KL
Sbjct  530  VAVAKNCYSVNDLDVSNTLVSDQGVKALA-SSPNHLNLQVLSIGGCSGVTDKSKACIQKL  588

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLNIQ C  IS   VD L+E LWRCDIL
Sbjct  589  GRTLLGLNIQRCGRISSSTVDNLLEHLWRCDIL  621



>ref|XP_009419280.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=654

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 110/154 (71%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD  L+P ++S + G V++NL+GC+NVTD  ++ + K+HG +L++LNL+GC  +TD SL
Sbjct  503  VTDESLIPLIESSEVGFVEINLTGCVNVTDDLVTMLIKVHGSSLKMLNLHGCRKITDRSL  562

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AI + CSVL DLD+S   VSD+G+A LA  SA Q +L ILSL+ C   + K LP+L  L
Sbjct  563  LAITESCSVLDDLDLSSCSVSDYGVALLA--SARQLNLHILSLASCSQVTLKSLPFLGNL  620

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G S+ GLN+Q+C  IS  G+ LL E+LW CDI+S
Sbjct  621  GLSIVGLNLQDCSLISAHGLRLLEEKLWWCDIIS  654



>ref|NP_565597.1| EIN3-binding F-box protein 1 [Arabidopsis thaliana]
 sp|Q9SKK0.1|EBF1_ARATH RecName: Full=EIN3-binding F-box protein 1; AltName: Full=F-box/LRR-repeat 
protein 6 [Arabidopsis thaliana]
 gb|AAD20708.1| F-box protein family, AtFBL6 [Arabidopsis thaliana]
 gb|AAL60026.1| putative F-box protein family, AtFBL6 [Arabidopsis thaliana]
 gb|AAM14272.1| unknown protein [Arabidopsis thaliana]
 emb|CAE75864.1| F-box protein [Arabidopsis thaliana]
 gb|AEC07708.1| EIN3-binding F-box protein 1 [Arabidopsis thaliana]
Length=628

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 110/154 (71%), Gaps = 5/154 (3%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +T+ G L  +QS    LVK+N SGC N+TD+ ISAI   +G TLE+LN++GC  +TDASL
Sbjct  480  ITESGFLHLIQS---SLVKINFSGCSNLTDRVISAITARNGWTLEVLNIDGCSNITDASL  536

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             +IA  C +L DLDISK  +SD GI ALA  S+ +  LQILS++GC + +DK LP +  L
Sbjct  537  VSIAANCQILSDLDISKCAISDSGIQALA--SSDKLKLQILSVAGCSMVTDKSLPAIVGL  594

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G++L GLN+Q C  IS+  VD LVERL++CDILS
Sbjct  595  GSTLLGLNLQQCRSISNSTVDFLVERLYKCDILS  628


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 72/156 (46%), Gaps = 10/156 (6%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VT +G    + +C   L   +L  C+++ D T    A  H   L  L++  C    DA+L
Sbjct  400  VTQFGFFGSLLNCGEKLKAFSLVNCLSIRDLTTGLPASSHCSALRSLSIRNCPGFGDANL  459

Query  182  AAIADYCSVLRDLDISKSR-VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLH-  355
            AAI   C  L D+D+   + +++ G   L     IQ SL  ++ SGC   +D+ +  +  
Sbjct  460  AAIGKLCPQLEDIDLCGLKGITESGFLHL-----IQSSLVKINFSGCSNLTDRVISAITA  514

Query  356  KLGNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            + G +L  LNI  C  I+      LV     C ILS
Sbjct  515  RNGWTLEVLNIDGCSNITDAS---LVSIAANCQILS  547



>ref|XP_010421385.1| PREDICTED: EIN3-binding F-box protein 2-like [Camelina sativa]
Length=618

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 104/153 (68%), Gaps = 1/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD G+   +Q  + GLVKVNLSGCINV+D T+SA++  HG TLE LNL+GC  +TDASL
Sbjct  466  VTDAGVRELLQRNNVGLVKVNLSGCINVSDNTVSAVSVCHGHTLESLNLDGCKNITDASL  525

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             A+A  C  + DLDIS + VSD GI ALA  S    +LQ+LS+ GC   +DK    + KL
Sbjct  526  VAVAKNCYSVNDLDISNTLVSDHGIKALA-SSPNHLNLQVLSVGGCSAITDKSKACIQKL  584

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLNIQ C  IS   VD  +E+LWRCDIL
Sbjct  585  GRTLLGLNIQRCGRISSSTVDTFLEQLWRCDIL  617



>gb|ACF81449.1| unknown [Zea mays]
Length=206

 Score =   145 bits (366),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 108/154 (70%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD GLLP +QS ++GL+KV+LSGC N+TD  +S++ K HG++L+ ++L GC  +TDASL
Sbjct  55   VTDNGLLPLIQSSESGLIKVDLSGCKNITDVAVSSLVKRHGKSLKKVSLEGCSKITDASL  114

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
              +++ C+ L +LD+S   VSD+G+A LA  SA    L++LSLSGC   + K +P+L  L
Sbjct  115  FTMSESCTELAELDLSNCMVSDYGVAMLA--SARHLKLRVLSLSGCSKVTQKSVPFLGNL  172

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G SL GLN+Q C  I +  +  L ++LW CDIL+
Sbjct  173  GQSLEGLNLQFCNMIGNHNIASLEKKLWWCDILA  206



>dbj|BAH20224.1| AT2G25490 [Arabidopsis thaliana]
Length=604

 Score =   152 bits (383),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 110/154 (71%), Gaps = 5/154 (3%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +T+ G L  +QS    LVK+N SGC N+TD+ ISAI   +G TLE+LN++GC  +TDASL
Sbjct  456  ITESGFLHLIQS---SLVKINFSGCSNLTDRVISAITARNGWTLEVLNIDGCSNITDASL  512

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             +IA  C +L DLDISK  +SD GI ALA  S+ +  LQILS++GC + +DK LP +  L
Sbjct  513  VSIAANCQILSDLDISKCAISDSGIQALA--SSDKLKLQILSVAGCSMVTDKSLPAIVGL  570

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G++L GLN+Q C  IS+  VD LVERL++CDILS
Sbjct  571  GSTLLGLNLQQCRSISNSTVDFLVERLYKCDILS  604


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 72/156 (46%), Gaps = 10/156 (6%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VT +G    + +C   L   +L  C+++ D T    A  H   L  L++  C    DA+L
Sbjct  376  VTQFGFFGSLLNCGEKLKAFSLVNCLSIRDLTTGLPASSHCSALRSLSIRNCPGFGDANL  435

Query  182  AAIADYCSVLRDLDISKSR-VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLH-  355
            AAI   C  L D+D+   + +++ G   L     IQ SL  ++ SGC   +D+ +  +  
Sbjct  436  AAIGKLCPQLEDIDLCGLKGITESGFLHL-----IQSSLVKINFSGCSNLTDRVISAITA  490

Query  356  KLGNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            + G +L  LNI  C  I+      LV     C ILS
Sbjct  491  RNGWTLEVLNIDGCSNITDAS---LVSIAANCQILS  523



>emb|CDX87090.1| BnaC09g04050D [Brassica napus]
Length=616

 Score =   151 bits (382),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD G+L  +QS + GLVK+NL+GC+NVTD T+SA++  HG TLE L+L+GC  +TDASL
Sbjct  464  VTDAGVLSLLQSNNVGLVKLNLNGCVNVTDNTVSAVSFSHGSTLESLSLDGCKNITDASL  523

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
              +A  C  + DLD+S + VSD GI ALA  S    SLQ+LSL GC   +DK    + KL
Sbjct  524  VTVAKNCYSVNDLDVSNTLVSDHGIKALA-SSPNHLSLQVLSLGGCSGITDKSKACIQKL  582

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLNIQ C  IS   VD L+E+LWRCDIL
Sbjct  583  GRTLLGLNIQRCGRISSSTVDSLLEQLWRCDIL  615



>ref|XP_010541601.1| PREDICTED: EIN3-binding F-box protein 2 [Tarenaya hassleriana]
Length=624

 Score =   151 bits (382),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 103/153 (67%), Gaps = 1/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD GLL  +Q   AGL+KVNLS C+N+TD  +SAI   HG TLE LNL+GC  +TDASL
Sbjct  472  VTDSGLLELIQFNSAGLLKVNLSCCLNLTDSAVSAIVTRHGLTLESLNLDGCRNITDASL  531

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             ++A  C  + DLD+S SRVSD GI ALA  S    +LQI S+ GC   +D+    + KL
Sbjct  532  VSVAKNCYSINDLDVSNSRVSDLGIEALA-TSPNHLNLQIFSIGGCSAVTDESQASIQKL  590

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLNIQ C  IS   +D L+E+LWRCDIL
Sbjct  591  GRTLLGLNIQRCSKISSSTIDALLEQLWRCDIL  623



>gb|KJB07621.1| hypothetical protein B456_001G033400 [Gossypium raimondii]
Length=613

 Score =   151 bits (382),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 109/153 (71%), Gaps = 3/153 (2%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G L  ++S +AGLVKVNL  C+N++DK +  +  LH  TLE LNL+GC  ++DASL
Sbjct  463  ITDAGFLQLLKSRNAGLVKVNLKDCVNLSDKGVCRLTNLHRWTLETLNLDGCK-ISDASL  521

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA+ C +L DLD+SK  ++D GIAALA    I  ++QILS+SGC + SDK LP L  L
Sbjct  522  FAIAENCRLLGDLDVSKCAITDSGIAALAHSDLI--NVQILSVSGCSMVSDKSLPSLRNL  579

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLN+Q C  IS   +DLLV++LWRC+IL
Sbjct  580  GKTLLGLNLQQCKAISRSAIDLLVQQLWRCNIL  612



>ref|XP_002874252.1| ein3-binding F box protein 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50511.1| ein3-binding F box protein 2 [Arabidopsis lyrata subsp. lyrata]
Length=590

 Score =   151 bits (381),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 103/153 (67%), Gaps = 1/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD G+   +QS + GLVKVNLS CINV+D T+SAI+  HG TLE LNL+GC  +TD SL
Sbjct  438  VTDAGVRELLQSNNVGLVKVNLSECINVSDNTVSAISVCHGRTLESLNLDGCKNITDTSL  497

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             A+A  C  + DLDIS + VSD GI ALA  S    +LQ+LS+ GC   +DK    + KL
Sbjct  498  VAVAKNCYSVNDLDISNTLVSDHGIKALA-SSPNHLNLQVLSVGGCSAITDKSKACIQKL  556

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLNIQ C  IS   VD L+E LWRCDIL
Sbjct  557  GRTLLGLNIQRCGRISSSTVDTLIENLWRCDIL  589



>ref|XP_009140675.1| PREDICTED: EIN3-binding F-box protein 1 [Brassica rapa]
Length=622

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 111/154 (72%), Gaps = 5/154 (3%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +T+ G L  +Q+    LVKVN SGC  +TD+ +SAI+  +G TLE+LN++GC  ++DASL
Sbjct  474  ITESGFLHLLQN---SLVKVNFSGCSGLTDRVVSAISARNGLTLEVLNMDGCSKISDASL  530

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             +IA  C +L DLD+SK  VSDFGI ALA  S+ +  LQILS++GC + +DK LP + KL
Sbjct  531  VSIAANCQILSDLDLSKCSVSDFGIQALA--SSDKLKLQILSMAGCAMVTDKSLPSIVKL  588

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G++L GLN+Q C  +S   VD LVERL++CDILS
Sbjct  589  GSTLLGLNLQQCRSVSCSTVDFLVERLYKCDILS  622



>gb|AES73649.2| EIN3-binding F-box-like protein [Medicago truncatula]
Length=641

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 106/153 (69%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G +  +Q   A L  VNLSGCIN+TD  + ++ KLH  TL +LNLNGC  V DASL
Sbjct  490  ITDPGFISLLQRSKASLGNVNLSGCINLTDVGVLSMVKLHCSTLGVLNLNGCKKVGDASL  549

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIAD C VL DLD+S+  ++D GI+AL  G  + F+L +LSL+GC L S+K L  L KL
Sbjct  550  TAIADNCIVLSDLDVSECAITDAGISALTRG--VLFNLDVLSLAGCSLVSNKSLSALKKL  607

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G+SL GLNI+NC  IS R V+ LVE LW CDIL
Sbjct  608  GDSLEGLNIKNCKSISSRTVNKLVEHLWMCDIL  640



>emb|CDX80503.1| BnaC07g29410D [Brassica napus]
Length=621

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 103/153 (67%), Gaps = 1/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD G+   VQS   GLVKVNLSGCINV+D  +SAI+  HG TLE LN++GC  +TDASL
Sbjct  469  VTDAGVFELVQSNSVGLVKVNLSGCINVSDNAVSAISVCHGRTLESLNVDGCKNITDASL  528

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             A+A  C  + DLD+S + VSD G+ ALA  S    +LQ+LS+ GC   +DK    + KL
Sbjct  529  VAVAKNCYSVNDLDVSNTLVSDQGVKALA-SSPNHLNLQVLSVGGCSAITDKSKACIQKL  587

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLNIQ C  IS   VD L+E LWRCDIL
Sbjct  588  GRTLLGLNIQRCGRISSSTVDNLLEHLWRCDIL  620



>ref|XP_008443991.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis melo]
Length=614

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 111/153 (73%), Gaps = 3/153 (2%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD  L+P ++SC+ GLVKVNLSGC+N+TDK+I A+A+LHG TL+L+NL GC  +TD SL
Sbjct  464  LTDAVLVPLLESCE-GLVKVNLSGCLNLTDKSILALARLHGATLQLVNLEGCRKITDQSL  522

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIAD   VL +LD+S   VSD G+ ALA   A   +L ILSL+GC   + + LP L +L
Sbjct  523  VAIADNLLVLNELDVSNCAVSDRGLIALA--RAQHINLLILSLAGCCGITSRSLPSLERL  580

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLN++ C  IS+  +++LVE LWRCDIL
Sbjct  581  GKTLVGLNLKGCNSISNGSIEVLVENLWRCDIL  613



>emb|CDY35358.1| BnaA04g14890D [Brassica napus]
Length=623

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 111/154 (72%), Gaps = 5/154 (3%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +T+ G L  +Q+    LVKVN SGC  +TD+ +SAI+  +G TLE+LN++GC  ++DASL
Sbjct  475  ITESGFLHLLQN---SLVKVNFSGCSGLTDRVVSAISARNGLTLEVLNMDGCSKISDASL  531

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             +IA  C +L DLD+SK  VSDFGI ALA  S+ +  LQILS++GC + +DK LP + KL
Sbjct  532  VSIAANCQILSDLDLSKCSVSDFGIQALA--SSEKLKLQILSMAGCAMVTDKSLPSIVKL  589

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G++L GLN+Q C  +S   VD +VERL++CDILS
Sbjct  590  GSTLLGLNLQQCRSVSCSTVDFVVERLYKCDILS  623



>ref|NP_197917.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 sp|Q708Y0.1|EBF2_ARATH RecName: Full=EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 gb|AAR27072.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 emb|CAE75865.1| F-box protein [Arabidopsis thaliana]
 dbj|BAE99835.1| leucine-rich repeats containing protein [Arabidopsis thaliana]
 gb|AED93429.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
Length=623

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 104/153 (68%), Gaps = 1/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD G+   +QS + GLVKVNLS CINV+D T+SAI+  HG TLE LNL+GC  +T+ASL
Sbjct  471  VTDAGVRELLQSNNVGLVKVNLSECINVSDNTVSAISVCHGRTLESLNLDGCKNITNASL  530

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             A+A  C  + DLDIS + VSD GI ALA  S    +LQ+LS+ GC   +DK    + KL
Sbjct  531  VAVAKNCYSVNDLDISNTLVSDHGIKALA-SSPNHLNLQVLSIGGCSSITDKSKACIQKL  589

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLNIQ C  IS   VD L+E LWRCDIL
Sbjct  590  GRTLLGLNIQRCGRISSSTVDTLLENLWRCDIL  622



>ref|XP_009397481.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=652

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 107/154 (69%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD  L+  + S + G V+VNL GC+++TD  ++ + K HG TL++LNLNGC  +TD SL
Sbjct  501  VTDASLIQLIGSSEVGFVEVNLCGCVDLTDDLVTLLVKAHGSTLKMLNLNGCKKITDRSL  560

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             A+AD CS+L DLD+S   VSD+G+A LA  SA Q +L +LSLS C   + K +P+L  L
Sbjct  561  LAVADSCSMLDDLDLSCCSVSDYGVAVLA--SARQLNLHVLSLSSCSKVTQKIVPFLGNL  618

