BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF039E12

Length=558
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU34325.1|  hypothetical protein MIMGU_mgv1a005646mg                188   1e-59   Erythranthe guttata [common monkey flower]
ref|XP_011079368.1|  PREDICTED: serine carboxypeptidase II-2            190   3e-59   Sesamum indicum [beniseed]
gb|KDO62275.1|  hypothetical protein CISIN_1g0418332mg                  185   1e-57   Citrus sinensis [apfelsine]
ref|XP_010526302.1|  PREDICTED: serine carboxypeptidase-like 29         195   2e-57   Tarenaya hassleriana [spider flower]
ref|XP_010531651.1|  PREDICTED: serine carboxypeptidase-like 29         185   5e-57   Tarenaya hassleriana [spider flower]
ref|XP_010273729.1|  PREDICTED: serine carboxypeptidase II-2            182   1e-56   Nelumbo nucifera [Indian lotus]
ref|XP_004242620.1|  PREDICTED: serine carboxypeptidase II-2            196   1e-56   Solanum lycopersicum
ref|XP_009630744.1|  PREDICTED: serine carboxypeptidase II-2            195   3e-56   Nicotiana tomentosiformis
ref|XP_006343604.1|  PREDICTED: serine carboxypeptidase II-2-like       195   3e-56   Solanum tuberosum [potatoes]
ref|XP_010048771.1|  PREDICTED: serine carboxypeptidase II-2            180   9e-56   Eucalyptus grandis [rose gum]
ref|XP_009789305.1|  PREDICTED: serine carboxypeptidase II-2            194   1e-55   Nicotiana sylvestris
ref|XP_010040844.1|  PREDICTED: serine carboxypeptidase II-2-like       180   1e-55   Eucalyptus grandis [rose gum]
gb|KFK29659.1|  hypothetical protein AALP_AA7G162000                    187   1e-55   Arabis alpina [alpine rockcress]
ref|XP_008452541.1|  PREDICTED: serine carboxypeptidase II-2            183   2e-55   Cucumis melo [Oriental melon]
gb|AFK34623.1|  unknown                                                 184   3e-55   Lotus japonicus
ref|XP_004162685.1|  PREDICTED: serine carboxypeptidase-like 29-like    182   4e-55   
gb|KGN61064.1|  hypothetical protein Csa_2G036620                       182   4e-55   
ref|XP_006286217.1|  hypothetical protein CARUB_v10007783mg             186   8e-55   Capsella rubella
ref|XP_004144720.1|  PREDICTED: serine carboxypeptidase-like 29-like    181   8e-55   Cucumis sativus [cucumbers]
ref|XP_010905043.1|  PREDICTED: serine carboxypeptidase II-2            181   2e-54   Elaeis guineensis
ref|XP_006453576.1|  hypothetical protein CICLE_v10008112mg             187   3e-54   
ref|XP_002869361.1|  hypothetical protein ARALYDRAFT_491673             185   3e-54   
gb|EPS71160.1|  hypothetical protein M569_03591                         182   3e-54   Genlisea aurea
ref|XP_010432944.1|  PREDICTED: serine carboxypeptidase-like 29         184   5e-54   Camelina sativa [gold-of-pleasure]
ref|XP_002528403.1|  serine carboxypeptidase, putative                  189   5e-54   Ricinus communis
ref|XP_010447670.1|  PREDICTED: serine carboxypeptidase-like 29         184   6e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010438130.1|  PREDICTED: serine carboxypeptidase-like 29         185   1e-53   Camelina sativa [gold-of-pleasure]
emb|CDY23258.1|  BnaA08g12880D                                          182   2e-53   Brassica napus [oilseed rape]
ref|NP_567854.1|  serine carboxypeptidase-like 29                       182   4e-53   Arabidopsis thaliana [mouse-ear cress]
emb|CDY55623.1|  BnaC03g77560D                                          181   6e-53   Brassica napus [oilseed rape]
ref|XP_006453577.1|  hypothetical protein CICLE_v10008112mg             187   6e-53   Citrus clementina [clementine]
ref|XP_006474032.1|  PREDICTED: serine carboxypeptidase-like 29-like    186   7e-53   Citrus sinensis [apfelsine]
emb|CAA18212.1|  SERINE CARBOXYPEPTIDASE II-like protein                182   7e-53   Arabidopsis thaliana [mouse-ear cress]
emb|CDX72270.1|  BnaC07g42920D                                          179   8e-53   
ref|XP_006453578.1|  hypothetical protein CICLE_v10008112mg             186   9e-53   Citrus clementina [clementine]
ref|XP_009108967.1|  PREDICTED: serine carboxypeptidase-like 29         182   1e-52   
ref|XP_004287151.1|  PREDICTED: serine carboxypeptidase II-2            186   1e-52   Fragaria vesca subsp. vesca
ref|XP_009358402.1|  PREDICTED: serine carboxypeptidase II-2            186   2e-52   Pyrus x bretschneideri [bai li]
ref|XP_009137969.1|  PREDICTED: serine carboxypeptidase-like 29         179   3e-52   Brassica rapa
emb|CDY13387.1|  BnaA03g51050D                                          179   3e-52   Brassica napus [oilseed rape]
ref|XP_006412667.1|  hypothetical protein EUTSA_v10025076mg             181   3e-52   Eutrema salsugineum [saltwater cress]
ref|XP_002324520.1|  serine carboxypeptidase S10 family protein         184   5e-52   
ref|XP_002324616.2|  hypothetical protein POPTR_0018s11210g             184   6e-52   
ref|XP_007202013.1|  hypothetical protein PRUPE_ppa005192mg             184   6e-52   Prunus persica
ref|XP_008243035.1|  PREDICTED: serine carboxypeptidase II-2            184   6e-52   Prunus mume [ume]
ref|XP_008394291.1|  PREDICTED: serine carboxypeptidase II-2            184   6e-52   
ref|XP_002275081.1|  PREDICTED: serine carboxypeptidase II-2            183   9e-52   Vitis vinifera
ref|XP_011018072.1|  PREDICTED: serine carboxypeptidase-like 29 i...    182   1e-51   Populus euphratica
ref|XP_009127491.1|  PREDICTED: serine carboxypeptidase-like 29         183   1e-51   Brassica rapa
ref|XP_009410194.1|  PREDICTED: serine carboxypeptidase II-2-like       182   2e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008790133.1|  PREDICTED: serine carboxypeptidase II-2 isof...    181   3e-51   Phoenix dactylifera
emb|CDX68696.1|  BnaC01g07570D                                          182   3e-51   
emb|CDY28216.1|  BnaA01g06330D                                          182   4e-51   Brassica napus [oilseed rape]
emb|CDP02851.1|  unnamed protein product                                182   4e-51   Coffea canephora [robusta coffee]
ref|XP_011018071.1|  PREDICTED: serine carboxypeptidase II-2-like...    182   4e-51   Populus euphratica
ref|XP_009127511.1|  PREDICTED: serine carboxypeptidase-like 29         182   4e-51   Brassica rapa
ref|XP_004488608.1|  PREDICTED: serine carboxypeptidase II-2-like       174   5e-51   Cicer arietinum [garbanzo]
gb|KDP38717.1|  hypothetical protein JCGZ_04070                         181   6e-51   Jatropha curcas
emb|CDY28217.1|  BnaA01g06320D                                          181   7e-51   Brassica napus [oilseed rape]
ref|XP_008790132.1|  PREDICTED: serine carboxypeptidase II-2 isof...    181   8e-51   Phoenix dactylifera
emb|CDX68695.1|  BnaC01g07580D                                          181   1e-50   
ref|XP_010687643.1|  PREDICTED: serine carboxypeptidase II-2            181   1e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006387151.1|  hypothetical protein POPTR_1689s00200g             176   2e-50   
gb|KJB76660.1|  hypothetical protein B456_012G098600                    178   3e-50   Gossypium raimondii
ref|XP_007138291.1|  hypothetical protein PHAVU_009G196000g             171   7e-50   Phaseolus vulgaris [French bean]
ref|XP_006845388.1|  hypothetical protein AMTR_s00019p00053910          178   7e-50   Amborella trichopoda
ref|XP_004964646.1|  PREDICTED: serine carboxypeptidase II-2-like       178   9e-50   Setaria italica
gb|KJB76659.1|  hypothetical protein B456_012G098600                    178   1e-49   Gossypium raimondii
ref|XP_007013884.1|  Serine carboxypeptidase-like 29                    177   3e-49   Theobroma cacao [chocolate]
emb|CBI36578.3|  unnamed protein product                                177   3e-49   Vitis vinifera
ref|XP_009395827.1|  PREDICTED: serine carboxypeptidase II-2-like       177   3e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001146398.1|  Serine carboxypeptidase K10B2.2 precursor          175   4e-49   Zea mays [maize]
ref|XP_003595890.1|  Serine carboxypeptidase II-2                       170   4e-49   Medicago truncatula
ref|XP_002273324.2|  PREDICTED: serine carboxypeptidase II-2            177   5e-49   Vitis vinifera
sp|P55748.1|CBP22_HORVU  RecName: Full=Serine carboxypeptidase II...    176   5e-49   Hordeum vulgare [barley]
gb|AFW85537.1|  hypothetical protein ZEAMMB73_208131                    174   5e-49   
ref|XP_003596536.1|  Serine carboxypeptidase                            172   6e-49   
gb|KHG11306.1|  Serine carboxypeptidase-like 29                         176   6e-49   Gossypium arboreum [tree cotton]
dbj|BAJ99024.1|  predicted protein                                      176   9e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK02147.1|  predicted protein                                      175   9e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006655861.1|  PREDICTED: serine carboxypeptidase II-2-like       175   2e-48   Oryza brachyantha
gb|KDP38716.1|  hypothetical protein JCGZ_04069                         154   2e-48   Jatropha curcas
gb|AES66787.2|  serine carboxypeptidase-like protein                    170   3e-48   Medicago truncatula
ref|XP_003564183.1|  PREDICTED: serine carboxypeptidase II-2            174   3e-48   Brachypodium distachyon [annual false brome]
ref|NP_001057009.1|  Os06g0186400                                       174   5e-48   
gb|KHN02055.1|  Serine carboxypeptidase II-2                            173   6e-48   Glycine soja [wild soybean]
emb|CDY32091.1|  BnaC04g44750D                                          164   6e-48   Brassica napus [oilseed rape]
ref|XP_003522937.2|  PREDICTED: serine carboxypeptidase II-2-like       173   7e-48   Glycine max [soybeans]
ref|XP_003595892.1|  Serine carboxypeptidase II-2                       164   8e-48   Medicago truncatula
ref|XP_009141519.1|  PREDICTED: serine carboxypeptidase-like 26         164   1e-47   Brassica rapa
ref|XP_010111113.1|  Serine carboxypeptidase-like 29                    173   1e-47   
emb|CDY40438.1|  BnaA04g20790D                                          163   1e-47   Brassica napus [oilseed rape]
ref|XP_003548016.1|  PREDICTED: serine carboxypeptidase-like 27-like    155   2e-47   Glycine max [soybeans]
ref|XP_003595891.1|  Serine carboxypeptidase-like protein               164   4e-47   Medicago truncatula
ref|XP_006294202.1|  hypothetical protein CARUB_v10023198mg             162   8e-47   Capsella rubella
gb|KFK36474.1|  hypothetical protein AALP_AA4G129400                    161   8e-47   Arabis alpina [alpine rockcress]
ref|XP_011076996.1|  PREDICTED: serine carboxypeptidase-like 27         159   1e-46   Sesamum indicum [beniseed]
ref|NP_181121.1|  serine carboxypeptidase-like 26                       162   1e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006410747.1|  hypothetical protein EUTSA_v10016650mg             161   2e-46   Eutrema salsugineum [saltwater cress]
gb|ACA61621.1|  hypothetical protein AP7_B10.1                          163   3e-46   Arabidopsis lyrata subsp. petraea
ref|XP_002881414.1|  hypothetical protein ARALYDRAFT_482550             162   3e-46   
ref|XP_006589433.1|  PREDICTED: serine carboxypeptidase-like 27-like    156   5e-46   Glycine max [soybeans]
gb|KHN13367.1|  Serine carboxypeptidase-like 27                         150   6e-46   Glycine soja [wild soybean]
ref|XP_010505098.1|  PREDICTED: serine carboxypeptidase-like 26         159   7e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010509560.1|  PREDICTED: serine carboxypeptidase-like 26         159   8e-46   Camelina sativa [gold-of-pleasure]
gb|KHG25905.1|  Serine carboxypeptidase-like 27                         154   9e-46   Gossypium arboreum [tree cotton]
ref|XP_009378094.1|  PREDICTED: serine carboxypeptidase-like 27         162   1e-45   Pyrus x bretschneideri [bai li]
ref|XP_002315293.2|  hypothetical protein POPTR_0010s22700g             161   1e-45   
ref|XP_002534550.1|  serine carboxypeptidase, putative                  160   1e-45   
ref|XP_010547376.1|  PREDICTED: serine carboxypeptidase-like 27         155   1e-45   Tarenaya hassleriana [spider flower]
gb|KJB78939.1|  hypothetical protein B456_013G026200                    154   2e-45   Gossypium raimondii
gb|KJB78940.1|  hypothetical protein B456_013G026200                    154   2e-45   Gossypium raimondii
ref|XP_007143689.1|  hypothetical protein PHAVU_007G093300g             155   2e-45   Phaseolus vulgaris [French bean]
ref|XP_009592854.1|  PREDICTED: serine carboxypeptidase-like 27         162   2e-45   Nicotiana tomentosiformis
ref|XP_009802382.1|  PREDICTED: serine carboxypeptidase-like 27         161   2e-45   Nicotiana sylvestris
gb|KJB78942.1|  hypothetical protein B456_013G026200                    153   2e-45   Gossypium raimondii
gb|KJB78938.1|  hypothetical protein B456_013G026200                    153   2e-45   Gossypium raimondii
ref|XP_010516783.1|  PREDICTED: serine carboxypeptidase-like 26         157   2e-45   Camelina sativa [gold-of-pleasure]
emb|CAN75200.1|  hypothetical protein VITISV_014887                     167   3e-45   Vitis vinifera
ref|XP_002315292.2|  serine carboxypeptidase S10 family protein         159   4e-45   Populus trichocarpa [western balsam poplar]
gb|KHN17121.1|  Serine carboxypeptidase-like 27                         153   4e-45   Glycine soja [wild soybean]
ref|XP_010264739.1|  PREDICTED: serine carboxypeptidase-like 27         155   4e-45   Nelumbo nucifera [Indian lotus]
ref|XP_002312023.1|  hypothetical protein POPTR_0008s04130g             157   5e-45   Populus trichocarpa [western balsam poplar]
ref|XP_011040962.1|  PREDICTED: serine carboxypeptidase-like 27         159   5e-45   Populus euphratica
ref|XP_007009790.1|  Serine carboxypeptidase-like 28                    161   5e-45   
gb|KFK38250.1|  hypothetical protein AALP_AA3G088900                    149   6e-45   Arabis alpina [alpine rockcress]
ref|XP_007009788.1|  Serine carboxypeptidase-like 27 isoform 2          155   6e-45   
ref|XP_004142401.1|  PREDICTED: serine carboxypeptidase-like 27-like    157   8e-45   Cucumis sativus [cucumbers]
ref|XP_009141517.1|  PREDICTED: serine carboxypeptidase-like 28         160   8e-45   Brassica rapa
ref|XP_006407773.1|  hypothetical protein EUTSA_v10020705mg             150   8e-45   Eutrema salsugineum [saltwater cress]
ref|XP_007009787.1|  Serine carboxypeptidase-like 27 isoform 1          154   9e-45   
ref|XP_003556225.1|  PREDICTED: serine carboxypeptidase-like 27-l...    152   9e-45   Glycine max [soybeans]
ref|XP_008368824.1|  PREDICTED: serine carboxypeptidase-like 27         160   1e-44   Malus domestica [apple tree]
ref|XP_010669644.1|  PREDICTED: serine carboxypeptidase-like 27         164   1e-44   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008446902.1|  PREDICTED: serine carboxypeptidase-like 27         157   1e-44   Cucumis melo [Oriental melon]
gb|KJB76571.1|  hypothetical protein B456_012G095000                    160   1e-44   Gossypium raimondii
gb|AFK37459.1|  unknown                                                 155   1e-44   Lotus japonicus
emb|CDY40439.1|  BnaA04g20780D                                          159   1e-44   Brassica napus [oilseed rape]
gb|EYU39591.1|  hypothetical protein MIMGU_mgv1a009171mg                157   2e-44   Erythranthe guttata [common monkey flower]
ref|XP_009147009.1|  PREDICTED: serine carboxypeptidase-like 27 i...    152   3e-44   Brassica rapa
ref|XP_009147010.1|  PREDICTED: serine carboxypeptidase-like 27 i...    152   3e-44   
ref|XP_011031766.1|  PREDICTED: serine carboxypeptidase-like 27         154   4e-44   Populus euphratica
emb|CDY35977.1|  BnaA05g29730D                                          152   4e-44   Brassica napus [oilseed rape]
emb|CDY28004.1|  BnaC05g44060D                                          151   5e-44   Brassica napus [oilseed rape]
gb|ACA61622.1|  hypothetical protein AP7_B10.2                          156   6e-44   Arabidopsis lyrata subsp. petraea
ref|XP_008381976.1|  PREDICTED: serine carboxypeptidase-like 27         162   6e-44   
ref|XP_009333715.1|  PREDICTED: serine carboxypeptidase-like 27         162   6e-44   Pyrus x bretschneideri [bai li]
ref|XP_010460785.1|  PREDICTED: serine carboxypeptidase-like 27         152   6e-44   Camelina sativa [gold-of-pleasure]
gb|EPS66906.1|  hypothetical protein M569_07869                         155   6e-44   Genlisea aurea
emb|CBI31484.3|  unnamed protein product                                155   7e-44   Vitis vinifera
ref|XP_002274699.1|  PREDICTED: serine carboxypeptidase-like 28         155   8e-44   Vitis vinifera
ref|XP_004307401.1|  PREDICTED: serine carboxypeptidase-like 27         162   9e-44   Fragaria vesca subsp. vesca
ref|NP_187456.1|  serine carboxypeptidase-like 27                       152   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006350225.1|  PREDICTED: serine carboxypeptidase-like 27-like    161   1e-43   Solanum tuberosum [potatoes]
ref|XP_010464446.1|  PREDICTED: serine carboxypeptidase-like 27         152   1e-43   Camelina sativa [gold-of-pleasure]
emb|CDO99730.1|  unnamed protein product                                161   1e-43   Coffea canephora [robusta coffee]
ref|XP_010486379.1|  PREDICTED: serine carboxypeptidase-like 27         152   2e-43   Camelina sativa [gold-of-pleasure]
gb|AES62200.2|  serine carboxypeptidase-like protein                    145   2e-43   Medicago truncatula
ref|XP_003591950.1|  Serine carboxypeptidase-like protein               145   2e-43   Medicago truncatula
ref|XP_003591949.1|  Serine carboxypeptidase-like protein               145   3e-43   
ref|XP_010067291.1|  PREDICTED: serine carboxypeptidase-like 28         160   3e-43   Eucalyptus grandis [rose gum]
ref|XP_004236634.1|  PREDICTED: serine carboxypeptidase-like 27         160   3e-43   Solanum lycopersicum
ref|XP_002312024.1|  serine carboxypeptidase S10 family protein         160   4e-43   Populus trichocarpa [western balsam poplar]
ref|XP_008233341.1|  PREDICTED: serine carboxypeptidase-like 27         160   4e-43   Prunus mume [ume]
ref|NP_181120.2|  serine carboxypeptidase-like 28                       152   4e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011040963.1|  PREDICTED: serine carboxypeptidase-like 27         160   4e-43   Populus euphratica
ref|XP_010505097.1|  PREDICTED: serine carboxypeptidase-like 28         153   4e-43   Camelina sativa [gold-of-pleasure]
emb|CDP11023.1|  unnamed protein product                                160   5e-43   Coffea canephora [robusta coffee]
ref|XP_010258045.1|  PREDICTED: serine carboxypeptidase-like 25         155   5e-43   Nelumbo nucifera [Indian lotus]
ref|XP_009399563.1|  PREDICTED: serine carboxypeptidase 24-like         152   5e-43   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI21207.3|  unnamed protein product                                155   7e-43   Vitis vinifera
ref|XP_011469672.1|  PREDICTED: serine carboxypeptidase-like 27 i...    159   7e-43   Fragaria vesca subsp. vesca
ref|XP_002280058.1|  PREDICTED: serine carboxypeptidase-like 25         155   7e-43   Vitis vinifera
ref|XP_011031767.1|  PREDICTED: serine carboxypeptidase-like 27         159   7e-43   Populus euphratica
ref|XP_006297634.1|  hypothetical protein CARUB_v10013654mg             151   7e-43   
ref|XP_009386999.1|  PREDICTED: serine carboxypeptidase-like 27         156   8e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004307399.1|  PREDICTED: serine carboxypeptidase-like 27 i...    159   9e-43   Fragaria vesca subsp. vesca
ref|XP_006297635.1|  hypothetical protein CARUB_v10013654mg             150   9e-43   
gb|KDP25725.1|  hypothetical protein JCGZ_23946                         159   1e-42   Jatropha curcas
gb|ABR16028.1|  unknown                                                 148   1e-42   Picea sitchensis
ref|XP_010032541.1|  PREDICTED: serine carboxypeptidase-like 25         159   2e-42   Eucalyptus grandis [rose gum]
ref|XP_006294164.1|  hypothetical protein CARUB_v10023157mg             153   2e-42   Capsella rubella
gb|AFK43035.1|  unknown                                                 143   2e-42   Medicago truncatula
ref|XP_010253608.1|  PREDICTED: serine carboxypeptidase-like 27         158   2e-42   Nelumbo nucifera [Indian lotus]
ref|XP_010260054.1|  PREDICTED: serine carboxypeptidase-like 25 i...    157   2e-42   Nelumbo nucifera [Indian lotus]
ref|XP_002882565.1|  hypothetical protein ARALYDRAFT_478140             150   2e-42   Arabidopsis lyrata subsp. lyrata
gb|KCW65386.1|  hypothetical protein EUGRSUZ_G02816                     158   3e-42   Eucalyptus grandis [rose gum]
ref|XP_010067290.1|  PREDICTED: serine carboxypeptidase-like 27         159   3e-42   Eucalyptus grandis [rose gum]
ref|XP_006410746.1|  hypothetical protein EUTSA_v10016610mg             153   3e-42   Eutrema salsugineum [saltwater cress]
ref|XP_003591947.1|  Serine carboxypeptidase-like protein               146   3e-42   Medicago truncatula
ref|XP_004496292.1|  PREDICTED: serine carboxypeptidase-like 27-l...    148   4e-42   Cicer arietinum [garbanzo]
ref|XP_004496293.1|  PREDICTED: serine carboxypeptidase-like 27-l...    148   4e-42   
gb|KDP25724.1|  hypothetical protein JCGZ_23945                         153   4e-42   Jatropha curcas
ref|XP_002881413.1|  hypothetical protein ARALYDRAFT_321290             152   4e-42   
ref|XP_010260044.1|  PREDICTED: serine carboxypeptidase-like 25 i...    157   5e-42   Nelumbo nucifera [Indian lotus]
gb|KDO48447.1|  hypothetical protein CISIN_1g012819mg                   157   5e-42   Citrus sinensis [apfelsine]
gb|KJB76564.1|  hypothetical protein B456_012G094900                    154   6e-42   Gossypium raimondii
ref|XP_006436271.1|  hypothetical protein CICLE_v10031497mg             157   6e-42   Citrus clementina [clementine]
gb|AAM15112.1|  putative serine carboxypeptidase II                     152   6e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010920885.1|  PREDICTED: serine carboxypeptidase-like 27         157   7e-42   Elaeis guineensis
ref|XP_010265559.1|  PREDICTED: serine carboxypeptidase 24-like i...    153   7e-42   Nelumbo nucifera [Indian lotus]
ref|XP_006850617.1|  hypothetical protein AMTR_s00034p00161680          147   8e-42   Amborella trichopoda
dbj|BAO04184.1|  hypothetical protein                                   150   8e-42   Delphinium grandiflorum
emb|CDO99728.1|  unnamed protein product                                150   1e-41   Coffea canephora [robusta coffee]
gb|KJB76565.1|  hypothetical protein B456_012G094900                    154   1e-41   Gossypium raimondii
ref|XP_010089631.1|  Serine carboxypeptidase-like 25                    156   1e-41   Morus notabilis
ref|XP_010509563.1|  PREDICTED: serine carboxypeptidase-like 28         150   1e-41   Camelina sativa [gold-of-pleasure]
gb|EYU39590.1|  hypothetical protein MIMGU_mgv1a0101821mg               149   2e-41   Erythranthe guttata [common monkey flower]
ref|XP_007219592.1|  hypothetical protein PRUPE_ppa023509mg             155   2e-41   
ref|XP_010516781.1|  PREDICTED: serine carboxypeptidase-like 28         151   2e-41   Camelina sativa [gold-of-pleasure]
emb|CDY43258.1|  BnaC05g48510D                                          148   2e-41   Brassica napus [oilseed rape]
ref|XP_007032751.1|  Serine carboxypeptidase-like 25 isoform 4          154   2e-41   
ref|XP_009414289.1|  PREDICTED: serine carboxypeptidase-like 27         147   2e-41   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU44197.1|  hypothetical protein MIMGU_mgv1a005600mg                152   3e-41   Erythranthe guttata [common monkey flower]
ref|XP_009147382.1|  PREDICTED: serine carboxypeptidase-like 25         147   3e-41   Brassica rapa
gb|KJB07560.1|  hypothetical protein B456_001G032600                    151   3e-41   Gossypium raimondii
gb|KFK36473.1|  hypothetical protein AALP_AA4G129300                    151   3e-41   Arabis alpina [alpine rockcress]
ref|XP_006845845.1|  hypothetical protein AMTR_s00154p00033550          152   4e-41   Amborella trichopoda
ref|XP_002452974.1|  hypothetical protein SORBIDRAFT_04g035810          153   4e-41   Sorghum bicolor [broomcorn]
ref|XP_011079399.1|  PREDICTED: serine carboxypeptidase 24              150   4e-41   Sesamum indicum [beniseed]
ref|XP_002529402.1|  serine carboxypeptidase, putative                  155   4e-41   Ricinus communis
ref|XP_006408447.1|  hypothetical protein EUTSA_v10020652mg             148   4e-41   Eutrema salsugineum [saltwater cress]
gb|KJB07562.1|  hypothetical protein B456_001G032600                    151   4e-41   Gossypium raimondii
ref|XP_006373363.1|  hypothetical protein POPTR_0017s12960g             154   5e-41   
ref|XP_011009401.1|  PREDICTED: serine carboxypeptidase-like 25 i...    155   5e-41   Populus euphratica
gb|KJB07564.1|  hypothetical protein B456_001G032600                    151   5e-41   Gossypium raimondii
gb|KJB07559.1|  hypothetical protein B456_001G032600                    150   5e-41   Gossypium raimondii
ref|XP_004288721.2|  PREDICTED: serine carboxypeptidase 24              155   5e-41   Fragaria vesca subsp. vesca
gb|KJB75609.1|  hypothetical protein B456_012G048700                    152   5e-41   Gossypium raimondii
ref|XP_004304228.1|  PREDICTED: serine carboxypeptidase-like 25         149   6e-41   Fragaria vesca subsp. vesca
ref|XP_003549539.1|  PREDICTED: serine carboxypeptidase 24-like         150   7e-41   Glycine max [soybeans]
ref|XP_009792407.1|  PREDICTED: serine carboxypeptidase 24-like         154   7e-41   Nicotiana sylvestris
ref|XP_006845380.1|  hypothetical protein AMTR_s00019p00043630          148   7e-41   
ref|XP_010938508.1|  PREDICTED: serine carboxypeptidase II-3-like...    153   9e-41   
gb|KJB76563.1|  hypothetical protein B456_012G094900                    154   9e-41   Gossypium raimondii
ref|XP_011000079.1|  PREDICTED: serine carboxypeptidase-like 25         154   1e-40   Populus euphratica
ref|XP_009420309.1|  PREDICTED: serine carboxypeptidase 24-like         147   1e-40   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG08205.1|  Serine carboxypeptidase-like 27                         154   1e-40   Gossypium arboreum [tree cotton]
gb|KEH38195.1|  serine carboxypeptidase-like protein                    140   1e-40   Medicago truncatula
ref|XP_002324116.2|  serine carboxypeptidase S10 family protein         154   1e-40   Populus trichocarpa [western balsam poplar]
emb|CDP02317.1|  unnamed protein product                                154   1e-40   Coffea canephora [robusta coffee]
ref|XP_003519151.1|  PREDICTED: serine carboxypeptidase 24-like i...    154   1e-40   Glycine max [soybeans]
gb|KJB76567.1|  hypothetical protein B456_012G094900                    154   1e-40   Gossypium raimondii
ref|XP_004954211.1|  PREDICTED: serine carboxypeptidase 24-like         150   1e-40   Setaria italica
dbj|BAK05698.1|  predicted protein                                      147   1e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB76566.1|  hypothetical protein B456_012G094900                    154   1e-40   Gossypium raimondii
ref|XP_003552566.1|  PREDICTED: serine carboxypeptidase-like 25-l...    153   1e-40   Glycine max [soybeans]
ref|XP_009771074.1|  PREDICTED: serine carboxypeptidase-like 25         146   2e-40   Nicotiana sylvestris
ref|XP_002274723.1|  PREDICTED: serine carboxypeptidase-like 27         153   2e-40   Vitis vinifera
emb|CAN74854.1|  hypothetical protein VITISV_028701                     153   2e-40   Vitis vinifera
gb|KFK37671.1|  hypothetical protein AALP_AA3G013500                    145   2e-40   Arabis alpina [alpine rockcress]
ref|XP_009596929.1|  PREDICTED: serine carboxypeptidase-like 25         147   2e-40   Nicotiana tomentosiformis
ref|XP_008789080.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    153   2e-40   
gb|ABR16997.1|  unknown                                                 154   2e-40   Picea sitchensis
ref|NP_001140896.1|  hypothetical protein precursor                     148   2e-40   
ref|XP_010938742.1|  PREDICTED: serine carboxypeptidase II-3-like       153   2e-40   Elaeis guineensis
gb|ABR16596.1|  unknown                                                 154   2e-40   Picea sitchensis
ref|XP_006578498.1|  PREDICTED: serine carboxypeptidase II-3-like       145   2e-40   Glycine max [soybeans]
ref|XP_002275684.1|  PREDICTED: serine carboxypeptidase 24 isofor...    149   2e-40   Vitis vinifera
ref|XP_010108549.1|  Serine carboxypeptidase 24                         148   3e-40   
ref|XP_010938507.1|  PREDICTED: serine carboxypeptidase II-3-like...    153   3e-40   Elaeis guineensis
ref|XP_009631140.1|  PREDICTED: serine carboxypeptidase 24-like         152   3e-40   Nicotiana tomentosiformis
ref|XP_007032749.1|  Serine carboxypeptidase-like 25 isoform 2          152   3e-40   
gb|KHG14577.1|  Serine carboxypeptidase 24 -like protein                150   3e-40   Gossypium arboreum [tree cotton]
gb|KHN42831.1|  Serine carboxypeptidase 24                              152   3e-40   Glycine soja [wild soybean]
ref|XP_002308408.1|  BRI1 SUPPRESSOR 1 family protein                   148   3e-40   Populus trichocarpa [western balsam poplar]
ref|XP_007139483.1|  hypothetical protein PHAVU_008G033300g             152   3e-40   Phaseolus vulgaris [French bean]
ref|XP_009358427.1|  PREDICTED: serine carboxypeptidase 24              147   3e-40   Pyrus x bretschneideri [bai li]
gb|KHN41581.1|  Serine carboxypeptidase-like 25                         152   4e-40   Glycine soja [wild soybean]
ref|XP_003530438.1|  PREDICTED: serine carboxypeptidase-like 25-l...    152   4e-40   
ref|XP_010067796.1|  PREDICTED: serine carboxypeptidase-like 40 i...    152   4e-40   Eucalyptus grandis [rose gum]
ref|XP_011098746.1|  PREDICTED: serine carboxypeptidase-like 25         152   4e-40   Sesamum indicum [beniseed]
ref|XP_007146042.1|  hypothetical protein PHAVU_006G007800g             144   4e-40   Phaseolus vulgaris [French bean]
ref|XP_007032748.1|  Serine carboxypeptidase-like 25 isoform 1          153   4e-40   
gb|KHN35601.1|  Serine carboxypeptidase II-3                            144   4e-40   Glycine soja [wild soybean]
ref|XP_011018041.1|  PREDICTED: serine carboxypeptidase 24-like i...    150   5e-40   Populus euphratica
gb|KDO48446.1|  hypothetical protein CISIN_1g016137mg                   150   5e-40   Citrus sinensis [apfelsine]
gb|KHN13554.1|  Serine carboxypeptidase-like 25                         150   5e-40   Glycine soja [wild soybean]
ref|XP_002520355.1|  serine carboxypeptidase, putative                  147   5e-40   
ref|XP_006474013.1|  PREDICTED: serine carboxypeptidase 24-like         146   6e-40   
gb|KJB77373.1|  hypothetical protein B456_012G134700                    152   6e-40   
gb|EEC69980.1|  hypothetical protein OsI_00486                          152   6e-40   
gb|KJB77375.1|  hypothetical protein B456_012G134700                    152   7e-40   
ref|XP_008677402.1|  PREDICTED: lysosomal protective protein isof...    152   7e-40   
ref|XP_007204505.1|  hypothetical protein PRUPE_ppa019210mg             146   7e-40   
ref|XP_009413121.1|  PREDICTED: serine carboxypeptidase-like 34         141   7e-40   
ref|XP_008673013.1|  PREDICTED: LOC100285510 isoform X1                 140   7e-40   
ref|NP_001152245.1|  lysosomal protective protein precursor             151   8e-40   
ref|XP_010546240.1|  PREDICTED: serine carboxypeptidase-like 34 i...    146   8e-40   
ref|XP_006343642.1|  PREDICTED: serine carboxypeptidase 24-like         151   9e-40   
ref|XP_010546241.1|  PREDICTED: serine carboxypeptidase-like 34 i...    145   9e-40   
ref|XP_006453595.1|  hypothetical protein CICLE_v10008182mg             145   9e-40   
dbj|BAJ92218.1|  predicted protein                                      152   9e-40   
gb|ABK24285.1|  unknown                                                 151   9e-40   
ref|XP_008800209.1|  PREDICTED: serine carboxypeptidase II-3-like       147   9e-40   
ref|XP_010906017.1|  PREDICTED: serine carboxypeptidase II-3-like       149   9e-40   
dbj|BAJ85578.1|  predicted protein                                      151   9e-40   
ref|XP_006436272.1|  hypothetical protein CICLE_v10031437mg             151   9e-40   
ref|XP_008813040.1|  PREDICTED: serine carboxypeptidase II-3-like       151   9e-40   
gb|KJB76570.1|  hypothetical protein B456_012G095000                    144   1e-39   
ref|XP_010315500.1|  PREDICTED: serine carboxypeptidase II-3-like       147   1e-39   
ref|XP_008643436.1|  PREDICTED: hypothetical protein isoform X2         151   1e-39   
gb|KEH32355.1|  serine carboxypeptidase-like protein                    140   1e-39   
ref|NP_001141117.1|  uncharacterized protein LOC100273202 precursor     149   1e-39   
gb|KJB75608.1|  hypothetical protein B456_012G048700                    151   1e-39   
ref|XP_008643435.1|  PREDICTED: hypothetical protein isoform X1         151   1e-39   
ref|XP_010916829.1|  PREDICTED: serine carboxypeptidase II-3-like       147   1e-39   
ref|XP_010112534.1|  Serine carboxypeptidase-like 34                    151   1e-39   
ref|XP_010273635.1|  PREDICTED: serine carboxypeptidase 24-like         150   1e-39   