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G S+ GLN+QNC  IS  G+ LL E+LW CDI+S
Sbjct  619  GKSMVGLNLQNCSLISTHGIVLLEEKLWWCDIIS  652



>ref|XP_009151059.1| PREDICTED: EIN3-binding F-box protein 2 [Brassica rapa]
Length=622

 Score =   149 bits (376),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 102/153 (67%), Gaps = 1/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD G+   VQS   GLVKV LSGCINV D T+SA++  HG TLE LN++GC  +TDASL
Sbjct  470  VTDAGVFELVQSNSVGLVKVKLSGCINVADNTVSAVSVCHGRTLESLNVDGCKNITDASL  529

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             A+A  C  + DLD+S + VSD G+ ALA  S    +LQ+LS+ GC   +DK    + KL
Sbjct  530  VAVAKNCYSVNDLDVSNTLVSDQGVKALA-SSPNHLNLQVLSIGGCSGVTDKSKACIQKL  588

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLNIQ C  IS   VD L+E LWRCDIL
Sbjct  589  GRALLGLNIQRCGRISSSTVDNLLEHLWRCDIL  621



>gb|KFK32577.1| hypothetical protein AALP_AA6G261300 [Arabis alpina]
Length=630

 Score =   149 bits (376),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 110/154 (71%), Gaps = 5/154 (3%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +T+ G L  +Q+    LVKVN SGC N+TD+ ISAI+  +G TLE+LN++GC  ++DASL
Sbjct  482  ITESGFLHLLQN---SLVKVNFSGCSNLTDRVISAISARNGWTLEVLNVDGCTQISDASL  538

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA  C +L DLDISK  +SD GI ALA  S+    LQILS++GC L +DK LP + +L
Sbjct  539  VAIAANCQILSDLDISKCAISDCGIQALA--SSDNLKLQILSMAGCSLVTDKSLPAIVRL  596

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G++L GLN+Q C  IS   VD LVE+L++CDILS
Sbjct  597  GSTLLGLNLQQCRSISFSTVDFLVEQLYKCDILS  630



>ref|XP_006648432.1| PREDICTED: EIN3-binding F-box protein 1-like [Oryza brachyantha]
Length=490

 Score =   148 bits (374),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 108/154 (70%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD GLLP + S + GLVKV+LSGC N+TD  +SA+ K HG++L+ ++L GCG +TDASL
Sbjct  339  VTDRGLLPLINSSEGGLVKVDLSGCKNITDAAVSALVKGHGKSLKQVSLEGCGKITDASL  398

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AI++ CS L +LD+SK  VSD G+A LA  SA    L++LSLSGC   + K +P+L  +
Sbjct  399  LAISENCSELAELDLSKCMVSDNGVAMLA--SAKHLKLRVLSLSGCSKVTQKIVPFLGNM  456

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G SL GLN+Q C  I +  +  L ++LW CDIL+
Sbjct  457  GQSLEGLNLQFCNMIGNHNIASLEKQLWWCDILA  490



>ref|XP_010472548.1| PREDICTED: EIN3-binding F-box protein 1 [Camelina sativa]
Length=631

 Score =   149 bits (376),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 111/154 (72%), Gaps = 5/154 (3%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +T+ G L  +Q+    LVK+N SGC ++TDK ISAI   +G TLE+LN++GC  ++DAS+
Sbjct  483  ITESGFLHLIQN---SLVKMNFSGCSSLTDKVISAITARNGWTLEVLNIDGCSNISDASM  539

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             +IA  C +L DLD+SK  +SD GI ALA  S+ +  LQILS++GC + +DK LP + +L
Sbjct  540  VSIAANCQILSDLDLSKCSISDSGIQALA--SSEKLKLQILSMAGCSMVTDKSLPAIVRL  597

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G++L GLN+Q C  IS+  VD LVERL++CDILS
Sbjct  598  GSTLLGLNLQQCRSISNSTVDFLVERLYKCDILS  631



>ref|XP_010555012.1| PREDICTED: EIN3-binding F-box protein 2-like [Tarenaya hassleriana]
Length=624

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 103/153 (67%), Gaps = 1/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD GLL  +Q   AGL+KVNLSGCIN+TD  +  I   HG TLE LNL+ C  +TD SL
Sbjct  472  VTDVGLLGLLQYNSAGLLKVNLSGCINITDNAVLTIVTRHGCTLESLNLDTCKNITDTSL  531

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             A++  C  + DLD+S SRVSD GI ALA  S    +LQI S+ GC   +DK L  L KL
Sbjct  532  IAVSKNCYSINDLDVSNSRVSDVGIEALA-SSPNHLNLQIFSIGGCSAVTDKSLASLQKL  590

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G++L GL+I++C  IS   +D L+E+LWRCDIL
Sbjct  591  GHTLLGLSIRHCSKISSSAIDALLEQLWRCDIL  623



>ref|NP_001132560.1| F-box family member [Zea mays]
Length=375

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 108/154 (70%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD GLLP +QS ++GL+KV+LSGC N+TD  +S++ K HG++L+ ++L GC  +TDASL
Sbjct  224  VTDNGLLPLIQSSESGLIKVDLSGCKNITDVAVSSLVKRHGKSLKKVSLEGCSKITDASL  283

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
              +++ C+ L +LD+S   VSD+G+A LA  SA    L++LSLSGC   + K +P+L  L
Sbjct  284  FTMSESCTELAELDLSNCMVSDYGVAMLA--SARHLKLRVLSLSGCSKVTQKSVPFLGNL  341

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G SL GLN+Q C  I +  +  L ++LW CDIL+
Sbjct  342  GQSLEGLNLQFCNMIGNHNIASLEKKLWWCDILA  375



>ref|XP_009381112.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=650

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 107/154 (69%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD  L+P + +   G V+VNLS C+NVTD  ++ + K HG TL++ NL+GC  +TD SL
Sbjct  499  VTDASLIPLIGNSKGGFVEVNLSNCVNVTDVLVAMLVKSHGGTLKVFNLDGCKQITDRSL  558

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIAD CS L +LD+S   +SD+G+A LA  SA Q +L+ILSL+ C   + K LP+L  +
Sbjct  559  LAIADGCSELDNLDLSSCSISDYGVAVLA--SARQLNLRILSLASCSKVTQKSLPFLGNM  616

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G+S+ GLN+Q+C  IS  G+ LL E+LW CDILS
Sbjct  617  GSSMVGLNLQHCRLISTYGIGLLEEKLWWCDILS  650



>ref|XP_006293838.1| hypothetical protein CARUB_v10022822mg [Capsella rubella]
 gb|EOA26736.1| hypothetical protein CARUB_v10022822mg [Capsella rubella]
Length=628

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 109/154 (71%), Gaps = 5/154 (3%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +T+ G L  VQ+    LVKVN +GC N+TD+ ISAI   +G TLE+LN++GC  ++DASL
Sbjct  480  ITESGFLHLVQN---SLVKVNFNGCSNLTDRVISAITARNGWTLEVLNVDGCSKISDASL  536

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             +IA  C +L DLD+SK  +SD GI ALA  S+    LQILSL+GC + +D+ LP +  L
Sbjct  537  VSIAANCQILSDLDLSKCSISDCGIQALA--SSDNLKLQILSLAGCSMVTDESLPAIVSL  594

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G++L GLN+Q C  IS+  VD LVERL++CDILS
Sbjct  595  GSTLLGLNLQQCRSISNSTVDFLVERLYKCDILS  628


 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 45/156 (29%), Positives = 71/156 (46%), Gaps = 10/156 (6%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VT +G    + +C   L   +L  C+ + D T    A  H   L  L++  C    DA+L
Sbjct  400  VTQFGFFGSLLNCGEKLKAFSLVNCLGIRDLTTGLPASPHCSALRSLSIRNCPGFGDANL  459

Query  182  AAIADYCSVLRDLDISKSR-VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLH-  355
            AAI   C  L D+D+   + +++ G   L     +Q SL  ++ +GC   +D+ +  +  
Sbjct  460  AAIGKLCPQLEDIDLCGLKGITESGFLHL-----VQNSLVKVNFNGCSNLTDRVISAITA  514

Query  356  KLGNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            + G +L  LN+  C  IS      LV     C ILS
Sbjct  515  RNGWTLEVLNVDGCSKISDAS---LVSIAANCQILS  547



>emb|CDY19807.1| BnaA09g04600D [Brassica napus]
Length=616

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD G+L  +QS + GLVK+NL+GC+NV+D T+SA++  HG TLE L+L+GC  +TDAS+
Sbjct  464  VTDAGVLSLLQSNNVGLVKLNLNGCVNVSDNTVSAVSFSHGSTLESLSLDGCKNITDASV  523

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
              ++  C  + DLD+S + VSD GI ALA  S    +LQ+LSL GC   +DK    + KL
Sbjct  524  VTVSKNCYSVNDLDVSNTLVSDHGIKALA-SSPNHLNLQVLSLGGCSGITDKSKACIQKL  582

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLNIQ C  IS   VD L+E+LWRCDIL
Sbjct  583  GRTLLGLNIQRCGRISSSTVDSLLEQLWRCDIL  615



>ref|XP_002880682.1| ein3-binding F box protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56941.1| ein3-binding F box protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=629

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 110/154 (71%), Gaps = 5/154 (3%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +T+ G L  ++S    LVKVN SGC N+TD+ ISAI   +G TLE+LN++GC  +TDASL
Sbjct  481  ITESGFLHLIKS---SLVKVNFSGCSNLTDRVISAITARNGWTLEVLNIDGCSNITDASL  537

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             +IA  C +L DLD+SK  +SD G+ ALA  S+ +  LQILS++GC + +DK +P +  L
Sbjct  538  VSIAANCQILSDLDLSKCAISDSGVHALA--SSDKLKLQILSVAGCSMVTDKSMPAIVGL  595

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G++L GLN+Q C  IS+  V+ LVERL++CDILS
Sbjct  596  GSTLLGLNLQQCRSISNSTVEFLVERLYKCDILS  629



>ref|XP_009111664.1| PREDICTED: EIN3-binding F-box protein 2-like [Brassica rapa]
Length=616

 Score =   146 bits (368),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 105/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD G+L  +QS + GLVK+NL+GC+NV+D  +SA++  HG TLE L+L+GC  +TDASL
Sbjct  464  VTDAGVLSLLQSNNVGLVKLNLNGCVNVSDNAVSAVSFSHGSTLESLSLDGCKNITDASL  523

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
              ++  C  + DLD+S + VSD GI ALA  S    +LQ+LSL GC   +DK    + KL
Sbjct  524  VTVSKNCYSVNDLDVSNTLVSDHGIKALA-SSPNHLNLQVLSLGGCSGITDKSKACIQKL  582

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLNIQ C  IS   VD L+E+LWRCDIL
Sbjct  583  GRTLLGLNIQRCGRISSSTVDSLLEQLWRCDIL  615



>ref|XP_002437255.1| hypothetical protein SORBIDRAFT_10g023670 [Sorghum bicolor]
 gb|EER88622.1| hypothetical protein SORBIDRAFT_10g023670 [Sorghum bicolor]
Length=303

 Score =   142 bits (358),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 110/155 (71%), Gaps = 5/155 (3%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD G LP ++S ++GLV V+L+GC N+TD  +SA+ K HG +L  L+L GC  +TDASL
Sbjct  153  VTDNGFLPLLKSSESGLVNVDLNGCENLTDAAVSALVKAHGASLAHLSLEGCSKITDASL  212

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AI++ CS L +LD+S   VSD+G+A LA  +A Q  L+ILSLSGC+  + K +P+L  +
Sbjct  213  FAISESCSQLAELDLSNCMVSDYGVAVLA--AAKQLKLRILSLSGCMKVTQKSVPFLGSM  270

Query  362  GNSLAGLNIQ-NCVGISHRGVDLLVERLWRCDILS  463
             +SL GLN+Q N +G  +R +  L ++LWRCDIL+
Sbjct  271  SSSLEGLNLQFNFIG--NRNIASLEKQLWRCDILA  303



>ref|XP_004170235.1| PREDICTED: LOW QUALITY PROTEIN: EIN3-binding F-box protein 1-like, 
partial [Cucumis sativus]
Length=509

 Score =   145 bits (366),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 109/153 (71%), Gaps = 3/153 (2%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD   +P ++SC+ GLVKVNLSGC+N+TD++I A+A+LHG TL+L+NL+GC  +TD SL
Sbjct  359  LTDAVFVPLLESCE-GLVKVNLSGCLNLTDESIIALARLHGATLQLVNLDGCRKITDQSL  417

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIAD   VL +LD+S   VSD G+ ALA   A   +L ILSL+GC   +   LP L  L
Sbjct  418  VAIADNLLVLNELDVSNCAVSDRGLIALA--RAQHINLSILSLAGCCGITGTSLPCLEIL  475

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLN++ C  IS+  +++LVE LWRCDIL
Sbjct  476  GKTLVGLNLEGCNSISNGSIEVLVENLWRCDIL  508



>gb|ACR35519.1| unknown [Zea mays]
Length=520

 Score =   145 bits (365),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 108/154 (70%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD GLLP +QS ++GL+KV+LSGC N+TD  +S++ K HG++L+ ++L GC  +TDASL
Sbjct  369  VTDNGLLPLIQSSESGLIKVDLSGCKNITDVAVSSLVKRHGKSLKKVSLEGCSKITDASL  428

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
              +++ C+ L +LD+S   VSD+G+A LA  SA    L++LSLSGC   + K +P+L  L
Sbjct  429  FTMSESCTELAELDLSNCMVSDYGVAMLA--SARHLKLRVLSLSGCSKVTQKSVPFLGNL  486

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G SL GLN+Q C  I +  +  L ++LW CDIL+
Sbjct  487  GQSLEGLNLQFCNMIGNHNIASLEKKLWWCDILA  520


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 72/146 (49%), Gaps = 4/146 (3%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            V D GL    +SC   L  VN+  C  V D+ IS++      +L  + L G   +TDASL
Sbjct  133  VGDEGLRAIGRSC-MKLQAVNIKNCPLVGDQGISSLVCSATASLAKIRLQGLN-ITDASL  190

Query  182  AAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHK  358
            A I  Y   + DL +++ + V + G   +A  + +Q +L+ +S++ C   +D  L  + K
Sbjct  191  AVIGYYGKAITDLSLTRLATVGERGFWVMANAAGLQ-NLRCMSVTSCPGVTDLALASIAK  249

Query  359  LGNSLAGLNIQNCVGISHRGVDLLVE  436
               SL  L ++ C  +S  G+    E
Sbjct  250  FCPSLKKLYLRKCGHVSDAGLKAFTE  275


 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 66/133 (50%), Gaps = 8/133 (6%)
 Frame = +2

Query  47   GLVKVNLSG---CINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRD  217
            GL K+++ G      VTD+ +SA+A+     L  L L     +TDA L  IA  C +L  
Sbjct  40   GLEKLSVRGSHPARGVTDQGLSAVAR-GSPNLSSLALWDVPLITDAGLVEIAAGCPLLER  98

Query  218  LDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQN  394
            LDIS+   ++D G+AA A G     SL I     C    D+ L  + +    L  +NI+N
Sbjct  99   LDISRCPLITDKGLAAFAQGCPDLVSLTI---EACSSVGDEGLRAIGRSCMKLQAVNIKN  155

Query  395  CVGISHRGVDLLV  433
            C  +  +G+  LV
Sbjct  156  CPLVGDQGISSLV  168



>ref|XP_008681226.1| PREDICTED: F-box family member isoform X1 [Zea mays]
 gb|AFW70693.1| F-box family member [Zea mays]
Length=643

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 108/154 (70%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD GLLP +QS ++GL+KV+LSGC N+TD  +S++ K HG++L+ ++L GC  +TDASL
Sbjct  492  VTDNGLLPLIQSSESGLIKVDLSGCKNITDVAVSSLVKRHGKSLKKVSLEGCSKITDASL  551

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
              +++ C+ L +LD+S   VSD+G+A LA  SA    L++LSLSGC   + K +P+L  L
Sbjct  552  FTMSESCTELAELDLSNCMVSDYGVAMLA--SARHLKLRVLSLSGCSKVTQKSVPFLGNL  609

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G SL GLN+Q C  I +  +  L ++LW CDIL+
Sbjct  610  GQSLEGLNLQFCNMIGNHNIASLEKKLWWCDILA  643