ref|XP_004146676.1|  PREDICTED: serine carboxypeptidase 24-like         146   1e-39   
ref|XP_008243007.1|  PREDICTED: serine carboxypeptidase 24              145   1e-39   
emb|CDP10248.1|  unnamed protein product                                150   1e-39   
ref|XP_006453596.1|  hypothetical protein CICLE_v10008182mg             144   1e-39   
gb|ACL53740.1|  unknown                                                 148   1e-39   
ref|XP_006345489.1|  PREDICTED: serine carboxypeptidase-like 40-like    150   2e-39   
ref|XP_009618061.1|  PREDICTED: serine carboxypeptidase-like 34         145   2e-39   
gb|KEH21654.1|  serine carboxypeptidase-like protein                    150   2e-39   
ref|XP_004161865.1|  PREDICTED: serine carboxypeptidase 24-like         146   2e-39   
gb|AAK44013.1|AF370198_1  putative serine carboxypeptidase II           145   2e-39   
ref|XP_011083949.1|  PREDICTED: serine carboxypeptidase 24-like i...    150   2e-39   
ref|XP_008783277.1|  PREDICTED: serine carboxypeptidase II-3-like       144   2e-39   
ref|NP_001042076.1|  Os01g0158200                                       150   2e-39   
ref|XP_002306020.2|  serine carboxypeptidase S10 family protein         150   2e-39   
ref|XP_003570294.1|  PREDICTED: serine carboxypeptidase 24              150   2e-39   
ref|XP_008460255.1|  PREDICTED: serine carboxypeptidase-like 25 i...    146   2e-39   
ref|XP_008221066.1|  PREDICTED: serine carboxypeptidase-like 34         150   2e-39   
dbj|BAB08188.1|  unnamed protein product                                150   2e-39   
ref|XP_009794620.1|  PREDICTED: putative serine carboxypeptidase-...    149   2e-39   
ref|XP_007011905.1|  Alpha/beta-Hydrolases superfamily protein          144   3e-39   
ref|NP_001151874.1|  LOC100285510 precursor                             138   3e-39   
ref|XP_008654562.1|  PREDICTED: uncharacterized protein LOC100273...    147   3e-39   
gb|KDO72764.1|  hypothetical protein CISIN_1g011426mg                   148   3e-39   
gb|AFW73854.1|  hypothetical protein ZEAMMB73_784908                    150   3e-39   
ref|NP_194790.1|  serine carboxypeptidase 24                            145   3e-39   
gb|KJB07563.1|  hypothetical protein B456_001G032600                    145   3e-39   
ref|NP_001150705.1|  LOC100284338 precursor                             150   3e-39   
ref|XP_011018040.1|  PREDICTED: serine carboxypeptidase 24-like i...    149   3e-39   
ref|XP_009601275.1|  PREDICTED: serine carboxypeptidase-like 40         150   3e-39   
ref|XP_006354981.1|  PREDICTED: serine carboxypeptidase-like 34-like    140   4e-39   
ref|XP_002282331.1|  PREDICTED: serine carboxypeptidase II-3-like       150   4e-39   
emb|CDY68103.1|  BnaCnng57600D                                          143   4e-39   
gb|EPS67442.1|  hypothetical protein M569_07330                         140   4e-39   
ref|XP_006830191.1|  hypothetical protein AMTR_s00173p00045470          150   4e-39   
ref|XP_009399958.1|  PREDICTED: serine carboxypeptidase II-3-like       148   4e-39   
gb|KHG16869.1|  Serine carboxypeptidase-like 25                         149   4e-39   
ref|XP_003592243.1|  Serine carboxypeptidase II-3                       145   4e-39   
ref|XP_006847849.1|  hypothetical protein AMTR_s00029p00064790          146   4e-39   
ref|XP_010501423.1|  PREDICTED: serine carboxypeptidase-like 31         141   4e-39   
ref|XP_004297735.1|  PREDICTED: serine carboxypeptidase-like 34         146   5e-39   
gb|AES71591.2|  serine carboxypeptidase-like protein                    144   5e-39   
ref|XP_006297594.1|  hypothetical protein CARUB_v10013616mg             146   5e-39   
gb|KJB76569.1|  hypothetical protein B456_012G094900                    149   5e-39   
gb|KDO75846.1|  hypothetical protein CISIN_1g0117382mg                  140   6e-39   
ref|XP_010551814.1|  PREDICTED: serine carboxypeptidase-like 25 i...    149   6e-39   
ref|XP_006853073.1|  hypothetical protein AMTR_s00038p00085900          149   6e-39   
ref|XP_004232164.1|  PREDICTED: serine carboxypeptidase-like 25         149   6e-39   
emb|CBI19568.3|  unnamed protein product                                149   6e-39   
ref|XP_006593897.1|  PREDICTED: serine carboxypeptidase II-3-like       143   6e-39   
ref|XP_010942075.1|  PREDICTED: serine carboxypeptidase 24 isofor...    140   6e-39   
ref|XP_010551812.1|  PREDICTED: serine carboxypeptidase-like 25 i...    149   6e-39   
ref|XP_010670278.1|  PREDICTED: serine carboxypeptidase-like 25         149   6e-39   
ref|XP_007216267.1|  hypothetical protein PRUPE_ppa017321mg             149   6e-39   
ref|XP_010463602.1|  PREDICTED: serine carboxypeptidase-like 25         145   6e-39   
ref|XP_002452495.1|  hypothetical protein SORBIDRAFT_04g026900          149   6e-39   
gb|KHN05141.1|  Serine carboxypeptidase II-3                            142   7e-39   
ref|XP_010468839.1|  PREDICTED: serine carboxypeptidase-like 40         149   7e-39   
gb|KHN05312.1|  Serine carboxypeptidase II-3                            142   7e-39   
ref|XP_009777002.1|  PREDICTED: serine carboxypeptidase-like 40         149   8e-39   
ref|XP_006338367.1|  PREDICTED: serine carboxypeptidase-like 25-like    149   8e-39   
ref|XP_010512774.1|  PREDICTED: serine carboxypeptidase-like 40 i...    149   8e-39   
ref|XP_006467848.1|  PREDICTED: serine carboxypeptidase-like 31-like    139   8e-39   
ref|XP_011033395.1|  PREDICTED: serine carboxypeptidase 24-like         149   8e-39   
ref|XP_007035881.1|  Serine carboxypeptidase-like 33                    141   8e-39   
ref|XP_008394313.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    149   8e-39   
ref|XP_003592239.1|  Serine carboxypeptidase-like protein               144   8e-39   
ref|XP_006595329.1|  PREDICTED: serine carboxypeptidase II-3-like       142   8e-39   
ref|XP_006449285.1|  hypothetical protein CICLE_v10015093mg             139   8e-39   
ref|XP_004505704.1|  PREDICTED: serine carboxypeptidase-like 34-like    142   8e-39   
ref|XP_006292523.1|  hypothetical protein CARUB_v10018754mg             148   9e-39   
ref|NP_001047514.1|  Os02g0634700                                       144   9e-39   
ref|XP_008783276.1|  PREDICTED: serine carboxypeptidase II-3-like       149   9e-39   
ref|XP_010445019.1|  PREDICTED: serine carboxypeptidase-like 25         145   9e-39   
emb|CBI29056.3|  unnamed protein product                                149   9e-39   
ref|XP_009365880.1|  PREDICTED: serine carboxypeptidase-like 25         149   9e-39   
gb|KEH32356.1|  serine carboxypeptidase-like protein                    137   9e-39   
ref|XP_008357779.1|  PREDICTED: serine carboxypeptidase-like 25 i...    149   9e-39   
gb|AAQ63884.1|  putative serine carboxypeptidase                        144   9e-39   
ref|XP_002869369.1|  hypothetical protein ARALYDRAFT_491690             142   9e-39   
dbj|BAK02399.1|  predicted protein                                      148   1e-38   
ref|XP_010655923.1|  PREDICTED: serine carboxypeptidase-like 34         149   1e-38   
ref|XP_006662015.1|  PREDICTED: serine carboxypeptidase-like 34-like    148   1e-38   
ref|XP_010458486.1|  PREDICTED: serine carboxypeptidase-like 31         141   1e-38   
ref|XP_010047069.1|  PREDICTED: serine carboxypeptidase 24-like         148   1e-38   
gb|KDP38391.1|  hypothetical protein JCGZ_04316                         146   1e-38   
ref|NP_186860.1|  serine carboxypeptidase-like 25                       146   1e-38   
ref|XP_004970465.1|  PREDICTED: serine carboxypeptidase-like 27-like    140   1e-38   
ref|XP_002458719.1|  hypothetical protein SORBIDRAFT_03g038940          140   1e-38   
gb|KJB76572.1|  hypothetical protein B456_012G095000                    140   1e-38   
ref|XP_011022036.1|  PREDICTED: serine carboxypeptidase-like 34         148   1e-38   
ref|XP_004231499.1|  PREDICTED: serine carboxypeptidase-like 34         140   1e-38   
gb|AAM65698.1|  putative serine carboxypeptidase II                     146   2e-38   
ref|XP_009400122.1|  PREDICTED: serine carboxypeptidase II-3-like       148   2e-38   
ref|XP_008805039.1|  PREDICTED: serine carboxypeptidase-like 27         140   2e-38   
ref|XP_010279511.1|  PREDICTED: serine carboxypeptidase-like 40 i...    148   2e-38   
gb|KEH33266.1|  serine carboxypeptidase-like protein                    147   2e-38   
gb|AFW56972.1|  hypothetical protein ZEAMMB73_293605                    140   2e-38   
emb|CDX72256.1|  BnaC07g42780D                                          147   2e-38   
emb|CBI32445.3|  unnamed protein product                                147   2e-38   
ref|XP_008461353.1|  PREDICTED: serine carboxypeptidase-like 40         145   2e-38   
ref|XP_004135951.1|  PREDICTED: serine carboxypeptidase-like 40-like    144   2e-38   
ref|XP_009619884.1|  PREDICTED: serine carboxypeptidase 24-like         145   2e-38   
ref|XP_010447693.1|  PREDICTED: serine carboxypeptidase 24-like         144   2e-38   
ref|XP_008654561.1|  PREDICTED: uncharacterized protein LOC100273...    147   2e-38   
ref|XP_006482747.1|  PREDICTED: serine carboxypeptidase-like 25-l...    147   2e-38   
ref|XP_006434836.1|  hypothetical protein CICLE_v10000968mg             147   2e-38   
ref|XP_006431295.1|  hypothetical protein CICLE_v10011605mg             147   2e-38   
ref|XP_008365144.1|  PREDICTED: serine carboxypeptidase II-3-like       146   2e-38   
ref|XP_008663967.1|  PREDICTED: serine carboxypeptidase-like 34         140   2e-38   
gb|KJB79850.1|  hypothetical protein B456_013G069700                    147   2e-38   
ref|XP_003592240.1|  Serine carboxypeptidase-like protein               142   2e-38   
ref|XP_002316057.2|  serine carboxypeptidase S10 family protein         138   2e-38   
ref|XP_010485446.1|  PREDICTED: serine carboxypeptidase-like 25         144   3e-38   
ref|XP_010533891.1|  PREDICTED: serine carboxypeptidase-like 31 i...    142   3e-38   
ref|XP_010937832.1|  PREDICTED: serine carboxypeptidase-like 27         147   3e-38   
ref|XP_004149744.1|  PREDICTED: serine carboxypeptidase-like 35-like    142   3e-38   
ref|XP_003592238.1|  Serine carboxypeptidase II-3                       142   3e-38   
emb|CBI18754.3|  unnamed protein product                                140   3e-38   
ref|XP_010432963.1|  PREDICTED: serine carboxypeptidase 24 isofor...    144   3e-38   
ref|XP_006473369.1|  PREDICTED: serine carboxypeptidase II-3-like       147   3e-38   
ref|XP_003572740.1|  PREDICTED: serine carboxypeptidase-like 34         147   3e-38   
emb|CAN82217.1|  hypothetical protein VITISV_020424                     140   3e-38   
ref|XP_008443849.1|  PREDICTED: serine carboxypeptidase 24-like i...    147   3e-38   
gb|ACF79757.1|  unknown                                                 147   3e-38   
ref|XP_007223035.1|  hypothetical protein PRUPE_ppa005368mg             147   3e-38   
ref|XP_010067819.1|  PREDICTED: serine carboxypeptidase-like 40         147   3e-38   
ref|XP_010645362.1|  PREDICTED: serine carboxypeptidase-like 31         140   3e-38   
ref|XP_004953203.1|  PREDICTED: serine carboxypeptidase-like 34-like    147   4e-38   
ref|XP_007220730.1|  hypothetical protein PRUPE_ppa023387mg             142   4e-38   
ref|XP_003592237.1|  Serine carboxypeptidase II-3                       144   4e-38   
ref|XP_006392053.1|  hypothetical protein EUTSA_v10023955mg             140   4e-38   
gb|EMT05424.1|  Serine carboxypeptidase II-3                            142   4e-38   
gb|ACG38162.1|  serine carboxypeptidase K10B2.2 precursor               147   4e-38   
ref|XP_008654560.1|  PREDICTED: uncharacterized protein LOC100273...    147   4e-38   
ref|XP_002285022.1|  PREDICTED: putative serine carboxypeptidase-...    147   4e-38   
ref|XP_010549997.1|  PREDICTED: serine carboxypeptidase-like 25         147   4e-38   
ref|XP_004508115.1|  PREDICTED: serine carboxypeptidase-like 33-like    138   4e-38   
ref|NP_191906.1|  serine carboxypeptidase-like 40                       147   4e-38   
ref|XP_010323187.1|  PREDICTED: serine carboxypeptidase 24 isofor...    145   4e-38   
ref|XP_006301480.1|  hypothetical protein CARUB_v10021903mg             140   5e-38   
ref|XP_002457307.1|  hypothetical protein SORBIDRAFT_03g005360          146   5e-38   
ref|XP_008801741.1|  PREDICTED: serine carboxypeptidase-like 33 i...    135   5e-38   
ref|XP_008801742.1|  PREDICTED: serine carboxypeptidase-like 33 i...    135   5e-38   
ref|XP_010265560.1|  PREDICTED: serine carboxypeptidase 24-like i...    140   5e-38   
ref|XP_003564543.1|  PREDICTED: serine carboxypeptidase-like 27         138   5e-38   
gb|KCW51319.1|  hypothetical protein EUGRSUZ_J00874                     145   5e-38   
gb|KDP27243.1|  hypothetical protein JCGZ_19942                         146   5e-38   
ref|XP_006412683.1|  hypothetical protein EUTSA_v10025119mg             145   6e-38   
ref|XP_002886559.1|  serine carboxypeptidase S10 family protein         139   6e-38   
gb|ABF70080.1|  serine carboxypeptidase (carboxypeptidase D), put...    134   6e-38   
ref|XP_009391583.1|  PREDICTED: serine carboxypeptidase II-3            144   6e-38   
ref|XP_002310649.2|  hypothetical protein POPTR_0007s07690g             146   7e-38   
ref|XP_011008273.1|  PREDICTED: serine carboxypeptidase-like 40         146   7e-38   
ref|XP_010278297.1|  PREDICTED: serine carboxypeptidase-like 31         136   7e-38   
ref|XP_002298413.2|  putative serine carboxypeptidase family protein    146   7e-38   
ref|XP_009370169.1|  PREDICTED: serine carboxypeptidase II-3-like...    143   8e-38   
ref|XP_010473314.1|  PREDICTED: serine carboxypeptidase-like 32         138   8e-38   
ref|XP_010315499.1|  PREDICTED: serine carboxypeptidase II-3-like       142   8e-38   
gb|KDP20920.1|  hypothetical protein JCGZ_21391                         139   8e-38   
ref|XP_003599510.1|  Serine carboxypeptidase-like protein               146   8e-38   
ref|XP_008809533.1|  PREDICTED: putative serine carboxypeptidase-...    146   9e-38   
ref|XP_009370170.1|  PREDICTED: serine carboxypeptidase II-3-like...    143   9e-38   
ref|XP_003607259.1|  Serine carboxypeptidase-like protein               142   1e-37   
gb|EPS67928.1|  hypothetical protein M569_06845                         145   1e-37   
gb|KEH30582.1|  serine carboxypeptidase-like protein                    142   1e-37   
ref|XP_010261659.1|  PREDICTED: serine carboxypeptidase-like 40         145   1e-37   
ref|XP_006345490.1|  PREDICTED: serine carboxypeptidase-like 40-like    145   1e-37   
ref|XP_006412682.1|  hypothetical protein EUTSA_v10025119mg             144   1e-37   
ref|XP_004242603.2|  PREDICTED: serine carboxypeptidase 24 isofor...    145   1e-37   
ref|XP_009592794.1|  PREDICTED: serine carboxypeptidase-like 40         145   1e-37   
ref|XP_010688683.1|  PREDICTED: serine carboxypeptidase-like 34         140   1e-37   
ref|XP_003601337.1|  Serine carboxypeptidase-like protein               139   1e-37   
gb|KDP43605.1|  hypothetical protein JCGZ_16892                         145   1e-37   
ref|XP_002884303.1|  hypothetical protein ARALYDRAFT_477440             145   1e-37   
gb|KCW51318.1|  hypothetical protein EUGRSUZ_J00874                     145   1e-37   
ref|XP_008652806.1|  PREDICTED: serine carboxypeptidase II-3-like       136   1e-37   
ref|XP_004489523.1|  PREDICTED: serine carboxypeptidase-like 25-like    145   1e-37   
ref|XP_006345492.1|  PREDICTED: serine carboxypeptidase-like 40-like    146   1e-37   
ref|XP_006303173.1|  hypothetical protein CARUB_v10008980mg             142   1e-37   
ref|XP_010041326.1|  PREDICTED: serine carboxypeptidase II-3-like       143   1e-37   
emb|CDM82001.1|  unnamed protein product                                145   1e-37   
ref|XP_008806723.1|  PREDICTED: serine carboxypeptidase-like 33 i...    132   1e-37   
ref|XP_006392051.1|  hypothetical protein EUTSA_v10023439mg             145   1e-37   
gb|AES71588.2|  serine carboxypeptidase-like protein                    139   1e-37   
ref|XP_007043281.1|  Serine carboxypeptidase-like 34 isoform 1          145   1e-37   
gb|KEH17669.1|  serine carboxypeptidase-like protein                    143   1e-37   
ref|XP_003550568.2|  PREDICTED: serine carboxypeptidase-like 33-like    136   1e-37   
gb|KCW66184.1|  hypothetical protein EUGRSUZ_F00022                     143   1e-37   
ref|XP_008806724.1|  PREDICTED: serine carboxypeptidase-like 33 i...    132   1e-37   
ref|XP_006392050.1|  hypothetical protein EUTSA_v10023439mg             145   1e-37   
ref|XP_009801012.1|  PREDICTED: serine carboxypeptidase II-3-like       144   1e-37   



>gb|EYU34325.1| hypothetical protein MIMGU_mgv1a005646mg [Erythranthe guttata]
Length=476

 Score =   188 bits (477),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA  DPSSKP+VLWLNGGPGCSS+AFGLAEE+GPFH+EKDGK++Y NPYSW
Sbjct  70   GRALFYWFFEAEVDPSSKPIVLWLNGGPGCSSVAFGLAEEIGPFHIEKDGKSIYLNPYSW  129

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N AAN+LF+DSPAGVG+SYSNTSSD+ T+GDKRTA ++LEFLL+WF+R
Sbjct  130  NKAANILFLDSPAGVGFSYSNTSSDLFTNGDKRTAAENLEFLLQWFKR  177


 Score = 68.6 bits (166),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 48/74 (65%), Gaps = 8/74 (11%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATS---IDGGKG-----SSSVDQQKLDAVLDLPGLGFNVSFAHYS  205
            MS  +W   L +++L +    I  G G     +SS +QQ+LD V  LPG  FNVSFAHYS
Sbjct  1    MSTFNWVFNLVLVILISELHLISCGAGLSSSKNSSYEQQQLDRVSKLPGQSFNVSFAHYS  60

Query  206  GYVTVNQESGRALF  247
            GY TVN+ESGRALF
Sbjct  61   GYATVNKESGRALF  74



>ref|XP_011079368.1| PREDICTED: serine carboxypeptidase II-2 [Sesamum indicum]
Length=474

 Score =   190 bits (483),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA EDPSSKPLVLWLNGGPGCSSIA+GLAEE+GPFHVEKDGKTLY NPYSW
Sbjct  67   GRALFYWFFEADEDPSSKPLVLWLNGGPGCSSIAYGLAEEIGPFHVEKDGKTLYLNPYSW  126

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+DSP GVG+SYSNTSSD L +GDKRTA D+LEFLL+WFER
Sbjct  127  NKVANILFLDSPVGVGFSYSNTSSDSLNNGDKRTATDNLEFLLQWFER  174


 Score = 64.7 bits (156),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 46/71 (65%), Gaps = 5/71 (7%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSID--GGKGSSSVD---QQKLDAVLDLPGLGFNVSFAHYSGYV  214
            M+ L+W   L +++    +     + S S D   QQ LD VL LPG  FNVSFAHY+GYV
Sbjct  1    MTTLNWVFNLSLIICVAKLHFISCRASFSPDPPNQQLLDRVLKLPGQNFNVSFAHYAGYV  60

Query  215  TVNQESGRALF  247
            TVN+ESGRALF
Sbjct  61   TVNKESGRALF  71



>gb|KDO62275.1| hypothetical protein CISIN_1g0418332mg, partial [Citrus sinensis]
Length=320

 Score =   185 bits (469),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EAVEDP SKPLVLWLNGGPGCSSIA+G AEE+GPFH++ DGKTLY NPYSW
Sbjct  101  GRALFYWFVEAVEDPDSKPLVLWLNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYSW  160

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+DSP GVG+SYSNTSSDI T+GDKRTAEDSL+FLLKW ER
Sbjct  161  NQVANILFLDSPVGVGFSYSNTSSDITTNGDKRTAEDSLKFLLKWLER  208


 Score = 65.1 bits (157),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            V QQKLD V  LPG  FNV+FAHYSGYVTVN+ESGRALF
Sbjct  67   VAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALF  105



>ref|XP_010526302.1| PREDICTED: serine carboxypeptidase-like 29 [Tarenaya hassleriana]
Length=489

 Score =   195 bits (495),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +3

Query  231  LGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  410
            LG   FYWFFEAVEDP SKPLVLWLNGGPGCSSIAFGLAEE+GPFH++ DGKTLY NPYS
Sbjct  67   LGRALFYWFFEAVEDPDSKPLVLWLNGGPGCSSIAFGLAEEIGPFHIKPDGKTLYLNPYS  126

Query  411  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            WN  AN+LF+D+P GVGYSYSNTSSD+LT+GDKRTA+DSL+FLLKW ER
Sbjct  127  WNQVANVLFLDAPVGVGYSYSNTSSDLLTNGDKRTAQDSLKFLLKWLER  175


 Score = 54.7 bits (130),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 39/59 (66%), Gaps = 3/59 (5%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
             L+F+ LLA   +   G   + +Q+ D V  LPG  FNV+F HYSG+VTVN++ GRALF
Sbjct  17   ALIFLTLLA---NAHLGICVLSRQQQDKVSKLPGQDFNVNFEHYSGFVTVNEKLGRALF  72



>ref|XP_010531651.1| PREDICTED: serine carboxypeptidase-like 29, partial [Tarenaya 
hassleriana]
Length=204

 Score =   185 bits (469),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEAVEDP SKPL+LWLNGGPGCSSI +GLAEE+GPFH++ DGKTLY NPYSW
Sbjct  64   GRALFYWFFEAVEDPDSKPLLLWLNGGPGCSSIGYGLAEEIGPFHIKPDGKTLYLNPYSW  123

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+D P GVG+SYSNTSSD+LT+GDKRTA+DSL+FLLKW +R
Sbjct  124  NQVANVLFLDMPVGVGFSYSNTSSDLLTNGDKRTAQDSLKFLLKWLDR  171


 Score = 62.8 bits (151),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 42/59 (71%), Gaps = 2/59 (3%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
             L+F  LLA +  G    SS  +Q+ D V  LPG GFNVSFAHYSGYVTV+++SGRALF
Sbjct  12   ALIFFTLLANAHLGNCALSS--RQEQDRVSKLPGQGFNVSFAHYSGYVTVHEKSGRALF  68



>ref|XP_010273729.1| PREDICTED: serine carboxypeptidase II-2 [Nelumbo nucifera]
Length=485

 Score =   182 bits (462),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEAVEDPSSKPLVLWLNGGPGCSSIA+G AEE+GPFH++ DGKTLY N YSW
Sbjct  80   GRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAYGEAEEIGPFHIKADGKTLYLNQYSW  139

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF++SP GVG+SYSN S D+L +GDKRTAEDSL FLLKWFER
Sbjct  140  NQVANVLFLESPVGVGFSYSNNSLDVLNNGDKRTAEDSLMFLLKWFER  187


 Score = 64.3 bits (155),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            QQ+LD VL+LPG  FNVSFAHY+GYVTVN+ SGRALF
Sbjct  48   QQQLDRVLELPGQTFNVSFAHYAGYVTVNEASGRALF  84



>ref|XP_004242620.1| PREDICTED: serine carboxypeptidase II-2 [Solanum lycopersicum]
Length=465

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +3

Query  243  FFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLA  422
             FYWFFEAV+DPSSKPLVLWLNGGPGCSSIAFGLAEE+GPFH+EKDGKTLYWNPYSWNLA
Sbjct  62   LFYWFFEAVDDPSSKPLVLWLNGGPGCSSIAFGLAEEIGPFHIEKDGKTLYWNPYSWNLA  121

Query  423  ANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            AN+LF+DSP GVGYSYSNTSSD L +GD RTA DSL FLLKW ER
Sbjct  122  ANVLFLDSPVGVGYSYSNTSSDHLNNGDARTAADSLVFLLKWLER  166


 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +2

Query  77   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLV  256
            +FV+L   SI G    +   Q++LD V  LPG GFNV+FAHYSGYVTVN++S RALF   
Sbjct  7    VFVVLGLFSISGSFSVNPNAQKQLDRVSKLPGQGFNVNFAHYSGYVTVNEDSERALFYWF  66

Query  257  L*GCGGP  277
                  P
Sbjct  67   FEAVDDP  73



>ref|XP_009630744.1| PREDICTED: serine carboxypeptidase II-2 [Nicotiana tomentosiformis]
Length=470

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +3

Query  243  FFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLA  422
             FYWFFEAV+DPSSKPLVLWLNGGPGCSSIA+GLAEE+GPFH+EKDGKTLYWNPYSWNLA
Sbjct  67   LFYWFFEAVDDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHIEKDGKTLYWNPYSWNLA  126

Query  423  ANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            ANLLF+DSP GVGYSYSNTSSD L +GD RTA DSL FLLKW ER
Sbjct  127  ANLLFLDSPVGVGYSYSNTSSDHLNNGDARTAADSLAFLLKWLER  171


 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 48/78 (62%), Gaps = 2/78 (3%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKG--SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  223
            MS L WG L+F L   T +  G    +S+V Q++LD V  LPG GFNV+F +Y+GYVTVN
Sbjct  1    MSNLKWGFLVFALFFITEVHLGSCFVNSNVVQKQLDKVTKLPGQGFNVNFENYAGYVTVN  60

Query  224  QESGRALFLLVL*GCGGP  277
            +ES RALF         P
Sbjct  61   EESERALFYWFFEAVDDP  78



>ref|XP_006343604.1| PREDICTED: serine carboxypeptidase II-2-like [Solanum tuberosum]
Length=465

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +3

Query  243  FFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLA  422
             FYWFFEAV+DPSSKPLVLWLNGGPGCSSIAFGLAEE+GPFH+EKDGKTLYWNPYSWNLA
Sbjct  62   LFYWFFEAVDDPSSKPLVLWLNGGPGCSSIAFGLAEELGPFHIEKDGKTLYWNPYSWNLA  121

Query  423  ANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            AN+LF+DSP GVGYSYSNTSSD L +GD RTA DSL FLLKW ER
Sbjct  122  ANVLFLDSPVGVGYSYSNTSSDHLNNGDTRTAADSLVFLLKWLER  166


 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 40/67 (60%), Gaps = 0/67 (0%)
 Frame = +2

Query  77   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLV  256
            +FV+L    I G    +   Q+ LD V  LPG GFNV+FAHYSGYVTVN+ES RALF   
Sbjct  7    VFVVLGLFFISGSFSVTPNAQKLLDRVSKLPGQGFNVNFAHYSGYVTVNEESERALFYWF  66

Query  257  L*GCGGP  277
                  P
Sbjct  67   FEAVDDP  73



>ref|XP_010048771.1| PREDICTED: serine carboxypeptidase II-2 [Eucalyptus grandis]
 gb|KCW81143.1| hypothetical protein EUGRSUZ_C02514 [Eucalyptus grandis]
Length=473

 Score =   180 bits (457),  Expect(2) = 9e-56, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 93/108 (86%), Gaps = 1/108 (1%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA EDP SKPLVLWLNGGPGCSSIA+G+AEE+GPFH+  D  +LY NPYSW
Sbjct  68   GRSLFYWFTEAAEDPDSKPLVLWLNGGPGCSSIAYGMAEEIGPFHIRPD-MSLYLNPYSW  126

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            NL ANLLF+DSP GVG+SYSNTSSD+L +GDKRTAEDSL FLLKWFER
Sbjct  127  NLVANLLFIDSPVGVGFSYSNTSSDLLNNGDKRTAEDSLAFLLKWFER  174


 Score = 63.5 bits (153),  Expect(2) = 9e-56, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            QQ+LD VL+LPG  FN+SF HYSGY TVN+ESGR+LF
Sbjct  36   QQELDRVLELPGQSFNISFPHYSGYATVNEESGRSLF  72



>ref|XP_009789305.1| PREDICTED: serine carboxypeptidase II-2 [Nicotiana sylvestris]
Length=470

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +3

Query  243  FFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLA  422
             FYWFFEAV++PSSKPLVLWLNGGPGCSSIA+GLAEE+GPFH+EKDGKTLYWNPYSWNLA
Sbjct  67   LFYWFFEAVDEPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHIEKDGKTLYWNPYSWNLA  126

Query  423  ANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            ANLLF+DSP GVGYSYSNTSSD L +GD RTA DSL FLLKW ER
Sbjct  127  ANLLFLDSPVGVGYSYSNTSSDHLNNGDARTAADSLAFLLKWLER  171


 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKG--SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  223
            MS L WG L+F L   T +  G     S+V Q++LD V  LPG GFNV+F +Y+GYVTVN
Sbjct  1    MSNLKWGFLVFALFFITEVHLGSCFVDSNVVQKQLDKVSKLPGQGFNVNFENYAGYVTVN  60

Query  224  QESGRALFLLVL*GCGGP  277
            +ES RALF         P
Sbjct  61   EESERALFYWFFEAVDEP  78



>ref|XP_010040844.1| PREDICTED: serine carboxypeptidase II-2-like [Eucalyptus grandis]
 gb|KCW44872.1| hypothetical protein EUGRSUZ_L01547 [Eucalyptus grandis]
Length=473

 Score =   180 bits (456),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 93/108 (86%), Gaps = 1/108 (1%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA EDP SKPLVLWLNGGPGCSSIA+G+AEE+GPFH+  D  +LY NPYSW
Sbjct  68   GRSLFYWFTEAAEDPDSKPLVLWLNGGPGCSSIAYGMAEEIGPFHIRPD-MSLYLNPYSW  126

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            NL ANLLF+DSP GVG+SYSNTSSD+L +GDKRTAEDSL FLLKWFER
Sbjct  127  NLVANLLFIDSPVGVGFSYSNTSSDLLNNGDKRTAEDSLAFLLKWFER  174


 Score = 63.5 bits (153),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            QQ+LD VL+LPG  FN+SF HYSGY TVN+ESGR+LF
Sbjct  36   QQELDRVLELPGQSFNISFPHYSGYATVNEESGRSLF  72



>gb|KFK29659.1| hypothetical protein AALP_AA7G162000 [Arabis alpina]
Length=478

 Score =   187 bits (476),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +3

Query  231  LGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  410
            LG   FYWFFEAVED +SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N YS
Sbjct  60   LGRALFYWFFEAVEDANSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKADGKTLYLNQYS  119

Query  411  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            WN AAN+LF+D+P GVGYSYSNTSSD+L++GDKRTA+DSL+FLLKW ER
Sbjct  120  WNQAANILFLDAPVGVGYSYSNTSSDLLSNGDKRTAQDSLKFLLKWVER  168


 Score = 55.5 bits (132),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  229
            M+     CL  + +LA +       + + Q++ D V  LPG  FNVSFAHYSGYVT N++
Sbjct  1    MAKTRGSCLFAITILAIA-HFCNCEAVLSQKEQDKVSTLPGQDFNVSFAHYSGYVTTNEK  59

Query  230  SGRALF  247
             GRALF
Sbjct  60   LGRALF  65



>ref|XP_008452541.1| PREDICTED: serine carboxypeptidase II-2 [Cucumis melo]
Length=468

 Score =   183 bits (464),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA ED +SKPLVLWLNGGPGCSSIAFG AEE+GPFH+  DGK++Y NPYSW
Sbjct  64   GRALFYWFFEATEDSASKPLVLWLNGGPGCSSIAFGEAEEIGPFHINADGKSVYLNPYSW  123

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+DSPAGVG+SYSNTSSD++ +GDKRTAEDSL FLLKWFER
Sbjct  124  NEVANVLFLDSPAGVGFSYSNTSSDLMNNGDKRTAEDSLAFLLKWFER  171


 Score = 59.7 bits (143),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            QQ+LD + +LPG  F V F HYSGY+TVN+ESGRALF
Sbjct  32   QQELDRIAELPGQNFEVKFGHYSGYITVNEESGRALF  68



>gb|AFK34623.1| unknown [Lotus japonicus]
Length=174

 Score =   184 bits (467),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA +DP SKPLVLWLNGGPGCSSIA+G AEE+GPFH++ DGKTLY NPY+W
Sbjct  65   GRALFYWFMEADQDPQSKPLVLWLNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYAW  124

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LFVD+PAGVG+SYSNTSSD+L HGD++TAEDSL FLLKWFER
Sbjct  125  NQVANILFVDAPAGVGFSYSNTSSDLLNHGDRKTAEDSLIFLLKWFER  172


 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 39/65 (60%), Gaps = 3/65 (5%)
 Frame = +2

Query  74   LLFVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            +L + ++AT    I+    S    QQ  D V  LPG  FN SFAHYSGY+TVN ++GRAL
Sbjct  9    ILAIAIVATLFLCINFATSSDPFVQQHHDKVGRLPGQNFNTSFAHYSGYITVNDKAGRAL  68

Query  245  FLLVL  259
            F   +
Sbjct  69   FYWFM  73



>ref|XP_004162685.1| PREDICTED: serine carboxypeptidase-like 29-like [Cucumis sativus]
Length=468

 Score =   182 bits (461),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA ED +SKPLVLWLNGGPGCSSIA+G AEE+GPFH+  DGK++Y NPYSW
Sbjct  64   GRALFYWFFEATEDSASKPLVLWLNGGPGCSSIAYGEAEEIGPFHINADGKSVYLNPYSW  123

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+DSPAGVG+SYSNTSSD++ +GDKRTAEDSL FLLKWFER
Sbjct  124  NEVANVLFLDSPAGVGFSYSNTSSDLMNNGDKRTAEDSLAFLLKWFER  171


 Score = 59.7 bits (143),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            QQ+LD + +LPG  F V F HYSGY+TVN+ESGRALF
Sbjct  32   QQELDRIAELPGQNFEVKFGHYSGYITVNEESGRALF  68



>gb|KGN61064.1| hypothetical protein Csa_2G036620 [Cucumis sativus]
Length=542

 Score =   182 bits (461),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA ED +SKPLVLWLNGGPGCSSIA+G AEE+GPFH+  DGK +Y NPYSW
Sbjct  138  GRALFYWFFEATEDSASKPLVLWLNGGPGCSSIAYGEAEEIGPFHINADGKPVYLNPYSW  197

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+DSPAGVG+SYSNTSSD++ +GDKRTAEDSL FLLKWFER
Sbjct  198  NEVANVLFLDSPAGVGFSYSNTSSDLMNNGDKRTAEDSLAFLLKWFER  245


 Score = 60.1 bits (144),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            QQ+LD + +LPG  F V F HYSGY+TVN+ESGRALF
Sbjct  106  QQELDRIAELPGQNFEVKFGHYSGYITVNEESGRALF  142



>ref|XP_006286217.1| hypothetical protein CARUB_v10007783mg [Capsella rubella]
 gb|EOA19115.1| hypothetical protein CARUB_v10007783mg [Capsella rubella]
Length=479