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 72/146 (49%), Gaps = 4/146 (3%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            V D GL    +SC   L  VN+  C  V D+ IS++      +L  + L G   +TDASL
Sbjct  256  VGDEGLRAIGRSC-MKLQAVNIKNCPLVGDQGISSLVCSATASLAKIRLQGLN-ITDASL  313

Query  182  AAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHK  358
            A I  Y   + DL +++ + V + G   +A  + +Q +L+ +S++ C   +D  L  + K
Sbjct  314  AVIGYYGKAITDLSLTRLATVGERGFWVMANAAGLQ-NLRCMSVTSCPGVTDLALASIAK  372

Query  359  LGNSLAGLNIQNCVGISHRGVDLLVE  436
               SL  L ++ C  +S  G+    E
Sbjct  373  FCPSLKKLYLRKCGHVSDAGLKAFTE  398


 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 66/133 (50%), Gaps = 8/133 (6%)
 Frame = +2

Query  47   GLVKVNLSG---CINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRD  217
            GL K+++ G      VTD+ +SA+A+     L  L L     +TDA L  IA  C +L  
Sbjct  163  GLEKLSVRGSHPARGVTDQGLSAVAR-GSPNLSSLALWDVPLITDAGLVEIAAGCPLLER  221

Query  218  LDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQN  394
            LDIS+   ++D G+AA A G     SL I     C    D+ L  + +    L  +NI+N
Sbjct  222  LDISRCPLITDKGLAAFAQGCPDLVSLTI---EACSSVGDEGLRAIGRSCMKLQAVNIKN  278

Query  395  CVGISHRGVDLLV  433
            C  +  +G+  LV
Sbjct  279  CPLVGDQGISSLV  291



>gb|AEK81539.1| EIN3 binding F-box 1 [Dianthus caryophyllus]
Length=625

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 112/154 (73%), Gaps = 3/154 (2%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLV-KVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDAS  178
            +TD G+L  +++C  G++ K+NL+ CIN++D ++ AI +LHGE+++ L+L+GC  +TD S
Sbjct  473  MTDDGILALLENCQPGIITKLNLNSCINLSDASVLAIVRLHGESVKELSLDGCRKITDTS  532

Query  179  LAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHK  358
            L AIA  C +L DLD+S   V+D GIAAL+  S+ + +LQILS+SGC   S+K LPYL +
Sbjct  533  LFAIAGNCPLLNDLDVSNCSVTDSGIAALS--SSQKLNLQILSISGCTNISNKSLPYLIQ  590

Query  359  LGNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            LG  L GLN+++C  +S   VD+LV  LWRCDIL
Sbjct  591  LGKRLIGLNLKHCSSLSLSTVDMLVGNLWRCDIL  624



>ref|XP_004150592.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
Length=614

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 109/153 (71%), Gaps = 3/153 (2%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD   +P ++SC+ GLVKVNLSGC+N+TD++I A+A+LHG TL+L+NL+GC  +TD SL
Sbjct  464  LTDAVFVPLLESCE-GLVKVNLSGCLNLTDESIIALARLHGATLQLVNLDGCRKITDQSL  522

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIAD   VL +LD+S   VSD G+ ALA   A   +L ILSL+GC   +   LP L  L
Sbjct  523  VAIADNLLVLNELDVSNCAVSDRGLIALA--RAQHINLSILSLAGCCGITGTSLPCLEIL  580

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            G +L GLN++ C  IS+  +++LVE LWRCDIL
Sbjct  581  GKTLVGLNLEGCNSISNGSIEVLVENLWRCDIL  613



>ref|XP_004951542.1| PREDICTED: EIN3-binding F-box protein 1-like [Setaria italica]
Length=654

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 107/154 (69%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD GLLP +QS +AGL+KV+LSGC N+TD  +S++ K HG++L+ ++L GC  +TDASL
Sbjct  503  VTDNGLLPLIQSSEAGLIKVDLSGCKNITDVAVSSLVKAHGKSLKKVSLEGCSKITDASL  562

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
              IA+ C  L +LD+S   VSD+G+A L+  SA    L++LSLSGC   + K +P+L  L
Sbjct  563  FTIAESCMELAELDLSNCMVSDYGVAILS--SARHLKLRVLSLSGCSKVTQKSVPFLGNL  620

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G SL GLN+Q C  I +  +  L ++LW CDIL+
Sbjct  621  GQSLEGLNLQFCNMIGNHNIVSLEKKLWWCDILA  654


 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 67/134 (50%), Gaps = 3/134 (2%)
 Frame = +2

Query  38   CDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRD  217
            C   L  VN+  C +V D+ IS++      +L  + L G   +TDASLA I  Y   + D
Sbjct  276  CCTKLQAVNIKNCAHVGDQGISSLVCSATASLAKIRLQGLN-ITDASLAVIGYYGKAVTD  334

Query  218  LDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQN  394
            L +++ + V + G   +A  + +Q +L+ +S++ C   +D  L  + K   SL  L ++ 
Sbjct  335  LTLTRLATVGERGFWVMANAAGLQ-NLRCMSITSCPGVTDLALSSIAKFCPSLKQLYLRK  393

Query  395  CVGISHRGVDLLVE  436
            C  +S  G+    E
Sbjct  394  CGYVSDAGLTAFTE  407



>ref|XP_010417316.1| PREDICTED: EIN3-binding F-box protein 1-like [Camelina sativa]
Length=632

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 109/154 (71%), Gaps = 5/154 (3%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +T+ G L   Q+    LVKVN SGC ++TDK +SAI   +G TLE+LN++GC  ++DAS+
Sbjct  484  ITESGFLHLTQN---SLVKVNFSGCSSLTDKVVSAITARNGWTLEVLNIDGCSNISDASM  540

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             +IA  C +L DLD+SK  +SD GI ALA  S+ +  LQILS++GC + +DK L  + +L
Sbjct  541  VSIAANCQILSDLDLSKCSISDSGIQALA--SSDKLKLQILSMAGCSMVTDKSLAAIVRL  598

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G++L GLN+Q C  IS+  VD LVERL++CDILS
Sbjct  599  GSTLLGLNLQQCRSISNSTVDFLVERLYKCDILS  632



>emb|CBI21043.3| unnamed protein product [Vitis vinifera]
Length=610

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 100/124 (81%), Gaps = 2/124 (2%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +T+ G LP ++SC+A L+KVNLSGC+N+TD  +SA+AK+HG TLE LNL+GC  +TDAS+
Sbjct  484  ITNAGFLPLLESCEASLIKVNLSGCMNLTDNVVSALAKVHGGTLEQLNLDGCQKITDASM  543

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA+ C++L DLD+SK+ ++D+G+AALA  SA   ++QILSLSGC L S++ +P+L KL
Sbjct  544  FAIAENCALLSDLDVSKTAITDYGVAALA--SAKHLNVQILSLSGCSLISNQSVPFLRKL  601

Query  362  GNSL  373
            G +L
Sbjct  602  GQTL  605



>ref|XP_010322126.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum lycopersicum]
Length=613

 Score =   143 bits (361),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 104/154 (68%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G+ P V++C A LV VNLSGC+N+TD ++S I    G++L+ L ++GC  VTDA+L
Sbjct  462  ITDEGIFPLVKNCAANLVAVNLSGCVNITDISVSYIVNKCGKSLKYLLVDGCKNVTDATL  521

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
              I + C  L  LD+SK  ++D GI  L+  SAIQ  LQILSLSGC L SD  LP+L  L
Sbjct  522  VEIWNSCWTLNVLDVSKCGITDSGITTLS--SAIQLQLQILSLSGCPLVSDNSLPFLLDL  579

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
              +L GLNIQ+C  IS + VD LVE   RCDILS
Sbjct  580  TQNLQGLNIQHCPNISSKTVDALVEINPRCDILS  613



>ref|XP_002453497.1| hypothetical protein SORBIDRAFT_04g006870 [Sorghum bicolor]
 gb|EES06473.1| hypothetical protein SORBIDRAFT_04g006870 [Sorghum bicolor]
Length=655

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 107/154 (69%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD GLLP +QS +AGL+KV+LSGC N+TD  +S++ K HG++L+ ++L GC  +TDASL
Sbjct  504  VTDNGLLPLIQSSEAGLIKVDLSGCKNITDVAVSSLVKGHGKSLKKVSLEGCSKITDASL  563

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
              +++ C+ L +LD+S   VSD G+A LA  SA    L++LSLSGC   + K +P+L  L
Sbjct  564  FTMSESCTELAELDLSNCMVSDHGVAILA--SARHLKLRVLSLSGCSKVTQKSVPFLGNL  621

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G SL GLN+Q C  I +  +  L ++LW CDIL+
Sbjct  622  GQSLEGLNLQFCNMIGNHNIASLEKQLWWCDILA  655



>ref|NP_001046222.1| Os02g0200900 [Oryza sativa Japonica Group]
 dbj|BAD15850.1| putative F-box protein [Oryza sativa Japonica Group]
 dbj|BAF08136.1| Os02g0200900 [Oryza sativa Japonica Group]
Length=511

 Score =   140 bits (352),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 105/154 (68%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD GLLP + S + GLVKV+LSGC N+TD  +S + K HG++L+ ++L GC  +TDASL
Sbjct  360  VTDRGLLPLINSSEGGLVKVDLSGCKNITDAAVSTLVKGHGKSLKQVSLEGCSKITDASL  419

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AI++ C+ L +LD+SK  VSD G+A LA  SA    L++LSLSGC   + K + +L  +
Sbjct  420  FAISENCTELAELDLSKCMVSDNGVATLA--SAKHLKLRVLSLSGCSKVTPKSVSFLGNM  477

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G SL GLN+Q C  I +  +  L ++LW CDIL+
Sbjct  478  GQSLEGLNLQFCNMIGNHNIASLEKQLWWCDILA  511



>ref|XP_004965933.1| PREDICTED: EIN3-binding F-box protein 1-like [Setaria italica]
Length=628

 Score =   140 bits (353),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 109/155 (70%), Gaps = 5/155 (3%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD G LP ++S ++GLV V+L+GC N+TD  +SA+ K HG +L  L+L GC  +TDASL
Sbjct  478  VTDNGFLPLIKSSESGLVNVDLNGCENLTDAAVSALVKAHGASLAHLSLEGCSRITDASL  537

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AI++ CS L +LD+S   VSD+G+A LA  +A Q  L+ILSLSGC+  + K +P+L  +
Sbjct  538  FAISESCSQLAELDLSNCMVSDYGVAVLA--AAKQLKLRILSLSGCMKVTQKSVPFLGSM  595

Query  362  GNSLAGLNIQ-NCVGISHRGVDLLVERLWRCDILS  463
             +SL GLN+Q N +G  +  +  L ++LWRCDIL+
Sbjct  596  SSSLEGLNLQFNFIG--NHNIASLEKQLWRCDILA  628



>gb|EAY84905.1| hypothetical protein OsI_06273 [Oryza sativa Indica Group]
Length=653

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 105/154 (68%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD GLLP + S + GLVKV+LSGC N+TD  +S + K HG++L+ ++L GC  +TDASL
Sbjct  502  VTDRGLLPLINSSEGGLVKVDLSGCKNITDAAVSTLVKGHGKSLKQVSLEGCSKITDASL  561

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AI++ C+ L +LD+SK  VSD G+A LA  SA    L++LSLSGC   + K + +L  +
Sbjct  562  FAISENCTELAELDLSKCMVSDNGVATLA--SAKHLKLRVLSLSGCSKVTPKSVSFLGNM  619

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G SL GLN+Q C  I +  +  L ++LW CDIL+
Sbjct  620  GQSLEGLNLQFCNMIGNHNIASLEKQLWWCDILA  653


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 71/139 (51%), Gaps = 6/139 (4%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLH-GETLELLNLNGCGCVTDAS  178
            VT  G+L F+ +C      ++L  C+ + D   S  A+L   ++L+ L +  C   TDAS
Sbjct  422  VTLVGILDFLVNCGPKFRSLSLVKCMGIKD-ICSTPARLPLCKSLQFLTIKDCPDFTDAS  480

Query  179  LAAIADYCSVLRDLDISKSR-VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLH  355
            LA +   C  L  +D+S+ R V+D G+  L   S  +  L  + LSGC   +D  +  L 
Sbjct  481  LAVVGMVCPYLEQVDLSRLREVTDRGLLPLINSS--EGGLVKVDLSGCKNITDAAVSTLV  538

Query  356  K-LGNSLAGLNIQNCVGIS  409
            K  G SL  ++++ C  I+
Sbjct  539  KGHGKSLKQVSLEGCSKIT  557



>dbj|BAD15849.1| putative F-box protein [Oryza sativa Japonica Group]
 gb|EAZ22129.1| hypothetical protein OsJ_05792 [Oryza sativa Japonica Group]
Length=660

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 105/154 (68%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD GLLP + S + GLVKV+LSGC N+TD  +S + K HG++L+ ++L GC  +TDASL
Sbjct  509  VTDRGLLPLINSSEGGLVKVDLSGCKNITDAAVSTLVKGHGKSLKQVSLEGCSKITDASL  568

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AI++ C+ L +LD+SK  VSD G+A LA  SA    L++LSLSGC   + K + +L  +
Sbjct  569  FAISENCTELAELDLSKCMVSDNGVATLA--SAKHLKLRVLSLSGCSKVTPKSVSFLGNM  626

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G SL GLN+Q C  I +  +  L ++LW CDIL+
Sbjct  627  GQSLEGLNLQFCNMIGNHNIASLEKQLWWCDILA  660



>ref|NP_001147557.1| LOC100281166 [Zea mays]
 gb|ACG27917.1| EIN3-binding F-box protein 1 [Zea mays]
 gb|AFW76402.1| EIN3-binding F-box protein 1 [Zea mays]
Length=626

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 109/155 (70%), Gaps = 5/155 (3%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD G LP ++S ++GLV V+L+GC N+TD  +SA+ K HG +L  L+L GC  +TDASL
Sbjct  476  VTDSGFLPLIKSSNSGLVNVDLNGCENLTDAAVSALVKAHGASLAHLSLEGCSKITDASL  535

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AI++ CS L +LD+S   VSD+G+A LA  +A Q  L++LSLSGC+  + K +P+L  +
Sbjct  536  FAISESCSQLAELDLSNCMVSDYGVAVLA--AAKQLRLRVLSLSGCMKVTQKSVPFLGSM  593

Query  362  GNSLAGLNIQ-NCVGISHRGVDLLVERLWRCDILS  463
             +SL GLN+Q N +G  +  +  L ++LWRCDIL+
Sbjct  594  SSSLEGLNLQFNFIG--NHNIASLEKQLWRCDILA  626


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 63/118 (53%), Gaps = 5/118 (4%)
 Frame = +2

Query  83   VTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIA  259
            VTD  ISA+A+   E L  L L     VTDA LA +A  C  L  LDIS    ++D G+A
Sbjct  159  VTDAGISALARGCPE-LRSLTLWDVPQVTDAGLAEVAAECHSLERLDISGCPMITDKGLA  217

Query  260  ALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLV  433
            A+A G      L+ L++ GC   +++ L  + +    L  ++I+NC  +  +GV  LV
Sbjct  218  AVAQGCP---ELKSLTIEGCSGVANEGLKAVGRFCAKLQAVSIKNCALVDDQGVSGLV  272



>ref|NP_001145991.1| uncharacterized protein LOC100279520 [Zea mays]
 gb|ACL52991.1| unknown [Zea mays]
Length=522

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 106/154 (69%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD GLLP +QS +AGLVKV+LSGC N+TD  +S++ K HG++L+ +NL GC  +TDA L
Sbjct  371  VTDNGLLPLIQSSEAGLVKVDLSGCKNITDVAVSSLVKGHGKSLKKINLEGCSKITDAIL  430

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
              +++ C+ L +L++S   VSD+G+A LA  SA    L++LSLSGC   + K + +L  L
Sbjct  431  FTMSESCTELAELNLSNCMVSDYGVAILA--SARHLKLRVLSLSGCSKVTQKSVLFLGNL  488

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G S+ GLN+Q C  I +  +  L ++LW CDIL+
Sbjct  489  GQSIEGLNLQFCDMIGNHNIASLEKKLWWCDILA  522



>ref|XP_006657116.1| PREDICTED: EIN3-binding F-box protein 1-like [Oryza brachyantha]
Length=590

 Score =   137 bits (345),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 109/155 (70%), Gaps = 5/155 (3%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD GLLP ++S ++GLV V+L+GC N+TD T+SA+ K HG +L  L+L GC  +TDASL
Sbjct  440  VTDNGLLPLIKSSESGLVHVDLNGCENLTDATVSALVKAHGSSLARLSLEGCSKITDASL  499

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AI++ C+ L +LD+S   VSD+G+A LA  SA Q  L++LSLSGC+  + K +P+L  +
Sbjct  500  FAISEGCTDLAELDLSNCMVSDYGVAVLA--SARQLKLRVLSLSGCLKVTQKSVPFLGSM  557

Query  362  GNSLAGLNIQ-NCVGISHRGVDLLVERLWRCDILS  463
              SL GLN+Q N +G  +  +  L ++LW CDIL+
Sbjct  558  SASLEGLNLQFNFIG--NHNIASLEKQLWWCDILA  590



>ref|XP_008677099.1| PREDICTED: uncharacterized protein LOC100279520 isoform X1 [Zea 
mays]
 ref|XP_008677100.1| PREDICTED: uncharacterized protein LOC100279520 isoform X1 [Zea 
mays]
Length=651

 Score =   137 bits (346),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 106/154 (69%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD GLLP +QS +AGLVKV+LSGC N+TD  +S++ K HG++L+ +NL GC  +TDA L
Sbjct  500  VTDNGLLPLIQSSEAGLVKVDLSGCKNITDVAVSSLVKGHGKSLKKINLEGCSKITDAIL  559

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
              +++ C+ L +L++S   VSD+G+A LA  SA    L++LSLSGC   + K + +L  L
Sbjct  560  FTMSESCTELAELNLSNCMVSDYGVAILA--SARHLKLRVLSLSGCSKVTQKSVLFLGNL  617

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G S+ GLN+Q C  I +  +  L ++LW CDIL+
Sbjct  618  GQSIEGLNLQFCDMIGNHNIASLEKKLWWCDILA  651



>dbj|BAD35544.1| putative F-box protein Fbl2 [Oryza sativa Japonica Group]
 dbj|BAG89384.1| unnamed protein product [Oryza sativa Japonica Group]
Length=627

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 109/155 (70%), Gaps = 5/155 (3%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD GLLP ++S ++GLV V+L+GC N+TD T+SA+ K HG +L  L+L GC  +TDASL
Sbjct  477  VTDNGLLPLIKSSESGLVHVDLNGCENLTDATVSALVKAHGSSLARLSLEGCSRITDASL  536

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AI++ C+ L +LD+S   VSD+G+A LA  SA Q  L++LSLSGC+  + K +P+L  +
Sbjct  537  FAISEGCTDLAELDLSNCMVSDYGVAVLA--SARQLKLRVLSLSGCLKVTQKSVPFLGSM  594

Query  362  GNSLAGLNIQ-NCVGISHRGVDLLVERLWRCDILS  463
              SL GLN+Q N +G  +  +  L ++LW CDIL+
Sbjct  595  SASLEGLNLQFNFIG--NHNIASLEKQLWWCDILA  627


 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 67/137 (49%), Gaps = 4/137 (3%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            V D GL    + C A L  VN+  C +V D+ +S +      +L  + L G   +TDASL
Sbjct  239  VADEGLKAIGRCC-AKLQSVNIKNCAHVGDQGVSGLVCSAAASLAKVRLQGLS-ITDASL  296

Query  182  AAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHK  358
            + I  Y   + DL +++   V + G   +A    +Q  L+ +S+S C   +D  L  + K
Sbjct  297  SVIGYYGKAITDLTLARLPAVGERGFWVMANALGLQ-KLRFMSVSSCPGVTDLALASIAK  355

Query  359  LGNSLAGLNIQNCVGIS  409
               SL  LN++ C  +S
Sbjct  356  FCPSLKQLNLKKCGQVS  372



>gb|ACB59221.1| F-box protein [Brassica oleracea]
Length=629

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 105/154 (68%), Gaps = 5/154 (3%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
             T+ G L  +QS    LVK+ LSGC N+TD+ ISAI   +G TLE+LN +GC  +TDASL
Sbjct  481  TTESGNLHLIQS---SLVKIKLSGCSNLTDRVISAITARNGWTLEVLNRDGCSNITDASL  537

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             +IA  C +L DLDIS+  +SD GI ALA  S+ +  LQILS++GC + +DK LP +  L
Sbjct  538  VSIAANCQILSDLDISECAISDSGIQALA--SSDKLKLQILSVAGCSMVTDKRLPAIVGL  595

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G++L GLN+Q C  IS+  VD LV  L++CD LS
Sbjct  596  GSTLLGLNLQQCRSISNSPVDFLVGSLYKCDALS  629



>gb|EAZ01599.1| hypothetical protein OsI_23635 [Oryza sativa Indica Group]
 gb|EAZ37582.1| hypothetical protein OsJ_21915 [Oryza sativa Japonica Group]
Length=664

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 109/155 (70%), Gaps = 5/155 (3%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD GLLP ++S ++GLV V+L+GC N+TD T+SA+ K HG +L  L+L GC  +TDASL
Sbjct  514  VTDNGLLPLIKSSESGLVHVDLNGCENLTDATVSALVKAHGSSLARLSLEGCSRITDASL  573

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AI++ C+ L +LD+S   VSD+G+A LA  SA Q  L++LSLSGC+  + K +P+L  +
Sbjct  574  FAISEGCTDLAELDLSNCMVSDYGVAVLA--SARQLKLRVLSLSGCLKVTQKSVPFLGSM  631

Query  362  GNSLAGLNIQ-NCVGISHRGVDLLVERLWRCDILS  463
              SL GLN+Q N +G  +  +  L ++LW CDIL+
Sbjct  632  SASLEGLNLQFNFIG--NHNIASLEKQLWWCDILA  664


 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 67/137 (49%), Gaps = 4/137 (3%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            V D GL    + C A L  VN+  C +V D+ +S +      +L  + L G   +TDASL
Sbjct  276  VADEGLKAIGRCC-AKLQSVNIKNCAHVGDQGVSGLVCSAAASLAKVRLQGLS-ITDASL  333

Query  182  AAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHK  358
            + I  Y   + DL +++   V + G   +A    +Q  L+ +S+S C   +D  L  + K
Sbjct  334  SVIGYYGKAITDLTLARLPAVGERGFWVMANALGLQ-KLRFMSVSSCPGVTDLALASIAK  392

Query  359  LGNSLAGLNIQNCVGIS  409
               SL  LN++ C  +S
Sbjct  393  FCPSLKQLNLKKCGQVS  409



>gb|AFW66152.1| hypothetical protein ZEAMMB73_923849 [Zea mays]
Length=754

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 106/154 (69%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD GLLP +QS +AGLVKV+LSGC N+TD  +S++ K HG++L+ +NL GC  +TDA L
Sbjct  603  VTDNGLLPLIQSSEAGLVKVDLSGCKNITDVAVSSLVKGHGKSLKKINLEGCSKITDAIL  662

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
              +++ C+ L +L++S   VSD+G+A LA  SA    L++LSLSGC   + K + +L  L
Sbjct  663  FTMSESCTELAELNLSNCMVSDYGVAILA--SARHLKLRVLSLSGCSKVTQKSVLFLGNL  720

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G S+ GLN+Q C  I +  +  L ++LW CDIL+
Sbjct  721  GQSIEGLNLQFCDMIGNHNIASLEKKLWWCDILA  754



>gb|EMS45959.1| hypothetical protein TRIUR3_29988 [Triticum urartu]
Length=383

 Score =   133 bits (334),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 108/155 (70%), Gaps = 5/155 (3%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD GLLP ++S ++GL+ V+L+GC N+TD  ISA+ K HG +L  L+L GC  +TDASL
Sbjct  233  VTDDGLLPLIRSSESGLIHVDLNGCENLTDAAISALVKAHGTSLAHLSLEGCSKITDASL  292

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AI++ CS L +LD+S   VSD+G+A L+  SA +  L++LSLSGC+  + K +P+L  +
Sbjct  293  FAISESCSELAELDLSNCMVSDYGVAVLS--SAERLKLRVLSLSGCLKVTPKSVPFLGSM  350

Query  362  GNSLAGLNIQ-NCVGISHRGVDLLVERLWRCDILS  463
              SL GLN+Q N +G  +  +  L ++LW CDIL+
Sbjct  351  PASLEGLNLQFNFIG--NHNIASLEKQLWWCDILA  383



>gb|EMT32544.1| hypothetical protein F775_30491 [Aegilops tauschii]
Length=452

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 108/155 (70%), Gaps = 5/155 (3%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD GLLP ++S ++GLV V+L+GC N+TD  ISA+ K HG +L  L+L GC  ++DASL
Sbjct  302  VTDDGLLPLIRSSESGLVHVDLNGCENLTDAAISALVKAHGTSLAHLSLEGCSKISDASL  361

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AI++ CS L +LD+S   VSD+G+A LA  SA +  L++LSLSGC+  + K +P+L  +
Sbjct  362  FAISESCSELAELDLSNCMVSDYGVAVLA--SAERLKLRVLSLSGCLKVTPKSVPFLGSM  419

Query  362  GNSLAGLNIQ-NCVGISHRGVDLLVERLWRCDILS  463
              SL GLN+Q N +G  +  +  L ++LW CDIL+
Sbjct  420  PASLEGLNLQFNFIG--NHNIASLEKQLWWCDILA  452



>gb|AFA36487.1| EIN3-binding F-box protein, partial [Lolium perenne]
Length=263

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 105/155 (68%), Gaps = 5/155 (3%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD GLLP ++S ++GLV V+L+GC N+TD  ISA+ K HG +L  L+L  C  +TDASL
Sbjct  113  VTDNGLLPLIRSSESGLVNVDLNGCENLTDAAISALVKAHGGSLAHLSLESCSKITDASL  172

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AI++ C  L +LD+S   VSD+G+A LA  SA    L+ILSLSGC+  + K +P+L  +
Sbjct  173  FAISESCYELAELDLSNCMVSDYGVAVLA--SAAGLKLRILSLSGCLKVTQKSVPFLGSM  230

Query  362  GNSLAGLNIQ-NCVGISHRGVDLLVERLWRCDILS  463
              SL GLN+Q N +G  +  +  L ++LW CDIL+
Sbjct  231  PASLEGLNLQFNFIG--NHNIASLEKQLWWCDILA  263



>ref|XP_003603398.1| Ein3-binding f-box protein, partial [Medicago truncatula]
Length=627

 Score =   132 bits (333),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G +  +Q   A L  VNLSGCIN+TD  + ++ KLH  TL +LNLNGC  V DASL
Sbjct  490  ITDPGFISLLQRSKASLGNVNLSGCINLTDVGVLSMVKLHCSTLGVLNLNGCKKVGDASL  549

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIAD C VL DLD+S+  ++D GI+AL  G  + F+L +LSL+GC L S+K L  L KL
Sbjct  550  TAIADNCIVLSDLDVSECAITDAGISALTRG--VLFNLDVLSLAGCSLVSNKSLSALKKL  607

Query  362  GNSLAGLNIQNCVGISHRGV  421
            G+SL GLNI+NC  IS R V
Sbjct  608  GDSLEGLNIKNCKSISSRTV  627



>ref|XP_003563656.1| PREDICTED: EIN3-binding F-box protein 1 [Brachypodium distachyon]
 gb|ACF22741.1| EIN3-binding F-box protein [Brachypodium distachyon]
Length=642

 Score =   132 bits (332),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 107/155 (69%), Gaps = 5/155 (3%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD GLLP ++S ++GL+ V+L+GC N+TD +ISA+ K HG +L  L+L GC  ++DASL
Sbjct  492  VTDNGLLPLIKSSESGLIHVDLNGCENLTDASISALVKAHGNSLTHLSLEGCSKISDASL  551

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AI++ C  L +LD+S   VSD+G+A LA  SA Q  L++LSLSGC   + K +P+L  +
Sbjct  552  FAISESCCELAELDLSNCMVSDYGVAVLA--SAGQLKLRVLSLSGCFKVTQKSVPFLGSM  609

Query  362  GNSLAGLNIQ-NCVGISHRGVDLLVERLWRCDILS  463
              SL GLN+Q N +G  +  +  L ++LW CDIL+
Sbjct  610  PVSLEGLNLQFNFIG--NHNIASLEKQLWWCDILA  642


 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 72/139 (52%), Gaps = 6/139 (4%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCGCVTDAS  178
            VT  G+L F+ +C      ++L  CI + D   SA A+L   ++L  L +  C   TDAS
Sbjct  412  VTLMGILAFLLNCSPKFKALSLVKCIGIKD-ICSAPAQLPVCKSLRSLTIKDCPGFTDAS  470

Query  179  LAAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLH  355
            LA +   C  L ++D+S  + V+D G+  L   S  +  L  + L+GC   +D  +  L 
Sbjct  471  LAVVGMICPHLENVDLSGLAAVTDNGLLPLIKSS--ESGLIHVDLNGCENLTDASISALV  528

Query  356  KL-GNSLAGLNIQNCVGIS  409
            K  GNSL  L+++ C  IS
Sbjct  529  KAHGNSLTHLSLEGCSKIS  547



>gb|AFW87207.1| hypothetical protein ZEAMMB73_795948 [Zea mays]
Length=626

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 108/156 (69%), Gaps = 6/156 (4%)
 Frame = +2

Query  2    VTDYGLLPFVQS-CDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDAS  178
            VTD G LP ++   ++GLV+V L+GC ++TD  +SA+AK HG +L  L+L GC  +TDAS
Sbjct  475  VTDNGFLPLMKKGSESGLVRVGLNGCESLTDAAVSALAKAHGASLAHLSLEGCSKITDAS  534

Query  179  LAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHK  358
            L AI++ CS L +LD+S   VSD+G+A LA  +A Q  L++LSLSGC+  + K +P+L  
Sbjct  535  LFAISESCSQLAELDLSNCMVSDYGVAVLA--AARQLKLRVLSLSGCMKVTQKSVPFLGS  592

Query  359  LGNSLAGLNIQ-NCVGISHRGVDLLVERLWRCDILS  463
            + +SL  LN+Q N +G  +  +  L ++LWRCDIL+
Sbjct  593  MSSSLEALNLQFNFIG--NHNIASLEKQLWRCDILA  626


 Score = 48.1 bits (113),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 71/139 (51%), Gaps = 5/139 (4%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCGCVTDAS  178
            VT  G+L F+ +C+     ++LS CI + D   SA A+L   ++L  L +  C   TDAS
Sbjct  395  VTLVGILAFLLNCNPKFKALSLSKCIGIKD-ICSAPAQLPVCKSLRSLTIKDCPGFTDAS  453

Query  179  LAAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLH  355
            LA +   C  L  +D+S    V+D G   L    + +  L  + L+GC   +D  +  L 
Sbjct  454  LAVVGMICPQLESIDLSGLGAVTDNGFLPLMKKGS-ESGLVRVGLNGCESLTDAAVSALA  512

Query  356  KL-GNSLAGLNIQNCVGIS  409
            K  G SLA L+++ C  I+
Sbjct  513  KAHGASLAHLSLEGCSKIT  531



>emb|CDP10419.1| unnamed protein product [Coffea canephora]
Length=628

 Score =   130 bits (326),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 97/154 (63%), Gaps = 26/154 (17%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD  LLP ++SC++ LVKVNLS C  +TDK I A+A+LHG TLELLNL GC  VTDASL
Sbjct  501  ITDAALLPLLESCES-LVKVNLSDCGILTDKVIIALAELHGATLELLNLEGCKKVTDASL  559

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIAD C  L DLD+SK  ++D G+AAL+ G  +  +LQ                     
Sbjct  560  VAIADSCLFLNDLDVSKCSITDSGVAALSNG--VHLNLQ---------------------  596

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
              +L GLN+Q+C  IS   ++ LVE LWRCDILS
Sbjct  597  --TLVGLNLQHCNSISSSSIERLVENLWRCDILS  628



>ref|XP_003571400.1| PREDICTED: EIN3-binding F-box protein 1-like [Brachypodium distachyon]
Length=655

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 104/154 (68%), Gaps = 3/154 (2%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLLP + S +   VKV+LSGC N+TD  +S++ K+HG++++ ++L GC  +TDASL
Sbjct  505  ITDNGLLPLIGSSEGAFVKVDLSGCKNITDLAVSSLVKVHGKSVKQVSLEGCSKITDASL  564

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             +I++ C+ L +LD+S   VSD G+A+LA  S   F L++LSL GC   + + +P+L  +
Sbjct  565  FSISENCTELAELDLSNCMVSDSGVASLASTS--NFKLRVLSLFGCSNVTQRSVPFLGNM  622

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G  L GLNIQ C  I +  +  L ++LW CDIL+
Sbjct  623  GK-LEGLNIQFCNMIGNHNIASLEKQLWWCDILA  655