 Score =   186 bits (473),  Expect(2) = 8e-55, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +3

Query  231  LGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  410
            LG   FYWFFEAVED  SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N YS
Sbjct  63   LGRALFYWFFEAVEDAKSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQYS  122

Query  411  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            WN AAN+LF+D+P GVGYSYSNTSSD+ T+GDKRTA+DSL+FLLKW ER
Sbjct  123  WNQAANILFLDAPVGVGYSYSNTSSDLQTNGDKRTAQDSLKFLLKWVER  171


 Score = 53.9 bits (128),  Expect(2) = 8e-55, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 38/60 (63%), Gaps = 2/60 (3%)
 Frame = +2

Query  68   GCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
              L+ + LLAT+    +   S  +Q  D V  LPG  FNVSFAHYSG++T N++ GRALF
Sbjct  11   NALIAIALLATTAHLCEAGLSRKEQ--DKVSKLPGQNFNVSFAHYSGFITTNEKLGRALF  68



>ref|XP_004144720.1| PREDICTED: serine carboxypeptidase-like 29-like [Cucumis sativus]
Length=468

 Score =   181 bits (458),  Expect(2) = 8e-55, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA ED +SKPLVLWLNGGPGCSSIA+G AEE+GPFH+  DGK +Y NPYSW
Sbjct  64   GRALFYWFFEATEDSASKPLVLWLNGGPGCSSIAYGEAEEIGPFHINADGKPVYLNPYSW  123

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+DSPAGVG+SYSNTSSD++ +GDKRTAEDSL FLLKWFER
Sbjct  124  NEVANVLFLDSPAGVGFSYSNTSSDLMNNGDKRTAEDSLAFLLKWFER  171


 Score = 59.7 bits (143),  Expect(2) = 8e-55, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            QQ+LD + +LPG  F V F HYSGY+TVN+ESGRALF
Sbjct  32   QQELDRIAELPGQNFEVKFGHYSGYITVNEESGRALF  68



>ref|XP_010905043.1| PREDICTED: serine carboxypeptidase II-2 [Elaeis guineensis]
Length=471

 Score =   181 bits (458),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEAVEDP SKPLVLWLNGGPGCSSIA+GLAEEVGPFHV  DG++LY NPYSW
Sbjct  64   GRALFYWFFEAVEDPVSKPLVLWLNGGPGCSSIAYGLAEEVGPFHVNADGQSLYLNPYSW  123

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+DSP GVG+SYSN S D+L++GD+RTA+DSL FL KWFER
Sbjct  124  NQVANILFLDSPVGVGFSYSNNSQDVLSNGDERTAKDSLIFLKKWFER  171


 Score = 58.5 bits (140),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  116  KGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
             G S   +Q+ D V  LPG  FNVSFAHY+GYVTVN++SGRALF
Sbjct  25   NGGSPFVRQEGDRVQRLPGQSFNVSFAHYAGYVTVNEDSGRALF  68



>ref|XP_006453576.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66816.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=352

 Score =   187 bits (475),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EAVEDP SKPLVLWLNGGPGCSSIA+G AEE+GPFH++ DGKTLY NPYSW
Sbjct  66   GRALFYWFVEAVEDPDSKPLVLWLNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYSW  125

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+DSP GVG+SYSNTSSDI T+GDKRTAEDSL+FLLKW ER
Sbjct  126  NQVANILFLDSPVGVGFSYSNTSSDITTNGDKRTAEDSLKFLLKWLER  173


 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 43/69 (62%), Gaps = 6/69 (9%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFL  250
            C++F L  A S D       V QQKLD V  LPG  FNV+FAHYSGYVTVN+ESGRALF 
Sbjct  18   CIIFYLGSAFSTD------PVAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFY  71

Query  251  LVL*GCGGP  277
              +     P
Sbjct  72   WFVEAVEDP  80



>ref|XP_002869361.1| hypothetical protein ARALYDRAFT_491673 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45620.1| hypothetical protein ARALYDRAFT_491673 [Arabidopsis lyrata subsp. 
lyrata]
Length=479

 Score =   185 bits (469),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +3

Query  231  LGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  410
            LG   FYW FEAVED  SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N YS
Sbjct  63   LGRALFYWLFEAVEDAKSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKADGKTLYLNQYS  122

Query  411  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            WN AAN+LF+D+P GVGYSYSNTSSD+ T+GDKRTAEDSL+FLLKW ER
Sbjct  123  WNQAANILFLDAPVGVGYSYSNTSSDLKTNGDKRTAEDSLKFLLKWVER  171


 Score = 53.9 bits (128),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            Q++ D V  LPG  FNVSFAHYSG+VT N++ GRALF
Sbjct  32   QKEQDKVSKLPGQNFNVSFAHYSGFVTTNEKLGRALF  68



>gb|EPS71160.1| hypothetical protein M569_03591, partial [Genlisea aurea]
Length=441

 Score =   182 bits (463),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G  +FYWFFEA EDPSSKPL+LWLNGGPGCSSIA+GLAEEVGPFH+EKDGKTLY N +SW
Sbjct  39   GRAYFYWFFEADEDPSSKPLLLWLNGGPGCSSIAYGLAEEVGPFHIEKDGKTLYLNQFSW  98

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LFVDSP GVG+SYSNTSSD+L +GDKRTA ++LEFLL WF R
Sbjct  99   NKVANVLFVDSPVGVGFSYSNTSSDLLNNGDKRTASENLEFLLGWFNR  146


 Score = 55.8 bits (133),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            +QQ+LD V  LPG  F+V+FA Y+GYVTVN+ESGRA F
Sbjct  6    NQQELDRVSKLPGQNFDVNFASYAGYVTVNEESGRAYF  43



>ref|XP_010432944.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=480

 Score =   184 bits (468),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +3

Query  231  LGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  410
            LG   FYW FEAVED  SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N YS
Sbjct  64   LGRALFYWLFEAVEDAKSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKADGKTLYLNQYS  123

Query  411  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            WN AAN+LF+D+P GVGYSYSNTSSD+ T+GDKRTA+DSL+FLLKW ER
Sbjct  124  WNQAANILFLDAPVGVGYSYSNTSSDLQTNGDKRTAQDSLKFLLKWVER  172


 Score = 53.5 bits (127),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            Q++ D V  LPG  FNVSFAHYSG+VT N++ GRALF
Sbjct  33   QKEQDKVSKLPGQDFNVSFAHYSGFVTTNEKLGRALF  69



>ref|XP_002528403.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF33996.1| serine carboxypeptidase, putative [Ricinus communis]
Length=480

 Score =   189 bits (481),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G + FYWF EAVEDP SKPL+LWLNGGPGCSSIA+G AEE+GPFH+++DGKTLY NPYSW
Sbjct  74   GRNLFYWFMEAVEDPDSKPLILWLNGGPGCSSIAYGEAEEIGPFHIQRDGKTLYLNPYSW  133

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  ANLLFVDSP GVG+SYSNTSSD+L +GDKRTA DSL FLLKWFER
Sbjct  134  NQVANLLFVDSPVGVGFSYSNTSSDLLNNGDKRTAADSLAFLLKWFER  181


 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGP  277
            +  V QQ LD VL+LPG  FN+SFAHYSGYVTVNQESGR LF   +     P
Sbjct  37   TDPVAQQGLDRVLELPGQTFNISFAHYSGYVTVNQESGRNLFYWFMEAVEDP  88



>ref|XP_010447670.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=479

 Score =   184 bits (467),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +3

Query  231  LGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  410
            LG   FYW FEAVED  SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N YS
Sbjct  63   LGRALFYWLFEAVEDAKSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQYS  122

Query  411  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            WN AAN+LF+D+P GVGYSYSNTSSD+ T+GDKRTA+DSL+FLLKW ER
Sbjct  123  WNQAANILFLDAPVGVGYSYSNTSSDLQTNGDKRTAQDSLKFLLKWVER  171


 Score = 53.5 bits (127),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            Q++ D V  LPG  FNVSFAHYSG+VT N++ GRALF
Sbjct  32   QKEQDKVSKLPGQDFNVSFAHYSGFVTTNEKLGRALF  68



>ref|XP_010438130.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=498

 Score =   185 bits (469),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +3

Query  231  LGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  410
            LG   FYW FEAVED  SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N YS
Sbjct  82   LGRALFYWLFEAVEDAKSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQYS  141

Query  411  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            WN AAN+LF+D+P GVGYSYSNTSSD+ T+GDKRTA+DSL+FLLKW ER
Sbjct  142  WNQAANILFLDAPVGVGYSYSNTSSDLQTNGDKRTAQDSLKFLLKWVER  190


 Score = 52.0 bits (123),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            Q++ D V  LPG  F+VSFAHYSG+VT N++ GRALF
Sbjct  51   QKEQDKVSKLPGQNFDVSFAHYSGFVTTNEKLGRALF  87



>emb|CDY23258.1| BnaA08g12880D [Brassica napus]
Length=478

 Score =   182 bits (463),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +3

Query  231  LGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  410
            LG   FYWFFEA +D +SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N YS
Sbjct  62   LGRALFYWFFEATDDAASKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQYS  121

Query  411  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            WN AAN+LF+D+P GVGYSYSNTSSD+ ++GDKRTA+DSL+FLLKW ER
Sbjct  122  WNQAANILFLDAPVGVGYSYSNTSSDLRSNGDKRTAQDSLKFLLKWVER  170


 Score = 52.8 bits (125),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            Q++ D V  LPG  FNV FAHYSG+VT N++ GRALF
Sbjct  31   QKEQDKVTKLPGQNFNVDFAHYSGFVTTNEKLGRALF  67



>ref|NP_567854.1| serine carboxypeptidase-like 29 [Arabidopsis thaliana]
 sp|Q949Q7.1|SCP29_ARATH RecName: Full=Serine carboxypeptidase-like 29; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK93635.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM91708.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AEE85811.1| serine carboxypeptidase-like 29 [Arabidopsis thaliana]
Length=479

 Score =   182 bits (463),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +3

Query  222  TRSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
               LG   FYW FEAVED  SKPLVLWLNGGPGCSS+A+G AEE+GPFH++ DGKTLY N
Sbjct  60   NEQLGRALFYWLFEAVEDAKSKPLVLWLNGGPGCSSVAYGEAEEIGPFHIKADGKTLYLN  119

Query  402  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
             YSWN AAN+LF+D+P GVGYSYSNTSSD+ ++GDKRTAEDSL+FLLKW ER
Sbjct  120  QYSWNQAANILFLDAPVGVGYSYSNTSSDLKSNGDKRTAEDSLKFLLKWVER  171


 Score = 52.4 bits (124),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            Q++ D V  LPG  FNVSFAHYSG+V  N++ GRALF
Sbjct  32   QKEQDKVSKLPGQNFNVSFAHYSGFVATNEQLGRALF  68



>emb|CDY55623.1| BnaC03g77560D [Brassica napus]
Length=477

 Score =   181 bits (460),  Expect(2) = 6e-53, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +3

Query  231  LGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  410
            LG   FYWFFEA +D +SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N YS
Sbjct  61   LGRALFYWFFEAADDAASKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQYS  120

Query  411  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            WN AAN+LF+D+P GVGYSYSNTS+D+ ++GDKRTA+DSL+FLLKW ER
Sbjct  121  WNQAANILFLDAPVGVGYSYSNTSTDLRSNGDKRTAQDSLKFLLKWVER  169


 Score = 53.1 bits (126),  Expect(2) = 6e-53, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            Q++ D V  LPG  FNV FAHYSG+VT N++ GRALF
Sbjct  30   QKEQDKVTKLPGQNFNVDFAHYSGFVTTNEKLGRALF  66



>ref|XP_006453577.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66817.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=474

 Score =   187 bits (474),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EAVEDP SKPLVLWLNGGPGCSSIA+G AEE+GPFH++ DGKTLY NPYSW
Sbjct  66   GRALFYWFVEAVEDPDSKPLVLWLNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYSW  125

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+DSP GVG+SYSNTSSDI T+GDKRTAEDSL+FLLKW ER
Sbjct  126  NQVANILFLDSPVGVGFSYSNTSSDITTNGDKRTAEDSLKFLLKWLER  173


 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 43/69 (62%), Gaps = 6/69 (9%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFL  250
            C++F L  A S D       V QQKLD V  LPG  FNV+FAHYSGYVTVN+ESGRALF 
Sbjct  18   CIIFYLGSAFSTD------PVAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFY  71

Query  251  LVL*GCGGP  277
              +     P
Sbjct  72   WFVEAVEDP  80



>ref|XP_006474032.1| PREDICTED: serine carboxypeptidase-like 29-like [Citrus sinensis]
Length=474

 Score =   186 bits (473),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EAVEDP SKPLVLWLNGGPGCSSIA+G AEE+GPFH++ DGKTLY NPYSW
Sbjct  66   GRALFYWFVEAVEDPDSKPLVLWLNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYSW  125

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+DSP GVG+SYSNTSSDI T+GDKRTAEDSL+FLLKW ER
Sbjct  126  NQVANILFLDSPVGVGFSYSNTSSDITTNGDKRTAEDSLKFLLKWLER  173


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGP  277
            +  V QQKLD V  LPG  FNV+FAHYSGYVTVN+ESGRALF   +     P
Sbjct  29   TDPVAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFYWFVEAVEDP  80



>emb|CAA18212.1| SERINE CARBOXYPEPTIDASE II-like protein [Arabidopsis thaliana]
 emb|CAB79799.1| SERINE CARBOXYPEPTIDASE II-like protein [Arabidopsis thaliana]
Length=425

 Score =   182 bits (461),  Expect(2) = 7e-53, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +3

Query  222  TRSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
               LG   FYW FEAVED  SKPLVLWLNGGPGCSS+A+G AEE+GPFH++ DGKTLY N
Sbjct  60   NEQLGRALFYWLFEAVEDAKSKPLVLWLNGGPGCSSVAYGEAEEIGPFHIKADGKTLYLN  119

Query  402  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
             YSWN AAN+LF+D+P GVGYSYSNTSSD+ ++GDKRTAEDSL+FLLKW ER
Sbjct  120  QYSWNQAANILFLDAPVGVGYSYSNTSSDLKSNGDKRTAEDSLKFLLKWVER  171


 Score = 52.0 bits (123),  Expect(2) = 7e-53, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            Q++ D V  LPG  FNVSFAHYSG+V  N++ GRALF
Sbjct  32   QKEQDKVSKLPGQNFNVSFAHYSGFVATNEQLGRALF  68



>emb|CDX72270.1| BnaC07g42920D [Brassica napus]
Length=667

 Score =   179 bits (455),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  LGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  410
            LG   FYW FEA ED +SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N YS
Sbjct  60   LGRALFYWLFEAAEDAASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQYS  119

Query  411  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFE  554
            WN  AN+LF+D+P GVGYSYSNTSSD+LT+GD+RTA+DSL+FLLKW E
Sbjct  120  WNQVANILFLDAPVGVGYSYSNTSSDLLTNGDQRTAKDSLQFLLKWVE  167


 Score = 54.3 bits (129),  Expect(2) = 8e-53, Method: Composition-based stats.
 Identities = 29/66 (44%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  229
            M+   W CL  + LLA +       + + Q++ D V  LPG  F+V FAHYSG+VT N++
Sbjct  1    MAKTRWSCLA-IALLAIARFCNCEEAVLCQKEQDRVSRLPGQDFDVDFAHYSGFVTTNEK  59

Query  230  SGRALF  247
             GRALF
Sbjct  60   LGRALF  65



>ref|XP_006453578.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66818.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=491

 Score =   186 bits (473),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EAVEDP SKPLVLWLNGGPGCSSIA+G AEE+GPFH++ DGKTLY NPYSW
Sbjct  66   GRALFYWFVEAVEDPDSKPLVLWLNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYSW  125

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+DSP GVG+SYSNTSSDI T+GDKRTAEDSL+FLLKW ER
Sbjct  126  NQVANILFLDSPVGVGFSYSNTSSDITTNGDKRTAEDSLKFLLKWLER  173


 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 43/69 (62%), Gaps = 6/69 (9%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFL  250
            C++F L  A S D       V QQKLD V  LPG  FNV+FAHYSGYVTVN+ESGRALF 
Sbjct  18   CIIFYLGSAFSTD------PVAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFY  71

Query  251  LVL*GCGGP  277
              +     P
Sbjct  72   WFVEAVEDP  80



>ref|XP_009108967.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=477

 Score =   182 bits (463),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +3

Query  231  LGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  410
            LG   FYWFFEA +D +SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N YS
Sbjct  61   LGRALFYWFFEATDDAASKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQYS  120

Query  411  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            WN AAN+LF+D+P GVGYSYSNTSSD+ ++GDKRTA+DSL+FLLKW ER
Sbjct  121  WNQAANILFLDAPVGVGYSYSNTSSDLRSNGDKRTAQDSLKFLLKWVER  169


 Score = 50.8 bits (120),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            Q++ D V  LPG  FNV F HYSG+VT N++ GRALF
Sbjct  30   QKEQDKVSKLPGQNFNVDFTHYSGFVTTNEKLGRALF  66



>ref|XP_004287151.1| PREDICTED: serine carboxypeptidase II-2 [Fragaria vesca subsp. 
vesca]
Length=470

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA EDP+SKPLVLWLNGGPGCSSIA+G+AEEVGPFH++ DGKTLY NPYSW
Sbjct  64   GRALFYWFVEAAEDPTSKPLVLWLNGGPGCSSIAYGMAEEVGPFHIQADGKTLYLNPYSW  123

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+DSP GVG+SYSNTSSD++++GDKRTA DSL FLLKW ER
Sbjct  124  NQVANILFLDSPVGVGFSYSNTSSDLMSNGDKRTASDSLAFLLKWLER  171


 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGP  277
            QQ+LD V  LPG  FNVSFAHY+GYV VN+++GRALF   +     P
Sbjct  32   QQQLDRVHGLPGQTFNVSFAHYAGYVNVNEDAGRALFYWFVEAAEDP  78



>ref|XP_009358402.1| PREDICTED: serine carboxypeptidase II-2 [Pyrus x bretschneideri]
Length=482

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA EDP SKP+VLWLNGGPGCSSIA+G+AEE+GPFH+E DGKTLY NPYSW
Sbjct  67   GRALFYWFVEAAEDPHSKPIVLWLNGGPGCSSIAYGMAEEIGPFHIEADGKTLYLNPYSW  126

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF DSP GVG+SYSNTSSD+L++GDKRTA DSL FLLKWFER
Sbjct  127  NQVANVLFFDSPVGVGFSYSNTSSDLLSNGDKRTANDSLTFLLKWFER  174


 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = +2

Query  71   CLLFVLLLAT-SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            CL+ +L L   S+     ++   QQKLD V +LPG  FN+SFAH+SGYV VN+E+GRALF
Sbjct  12   CLIILLNLHLGSVFSAPPANPFAQQKLDRVAELPGQSFNLSFAHFSGYVPVNEETGRALF  71

Query  248  LLVL*GCGGP  277
               +     P
Sbjct  72   YWFVEAAEDP  81



>ref|XP_009137969.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=476

 Score =   179 bits (454),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  LGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  410
            LG   FYWFFEA ED +SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N YS
Sbjct  60   LGRALFYWFFEAAEDAASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQYS  119

Query  411  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFE  554
            WN  AN+LF+D+P GVGYSYSNTSSD+LT+GD+RTA+DSL+FLLKW E
Sbjct  120  WNQVANILFLDAPVGVGYSYSNTSSDLLTNGDQRTAKDSLKFLLKWVE  167


 Score = 52.8 bits (125),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 38/66 (58%), Gaps = 1/66 (2%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  229
            M+   W C    LL+       +  + + Q++ D V  LPG  F+V FAHYSG+VT N++
Sbjct  1    MAKTRWFCFAIALLVIARFCNCE-EAVLSQKEQDRVSRLPGQDFDVDFAHYSGFVTTNEK  59

Query  230  SGRALF  247
             GRALF
Sbjct  60   LGRALF  65



>emb|CDY13387.1| BnaA03g51050D [Brassica napus]
Length=476

 Score =   179 bits (454),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  LGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  410
            LG   FYWFFEA ED +SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N YS
Sbjct  60   LGRALFYWFFEAAEDAASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQYS  119

Query  411  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFE  554
            WN  AN+LF+D+P GVGYSYSNTSSD+LT+GD+RTA+DSL+FLLKW E
Sbjct  120  WNQVANILFLDAPVGVGYSYSNTSSDLLTNGDQRTAKDSLKFLLKWVE  167


 Score = 52.8 bits (125),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 38/66 (58%), Gaps = 1/66 (2%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  229
            M+   W C    LL+       +  + + Q++ D V  LPG  F+V FAHYSG+VT N++
Sbjct  1    MAKTRWFCFAIALLVIARFCNCE-EAVLSQKEQDRVSRLPGQDFDVDFAHYSGFVTTNEK  59

Query  230  SGRALF  247
             GRALF
Sbjct  60   LGRALF  65



>ref|XP_006412667.1| hypothetical protein EUTSA_v10025076mg [Eutrema salsugineum]
 gb|ESQ54120.1| hypothetical protein EUTSA_v10025076mg [Eutrema salsugineum]
Length=480

 Score =   181 bits (460),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +3

Query  231  LGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  410
            LG   FYW FEA ED  SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N YS
Sbjct  64   LGRALFYWLFEATEDAESKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKADGKTLYLNQYS  123

Query  411  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            WN AAN+LF+D+P GVGYSYSNTSSD+ ++GDKRTA+DSL+FLLKW ER
Sbjct  124  WNQAANILFLDAPVGVGYSYSNTSSDLRSNGDKRTAQDSLKFLLKWVER  172


 Score = 50.4 bits (119),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            Q+  D V  LPG  FNV FAHYSG+VT N++ GRALF
Sbjct  33   QKAQDKVSILPGQNFNVDFAHYSGFVTTNEKLGRALF  69



>ref|XP_002324520.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF03085.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=470

 Score =   184 bits (467),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EAVEDP SKPL+LWLNGGPGCSSIA+G+AEE+GPFH++ DGKTLY NPYSW
Sbjct  72   GRALFYWFVEAVEDPQSKPLLLWLNGGPGCSSIAYGMAEEIGPFHIKPDGKTLYLNPYSW  131

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+DSP GVGYSYSNTSSD+L +GDK+TA DSL FLL WFER
Sbjct  132  NQVANILFLDSPVGVGYSYSNTSSDLLNNGDKKTAADSLAFLLNWFER  179


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGP  277
            V QQ LD VL LPG  F+V+FAHYSGYVTVN++ GRALF   +     P
Sbjct  38   VAQQHLDRVLKLPGQNFDVNFAHYSGYVTVNEKYGRALFYWFVEAVEDP  86



>ref|XP_002324616.2| hypothetical protein POPTR_0018s11210g [Populus trichocarpa]
 gb|EEF03181.2| hypothetical protein POPTR_0018s11210g [Populus trichocarpa]
Length=466

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EAVEDP SKPL+LWLNGGPGCSSIA+G+AEE+GPFH++ DGKTLY NPYSW
Sbjct  72   GRALFYWFVEAVEDPQSKPLLLWLNGGPGCSSIAYGMAEEIGPFHIKPDGKTLYLNPYSW  131

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+DSP GVGYSYSNTSSD+L +GDK+TA DSL FLL WFER
Sbjct  132  NQVANILFLDSPVGVGYSYSNTSSDLLNNGDKKTAADSLAFLLNWFER  179


 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGP  277
            V QQ LD VL LPG  F+V+FAHYSGYVTVN++ GRALF   +     P
Sbjct  38   VAQQHLDRVLKLPGQNFDVNFAHYSGYVTVNEKYGRALFYWFVEAVEDP  86



>ref|XP_007202013.1| hypothetical protein PRUPE_ppa005192mg [Prunus persica]
 gb|EMJ03212.1| hypothetical protein PRUPE_ppa005192mg [Prunus persica]
Length=473

 Score =   184 bits (467),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA EDP SKP+VLWLNGGPGCSSIA+G AEEVGPFH++ DGKTLY NPYSW
Sbjct  67   GRALFYWLVEAAEDPGSKPIVLWLNGGPGCSSIAYGEAEEVGPFHIKADGKTLYLNPYSW  126

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+DSP GVG+SYSNTSSD+L++GDKRTAEDSL FLLKWFER
Sbjct  127  NQVANILFLDSPVGVGFSYSNTSSDLLSNGDKRTAEDSLAFLLKWFER  174


 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 51/81 (63%), Gaps = 5/81 (6%)
 Frame = +2

Query  50   MSALSWGCLL--FVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYV  214
            M   SW  +L  F++LL     S+     + ++ QQKLD VL+LPG  FN+SFAHY+GY 
Sbjct  1    MVKPSWAFVLTYFIILLNLHLGSVFATIPTDALAQQKLDKVLELPGQTFNLSFAHYAGYA  60

Query  215  TVNQESGRALFLLVL*GCGGP  277
            TVN++SGRALF  ++     P
Sbjct  61   TVNEDSGRALFYWLVEAAEDP  81



>ref|XP_008243035.1| PREDICTED: serine carboxypeptidase II-2 [Prunus mume]
Length=473

 Score =   184 bits (467),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA EDP SKP+VLWLNGGPGCSSIA+G AEEVGPFH++ DGKTLY NPYSW
Sbjct  67   GRALFYWLVEAAEDPGSKPIVLWLNGGPGCSSIAYGEAEEVGPFHIKADGKTLYLNPYSW  126

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+DSP GVG+SYSNTSSD+L++GDKRTAEDSL FLLKWFER
Sbjct  127  NQVANILFLDSPVGVGFSYSNTSSDLLSNGDKRTAEDSLAFLLKWFER  174


 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 51/81 (63%), Gaps = 5/81 (6%)
 Frame = +2

Query  50   MSALSWGCLL--FVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYV  214
            M   SW  +L  F++LL     S+     + ++ QQKLD VL+LPG  FN+SFAHY+GY 
Sbjct  1    MVKPSWAFVLTYFIILLNLHLGSVFATIPTDALAQQKLDKVLELPGQTFNLSFAHYAGYA  60

Query  215  TVNQESGRALFLLVL*GCGGP  277
            TVN++SGRALF  ++     P
Sbjct  61   TVNEDSGRALFYWLVEAAEDP  81



>ref|XP_008394291.1| PREDICTED: serine carboxypeptidase II-2 [Malus domestica]
Length=482

 Score =   184 bits (467),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA EDP SKP+VLWLNGGPGCSSIA+G+AEE+GPFH+E DGKTLY NPYSW
Sbjct  67   GRALFYWFVEAAEDPHSKPVVLWLNGGPGCSSIAYGMAEEIGPFHIEADGKTLYLNPYSW  126

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF DSP GVG+SYSNTSSD+L++GDKRTA DSL FLL+WFER
Sbjct  127  NQVANVLFFDSPVGVGFSYSNTSSDLLSNGDKRTANDSLTFLLQWFER  174


 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 45/81 (56%), Gaps = 5/81 (6%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGG-----KGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYV  214
            M+   W   L VL++  ++  G       +  + QQ LD V  LPG  FN+SFAH+SGYV
Sbjct  1    MAKPRWDSALKVLIILLNLHLGSVFSAPPADPIAQQNLDRVAXLPGQSFNLSFAHFSGYV  60

Query  215  TVNQESGRALFLLVL*GCGGP  277
             VN++SGRALF   +     P
Sbjct  61   PVNEDSGRALFYWFVEAAEDP  81



>ref|XP_002275081.1| PREDICTED: serine carboxypeptidase II-2 [Vitis vinifera]
 emb|CBI36573.3| unnamed protein product [Vitis vinifera]
Length=469

 Score =   183 bits (465),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA EDPSSKPLVLWLNGGPGCSSIA+G +EE+GPFH+++DGKTLY NPYSW
Sbjct  63   GRALFYWFIEAAEDPSSKPLVLWLNGGPGCSSIAYGQSEEIGPFHIKEDGKTLYLNPYSW  122

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+DSP GVG+SYSNTSSD+ T+GD RTA+DSL FLLKWFER
Sbjct  123  NQVANILFLDSPVGVGFSYSNTSSDVSTNGDIRTAKDSLAFLLKWFER  170


 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 46/77 (60%), Gaps = 1/77 (1%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSS-VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  226
            M +L W  +L +L     ++    SS  + QQ+LD V  LPG  FN+SFAHYSGYVTVN+
Sbjct  1    MLSLKWVFVLQILFTLIYLNTPASSSDPLVQQRLDKVQHLPGQAFNISFAHYSGYVTVNE  60

Query  227  ESGRALFLLVL*GCGGP  277
             SGRALF   +     P
Sbjct  61   NSGRALFYWFIEAAEDP  77



>ref|XP_011018072.1| PREDICTED: serine carboxypeptidase-like 29 isoform X2 [Populus 
euphratica]
Length=410

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EAVEDP SKPL+L LNGGPGCSSIA+G+AEE+GPFH++ DGKTLY NPYSW
Sbjct  72   GRALFYWFVEAVEDPQSKPLLLRLNGGPGCSSIAYGMAEEIGPFHIKPDGKTLYLNPYSW  131

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+DSPAGVGYSYSNTSSD+L +GDK+TA DSL FLL WFER
Sbjct  132  NQVANILFLDSPAGVGYSYSNTSSDLLNNGDKKTAADSLAFLLNWFER  179


 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGP  277
            V QQ LD VL LPG  F+V+FAHYSGYVTVN++ GRALF   +     P
Sbjct  38   VAQQHLDRVLKLPGQNFDVNFAHYSGYVTVNEKYGRALFYWFVEAVEDP  86



>ref|XP_009127491.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=480

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +3

Query  231  LGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  410
            +G   FYW FEA EDP+SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N +S
Sbjct  72   MGRALFYWLFEAAEDPASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQHS  131

Query  411  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            WN AAN+LF+D+P GVGYSYSNTSSD+LT+GDKRTA+DSL FLLKW ER
Sbjct  132  WNQAANILFLDAPVGVGYSYSNTSSDLLTNGDKRTAQDSLTFLLKWVER  180


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 35/58 (60%), Gaps = 3/58 (5%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGPFF*ASCSLAQW  310
            ++  D V +LPG  FNV+FAHYSG+VT N++ GRALF  +      P   AS  L  W
Sbjct  41   EKDQDKVWNLPGQNFNVNFAHYSGFVTTNEKMGRALFYWLFEAAEDP---ASKPLVLW  95



>ref|XP_009410194.1| PREDICTED: serine carboxypeptidase II-2-like [Musa acuminata 
subsp. malaccensis]
Length=473

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEAVEDP+SKPLVLWLNGGPGCSSIA+GLAEE+GPFH+  DGK+LY NPY+W
Sbjct  66   GRALFYWFFEAVEDPASKPLVLWLNGGPGCSSIAYGLAEELGPFHINADGKSLYLNPYTW  125

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+DSP GVG+SYSN S D+LT+GDKRTA+DSL FL KWF+R
Sbjct  126  NQVANILFLDSPVGVGFSYSNNSQDVLTNGDKRTAKDSLTFLKKWFKR  173


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 40/64 (63%), Gaps = 3/64 (5%)
 Frame = +2

Query  119  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGPFF*ASCS  298
            G+S+ ++Q+ D VL LPG  FNVSFAHYSGYVTV+ + GRALF         P   AS  
Sbjct  28   GASAFERQEKDRVLRLPGQSFNVSFAHYSGYVTVDDDPGRALFYWFFEAVEDP---ASKP  84

Query  299  LAQW  310
            L  W
Sbjct  85   LVLW  88



>ref|XP_008790133.1| PREDICTED: serine carboxypeptidase II-2 isoform X2 [Phoenix dactylifera]
Length=441

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEAVEDP+SKPLVLWLNGGPGCSSIA+GLAEE+GPFHV  +GK+LY NPYSW
Sbjct  66   GRALFYWFFEAVEDPASKPLVLWLNGGPGCSSIAYGLAEELGPFHVNANGKSLYLNPYSW  125

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N AAN+LF+DSP GVG+SYSN S D+L++GD+RTA+DSL FL KWFER
Sbjct  126  NQAANILFLDSPVGVGFSYSNNSQDVLSNGDERTAKDSLVFLKKWFER  173


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 45/78 (58%), Gaps = 6/78 (8%)
 Frame = +2

Query  77   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLV  256
            L   + +  +DGG   S  + Q+ D VL LPG  FNVSFAHY+GYVTVN++SGRALF   
Sbjct  17   LLFFVFSADVDGG---SPFECQERDRVLHLPGQSFNVSFAHYAGYVTVNEDSGRALFYWF  73

Query  257  L*GCGGPFF*ASCSLAQW  310
                  P   AS  L  W
Sbjct  74   FEAVEDP---ASKPLVLW  88



>emb|CDX68696.1| BnaC01g07570D [Brassica napus]
Length=504

 Score =   182 bits (463),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +3

Query  231  LGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  410
            +G   FYW FEA EDP+SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N +S
Sbjct  96   MGRALFYWLFEAAEDPASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQHS  155

Query  411  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            WN AAN+LF+D+P GVGYSYSNTSSD LT+GDKRTA+DSL FLLKW ER
Sbjct  156  WNQAANILFLDAPVGVGYSYSNTSSDFLTNGDKRTAQDSLTFLLKWVER  204


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 3/58 (5%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGPFF*ASCSLAQW  310
            Q++ D V  LPG  FNV+FAHYSG+VT N++ GRALF  +      P   AS  L  W
Sbjct  65   QKEQDKVSQLPGQNFNVNFAHYSGFVTTNEKMGRALFYWLFEAAEDP---ASKPLVLW  119



>emb|CDY28216.1| BnaA01g06330D [Brassica napus]
Length=481

 Score =   182 bits (462),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +3

Query  231  LGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  410
            LG   FYW  EA EDP+SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N YS
Sbjct  64   LGRALFYWLIEAAEDPASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKPDGKTLYLNQYS  123

Query  411  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            WN AAN+LF+D+P GVG+SYSNTSSD+LT+GDKRTA+DSL FLLKW ER
Sbjct  124  WNQAANILFLDAPVGVGFSYSNTSSDLLTNGDKRTAQDSLTFLLKWVER  172


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 3/63 (5%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGPFF*ASCSL  301
             S + +++ D V  LPG  FNV+FAHYSG+VT N++ GRALF  ++     P   AS  L
Sbjct  28   ESVLSEKEQDKVSKLPGQNFNVNFAHYSGFVTTNEKLGRALFYWLIEAAEDP---ASKPL  84

Query  302  AQW  310
              W
Sbjct  85   VLW  87



>emb|CDP02851.1| unnamed protein product [Coffea canephora]
Length=472

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA EDP+SKPLVLWLNGGPGCSSIA+G+AEE+GPFHVEKDGK LY NPYSW
Sbjct  66   GRTLFYWFFEAAEDPASKPLVLWLNGGPGCSSIAYGVAEEIGPFHVEKDGKHLYLNPYSW  125

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N AAN+LF+DSP GVGYSYSNT SD L +GD RTA DS  FLLKWF+R
Sbjct  126  NQAANMLFLDSPVGVGYSYSNTPSDHLNNGDLRTAADSHAFLLKWFDR  173


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 53/93 (57%), Gaps = 11/93 (12%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSS---SVD---QQKLDAVLDLPGLGFNVSFAHYSGY  211
            M+ L+W  +L +L+    ID    SS   S D   QQ+LD VL LPG  FNVSFAHY+G+
Sbjct  1    MATLNW--VLVILISTLLIDLTNCSSCGFSADPYAQQQLDRVLHLPGQNFNVSFAHYAGF  58

Query  212  VTVNQESGRALFLLVL*GCGGPFF*ASCSLAQW  310
            VTVN+E+GR LF         P   AS  L  W
Sbjct  59   VTVNEEAGRTLFYWFFEAAEDP---ASKPLVLW  88



>ref|XP_011018071.1| PREDICTED: serine carboxypeptidase II-2-like isoform X1 [Populus 
euphratica]
Length=478

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EAVEDP SKPL+L LNGGPGCSSIA+G+AEE+GPFH++ DGKTLY NPYSW
Sbjct  72   GRALFYWFVEAVEDPQSKPLLLRLNGGPGCSSIAYGMAEEIGPFHIKPDGKTLYLNPYSW  131