>dbj|BAJ88579.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97493.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=649

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 104/154 (68%), Gaps = 3/154 (2%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GLLP ++S +  LVKV+LSGC N+TD T+S++ K HG++++ ++L GC  +TDASL
Sbjct  499  ITDNGLLPLIKSSEGSLVKVDLSGCKNITDVTVSSLVKAHGKSVKQVSLEGCSKITDASL  558

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
              I++ C+ L +LD+S   VSD G+A+LA  SA  F L++LSL GC   +   + +L  +
Sbjct  559  FCISENCTELAELDLSNCMVSDSGVASLA--SAKHFKLRVLSLFGCSNVTQASVQFLGSM  616

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G  L GLN+Q C  I +  +  L ++LW CDI++
Sbjct  617  GK-LEGLNLQYCNMIGNHNIASLEKQLWWCDIVA  649



>emb|CAN82790.1| hypothetical protein VITISV_030601 [Vitis vinifera]
Length=718

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 86/105 (82%), Gaps = 2/105 (2%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +T+ G LP ++SC+A L+KVNLSGC+N+TD  +SA+AK+HG TLE LNL+GC  +TDAS+
Sbjct  616  ITNAGFLPLLESCEASLIKVNLSGCMNLTDNVVSALAKVHGGTLEQLNLDGCQKITDASM  675

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSG  316
             AIA+ C++L DLD+SK+ ++D+G+AALA  SA   ++QILSLSG
Sbjct  676  FAIAENCALLSDLDVSKTAITDYGVAALA--SAKHLNVQILSLSG  718



>gb|EMS68820.1| hypothetical protein TRIUR3_29831 [Triticum urartu]
Length=484

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 100/154 (65%), Gaps = 3/154 (2%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD GLLP + S +  LVKV+LSGC N+TD  +S++ K HG++++ ++L GC  +TDASL
Sbjct  334  VTDNGLLPLINSSEGSLVKVDLSGCKNITDVAVSSLVKAHGKSVKQISLEGCSKITDASL  393

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
              I++ C+ L  LD+S   VSD G+A+LA  SA  F L+ LSL GC   +   + +L  +
Sbjct  394  FCISENCTELAGLDLSNCMVSDSGVASLA--SAKHFKLRALSLFGCSKVTQVSVQFLGSM  451

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G  L GLN+Q C  I +  +  L ++LW CDIL+
Sbjct  452  GK-LEGLNLQYCNMIGNHNIASLEKQLWWCDILA  484



>gb|EMT19526.1| hypothetical protein F775_07091 [Aegilops tauschii]
Length=939

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 102/154 (66%), Gaps = 3/154 (2%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD GLL  ++S +  LVKV+LSGC N+TD  +S++ K HG++++ ++L GC  +TDASL
Sbjct  789  VTDNGLLLLIKSSEGSLVKVDLSGCKNITDVAVSSLVKAHGKSVKQVSLEGCSKITDASL  848

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
              I++ C+ L +LD+S   VSD G+A+LA  SA  F L++LSL GC   +   + +L  +
Sbjct  849  FCISENCTELAELDLSNCMVSDSGVASLA--SAKHFKLRVLSLFGCSKVTQVGVQFLGSM  906

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G  L GLN+Q C  I +  +  L ++LW CDIL+
Sbjct  907  GK-LEGLNLQYCNMIGNHNIASLEKQLWWCDILA  939



>ref|NP_001237471.1| grr1 protein [Glycine max]
 gb|AAB70660.1| grr1 [Glycine max]
Length=690

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 81/108 (75%), Gaps = 2/108 (2%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD G LP ++S +AGLVKVNL+GC+N++D+ + ++   HG TLE+L+L+GC  V DASL
Sbjct  529  VTDAGFLPLLESSEAGLVKVNLNGCVNLSDRVVLSMVNSHGWTLEVLSLDGCKRVGDASL  588

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVL  325
             AIA  C +L DLD+S+  ++D GIAALA G   Q +L++LSL+GC +
Sbjct  589  MAIAGSCPLLADLDVSRCAITDTGIAALARGK--QINLEVLSLAGCAI  634



>emb|CDX76980.1| BnaC04g37750D [Brassica napus]
Length=599

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 91/154 (59%), Gaps = 29/154 (19%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VT+ G L  +Q+    LVKVN SGC  +TD+ +SAI+  +                    
Sbjct  475  VTESGFLHLLQN---SLVKVNFSGCSGLTDRVVSAISARNAN------------------  513

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
                  C +L DLD+SK  VSDFGI ALA  S+ +  LQILS++GC + +DK LP + KL
Sbjct  514  ------CQILSDLDLSKCSVSDFGIQALA--SSEKLKLQILSMAGCAMVTDKSLPSIVKL  565

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G++L GLN+Q C  +S   VD L+ERL++CDILS
Sbjct  566  GSTLLGLNLQQCRSVSCSTVDFLLERLYKCDILS  599



>ref|NP_001058023.1| Os06g0605900 [Oryza sativa Japonica Group]
 dbj|BAF19937.1| Os06g0605900, partial [Oryza sativa Japonica Group]
Length=122

 Score =   103 bits (256),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 85/126 (67%), Gaps = 5/126 (4%)
 Frame = +2

Query  89   DKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALA  268
            D T+SA+ K HG +L  L+L GC  +TDASL AI++ C+ L +LD+S   VSD+G+A LA
Sbjct  1    DATVSALVKAHGSSLARLSLEGCSRITDASLFAISEGCTDLAELDLSNCMVSDYGVAVLA  60

Query  269  GGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQ-NCVGISHRGVDLLVERLW  445
              SA Q  L++LSLSGC+  + K +P+L  +  SL GLN+Q N +G  +  +  L ++LW
Sbjct  61   --SARQLKLRVLSLSGCLKVTQKSVPFLGSMSASLEGLNLQFNFIG--NHNIASLEKQLW  116

Query  446  RCDILS  463
             CDIL+
Sbjct  117  WCDILA  122



>ref|XP_010264613.1| PREDICTED: EIN3-binding F-box protein 2-like [Nelumbo nucifera]
Length=645

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 94/157 (60%), Gaps = 6/157 (4%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAG----LVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT  169
            +TD G++  +Q+ +      LV V++SG   +TD ++ AI  + GE L  L L+GC  ++
Sbjct  489  ITDQGVINLIQTLNTNTVHRLVSVDMSGSSGITDLSVYAITSIVGEKLRCLILDGCERLS  548

Query  170  DASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPY  349
            D SL  I++ C  L DL +S+  +SD GI  L   S     L++LSL GCV  +D+CL Y
Sbjct  549  DLSLKMISERCPCLIDLGLSRCCISDDGIFCLT--STQMRCLKVLSLGGCVGITDRCLNY  606

Query  350  LHKLGNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
            L  +  SL GL++++C  ++  G+D + E LW CD+L
Sbjct  607  LLMIRGSLVGLDLKHCPQLTKEGIDAISETLWWCDLL  643



>ref|XP_002981899.1| hypothetical protein SELMODRAFT_233861 [Selaginella moellendorffii]
 gb|EFJ16992.1| hypothetical protein SELMODRAFT_233861 [Selaginella moellendorffii]
Length=595

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 96/154 (62%), Gaps = 4/154 (3%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            ++D GLL F+++  + LV +NLS C+ +TDK I  +++   E L+ + L+GC  V+D S+
Sbjct  443  LSDTGLLAFLETSGSSLVFLNLSDCVELTDKAIVGVSRKCFE-LQTVILDGCVKVSDKSV  501

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
              +A  C  L++LD+S   ++D GI A+    ++  +L+ LSLSGC   +D+ LP + K+
Sbjct  502  GVLASQCRSLQELDVSNCSITDDGIVAVV--ISVGPTLKTLSLSGCSRVTDESLPTIQKM  559

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERL-WRCDIL  460
             +SL  LN++NC G +   ++  V  L  RCDIL
Sbjct  560  CDSLTALNLKNCSGFTAAALEKFVSDLGTRCDIL  593



>ref|XP_006849175.1| hypothetical protein AMTR_s00027p00189050 [Amborella trichopoda]
 gb|ERN10756.1| hypothetical protein AMTR_s00027p00189050 [Amborella trichopoda]
Length=620

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 90/154 (58%), Gaps = 2/154 (1%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VT+ G++  +        +V+LSGC  V+D ++ A+    G  +  L+L+GC  V DASL
Sbjct  469  VTNLGIMALLDVRKEVWTEVSLSGCARVSDDSVVALCNGCGGGIRTLSLDGCVQVGDASL  528

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AIA  C+ + DLD+S+  VSD G+  LA       SL+I SLSGC   S+ C+ +L ++
Sbjct  529  EAIARLCTCINDLDLSQCAVSDLGLEFLARMGCT--SLRIFSLSGCSRISNGCMSFLKEV  586

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS  463
            G  L GLN+ +C G+S   ++ L   L +CDI S
Sbjct  587  GAGLVGLNLMHCGGLSRMAIERLKGSLSKCDIAS  620


 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 55/104 (53%), Gaps = 4/104 (4%)
 Frame = +2

Query  131  LELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILS  307
            LE L+L  CG + DA L AIA  C++LR LD+     V+D G+ A+A  S+   +L  L+
Sbjct  197  LESLSLWECGSIGDAGLEAIAMGCTLLRKLDLRNCPLVTDKGLVAIAKTSS---NLSSLT  253

Query  308  LSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVER  439
            L  C    D  L    K  N++  L++ NC  I   G+  +V R
Sbjct  254  LEACPNVGDPALEATSKCSNNIKSLSLNNCPCIGDEGLRSMVSR  297



>ref|XP_010251723.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=655

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 91/156 (58%), Gaps = 5/156 (3%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAG---LVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTD  172
            +TD G+   +++ +      + V+LSGC  +TD ++  I  L G+ L  L L+ C  +TD
Sbjct  501  ITDQGVENLIRALETEQNRRISVDLSGCSRITDWSVFVITSLIGDKLRSLMLDWCEKLTD  560

Query  173  ASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYL  352
             SL  IA+ C+ L DL +S  R+SD G+  L   S +Q  L+++S +GCV  SD+ L YL
Sbjct  561  LSLKMIAERCACLLDLGLSGCRISDDGVYCLV-ASKLQ-CLEVVSFAGCVGISDQSLHYL  618

Query  353  HKLGNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL  460
              L   L GLN+ +C  ++  G+D + E LW CD+L
Sbjct  619  RMLRCYLVGLNLMHCPKLTKEGIDRMRENLWWCDLL  654



>ref|XP_002986021.1| hypothetical protein SELMODRAFT_123441 [Selaginella moellendorffii]
 gb|EFJ12840.1| hypothetical protein SELMODRAFT_123441 [Selaginella moellendorffii]
Length=647

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 95/154 (62%), Gaps = 4/154 (3%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            ++D GLL F+++  + LV +NLS C+ +TDK I  +++   E L+ + L+GC  V+D S+
Sbjct  495  LSDTGLLAFLETSGSSLVFLNLSDCVELTDKAIVGVSRKCFE-LQTVILDGCVKVSDKSV  553

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
              +A  C  L++LD+S   ++D GI A+    ++  +L+ LSLSGC   +D+ LP + K+
Sbjct  554  GVLASQCRSLQELDVSNCSITDDGIVAVV--ISVGPTLKTLSLSGCSRVTDESLPTIQKM  611

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERL-WRCDIL  460
             +SL  LN++NC G +   ++     L  RCDIL
Sbjct  612  CDSLTALNLKNCSGFTAAALEKFESDLGTRCDIL  645



>ref|XP_007136869.1| hypothetical protein PHAVU_009G080700g [Phaseolus vulgaris]
 gb|ESW08863.1| hypothetical protein PHAVU_009G080700g [Phaseolus vulgaris]
Length=601

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD G LP ++  + GL  VNL GCINVTDK +  I   HG T ++L L+GC  VTDAS 
Sbjct  493  VTDAGFLPLLECSETGLTTVNLRGCINVTDKVVLPIVNSHGCTRQVLCLDGCTRVTDAST  552

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALA  268
             AIA  C +L DLD+SK  ++D GIAALA
Sbjct  553  MAIAGNCPMLSDLDVSKCAITDTGIAALA  581



>emb|CBI28209.3| unnamed protein product [Vitis vinifera]
Length=546

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 61/181 (34%), Positives = 90/181 (50%), Gaps = 30/181 (17%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VT  G++  + +C + L  ++L  C+ + D  +         +L  L++  C     ASL
Sbjct  367  VTQLGVIGSLSNCGSKLKSLSLVKCMGIKDIAVGTPMLSPCHSLRSLSIRNCPGFGSASL  426

Query  182  AAIADYCSVLRDLDIS----------------------------KSRVSDFGIAALAGGS  277
            A +   C  L  +D+S                            K  ++D GIAAL+ G 
Sbjct  427  AMVGKLCPQLHHVDLSGLDGMTDAGLLPLLESYNCLLLNDLDLSKCAITDSGIAALSCGE  486

Query  278  AIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVERLWRCDI  457
              + +LQILS+SGC   S+K +P L KLG +L GLN+Q+C  IS   V+LL+E LWRCDI
Sbjct  487  --KLNLQILSVSGCSKVSNKSMPSLCKLGKTLLGLNLQHCNKISSSSVELLMESLWRCDI  544

Query  458  L  460
            L
Sbjct  545  L  545



>ref|XP_001783097.1| predicted protein [Physcomitrella patens]
 gb|EDQ52100.1| predicted protein [Physcomitrella patens]
Length=633

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 86/151 (57%), Gaps = 3/151 (2%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            + D  ++  ++ C   LV +NL+ C N+TD  ++AIA  H   LE L L+GC  V D+ L
Sbjct  477  LNDEAIISVIEGCGEHLVSLNLTNCKNITDVVVAAIAS-HCGDLERLILDGCYQVGDSGL  535

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
              +A  C  L++LD+S + ++D G+ +L     +   LQ L+L+GC+  +D+ L  +   
Sbjct  536  QMLAAACPSLKELDLSGTSITDSGLRSLVISRGLW--LQGLTLTGCINLTDESLSLIEDY  593

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCD  454
              SL  LN++NC  +S  G+  L  +LW CD
Sbjct  594  CPSLGALNLRNCPLLSREGLSALESQLWSCD  624



>ref|XP_002974778.1| hypothetical protein SELMODRAFT_442539 [Selaginella moellendorffii]
 gb|EFJ24298.1| hypothetical protein SELMODRAFT_442539 [Selaginella moellendorffii]
Length=630

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 90/154 (58%), Gaps = 7/154 (5%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            ++D  L+PF+ +  +GL  +NLSGC  +T++ ++A+A     +L LL L+GC  VTD  +
Sbjct  480  LSDESLVPFLSASGSGLTSLNLSGCTRLTNRALAAVASFC-PSLGLLTLDGCASVTDQGI  538

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAAL--AGGSAIQFSLQILSLSGCVLASDKCLPYLH  355
              +A     +++L ++   V+D G+ AL  A GS    SL+ LSL+GC   +D+ L  + 
Sbjct  539  RYVAQGPQAVQELSLAGCDVTDDGMVALVLAKGS----SLKTLSLAGCGRVTDRSLLAMK  594

Query  356  KLGNSLAGLNIQNCVGISHRGVDLLVERLWRCDI  457
               N+L  LN+++C G+S   ++     LWRC +
Sbjct  595  TACNTLEALNVKDCKGLSRAKLEWFEAGLWRCHL  628



>ref|XP_002963689.1| hypothetical protein SELMODRAFT_62165, partial [Selaginella moellendorffii]
 gb|EFJ35560.1| hypothetical protein SELMODRAFT_62165, partial [Selaginella moellendorffii]
Length=542

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 90/154 (58%), Gaps = 7/154 (5%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            ++D  L+PF+ +  +GL  +NLSGC  +T++ ++A+A     +L LL L+GC  VTD  +
Sbjct  394  LSDESLVPFLLASGSGLTSLNLSGCTRLTNRALAAVASFC-PSLGLLTLDGCASVTDQGI  452

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAAL--AGGSAIQFSLQILSLSGCVLASDKCLPYLH  355
              +A     +++L ++   V+D G+ AL  A GS    SL+ LSL+GC   +D+ L  + 
Sbjct  453  RYVAQGPQAVQELSLAGCDVTDDGMVALVLAKGS----SLKTLSLAGCGRVTDRSLLVMK  508