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+DSPAGVGYSYSNTSSD+L +GDK+TA DSL FLL WFER
Sbjct  132  NQVANILFLDSPAGVGYSYSNTSSDLLNNGDKKTAADSLAFLLNWFER  179


 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGP  277
            V QQ LD VL LPG  F+V+FAHYSGYVTVN++ GRALF   +     P
Sbjct  38   VAQQHLDRVLKLPGQNFDVNFAHYSGYVTVNEKYGRALFYWFVEAVEDP  86



>ref|XP_009127511.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=481

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +3

Query  231  LGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  410
            LG   FYW  EA EDP+SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N YS
Sbjct  64   LGRALFYWLIEAAEDPASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKPDGKTLYLNQYS  123

Query  411  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            WN AAN+LF+D+P GVG+SYSNTSSD+LT+GDKRTA+DSL FLLKW ER
Sbjct  124  WNQAANILFLDAPVGVGFSYSNTSSDLLTNGDKRTAQDSLTFLLKWVER  172


 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 46/90 (51%), Gaps = 6/90 (7%)
 Frame = +2

Query  50   MSALSWGCL---LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTV  220
            M+   W C    LF + +          S + +++ + V  LPG  FNV+FAHYSG+VT 
Sbjct  1    MAKTRWSCFVNALFAIAVLAIAHFSNCESVLSEKEQNKVSKLPGQNFNVNFAHYSGFVTT  60

Query  221  NQESGRALFLLVL*GCGGPFF*ASCSLAQW  310
            N++ GRALF  ++     P   AS  L  W
Sbjct  61   NEKLGRALFYWLIEAAEDP---ASKPLVLW  87



>ref|XP_004488608.1| PREDICTED: serine carboxypeptidase II-2-like [Cicer arietinum]
Length=485

 Score =   174 bits (442),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 93/109 (85%), Gaps = 1/109 (1%)
 Frame = +3

Query  234  GEHFFYWFFEAV-EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  410
            G + FYWF EA  +DP+SKPL+LW NGGPGCSSIAFG AEE+GPFH+  DG TLY NPYS
Sbjct  79   GRNLFYWFIEAEHQDPTSKPLLLWFNGGPGCSSIAFGEAEEIGPFHINPDGNTLYLNPYS  138

Query  411  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            WN  AN+LFVDSP GVG+SYSNTSS++L +GDKRTAEDSL FLLKWFER
Sbjct  139  WNQVANILFVDSPVGVGFSYSNTSSELLNNGDKRTAEDSLIFLLKWFER  187


 Score = 53.5 bits (127),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 42/74 (57%), Gaps = 7/74 (9%)
 Frame = +2

Query  47   EMSALSWGCLLF--VLLLAT----SIDGGKGSSSVDQQKLDAV-LDLPGLGFNVSFAHYS  205
            EM+   W  +    +L+LAT    SI     +    QQ  D +   LPG  FN++F HYS
Sbjct  10   EMARFEWSQIWVTDILILATLFLCSISFAIATDPFVQQGKDRIGRALPGQNFNINFEHYS  69

Query  206  GYVTVNQESGRALF  247
            GY+TVN+++GR LF
Sbjct  70   GYITVNEDTGRNLF  83



>gb|KDP38717.1| hypothetical protein JCGZ_04070 [Jatropha curcas]
Length=478

 Score =   181 bits (460),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EAVEDP+SKPLVLWLNGGPGCSSI FG AEE+GPFH+  DGKTLY NPYSW
Sbjct  72   GRALFYWFIEAVEDPASKPLVLWLNGGPGCSSIGFGEAEEIGPFHIHADGKTLYLNPYSW  131

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+DSP GVG+SYSNTSSD++ +GDKRTA DSL FLLKW ER
Sbjct  132  NQVANILFIDSPVGVGFSYSNTSSDLVNNGDKRTAADSLIFLLKWVER  179


 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 39/58 (67%), Gaps = 3/58 (5%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGPFF*ASCSLAQW  310
            QQ+LD V +LPG  FNVSFAHYSGYVTVN+ESGRALF   +     P   AS  L  W
Sbjct  40   QQELDRVWELPGQNFNVSFAHYSGYVTVNEESGRALFYWFIEAVEDP---ASKPLVLW  94



>emb|CDY28217.1| BnaA01g06320D [Brassica napus]
Length=468

 Score =   181 bits (459),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +3

Query  231  LGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  410
            +G   FYW FEA EDP+ KPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N +S
Sbjct  59   MGRALFYWLFEAAEDPAYKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQHS  118

Query  411  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            WN AAN+LF+D+P GVGYSYSNTSSD+LT+GDKRTA+DSL FLLKW ER
Sbjct  119  WNQAANILFLDAPVGVGYSYSNTSSDLLTNGDKRTAQDSLTFLLKWVER  167


 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGPFF  283
            Q++ D V  LPG  FNV+FAHYSG+VT N++ GRALF  +      P +
Sbjct  28   QKEQDKVSQLPGQNFNVNFAHYSGFVTTNEKMGRALFYWLFEAAEDPAY  76



>ref|XP_008790132.1| PREDICTED: serine carboxypeptidase II-2 isoform X1 [Phoenix dactylifera]
Length=473

 Score =   181 bits (459),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEAVEDP+SKPLVLWLNGGPGCSSIA+GLAEE+GPFHV  +GK+LY NPYSW
Sbjct  66   GRALFYWFFEAVEDPASKPLVLWLNGGPGCSSIAYGLAEELGPFHVNANGKSLYLNPYSW  125

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N AAN+LF+DSP GVG+SYSN S D+L++GD+RTA+DSL FL KWFER
Sbjct  126  NQAANILFLDSPVGVGFSYSNNSQDVLSNGDERTAKDSLVFLKKWFER  173


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 45/78 (58%), Gaps = 6/78 (8%)
 Frame = +2

Query  77   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLV  256
            L   + +  +DGG   S  + Q+ D VL LPG  FNVSFAHY+GYVTVN++SGRALF   
Sbjct  17   LLFFVFSADVDGG---SPFECQERDRVLHLPGQSFNVSFAHYAGYVTVNEDSGRALFYWF  73

Query  257  L*GCGGPFF*ASCSLAQW  310
                  P   AS  L  W
Sbjct  74   FEAVEDP---ASKPLVLW  88



>emb|CDX68695.1| BnaC01g07580D [Brassica napus]
Length=481

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +3

Query  231  LGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  410
            LG   FYW  EA EDP+SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N YS
Sbjct  64   LGRALFYWLIEAAEDPASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKPDGKTLYLNQYS  123

Query  411  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            WN AAN+LF+D+P GVG+SYSNTSSD++T+GDKRTA+DSL FLLKW ER
Sbjct  124  WNQAANILFLDAPVGVGFSYSNTSSDLVTNGDKRTAQDSLTFLLKWVER  172


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 35/58 (60%), Gaps = 3/58 (5%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGPFF*ASCSLAQW  310
            +++ D V  LPG  FNV+FA YSG+VT N++ GRALF  ++     P   AS  L  W
Sbjct  33   EKEQDKVSKLPGQNFNVNFAQYSGFVTTNEKLGRALFYWLIEAAEDP---ASKPLVLW  87



>ref|XP_010687643.1| PREDICTED: serine carboxypeptidase II-2 [Beta vulgaris subsp. 
vulgaris]
Length=475

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EAVEDPSSKPL+LWLNGGPGCSSIAFG AEE+GPFH++KDGKTLY NP SW
Sbjct  71   GRALFYWFIEAVEDPSSKPLLLWLNGGPGCSSIAFGEAEELGPFHIQKDGKTLYLNPNSW  130

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN++F+D+P GVG+SYSNT+SD+LT+GD RTA+DSL+FL+ WFER
Sbjct  131  NKVANVIFLDAPVGVGFSYSNTTSDLLTNGDNRTAQDSLKFLVGWFER  178


 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 37/64 (58%), Gaps = 0/64 (0%)
 Frame = +2

Query  86   LLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*G  265
            L L T       S  + QQK+D V  LPG  F+V+F HYSGY+TVN+E GRALF   +  
Sbjct  22   LQLGTCSSSSSSSDPITQQKIDRVNYLPGQNFDVAFTHYSGYITVNEEFGRALFYWFIEA  81

Query  266  CGGP  277
               P
Sbjct  82   VEDP  85



>ref|XP_006387151.1| hypothetical protein POPTR_1689s00200g [Populus trichocarpa]
 gb|ERP46065.1| hypothetical protein POPTR_1689s00200g [Populus trichocarpa]
Length=324

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 93/114 (82%), Gaps = 6/114 (5%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EAVEDP SKPL+LWLNGGPGCSSIA+G+AEE+GPFH++ DGKTLY NPYSW
Sbjct  72   GRALFYWLVEAVEDPQSKPLLLWLNGGPGCSSIAYGMAEEIGPFHIKPDGKTLYLNPYSW  131

Query  414  N------LAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N        AN+LF+DSP GVGYSYSNTSSD+L +GDK+TA DSL FLL WFER
Sbjct  132  NQYFNQFAVANILFLDSPVGVGYSYSNTSSDLLNNGDKKTAADSLAFLLNWFER  185


 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGP  277
            V QQ LD V  LPG  F+V+FAHYSGYVTVN++ GRALF  ++     P
Sbjct  38   VAQQHLDRVQKLPGQNFDVNFAHYSGYVTVNEKYGRALFYWLVEAVEDP  86



>gb|KJB76660.1| hypothetical protein B456_012G098600 [Gossypium raimondii]
Length=407

 Score =   178 bits (452),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA +DP SKPL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKT+Y NPYSW
Sbjct  70   GRALFYWFFEAAKDPDSKPLLLWLNGGPGCSSVAYGEAEEIGPFHIRPDGKTVYLNPYSW  129

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF++SP GVG+SYSNTSSD+L +GDKRTA+DSL FLLKW ER
Sbjct  130  NQVANILFLESPVGVGFSYSNTSSDLLNNGDKRTAKDSLTFLLKWLER  177


 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 38/66 (58%), Gaps = 0/66 (0%)
 Frame = +2

Query  80   FVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            F L L + +       S+ QQKLD V +LPG  F V FAHY+GYVTVN+ SGRALF    
Sbjct  19   FYLSLGSCLIAASLEDSIAQQKLDKVHNLPGQSFTVDFAHYAGYVTVNEHSGRALFYWFF  78

Query  260  *GCGGP  277
                 P
Sbjct  79   EAAKDP  84



>ref|XP_007138291.1| hypothetical protein PHAVU_009G196000g [Phaseolus vulgaris]
 gb|ESW10285.1| hypothetical protein PHAVU_009G196000g [Phaseolus vulgaris]
Length=472

 Score =   171 bits (434),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA+EDP SKPLVLWLNGGPGCSSIAFG +EE+GPFH+  DGKTL+ NPYSW
Sbjct  64   GRTLFYWFIEALEDPHSKPLVLWLNGGPGCSSIAFGQSEEIGPFHINPDGKTLHPNPYSW  123

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+D+P GVG+SYSN  S++L +GD RTA+D+L FLLKWFER
Sbjct  124  NRVANILFLDTPVGVGFSYSNNGSELLNNGDNRTAKDNLVFLLKWFER  171


 Score = 52.4 bits (124),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            QQ  D V  LPG  FNVSFAHY+GY+TV + +GR LF
Sbjct  32   QQHKDRVGRLPGQNFNVSFAHYAGYITVEENAGRTLF  68



>ref|XP_006845388.1| hypothetical protein AMTR_s00019p00053910 [Amborella trichopoda]
 gb|ERN07063.1| hypothetical protein AMTR_s00019p00053910 [Amborella trichopoda]
Length=473

 Score =   178 bits (452),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            +  G   FYWFFEAV+DPSSKPLV+WLNGGPGCSSIA+G AEE+GPFH+  DGKTLY NP
Sbjct  62   KEAGRALFYWFFEAVDDPSSKPLVVWLNGGPGCSSIAYGEAEEIGPFHIRPDGKTLYLNP  121

Query  405  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
             SWN  ANLLFVDSP GVG+SYSNTS DI+++GDKRTAEDSL FL  W +R
Sbjct  122  DSWNQVANLLFVDSPVGVGFSYSNTSEDIISNGDKRTAEDSLAFLHNWLKR  172


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 49/88 (56%), Gaps = 15/88 (17%)
 Frame = +2

Query  71   CLLFVLLLATSI--------DGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  226
            CLLF++ L   +        D  +G+S V+    D VL LPG  F+VSFAHYSGYVTVN+
Sbjct  7    CLLFLIHLHIFLQVKGTIVEDEDRGASQVN----DRVLKLPGQAFDVSFAHYSGYVTVNK  62

Query  227  ESGRALFLLVL*GCGGPFF*ASCSLAQW  310
            E+GRALF         P   +S  L  W
Sbjct  63   EAGRALFYWFFEAVDDP---SSKPLVVW  87



>ref|XP_004964646.1| PREDICTED: serine carboxypeptidase II-2-like [Setaria italica]
Length=474

 Score =   178 bits (451),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA +DP SKPLVLWLNGGPGCSSIA+GL EEVGPFHV  DGK ++ NPYSW
Sbjct  65   GAALFYWFFEAEKDPGSKPLVLWLNGGPGCSSIAYGLGEEVGPFHVNADGKGVHVNPYSW  124

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  ANLLFVDSP GVGYSYSNTS DIL +GD RTA+DSL FLLKW ER
Sbjct  125  NKVANLLFVDSPVGVGYSYSNTSDDILRNGDARTAKDSLAFLLKWLER  172


 Score = 45.8 bits (107),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            ++Q  D V  +PG  F+ S+AHY+GYVTV++  G ALF
Sbjct  32   EEQARDRVPRVPGQAFDTSYAHYAGYVTVSEPRGAALF  69



>gb|KJB76659.1| hypothetical protein B456_012G098600 [Gossypium raimondii]
Length=487

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA +DP SKPL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKT+Y NPYSW
Sbjct  70   GRALFYWFFEAAKDPDSKPLLLWLNGGPGCSSVAYGEAEEIGPFHIRPDGKTVYLNPYSW  129

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF++SP GVG+SYSNTSSD+L +GDKRTA+DSL FLLKW ER
Sbjct  130  NQVANILFLESPVGVGFSYSNTSSDLLNNGDKRTAKDSLTFLLKWLER  177


 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 38/66 (58%), Gaps = 0/66 (0%)
 Frame = +2

Query  80   FVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            F L L + +       S+ QQKLD V +LPG  F V FAHY+GYVTVN+ SGRALF    
Sbjct  19   FYLSLGSCLIAASLEDSIAQQKLDKVHNLPGQSFTVDFAHYAGYVTVNEHSGRALFYWFF  78

Query  260  *GCGGP  277
                 P
Sbjct  79   EAAKDP  84



>ref|XP_007013884.1| Serine carboxypeptidase-like 29 [Theobroma cacao]
 gb|EOY31503.1| Serine carboxypeptidase-like 29 [Theobroma cacao]
Length=476

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA EDP SKPL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPYSW
Sbjct  70   GRALFYWFFEAAEDPDSKPLLLWLNGGPGCSSVAYGEAEEIGPFHIRPDGKTLYLNPYSW  129

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  ANLLF++SP GVG+SYSNTS D+L +GDKRTA+DSL FLLKW ER
Sbjct  130  NKVANLLFLESPIGVGFSYSNTSFDLLNNGDKRTAKDSLAFLLKWLER  177


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 41/63 (65%), Gaps = 5/63 (8%)
 Frame = +2

Query  89   LLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GC  268
            ++ATS++      SV QQKLD V  LPG  FNVSFAHY+GYVTVN+ SGRALF       
Sbjct  27   VIATSLE-----DSVAQQKLDKVPKLPGQNFNVSFAHYAGYVTVNEGSGRALFYWFFEAA  81

Query  269  GGP  277
              P
Sbjct  82   EDP  84



>emb|CBI36578.3| unnamed protein product [Vitis vinifera]
Length=470

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA EDPSSKPLVLWLNGGPGCSSIA+G +EE+GPFH+++DGKTLY NPYSW
Sbjct  64   GRALFYWFIEAAEDPSSKPLVLWLNGGPGCSSIAYGQSEEIGPFHIKEDGKTLYLNPYSW  123

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N AAN+LF+D P GVG+SYSN+S DI ++GD RTA+DSL+FLL+WFER
Sbjct  124  NQAANILFLDFPVGVGFSYSNSSFDISSNGDLRTAKDSLKFLLEWFER  171


 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 49/77 (64%), Gaps = 3/77 (4%)
 Frame = +2

Query  56   ALSWGCLLFVLLLATSIDGGKGSSSVD---QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  226
            ALS   +  V +L T I+  + +SS D   QQ+LD VL LPG  FN+SFAHY+GYVTVN+
Sbjct  2    ALSPKWVFVVQILLTLINLNRATSSSDPLVQQELDKVLQLPGQTFNISFAHYAGYVTVNE  61

Query  227  ESGRALFLLVL*GCGGP  277
             +GRALF   +     P
Sbjct  62   YTGRALFYWFIEAAEDP  78



>ref|XP_009395827.1| PREDICTED: serine carboxypeptidase II-2-like [Musa acuminata 
subsp. malaccensis]
Length=476

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G  FFYWFFEA E+P+SKPLVLWLNGGPGCSSI  GLAEEVGPFHV  DGK+LY NPYSW
Sbjct  68   GRAFFYWFFEATEEPASKPLVLWLNGGPGCSSIGLGLAEEVGPFHVNADGKSLYPNPYSW  127

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+DSP G G++YSN S D+LT+GDKRTA+D+L FL +WF+R
Sbjct  128  NQVANILFLDSPVGAGFAYSNNSQDVLTNGDKRTAKDNLTFLKRWFKR  175


 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 49/81 (60%), Gaps = 7/81 (9%)
 Frame = +2

Query  68   GCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            G   F+L+LA+S++    +S  +QQ  + VL LPG  F+VSFAHYSGYVTVN+E+GRA F
Sbjct  17   GPFFFLLVLASSLE----ASVFEQQARERVLRLPGQSFDVSFAHYSGYVTVNEEAGRAFF  72

Query  248  LLVL*GCGGPFF*ASCSLAQW  310
                     P   AS  L  W
Sbjct  73   YWFFEATEEP---ASKPLVLW  90



>ref|NP_001146398.1| Serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACG39493.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACL53886.1| unknown [Zea mays]
 gb|AFW85536.1| Serine carboxypeptidase K10B2.2 [Zea mays]
Length=474