Query  356  KLGNSLAGLNIQNCVGISHRGVDLLVERLWRCDI  457
               N+L  LN+++C G+S   ++     LWRC +
Sbjct  509  TACNALEALNVKDCKGLSRAKLEWFEAGLWRCQL  542



>ref|XP_001775242.1| predicted protein [Physcomitrella patens]
 gb|EDQ59978.1| predicted protein [Physcomitrella patens]
Length=619

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 85/151 (56%), Gaps = 3/151 (2%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            + D  ++  ++ C   LV +NL+ C N+TD  ++AIA   G+ LE L L+GC  V D  L
Sbjct  467  LNDEAIISIIEVCGEHLVNLNLTNCKNITDVAVAAIASRCGD-LERLILDGCYQVGDNGL  525

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
              +A  C +L++LD+S + ++D G+ +L     +   LQ L+ +GC+  +D+ L  +   
Sbjct  526  QTLATECPLLKELDLSGTSITDSGLRSLVTSQGL--FLQGLTFTGCINLTDESLSSIEDF  583

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCD  454
               L  LN++NC  ++  G+  L  +LW CD
Sbjct  584  CPLLGSLNLRNCPLLTREGLSSLESQLWSCD  614



>ref|NP_001172897.1| Os02g0281150 [Oryza sativa Japonica Group]
 dbj|BAH91626.1| Os02g0281150 [Oryza sativa Japonica Group]
Length=367

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 81/149 (54%), Gaps = 10/149 (7%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD  +   VQ+C   +V +NLSGC N++DK +  +A  + E L+ LN+  C  +TD  L
Sbjct  183  LTDLTIRHIVQNCK-HIVDLNLSGCKNISDKGMQLVAD-NYEGLKKLNITRCIKLTDDGL  240

Query  182  AAIADYCSVLRDLDISK----SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPY  349
              +   CS L  L++       RV+D G+ A+A G     SLQ+LSL G V  +D CL  
Sbjct  241  QEVLQKCSSLESLNLYALSRCVRVTDVGVVAIAQGCR---SLQLLSLFGIVGVTDVCLEA  297

Query  350  LHK-LGNSLAGLNIQNCVGISHRGVDLLV  433
            L K    SL  L++  C+GI    VDL V
Sbjct  298  LSKHCSRSLTTLDVNGCIGIKWWEVDLFV  326



>ref|XP_009032915.1| hypothetical protein AURANDRAFT_11299, partial [Aureococcus anophagefferens]
 gb|EGB11841.1| hypothetical protein AURANDRAFT_11299, partial [Aureococcus anophagefferens]
Length=330

 Score = 73.9 bits (180),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 85/154 (55%), Gaps = 11/154 (7%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
             +D  LL   + C   LV+++L+GC  VTD  +S +A   G TLE+ NL GC  +T+A  
Sbjct  75   TSDVALLSIAEGCGKTLVELDLNGCEMVTDVGVSWVAHQAGATLEVFNLRGCNRLTNAGC  134

Query  182  AAIADYCSVLRDLDISKS-RVSDFGIAALAGGSAIQFSLQILSLSGCVLASD--------  334
             AIAD+C V+R +D+  + RV+D G+  L  G+A+  +L+ L +S   L +D        
Sbjct  135  RAIADHCHVIRVVDLRGARRVTDVGVRVL--GAALGDTLETLDISSMHLVTDGVDRGFGF  192

Query  335  KCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVE  436
            + L  L +    L  L++  C  +S+R ++ L +
Sbjct  193  EGLLALAQDVTRLKCLHLDGCFQVSNRALNALAK  226



>ref|XP_009386195.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=604

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/146 (33%), Positives = 78/146 (53%), Gaps = 5/146 (3%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAG--LVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDA  175
            +TD G+  F+        + +V+L+GC  V + ++ AI +    +L+ L L GCG V D 
Sbjct  452  ITDRGIRCFLSQLKGSNKMARVDLTGCTRVGNWSVWAITRECKASLKRLVLRGCGRVNDR  511

Query  176  SLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLH  355
              A IA  C+ L +LD+    +SD G+  LA    I   L+++SL+GC   +D+ L  L 
Sbjct  512  GAAVIARRCAKLVELDLGGCDISDEGVKKLARDEPID--LEVISLAGCTRITDRSLLVLK  569

Query  356  K-LGNSLAGLNIQNCVGISHRGVDLL  430
            K +G  L  +N+  C G+S   ++ L
Sbjct  570  KYMGPGLERVNVAGCTGVSKAVINWL  595



>ref|XP_010908612.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=569

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 58/106 (55%), Gaps = 2/106 (2%)
 Frame = +2

Query  140  LNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGC  319
            L+L+GC  VTD SL AIA  C  L +LD+S  R+SD G+  LA        LQ LSL+GC
Sbjct  464  LDLSGCRLVTDRSLRAIAQRCQELEELDLSGCRISDQGVECLASEGPSW--LQALSLAGC  521

Query  320  VLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVERLWRCDI  457
               +DK L  L  L  SL  LN+  C GIS   +    E  + CD+
Sbjct  522  AEITDKSLEALQTLCVSLESLNVTRCPGISQEAISSFKEVCFFCDV  567



>gb|AAL67490.1|AF459405_1 putative glucose-induced repressor-like protein [Narcissus pseudonarcissus]
Length=85

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 53/85 (62%), Gaps = 2/85 (2%)
 Frame = +2

Query  209  LRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNI  388
            L +L +SK+ ++D+GIA LA  SA   +L+ILS SGC   + + LP    +G +L GLN+
Sbjct  3    LEELYMSKADITDYGIALLA--SARHLNLRILSFSGCSKVTPRSLPLFGNIGPTLVGLNL  60

Query  389  QNCVGISHRGVDLLVERLWRCDILS  463
            Q C  I   G   + E++W CDI++
Sbjct  61   QQCDLIKAHGTAAIEEKMWWCDIIA  85



>ref|XP_001630901.1| predicted protein [Nematostella vectensis]
 gb|EDO38838.1| predicted protein, partial [Nematostella vectensis]
Length=225

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 81/146 (55%), Gaps = 6/146 (4%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD  L      C  GL ++NL+G   +T++ + AIA+  G+ LE L L+GC  V+D  +
Sbjct  80   VTDTSLTHVANHC-PGLQRLNLTGKSLITNRGLGAIARSCGD-LEQLFLSGCSRVSDRGV  137

Query  182  AAIADYCSVLRDLDISKS-RVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHK  358
              +A  C  L  L +S   R++D  ++A++   +   SL+ L LSGCV  +D+ +  L +
Sbjct  138  RTLASKCPKLEKLSLSNCLRLTDKSLSAISRKCS---SLKTLDLSGCVKITDRGIKALSR  194

Query  359  LGNSLAGLNIQNCVGISHRGVDLLVE  436
                L  +N+++  GIS  G++LL  
Sbjct  195  YSEHLTDINLKDTTGISIEGIELLAR  220



>emb|CBJ28117.1| Hypothetical leucine rich repeat calmodulin binding protein [Ectocarpus 
siliculosus]
Length=1536

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 46/139 (33%), Positives = 71/139 (51%), Gaps = 5/139 (4%)
 Frame = +2

Query  50   LVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS  229
            ++ ++L  CI VTD  +  IA+ H   L  LN+ GC  VT+  L ++A  C  +  LD +
Sbjct  206  MIGLSLRNCIEVTDVGMWCIAR-HTTALRELNVGGCHSVTNIGLRSLAICCDNMEQLDFT  264

Query  230  K-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGI  406
              +R++D G+  + GG    +SL+ LSL GC   SD  +  + KL   L  LNI  C  +
Sbjct  265  SCTRLTDLGLRVIGGGC---WSLKSLSLEGCSHVSDTGVAEIAKLSTGLTYLNISRCERV  321

Query  407  SHRGVDLLVERLWRCDILS  463
               G   L++    C  L+
Sbjct  322  GEYGDRALIQLGRSCHQLT  340


 Score = 64.7 bits (156),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 51/158 (32%), Positives = 80/158 (51%), Gaps = 24/158 (15%)
 Frame = +2

Query  8    DYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAA  187
            D GLL   + C   L K+ L+GC  +T K++ A+A+     L  L+L+GCG V +  L  
Sbjct  363  DPGLLSVARGCPK-LEKLMLTGCGGITGKSVRALAR-GCSKLRDLSLSGCGGVGNGDLKE  420

Query  188  IADYCSVLRDLDISKSR-VSDFGIAALAGG-----------------SAIQ----FSLQI  301
            +A  C+ LR L+I++ R V+  G+AALA G                 SA++     + Q 
Sbjct  421  LARGCTSLRHLNIAQCRQVNAHGLAALARGLKNLTELDVGGCEKVDDSALRALCSMNAQF  480

Query  302  LSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHR  415
            L+LSGC   ++  +  +     +L+ LN+  C GI  R
Sbjct  481  LNLSGCSAITEMGVTGIAMNCTALSSLNVTGCPGIGRR  518



>ref|XP_006492816.1| PREDICTED: F-box protein At3g58530-like isoform X1 [Citrus sinensis]
Length=356

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 88/197 (45%), Gaps = 57/197 (29%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD G+   V++C   ++ +NLSGC N+ DK++  IA  + E LE LNL  C  VTD  L
Sbjct  153  VTDIGIQHLVKNC-KHIIDLNLSGCKNILDKSLQLIADNYQE-LESLNLTRCVKVTDGGL  210

Query  182  AAIADYCSVLRDLD---------------------------------------ISKSR--  238
              I   CS LR L+                                       I+K +  
Sbjct  211  QKILIKCSSLRSLNLYALSGFTDEAYKKISLLAHLKFLDLCGAQNLSDEGLACIAKCKNL  270

Query  239  ----------VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL-GNSLAGLN  385
                      ++D G+ A+A G +   SL+ LSL G V  +DKCL  L +   N+L  L+
Sbjct  271  VSLNLTWCVRITDVGVMAIAEGCS---SLEFLSLFGIVGVTDKCLEVLSRFCSNTLTTLD  327

Query  386  IQNCVGISHRGVDLLVE  436
            +  CVGI  R  D L++
Sbjct  328  VNGCVGIKQRSRDELLQ  344



>ref|XP_003727308.1| PREDICTED: protein AMN1 homolog [Strongylocentrotus purpuratus]
Length=264

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 76/139 (55%), Gaps = 3/139 (2%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G+     SC   L  V L  C+++ D +  A+A+   + +EL NL GC  +TDASL
Sbjct  107  ITDQGIQALATSC-PYLSIVYLRRCVSLEDPSTIALAQSCHQLMEL-NLGGCIRLTDASL  164

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
             AI   C +L+ L+IS+++V+D GI +L  G   Q SL+ L L+ C+  SD+ +  +   
Sbjct  165  QAIGQNCRMLKSLNISRTKVTDEGIFSLCNGVCKQ-SLKELHLNNCIHLSDEAVEAVVNF  223

Query  362  GNSLAGLNIQNCVGISHRG  418
               +A L    C  I+ R 
Sbjct  224  CPKIAILLFHGCPCITDRS  242



>gb|EMC86555.1| F-box/LRR-repeat protein 13, partial [Columba livia]
Length=546

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 77/141 (55%), Gaps = 7/141 (5%)
 Frame = +2

Query  2    VTDYGLLPFVQ-SCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDAS  178
            ++D G+ PFVQ S  A L ++NL+ CI VTD +++ IA+   E L  LNL  C  VTDA 
Sbjct  303  ISDEGVRPFVQGSSGAKLRELNLTNCIRVTDASVTEIAQRCHE-LTYLNLRYCENVTDAG  361

Query  179  LAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHK  358
            + A+ +  S++  LD+S + +SD G+ AL      Q  ++ LSLS C   SD  +    K
Sbjct  362  IEALGNISSLI-SLDVSGTSISDMGLRALGR----QGKIKELSLSECKNISDTGIQEFCK  416

Query  359  LGNSLAGLNIQNCVGISHRGV  421
                L G  + +C  ++   V
Sbjct  417  GTKHLEGCRVSSCPQLTDEAV  437



>ref|XP_005498171.1| PREDICTED: LOW QUALITY PROTEIN: F-box/LRR-repeat protein 13 [Columba 
livia]
Length=911

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 77/141 (55%), Gaps = 7/141 (5%)
 Frame = +2

Query  2    VTDYGLLPFVQ-SCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDAS  178
            ++D G+ PFVQ S  A L ++NL+ CI VTD +++ IA+   E L  LNL  C  VTDA 
Sbjct  650  ISDEGVRPFVQGSSGAKLRELNLTNCIRVTDASVTEIAQRCHE-LTYLNLRYCENVTDAG  708

Query  179  LAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHK  358
            + A+ +  S++  LD+S + +SD G+ AL      Q  ++ LSLS C   SD  +    K
Sbjct  709  IEALGNISSLI-SLDVSGTSISDMGLRALGR----QGKIKELSLSECKNISDTGIQEFCK  763

Query  359  LGNSLAGLNIQNCVGISHRGV  421
                L G  + +C  ++   V
Sbjct  764  GTKHLEGCRVSSCPQLTDEAV  784



>gb|KDO70837.1| hypothetical protein CISIN_1g018439mg [Citrus sinensis]
Length=356

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 61/197 (31%), Positives = 88/197 (45%), Gaps = 57/197 (29%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD G+   V++C   ++ +NLSGC N+ DK++  IA  + E LE LNL  C  +TD  L
Sbjct  153  VTDIGIQHLVKNC-KHIIDLNLSGCKNLLDKSLQLIADNYQE-LESLNLTRCVKLTDGGL  210

Query  182  AAIADYCSVLRDLD---------------------------------------ISKSR--  238
              I   CS LR L+                                       I+K +  
Sbjct  211  QKILIKCSSLRSLNLYALSGFTDEAYKKISLLAHLKFLDLCGAQNLSDEGLACIAKCKNL  270

Query  239  ----------VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL-GNSLAGLN  385
                      ++D G+ A+A G +   SL+ LSL G V  +DKCL  L +   N+L  L+
Sbjct  271  VSLNLTWCVRITDVGVMAIAEGCS---SLEFLSLFGIVGVTDKCLEVLSRFCSNTLTTLD  327

Query  386  IQNCVGISHRGVDLLVE  436
            +  CVGI  R  D L++
Sbjct  328  VNGCVGIKQRSRDELLQ  344



>ref|XP_010243424.1| PREDICTED: F-box protein At3g58530 [Nelumbo nucifera]
Length=376

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 87/197 (44%), Gaps = 57/197 (29%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            V+D G+   V  C   +V +NLSGC N+TDK++  IA  + E LE LNL  C  VTD  L
Sbjct  173  VSDLGIKHMVDHCKY-IVDLNLSGCKNITDKSLHLIADNYQE-LEFLNLTRCVKVTDGGL  230

Query  182  AAIADYCSVLRDLD---------------------------------------ISKSR--  238
              +   C +LR L+                                       I+K +  
Sbjct  231  QQVLLKCCLLRSLNLYALSSFTDEAYKKIAVLAHLRFLDLCGAQNLSDQGLSCIAKCKNL  290

Query  239  ----------VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL-GNSLAGLN  385
                      ++D G+ A+A G     SL+ LSL G V  +D+CL  L +   N+LA L+
Sbjct  291  VSLNLTWCVQITDVGVIAIAEGCC---SLEFLSLFGIVGVTDRCLEVLSRFCSNTLATLD  347

Query  386  IQNCVGISHRGVDLLVE  436
            +  C+GI  R  D L++
Sbjct  348  VNGCIGIKRRSRDELLQ  364



>gb|EFX86579.1| hypothetical protein DAPPUDRAFT_208061 [Daphnia pulex]
Length=431

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 74/146 (51%), Gaps = 6/146 (4%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            V D  +  F Q C+  +  +NL+ C  +TD T  A+++ H   L+ LNL+ C  +TD +L
Sbjct  99   VGDSAMRTFSQHCN-NIEDLNLNQCKRITDSTCLALSR-HCVKLQRLNLSSCPAITDQAL  156

Query  182  AAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHK  358
             A+AD C  L  +D+S    VS  G+  LA G      L      GC+L  D  L +L +
Sbjct  157  KALADGCPQLVYIDLSWCDLVSQNGVEVLAKGCP---GLMTFHCRGCILIGDDALTHLAR  213

Query  359  LGNSLAGLNIQNCVGISHRGVDLLVE  436
              + L  +NIQ C+ ++  GV  L  
Sbjct  214  FCSRLHTVNIQGCLEVTDVGVARLAR  239


 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 71/125 (57%), Gaps = 5/125 (4%)
 Frame = +2

Query  50   LVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS  229
            L  VN+ GC+ VTD  ++ +A+   E +  L L+GCG +TDA+L++++ +C  L  L+++
Sbjct  218  LHTVNIQGCLEVTDVGVARLARSCPE-MRYLCLSGCGHLTDATLSSLSQHCPQLATLEVA  276

Query  230  K-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGI  406
            + S  +D G  ALA    +   L+ + L  CVL +D  L YL      L  L++ +C  I
Sbjct  277  RCSLFTDIGFQALARNCHL---LKRMDLEECVLITDAALSYLAAGCPRLEKLSLSHCELI  333

Query  407  SHRGV  421
            +  G+
Sbjct  334  TDDGI  338



>gb|ETE73360.1| F-box/LRR-repeat protein 7, partial [Ophiophagus hannah]
Length=444

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 69/127 (54%), Gaps = 5/127 (4%)
 Frame = +2

Query  59   VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  238
            +++S C  + D+ +  IA  H   L  L L  C  +TD  L  +  YC  +R+L +S  R
Sbjct  230  LDMSDCFVLEDEGLHTIAT-HCTQLTHLYLRRCIRITDEGLRYLMIYCPSIRELSVSDCR  288

Query  239  -VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHR  415
             VSDFG+  +A    ++F L+ LS++ CV  +D  L Y+ K  + L  LN + C GI+  
Sbjct  289  FVSDFGMREIA---KLEFRLRYLSIAHCVRITDVGLRYITKYCSKLRYLNARGCEGITDH  345

Query  416  GVDLLVE  436
            G++ L +
Sbjct  346  GIEYLAK  352


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 74/153 (48%), Gaps = 7/153 (5%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            V+D+G+   +   +  L  ++++ C+ +TD  +  I K +   L  LN  GC  +TD  +
Sbjct  290  VSDFGMRE-IAKLEFRLRYLSIAHCVRITDVGLRYITK-YCSKLRYLNARGCEGITDHGI  347

Query  182  AAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHK  358
              +A  C+ L+ LDI K   VSD G+  LA      F+L+ LSL  C   + + L  +  
Sbjct  348  EYLAKNCTKLKSLDIGKCPLVSDIGLEFLALNC---FNLKRLSLKSCESVTGQGLQIVAA  404

Query  359  LGNSLAGLNIQNCVGISHRGVDLLVERLWRCDI  457
                L  LN+Q+C  IS   +  +     RC I
Sbjct  405  NCFDLQMLNVQDC-EISVEALRFVKRHCKRCII  436



>dbj|GAN11538.1| conserved hypothetical protein [Mucor ambiguus]
Length=807

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 53/129 (41%), Positives = 68/129 (53%), Gaps = 5/129 (4%)
 Frame = +2

Query  44   AGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLD  223
            A + K+NLS C  VTD     + +     LE L+LN C  +TD SLA +A  C  L  LD
Sbjct  533  ARIKKLNLSQCFYVTDDGFGRLIE-QLPNLETLDLNSCWLLTDKSLALLAATCPRLNRLD  591

Query  224  ISKSR-VSDFGI-AALAGGSAIQF-SLQILSLSGCVLASDKCLPYLHKL-GNSLAGLNIQ  391
            +S  R +SD GI   L    A  F  L+ LSLS C   SD  + YL +   N+L  LNIQ
Sbjct  592  LSNCRKISDIGIFKMLDEKQARGFPELKELSLSYCKKLSDMTMSYLAEFCSNTLESLNIQ  651

Query  392  NCVGISHRG  418
             C  I+ +G
Sbjct  652  RCTRITDQG  660


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 43/138 (31%), Positives = 69/138 (50%), Gaps = 6/138 (4%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G + +  +    L  +NL+ C  +TD+ IS +       L+ L+L+ C  ++D ++
Sbjct  656  ITDQGFVKWADTQFPQLKYLNLTDCSFLTDQAISHLVSA-APQLQSLSLSFCCALSDNAI  714

Query  182  AAIADYCSVLRDLDIS--KSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLH  355
              +      L++LD S   + VSD  I AL        S+  L+L GCV  +D C+  + 
Sbjct  715  EGLISLPH-LQELDASFCGAAVSDVSIRALLKSGTFA-SMNSLNLRGCVRITDTCIKSIL  772

Query  356  KLGNSLAGLNIQNCVGIS  409
            + G  L  LNI  C GIS
Sbjct  773  EWGR-LNTLNISQCPGIS  789



>ref|XP_002308350.2| F-box family protein [Populus trichocarpa]
 gb|EEE91873.2| F-box family protein [Populus trichocarpa]
Length=355

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 88/201 (44%), Gaps = 57/201 (28%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD G+   V++C   +V +NLSGC N++DK +  IA+ + E LE LNL  C  +TD  L
Sbjct  152  VTDIGIKHVVENCKQ-IVDLNLSGCKNISDKALQLIAENYQE-LESLNLTRCIKLTDGGL  209

Query  182  AAIADYCSVLRDLD---------------------------------------ISKSR--  238
              I   CS L+ L+                                       I+K +  
Sbjct  210  QQILSKCSSLQSLNLYALSSFTDKAYKKISSLSLLKFLDLCGAQNLSDEGLSCIAKCKNI  269

Query  239  ----------VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL-GNSLAGLN  385
                      V+D G  A+A G     SL+ LSL G V  +DKCL  L +   N++  L+
Sbjct  270  VSLNLTWCVRVTDVGAVAIAEGCT---SLEFLSLFGIVGVTDKCLEVLSRFCSNTVTTLD  326

Query  386  IQNCVGISHRGVDLLVERLWR  448
            +  C+GI  R  D L++   R
Sbjct  327  VNGCIGIKRRSRDELLQLFPR  347


 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 66/134 (49%), Gaps = 11/134 (8%)
 Frame = +2

Query  56   KVNLSGCINVTDKTISAIAK---LHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI  226
            ++NL    ++ D+ +  +     +  + LE LNLNGC  ++D  + AI   CS L+   I
Sbjct  87   EINLEFAQDIEDEHLEVLQSKCFVSLQKLESLNLNGCQKISDKGIEAITSTCSKLKVFSI  146

Query  227  SKS-RVSDFGIAALAGGSAIQFSLQI--LSLSGCVLASDKCLPYLHKLGNSLAGLNIQNC  397
              + RV+D GI  +          QI  L+LSGC   SDK L  + +    L  LN+  C
Sbjct  147  YWNVRVTDIGIKHVVENCK-----QIVDLNLSGCKNISDKALQLIAENYQELESLNLTRC  201

Query  398  VGISHRGVDLLVER  439
            + ++  G+  ++ +
Sbjct  202  IKLTDGGLQQILSK  215



>gb|KFO34898.1| F-box/LRR-repeat protein 20 [Fukomys damarensis]
Length=858

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 44/154 (29%), Positives = 73/154 (47%), Gaps = 25/154 (16%)
 Frame = +2

Query  32   QSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVL  211
            + C   L K++L GC+ V D  +   A+ +   +E+LNLNGC   TDA+  +++ +CS L
Sbjct  75   KRCGGFLRKLSLRGCLGVGDNALRTFAQ-NCRNIEVLNLNGCTKTTDATCTSLSKFCSKL  133

Query  212  RDLDISK-SRVSDFGIAALAGGSAIQFSLQI-----------------------LSLSGC  319
            R LD++  + +++  + AL+ G  +   L I                       L L GC
Sbjct  134  RHLDLASCTSITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCGGLKALFLKGC  193

Query  320  VLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV  421
                D+ L Y+      L  LN+Q C+ I+  G+
Sbjct  194  TQLEDEALKYIGAHCPELVTLNLQTCLQITDEGL  227


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 38/125 (30%), Positives = 63/125 (50%), Gaps = 5/125 (4%)
 Frame = +2

Query  50   LVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS  229
            LV +NL  C+ +TD+ +  I +     L+ L  +GC  +TDA L A+   C  LR L+++
Sbjct  211  LVTLNLQTCLQITDEGLITICR-GCHKLQSLCASGCSNITDAILNALGQNCPRLRILEVA  269

Query  230  K-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGI  406
            + S+++D G   LA        L+ + L  CV  +D  L  L      L  L++ +C  I
Sbjct  270  RCSQLTDVGFTTLARNC---HELEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELI  326

Query  407  SHRGV  421
            +  G+
Sbjct  327  TDDGI  331



>ref|XP_007426934.1| PREDICTED: F-box/LRR-repeat protein 7 [Python bivittatus]
Length=444

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 69/127 (54%), Gaps = 5/127 (4%)
 Frame = +2

Query  59   VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR  238
            +++S C  + D+ +  IA  H   L  L L  C  +TD  L  +  YC  +R+L +S  R
Sbjct  230  LDMSDCFVLEDEGLHTIAT-HCTQLTHLYLRRCIRITDEGLRYLMIYCPSIRELSVSDCR  288

Query  239  -VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHR  415
             VSDFG+  +A    ++F L+ LS++ CV  +D  + Y+ K  + L  LN + C GI+  
Sbjct  289  FVSDFGMREIA---KLEFRLRYLSIAHCVRITDVGIRYITKYCSKLRYLNARGCEGITDH  345

Query  416  GVDLLVE  436
            GV+ L +
Sbjct  346  GVEYLAK  352


 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 47/153 (31%), Positives = 74/153 (48%), Gaps = 7/153 (5%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            V+D+G+   +   +  L  ++++ C+ +TD  I  I K +   L  LN  GC  +TD  +
Sbjct  290  VSDFGMRE-IAKLEFRLRYLSIAHCVRITDVGIRYITK-YCSKLRYLNARGCEGITDHGV  347

Query  182  AAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHK  358
              +A  C+ L+ LDI K   VSD G+  LA      F+L+ LSL  C   + + L  +  
Sbjct  348  EYLAKNCTKLKSLDIGKCPLVSDIGLEFLALNC---FNLKRLSLKSCESVTGQGLQIVAA  404

Query  359  LGNSLAGLNIQNCVGISHRGVDLLVERLWRCDI  457
                L  LN+Q+C  IS   +  +     RC I
Sbjct  405  NCFDLQMLNVQDC-EISVEALRFVKRHCKRCII  436



>ref|XP_011047086.1| PREDICTED: F-box protein At3g58530 [Populus euphratica]
 ref|XP_011047087.1| PREDICTED: F-box protein At3g58530 [Populus euphratica]
Length=355

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 60/198 (30%), Positives = 88/198 (44%), Gaps = 51/198 (26%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD G+   V++C   ++ +NLSGC N+TDK +  IA+ H + LE LNL  C  +TD  L
Sbjct  152  VTDIGIKHVVENCKQ-IIDLNLSGCKNITDKALQLIAENH-QDLESLNLTRCVKLTDGGL  209

Query  182  AAIADYCSVLRDLDI--------------------------SKSRVSDFGIAALA-----  268
              I   CS L+ L++                              +SD G++ +A     
Sbjct  210  QQILSKCSSLQSLNLYALSSFTGKAYKNISSLPHLKFLDLCGAQNLSDEGLSCVAKCKNI  269

Query  269  --------------GGSAIQ---FSLQILSLSGCVLASDKCLPYLHKL-GNSLAGLNIQN  394
                          G  AI     SL+ LSL G V  +DKCL  L +   N++  L++  
Sbjct  270  VSLNLTWCVRVTDVGVEAIAEGCTSLEFLSLFGIVGVTDKCLEVLSRFCSNTVTTLDVNG  329

Query  395  CVGISHRGVDLLVERLWR  448
            C+GI  R  D L++   R
Sbjct  330  CIGIKRRSRDELLQLFPR  347


 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/134 (30%), Positives = 68/134 (51%), Gaps = 11/134 (8%)
 Frame = +2

Query  56   KVNLSGCINVTDKTISAIAK---LHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI  226
            ++NL    ++ DK +  +     +  + LE LNLNGC  ++D  + AI   CS L+   I
Sbjct  87   EINLEFAQDIEDKHLEVLQSKCTVSLQKLESLNLNGCQKISDKGIEAITSTCSKLKVFSI  146

Query  227  SKS-RVSDFGIAALAGGSAIQFSLQI--LSLSGCVLASDKCLPYLHKLGNSLAGLNIQNC  397
              + RV+D GI  +     ++   QI  L+LSGC   +DK L  + +    L  LN+  C
Sbjct  147  YWNVRVTDIGIKHV-----VENCKQIIDLNLSGCKNITDKALQLIAENHQDLESLNLTRC  201

Query  398  VGISHRGVDLLVER  439
            V ++  G+  ++ +
Sbjct  202  VKLTDGGLQQILSK  215



>gb|EFA03310.1| hypothetical protein TcasGA2_TC013252 [Tribolium castaneum]
Length=861

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 46/147 (31%), Positives = 75/147 (51%), Gaps = 6/147 (4%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            + D  +    Q C   +  +NL+GC  +TD + +A +K H   L+ LNL+GC  +TD SL
Sbjct  529  IADGSMKTLAQLC-PNVEDLNLNGCKKLTDASCTAFSK-HCSKLQKLNLDGCSAITDNSL  586

Query  182  AAIADYCSVLRDLDISKS-RVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHK  358
             A++D C  L  ++IS S  V++ G+ ALA G      L+     GC   + + +  L +
Sbjct  587  KALSDGCPNLTHINISWSNNVTENGVEALARGCR---KLKSFISKGCKQITSRAVICLAR  643

Query  359  LGNSLAGLNIQNCVGISHRGVDLLVER  439
              + L  +N+  C  I+   V  L E+
Sbjct  644  FCDQLEVVNLLGCCHITDEAVQALAEK  670


 Score = 65.5 bits (158),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 46/141 (33%), Positives = 75/141 (53%), Gaps = 6/141 (4%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +T   ++   + CD  L  VNL GC ++TD+ + A+A+     L  L L+GC  +TDASL
Sbjct  633  ITSRAVICLARFCDQ-LEVVNLLGCCHITDEAVQALAE-KCPKLHYLCLSGCSALTDASL  690

Query  182  AAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHK  358
             A+A  C++L  L+++  S+ +D G  ALA        L+ + L  CVL +D  L +L  
Sbjct  691  IALAQKCTLLSTLEVAGCSQFTDAGFQALARSCRY---LEKMDLDECVLITDNTLIHLAM  747

Query  359  LGNSLAGLNIQNCVGISHRGV  421
                +  L + +C  I+  G+
Sbjct  748  GCPRIEYLTLSHCELITDEGI  768



>gb|EFX60588.1| hypothetical protein DAPPUDRAFT_71291 [Daphnia pulex]
Length=154

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 69/133 (52%), Gaps = 5/133 (4%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD+G+    +     L  ++++ C  ++D  I  I + H   L  LNL GC  V+D SL
Sbjct  1    VTDFGMYELARL-GPNLRYLSVAKCDQISDAGIKQIGR-HCYKLRYLNLRGCEAVSDDSL  58

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
              +A  CS LR LD+ K  ++D G+  LA       +L+ LS+  C L +D+ +  +   
Sbjct  59   EVLARTCSRLRALDLGKCDITDRGLRLLAEHCP---NLKKLSVKSCELVTDEGVRSIAYY  115

Query  362  GNSLAGLNIQNCV  400
               L  LNIQ+C+
Sbjct  116  CRGLRQLNIQDCL  128



>ref|XP_002414639.1| fbxl20, putative [Ixodes scapularis]
 gb|EEC18304.1| fbxl20, putative [Ixodes scapularis]
Length=433

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 71/142 (50%), Gaps = 6/142 (4%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            V D  L  F Q+C+  +  +NL+GC  +TD T  ++ + H   L +L+L  C  VTD SL
Sbjct  101  VEDASLKTFAQNCN-NIEDLNLNGCKKLTDSTCQSLGR-HCSKLTVLDLGSCCQVTDLSL  158

Query  182  AAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHK  358
             AI   C  L  L+IS   +VS +G+ ALA G      L+     GC L +D+ +  L  
Sbjct  159  RAIGQGCPNLEHLNISWCDQVSKYGVEALAQGCG---RLRAFISKGCPLVNDEAVSQLAN  215

Query  359  LGNSLAGLNIQNCVGISHRGVD  424
            L   L  LN+  C  I+   V 
Sbjct  216  LCGGLQTLNLHECTHITDAAVQ  237


 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 76/138 (55%), Gaps = 8/138 (6%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLS-GCINVTDKTISAIAKLHGETLELLNLNGCGCVTDAS  178
            V+ YG+    Q C  G ++  +S GC  V D+ +S +A L G  L+ LNL+ C  +TDA+
Sbjct  179  VSKYGVEALAQGC--GRLRAFISKGCPLVNDEAVSQLANLCG-GLQTLNLHECTHITDAA  235

Query  179  LAAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLH  355
            +  ++ +C  L  L +S  ++++D  + +L+ G     +L  L ++GC   +D     L 
Sbjct  236  VQCVSQHCPKLHFLCVSNCAQLTDASLVSLSQGCQ---ALCTLEVAGCTQLTDSGFQALS  292

Query  356  KLGNSLAGLNIQNCVGIS  409
            +  ++L  ++++ CV I+
Sbjct  293  RSCHALEKMDLEECVLIT  310



>ref|XP_009059139.1| hypothetical protein LOTGIDRAFT_164359 [Lottia gigantea]
 gb|ESO90056.1| hypothetical protein LOTGIDRAFT_164359 [Lottia gigantea]
Length=406

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 72/128 (56%), Gaps = 5/128 (4%)
 Frame = +2

Query  50   LVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS  229
            L  ++++ C  + D  +  IA +H   L+ L L  C  +TD S+  +A+YCS LR+L +S
Sbjct  190  LRYLDMTDCFALDDDGLGVIA-MHCSQLQFLYLRRCVQLTDESMQYLANYCSTLRELSVS  248

Query  230  KSR-VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGI  406
              R ++D G+  L   S +  +L+ LS++ C   SD  + YL K  + L  LN++ C G+
Sbjct  249  DCRNITDLGLRDL---SKLGDNLRYLSVAKCDRMSDVGVRYLAKFCSKLRYLNVRGCEGV  305

Query  407  SHRGVDLL  430
            S   ++LL
Sbjct  306  SDESLELL  313


 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 73/152 (48%), Gaps = 6/152 (4%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD GL    +  D  L  ++++ C  ++D  +  +AK   + L  LN+ GC  V+D SL
Sbjct  253  ITDLGLRDLSKLGD-NLRYLSVAKCDRMSDVGVRYLAKFCSK-LRYLNVRGCEGVSDESL  310

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
              ++  C  LR LD+ K  +SD G+  L+        L+ LSL  C   +DK +  L   
Sbjct  311  ELLSASCPRLRSLDVGKCDISDQGLVVLSQNCP---QLRKLSLKACDSITDKGVVQLAYY  367

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDI  457
               L  LNIQ+C  IS  G   +     RC I
Sbjct  368  CRGLQQLNIQDC-NISVEGYKRVKRYCRRCII  398



>gb|KFQ73642.1| F-box/LRR-repeat protein 20 [Phoenicopterus ruber ruber]
Length=422

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 75/154 (49%), Gaps = 25/154 (16%)
 Frame = +2

Query  32   QSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVL  211
            + C   L K++L GC+ V D  +   A+ +   +E+LNLNGC  +TDA+  +++ +CS L
Sbjct  73   KRCGGFLRKLSLRGCLGVGDNALRTFAQ-NCRNIEVLNLNGCTKITDATCTSLSKFCSKL  131

Query  212  RDLDISK-SRVSDFGIAALAGGSAIQFSLQI-----------------------LSLSGC  319
            R LD++  + +++  + AL+ G  +   L I                       LSL GC
Sbjct  132  RHLDLASCTSITNLSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCGGLKALSLKGC  191

Query  320  VLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV  421
                D+ L Y+      L  LN+Q C+ I+  G+
Sbjct  192  TQLEDEALKYIGAHCPELVTLNLQTCLQITDDGL  225



>ref|XP_785847.3| PREDICTED: F-box/LRR-repeat protein 7-like [Strongylocentrotus 
purpuratus]
Length=543

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 71/128 (55%), Gaps = 5/128 (4%)
 Frame = +2

Query  50   LVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS  229
            L  ++++ C  +TD  + AIAK H   L  LN+ GC  V+D SL A++  C  LR LD+ 
Sbjct  403  LRYLSVAKCELITDMGVYAIAK-HCYKLRYLNVRGCVLVSDKSLEALSRGCPRLRSLDVG  461

Query  230  K-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGI  406
            K   ++D G+ ++A       SL+ LSL GC+  +D+ +  L ++   L  LNIQ+C  +
Sbjct  462  KCPLITDHGLVSIATNCQ---SLRKLSLKGCLHVTDQVIEVLAQVCPDLQQLNIQDCDEV  518

Query  407  SHRGVDLL  430
            S     LL
Sbjct  519  SREAYRLL  526



>ref|XP_004611387.1| PREDICTED: protein AMN1 homolog [Sorex araneus]
Length=216

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 66/112 (59%), Gaps = 3/112 (3%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +T  GL     SC   L +V+L  C ++TD  + A A+ H   L ++ LNGC  +TDA+L
Sbjct  59   ITSEGLQAVAASCPC-LQEVSLKWCHSLTDDGVLAFAR-HCRLLRIVQLNGCSGLTDAAL  116

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDK  337
             A+ ++CSVL+ +D S ++VSD G+ AL  G   Q  L+ +++  C   +D+
Sbjct  117  RALGEHCSVLQCIDFSFTQVSDDGVVALVSGPCAQ-KLEEINMGYCANLTDE  167



>ref|XP_007365012.1| RNI-like protein [Dichomitus squalens LYAD-421 SS1]
 gb|EJF62300.1| RNI-like protein [Dichomitus squalens LYAD-421 SS1]
Length=446

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = +2

Query  56   KVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS-K  232
            ++N++GC+ +TD+ +  I KL  + L  +++ G G VTDA + AIA  C+ LR +DIS  
Sbjct  240  RLNVAGCVELTDRAMHEICKLR-DHLSEIDVAGLGRVTDAGVFAIASTCTRLRSVDISFM  298

Query  233  SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISH  412
             R++D  I  LA        L+ L+ +G    +D+   +L +    LA L++  C  ++ 
Sbjct  299  PRLTDLAIQELATLP----RLRRLAAAGLPRVTDQAAFFLAEHARGLAQLHLSFCTRLTL  354

Query  413  RGVDLLVERLWRCDILS  463
             GV  L+ RL   + LS
Sbjct  355  EGVRALLRRLAELEYLS  371



>gb|KDR06592.1| F-box/LRR-repeat protein 7 [Zootermopsis nevadensis]
Length=589

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 78/152 (51%), Gaps = 6/152 (4%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD+GL    +   A L  ++++ C  V+D  +  IA+     L  LN  GC  V+D ++
Sbjct  436  VTDFGLYELAK-LGATLRYLSVAKCDQVSDAGLKVIAR-RCYKLRYLNARGCEAVSDDAI  493

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
              +A +C+ LR LDI K  VSD G+ ALA       +L+ LSL  C L +D+ +  +   
Sbjct  494  TVLAQFCTRLRALDIGKCDVSDAGLRALAESCP---NLKKLSLRSCDLVTDRGVQCIAYY  550

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDI  457
               L  LNIQ+C  IS  G   + +   RC I
Sbjct  551  CRGLQQLNIQDC-QISLEGYRAVKKYCKRCII  581



>ref|XP_010653862.1| PREDICTED: F-box protein At3g58530 isoform X3 [Vitis vinifera]
Length=338

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 61/197 (31%), Positives = 88/197 (45%), Gaps = 57/197 (29%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD G+   V++C   +V +NLSGC N+TDK++  IA  + + LELLNL  C  +TD  L
Sbjct  135  VTDIGMTHLVKNC-KHIVDLNLSGCKNITDKSLQLIADNYPD-LELLNLTRCIKLTDGGL  192

Query  182  AAIADYCSVLRDLD---------------------------------------ISKSR--  238
              I   CS L+ L+                                       I+K +  
Sbjct  193  QQILLKCSSLQSLNLYALSSFTDEAYKKISLLTDLRFLDLCGAQNLSDQGLCCIAKCKNL  252

Query  239  ----------VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHK-LGNSLAGLN  385
                      V+D G+ A+A G     SL+ LSL G V  +DKCL  L +   N +  L+
Sbjct  253  VSLNLTWCVRVTDVGVIAIAQGCT---SLEFLSLFGIVGVTDKCLEALSRSCSNMITTLD  309

Query  386  IQNCVGISHRGVDLLVE  436
            +  C+GI  R  D L++
Sbjct  310  VNGCIGIKGRSRDELLQ  326



>ref|XP_006155944.1| PREDICTED: F-box/LRR-repeat protein 20 isoform X1 [Tupaia chinensis]
Length=422

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 74/154 (48%), Gaps = 25/154 (16%)
 Frame = +2

Query  32   QSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVL  211
            + C   L K++L GC+ V D  +   A+ +   +E+LNLNGC   TDA+ A+++ +CS L
Sbjct  73   KRCGGFLRKLSLRGCLGVGDNALRTFAQ-NCRNIEVLNLNGCTKTTDATCASLSKFCSKL  131

Query  212  RDLDISK-SRVSDFGIAALAGGSAIQFSLQI-----------------------LSLSGC  319
            R LD++  + +++  + AL+ G  +   L I                       L L GC
Sbjct  132  RHLDLASCTSITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCGGLKALFLKGC  191

Query  320  VLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV  421
                D+ L Y+      L  LN+Q C+ I+  G+
Sbjct  192  TQLEDEALKYIGAHCPELVTLNLQTCLQITDEGL  225



>ref|XP_006155945.1| PREDICTED: F-box/LRR-repeat protein 20 isoform X2 [Tupaia chinensis]
Length=397

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 74/154 (48%), Gaps = 25/154 (16%)
 Frame = +2

Query  32   QSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVL  211
            + C   L K++L GC+ V D  +   A+ +   +E+LNLNGC   TDA+ A+++ +CS L
Sbjct  48   KRCGGFLRKLSLRGCLGVGDNALRTFAQ-NCRNIEVLNLNGCTKTTDATCASLSKFCSKL  106

Query  212  RDLDISK-SRVSDFGIAALAGGSAIQFSLQI-----------------------LSLSGC  319
            R LD++  + +++  + AL+ G  +   L I                       L L GC
Sbjct  107  RHLDLASCTSITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCGGLKALFLKGC  166

Query  320  VLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV  421
                D+ L Y+      L  LN+Q C+ I+  G+
Sbjct  167  TQLEDEALKYIGAHCPELVTLNLQTCLQITDEGL  200



>ref|XP_007029083.1| RNI-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY09585.1| RNI-like superfamily protein isoform 1 [Theobroma cacao]
Length=349

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 87/196 (44%), Gaps = 57/196 (29%)
 Frame = +2

Query  5    TDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLA  184
            TD G+   V +C   ++ +NLSGC N++++++  +A  H + LE LNL  C  +TD+ L 
Sbjct  147  TDIGVKHLVTNC-KHIIDLNLSGCKNLSERSLQLVAD-HYQELESLNLTRCVKMTDSGLQ  204

Query  185  AIADYCSVLRDLD---------------------------------------ISKSR---  238
             I   CS LR L+                                       I+K +   
Sbjct  205  QILIRCSFLRSLNLYALSSFTDETYKKISVLSHLRFLDLCGAQNLSDEGLSCIAKCKNLV  264

Query  239  ---------VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL-GNSLAGLNI  388
                     V+D G+ A+A G     SL+ LSL G V  +DKCL  L K   N++  L++
Sbjct  265  SLNLTWCVRVTDMGVIAIAEGCT---SLEFLSLFGIVGVTDKCLEALSKFCSNTITTLDV  321

Query  389  QNCVGISHRGVDLLVE  436
              C+GI  R  D L++
Sbjct  322  NGCIGIKRRSRDDLLQ  337



>ref|XP_002276459.1| PREDICTED: F-box protein At3g58530 isoform X2 [Vitis vinifera]
Length=353

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 61/197 (31%), Positives = 88/197 (45%), Gaps = 57/197 (29%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD G+   V++C   +V +NLSGC N+TDK++  IA  + + LELLNL  C  +TD  L
Sbjct  150  VTDIGMTHLVKNC-KHIVDLNLSGCKNITDKSLQLIADNYPD-LELLNLTRCIKLTDGGL  207

Query  182  AAIADYCSVLRDLD---------------------------------------ISKSR--  238
              I   CS L+ L+                                       I+K +  
Sbjct  208  QQILLKCSSLQSLNLYALSSFTDEAYKKISLLTDLRFLDLCGAQNLSDQGLCCIAKCKNL  267

Query  239  ----------VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHK-LGNSLAGLN  385
                      V+D G+ A+A G     SL+ LSL G V  +DKCL  L +   N +  L+
Sbjct  268  VSLNLTWCVRVTDVGVIAIAQGCT---SLEFLSLFGIVGVTDKCLEALSRSCSNMITTLD  324

Query  386  IQNCVGISHRGVDLLVE  436
            +  C+GI  R  D L++
Sbjct  325  VNGCIGIKGRSRDELLQ  341



>ref|XP_008481415.1| PREDICTED: F-box/LRR-repeat protein 7-like [Diaphorina citri]
Length=245

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 77/152 (51%), Gaps = 6/152 (4%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD+GL    +   A L  ++++ C  V+D  +  IA+     L  LN  GC  V+D ++
Sbjct  92   VTDFGLYELAKL-GATLRYLSVAKCDQVSDAGLKVIAR-RCYKLRYLNARGCEAVSDDAI  149

Query  182  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL  361
              +A  C+ LR LDI K  VSD G+ ALA       +++ LSL  C L +D+ +  +   
Sbjct  150  TVLARSCTRLRALDIGKCDVSDAGLRALAESCP---NIKKLSLRQCDLVTDRGVQCIAYY  206

Query  362  GNSLAGLNIQNCVGISHRGVDLLVERLWRCDI  457
               L  LNIQ+C  IS  G   + +   RC I
Sbjct  207  CRGLQQLNIQDC-QISVEGYRAVKKYCKRCII  237



>ref|XP_793918.2| PREDICTED: F-box/LRR-repeat protein 20-like [Strongylocentrotus 
purpuratus]
Length=431

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/141 (33%), Positives = 78/141 (55%), Gaps = 6/141 (4%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            VTD  L  F  +C   +  +NL  C  +TD T  ++++ + + L  LN+  C  +TD +L
Sbjct  99   VTDDALNTFADNC-RNIEVLNLEDCKRITDHTAQSLSR-YSKKLSQLNMVSCTAITDNAL  156

Query  182  AAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHK  358
             +++D C +L  L+IS   ++SD GI AL  G +    +++L L GC   +D+ + ++  
Sbjct  157  KSLSDGCHLLSHLNISWCDQISDNGIEALVRGCS---HIKVLILKGCHSITDEGITHIGS  213

Query  359  LGNSLAGLNIQNCVGISHRGV  421
               +L  LN+Q CV IS  G+
Sbjct  214  HCKNLTTLNVQGCVLISDDGM  234


 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 74/141 (52%), Gaps = 6/141 (4%)
 Frame = +2

Query  2    VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  181
            +TD G+      C   L  +N+ GC+ ++D  + A+AK    TL+ L ++GC  +TD +L
Sbjct  203  ITDEGITHIGSHC-KNLTTLNVQGCVLISDDGMIALAK-GCRTLQSLCVSGCTHLTDNTL  260

Query  182  AAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHK  358
            +A + +C  ++ L++S  S+ +D G  ALA        L+ + L  CVL +D  L YL  
Sbjct  261  SAFSQFCPKIKTLEVSGCSQFTDNGFQALARTC---IDLERMDLEECVLITDTALSYLAL  317

Query  359  LGNSLAGLNIQNCVGISHRGV  421
                L  L + +C  I+  G+
Sbjct  318  GCPMLQKLTLSHCELITDEGI  338



>ref|XP_009509760.1| PREDICTED: F-box/LRR-repeat protein 13-like, partial [Phalacrocorax 
carbo]
Length=254

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 77/144 (53%), Gaps = 7/144 (5%)
 Frame = +2

Query  2    VTDYGLLPFVQ-SCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDAS  178
            ++D G+ PFVQ S  A L ++NL+ C++VTD +++ IA+   E L  LNL  C  VTDA 
Sbjct  1    ISDGGIRPFVQGSSGAKLRELNLTNCVHVTDASVTEIAQRCHE-LTYLNLRHCENVTDAG  59

Query  179  LAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHK  358
            + A+ +  S++  +DIS + +SD G+ AL     I+     LS+S C   SD  +    K
Sbjct  60   IEALGNMSSLI-SVDISGTSISDTGLRALGRHGRIKE----LSISECKTISDTGIQEFCK  114

Query  359  LGNSLAGLNIQNCVGISHRGVDLL  430
                L   ++  C  ++   V  +
Sbjct  115  GTKPLEYCHVSYCPQLTDEAVKAM  138



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 567171140730