 Score =   175 bits (443),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA +DP SKPLVLWLNGGPGCSSIAFGL EEVGPFHV  DGK ++ NPYSW
Sbjct  65   GAALFYWFFEAEKDPGSKPLVLWLNGGPGCSSIAFGLGEEVGPFHVNADGKGVHVNPYSW  124

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  ANLLF+DSP GVGYSYSNTS D L +GD RTA DSL FLLKW ER
Sbjct  125  NKVANLLFLDSPVGVGYSYSNTSDDALKNGDARTATDSLAFLLKWLER  172


 Score = 46.6 bits (109),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            ++Q  D V  +PG  FN SFA Y+GYVTV+++ G ALF
Sbjct  32   EEQARDRVPRVPGQAFNTSFAQYAGYVTVSEQRGAALF  69



>ref|XP_003595890.1| Serine carboxypeptidase II-2 [Medicago truncatula]
 gb|ACJ85268.1| unknown [Medicago truncatula]
 gb|AES66141.1| serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AFK36219.1| unknown [Medicago truncatula]
Length=473

 Score =   170 bits (431),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 91/109 (83%), Gaps = 1/109 (1%)
 Frame = +3

Query  234  GEHFFYWFFEAVE-DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  410
            G + FYWF +A   DP+S PL+LWLNGGPGCSSIAFG AEE+GPFH+  D KTLY NPYS
Sbjct  66   GRNLFYWFIQADHVDPTSMPLLLWLNGGPGCSSIAFGEAEEIGPFHINSDSKTLYLNPYS  125

Query  411  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            WN  AN+L++DSP GVG+SYS  SSDILT+GDKRTAED+L FLLKWFER
Sbjct  126  WNQVANILYIDSPVGVGFSYSKNSSDILTNGDKRTAEDNLIFLLKWFER  174


 Score = 51.2 bits (121),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 1/38 (3%)
 Frame = +2

Query  137  QQKLDAV-LDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            QQ+ D +   LPG  FN+SF HYSGY+TVN+++GR LF
Sbjct  33   QQEQDRIDRPLPGQNFNISFEHYSGYITVNEDAGRNLF  70



>ref|XP_002273324.2| PREDICTED: serine carboxypeptidase II-2 [Vitis vinifera]
Length=510

 Score =   177 bits (449),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA EDPSSKPLVLWLNGGPGCSSIA+G +EE+GPFH+++DGKTLY NPYSW
Sbjct  104  GRALFYWFIEAAEDPSSKPLVLWLNGGPGCSSIAYGQSEEIGPFHIKEDGKTLYLNPYSW  163

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N AAN+LF+D P GVG+SYSN+S DI ++GD RTA+DSL+FLL+WFER
Sbjct  164  NQAANILFLDFPVGVGFSYSNSSFDISSNGDLRTAKDSLKFLLEWFER  211


 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 49/77 (64%), Gaps = 3/77 (4%)
 Frame = +2

Query  56   ALSWGCLLFVLLLATSIDGGKGSSSVD---QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  226
            ALS   +  V +L T I+  + +SS D   QQ+LD VL LPG  FN+SFAHY+GYVTVN+
Sbjct  42   ALSPKWVFVVQILLTLINLNRATSSSDPLVQQELDKVLQLPGQTFNISFAHYAGYVTVNE  101

Query  227  ESGRALFLLVL*GCGGP  277
             +GRALF   +     P
Sbjct  102  YTGRALFYWFIEAAEDP  118



>sp|P55748.1|CBP22_HORVU RecName: Full=Serine carboxypeptidase II-2; AltName: Full=CP-MII.2; 
Contains: RecName: Full=Serine carboxypeptidase II-2 
chain A; Contains: RecName: Full=Serine carboxypeptidase II-2 
chain B; Flags: Precursor, partial [Hordeum vulgare]
 gb|AAB31590.1| CP-MII.2=serine carboxypeptidase [Hordeum vulgare=barley, cv. 
Alexis, aleurone, Peptide, 436 aa]
 emb|CAB59202.1| serine carboxylase II-2 [Hordeum vulgare subsp. vulgare]
Length=436

 Score =   176 bits (445),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA  DP+SKPL+LWLNGGPGCSSIAFG+ EEVGPFHV  DGK ++ NPYSW
Sbjct  27   GAALFYWFFEAAHDPASKPLLLWLNGGPGCSSIAFGVGEEVGPFHVNADGKGVHMNPYSW  86

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+DSP GVGYSYSNTS+DIL++GD+RTA+DSL FL KW ER
Sbjct  87   NQVANILFLDSPVGVGYSYSNTSADILSNGDERTAKDSLVFLTKWLER  134



>gb|AFW85537.1| hypothetical protein ZEAMMB73_208131 [Zea mays]
Length=432

 Score =   174 bits (442),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = +3

Query  222  TRSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            +   G   FYWFFEA +DP SKPLVLWLNGGPGCSSIAFGL EEVGPFHV  DGK ++ N
Sbjct  61   SEQRGAALFYWFFEAEKDPGSKPLVLWLNGGPGCSSIAFGLGEEVGPFHVNADGKGVHVN  120

Query  402  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            PYSWN  ANLLF+DSP GVGYSYSNTS D L +GD RTA DSL FLLKW ER
Sbjct  121  PYSWNKVANLLFLDSPVGVGYSYSNTSDDALKNGDARTATDSLAFLLKWLER  172


 Score = 46.6 bits (109),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            ++Q  D V  +PG  FN SFA Y+GYVTV+++ G ALF
Sbjct  32   EEQARDRVPRVPGQAFNTSFAQYAGYVTVSEQRGAALF  69



>ref|XP_003596536.1| Serine carboxypeptidase [Medicago truncatula]
Length=562

 Score =   172 bits (436),  Expect(2) = 6e-49, Method: Composition-based stats.
 Identities = 78/112 (70%), Positives = 90/112 (80%), Gaps = 1/112 (1%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVE-DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            + +G   FYWF EA   DP+SKPL+LW NGGPGCSSIA+G AEE+GPFH+  DG TL+ N
Sbjct  64   KDVGRTLFYWFIEADHIDPTSKPLLLWFNGGPGCSSIAYGEAEEIGPFHINSDGNTLHLN  123

Query  402  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            PYSWN  AN+L +DSP GVG+SYSN SSDIL +GDKRT EDSL FLLKWFER
Sbjct  124  PYSWNQVANILLIDSPVGVGFSYSNASSDILNNGDKRTTEDSLIFLLKWFER  175


 Score = 48.9 bits (115),  Expect(2) = 6e-49, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 1/38 (3%)
 Frame = +2

Query  137  QQKLDAV-LDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            QQ+ D +   LPG  FN++F HYSGY+TVN++ GR LF
Sbjct  34   QQEQDRIGTALPGQNFNINFEHYSGYITVNKDVGRTLF  71



>gb|KHG11306.1| Serine carboxypeptidase-like 29 [Gossypium arboreum]
Length=487

 Score =   176 bits (447),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA +DP SKPL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKT+Y NPYSW
Sbjct  70   GRALFYWFFEAAKDPDSKPLLLWLNGGPGCSSVAYGEAEEIGPFHIRPDGKTVYLNPYSW  129

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N   N+LF++SP GVG+SYSNTSSD+L +GDKRTA+DSL FLLKW ER
Sbjct  130  NQVVNILFLESPVGVGFSYSNTSSDLLNNGDKRTAKDSLTFLLKWLER  177


 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 38/66 (58%), Gaps = 0/66 (0%)
 Frame = +2

Query  80   FVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            F L L + +       S+ QQKLD V +LPG  F V FAHY+GYVTVN+ SGRALF    
Sbjct  19   FYLSLGSCLIAASLEDSIAQQKLDKVHNLPGQSFTVDFAHYAGYVTVNKHSGRALFYWFF  78

Query  260  *GCGGP  277
                 P
Sbjct  79   EAAKDP  84



>dbj|BAJ99024.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=469

 Score =   176 bits (445),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA  DP+SKPL+LWLNGGPGCSSIAFG+ EEVGPFHV  DGK ++ NPYSW
Sbjct  60   GAALFYWFFEAAHDPASKPLLLWLNGGPGCSSIAFGVGEEVGPFHVNADGKGVHMNPYSW  119

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+DSP GVGYSYSNTS+DIL++GD+RTA+DSL FL KW ER
Sbjct  120  NQVANILFLDSPVGVGYSYSNTSADILSNGDERTAKDSLVFLTKWLER  167


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 33/58 (57%), Gaps = 3/58 (5%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGPFF*ASCSLAQW  310
            +Q+ D V  +PG  FN SFAHY+GYVTV+++ G ALF         P   AS  L  W
Sbjct  28   EQERDRVPRVPGQAFNASFAHYAGYVTVSEDRGAALFYWFFEAAHDP---ASKPLLLW  82



>dbj|BAK02147.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=469

 Score =   175 bits (444),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA  DP+SKPL+LWLNGGPGCSSIAFG+ EEVGPFHV  DGK ++ NPYSW
Sbjct  60   GAALFYWFFEAAHDPASKPLLLWLNGGPGCSSIAFGVGEEVGPFHVNADGKGVHMNPYSW  119

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+DSP GVGYSYSNTS+DIL++GD+RTA+DSL FL KW ER
Sbjct  120  NQVANILFLDSPVGVGYSYSNTSADILSNGDERTAKDSLVFLTKWLER  167


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 33/58 (57%), Gaps = 3/58 (5%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGPFF*ASCSLAQW  310
            +Q+ D V  +PG  FN SFAHY+GYVTV+++ G ALF         P   AS  L  W
Sbjct  28   EQERDRVPRVPGQAFNASFAHYAGYVTVSEDRGAALFYWFFEAAHDP---ASKPLLLW  82



>ref|XP_006655861.1| PREDICTED: serine carboxypeptidase II-2-like [Oryza brachyantha]
Length=484

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA EDP+SKPLVLWLNGGPGCSSIA+G+AEEVGPFHV  DG+ ++ NPYSW
Sbjct  75   GAALFYWFFEAAEDPASKPLVLWLNGGPGCSSIAYGVAEEVGPFHVNADGQGVHLNPYSW  134

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+DSP GVGYSYSN S DIL +GD RTA DSL FL KW ER
Sbjct  135  NQVANILFLDSPVGVGYSYSNVSDDILNNGDARTANDSLTFLTKWIER  182



>gb|KDP38716.1| hypothetical protein JCGZ_04069 [Jatropha curcas]
Length=266

 Score =   154 bits (389),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G  FFYWF EAVEDP SKPLVLWLNG PGCSSI +G AEEVG F+++ DGKTLY NPYSW
Sbjct  76   GRAFFYWFMEAVEDPESKPLVLWLNGRPGCSSIGYGEAEEVGLFYIQADGKTLYLNPYSW  135

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRT  515
            N  AN+LF+DSP GVG+SYSNTSSD+L +GDKRT
Sbjct  136  NNVANILFIDSPVGVGFSYSNTSSDVLNNGDKRT  169


 Score = 65.1 bits (157),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 42/64 (66%), Gaps = 9/64 (14%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKG-----SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  235
            CL F++ L      G G     S  + QQ+LD VL LPG  F+VSFAHYSGYVTVN+ESG
Sbjct  21   CLFFLINLYV----GTGVAFSLSDPIAQQELDRVLGLPGQTFDVSFAHYSGYVTVNEESG  76

Query  236  RALF  247
            RA F
Sbjct  77   RAFF  80



>gb|AES66787.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=474

 Score =   170 bits (430),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 90/112 (80%), Gaps = 1/112 (1%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVE-DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            + +G   FYWF EA   DP+SKPL+LW NGGPGCSSIA+G AEE+GPFH+  DG TL+ N
Sbjct  64   KDVGRTLFYWFIEADHIDPTSKPLLLWFNGGPGCSSIAYGEAEEIGPFHINSDGNTLHLN  123

Query  402  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            PYSWN  AN+L +DSP GVG+SYSN SSDIL +GDKRT EDSL FLLKWFER
Sbjct  124  PYSWNQVANILLIDSPVGVGFSYSNASSDILNNGDKRTTEDSLIFLLKWFER  175


 Score = 48.9 bits (115),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 1/38 (3%)
 Frame = +2

Query  137  QQKLDAV-LDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            QQ+ D +   LPG  FN++F HYSGY+TVN++ GR LF
Sbjct  34   QQEQDRIGTALPGQNFNINFEHYSGYITVNKDVGRTLF  71



>ref|XP_003564183.1| PREDICTED: serine carboxypeptidase II-2 [Brachypodium distachyon]
Length=474

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA  +P+SKPLVLWLNGGPGCSSIAFGL EEVGPFH+  DGK ++ NPYSW
Sbjct  65   GAALFYWFFEAAHEPASKPLVLWLNGGPGCSSIAFGLGEEVGPFHINADGKGVHMNPYSW  124

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+DSP GVGYSYSNTS DIL++GD++TA+DSL FL KW ER
Sbjct  125  NRVANILFLDSPVGVGYSYSNTSGDILSNGDEKTAKDSLVFLTKWLER  172


 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 44/80 (55%), Gaps = 3/80 (4%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFL  250
             +LF+L ++ +      SS   +Q+ D V  +PG GFN SFAHY+GYVTV++E G ALF 
Sbjct  11   AVLFLLAVSGAAAAEGSSSWRGEQERDRVPRVPGQGFNASFAHYAGYVTVSEERGAALFY  70

Query  251  LVL*GCGGPFF*ASCSLAQW  310
                    P   AS  L  W
Sbjct  71   WFFEAAHEP---ASKPLVLW  87



>ref|NP_001057009.1| Os06g0186400 [Oryza sativa Japonica Group]
 dbj|BAD72445.1| putative serine carboxylase II-2 [Oryza sativa Japonica Group]
 dbj|BAD72446.1| putative serine carboxylase II-2 [Oryza sativa Japonica Group]
 dbj|BAF18923.1| Os06g0186400 [Oryza sativa Japonica Group]
 gb|EAZ36073.1| hypothetical protein OsJ_20382 [Oryza sativa Japonica Group]
 dbj|BAG90330.1| unnamed protein product [Oryza sativa Japonica Group]
Length=484

 Score =   174 bits (440),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA +DP+SKPLVLWLNGGPGCSSIA+G+AEEVGPFHV  DG+ ++ NPYSW
Sbjct  75   GASLFYWFFEAADDPASKPLVLWLNGGPGCSSIAYGVAEEVGPFHVNADGQGVHLNPYSW  134

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+DSP GVGYSYSN S DIL +GD RTA DSL FL KW ER
Sbjct  135  NQVANILFLDSPVGVGYSYSNASDDILNNGDARTANDSLTFLTKWIER  182



>gb|KHN02055.1| Serine carboxypeptidase II-2 [Glycine soja]
Length=469

 Score =   173 bits (439),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA+EDP SKPLVLWLNGGPGCSSIAFG +EEVGPFH+  D KTL++NPYSW
Sbjct  62   GRTLFYWFIEALEDPHSKPLVLWLNGGPGCSSIAFGQSEEVGPFHINSDSKTLHFNPYSW  121

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+D+P GVG+SYSN  SD+L +GD+RTAED+L FLL WFER
Sbjct  122  NRVANILFLDTPVGVGFSYSNNKSDMLINGDERTAEDNLVFLLNWFER  169


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 44/78 (56%), Gaps = 2/78 (3%)
 Frame = +2

Query  44   LEMSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  223
            +E     W  +L ++ L    D    +S   +Q+ D V  LPG GFN+SFAHY+GY+TVN
Sbjct  1    MEWRMALWSQILCIVTLLLCSDCA--ASFAKEQQKDRVGRLPGQGFNISFAHYAGYITVN  58

Query  224  QESGRALFLLVL*GCGGP  277
            +++GR LF   +     P
Sbjct  59   EKAGRTLFYWFIEALEDP  76



>emb|CDY32091.1| BnaC04g44750D [Brassica napus]
Length=447

 Score =   164 bits (416),  Expect(2) = 6e-48, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            S G   FYW  E+ + P SKPLVLWLNGGPGCSS+AFG AEE+GPF +  DGKTLY NPY
Sbjct  53   SAGRALFYWLTESSDHPESKPLVLWLNGGPGCSSLAFGAAEEIGPFRINPDGKTLYHNPY  112

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  ANLLF++SPAGVG+SYSNT+SD+ T GD+RTAED+  FL+KWFER
Sbjct  113  AWNKLANLLFLESPAGVGFSYSNTTSDLYTAGDQRTAEDAYVFLVKWFER  162


 Score = 53.1 bits (126),  Expect(2) = 6e-48, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            SS  D Q+ D +  LPG   +VSF+HYSGYVTVN+ +GRALF
Sbjct  18   SSCRDAQENDRISHLPGEPNDVSFSHYSGYVTVNESAGRALF  59



>ref|XP_003522937.2| PREDICTED: serine carboxypeptidase II-2-like [Glycine max]
Length=483

 Score =   173 bits (439),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA+EDP SKPLVLWLNGGPGCSSIAFG +EEVGPFH+  D KTL++NPYSW
Sbjct  76   GRTLFYWFIEALEDPHSKPLVLWLNGGPGCSSIAFGQSEEVGPFHINSDSKTLHFNPYSW  135

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+D+P GVG+SYSN  SD+L +GD+RTAED+L FLL WFER
Sbjct  136  NRVANILFLDTPVGVGFSYSNNKSDMLINGDERTAEDNLVFLLNWFER  183


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 44/78 (56%), Gaps = 2/78 (3%)
 Frame = +2

Query  44   LEMSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  223
            +E     W  +L ++ L    D    +S   +Q+ D V  LPG GFN+SFAHY+GY+TVN
Sbjct  15   MEWRMALWSQILCIVTLLLCSDCA--ASFAKEQQKDRVGRLPGQGFNISFAHYAGYITVN  72

Query  224  QESGRALFLLVL*GCGGP  277
            +++GR LF   +     P
Sbjct  73   EKAGRTLFYWFIEALEDP  90



>ref|XP_003595892.1| Serine carboxypeptidase II-2 [Medicago truncatula]
 gb|AES66143.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=472

 Score =   164 bits (415),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 93/112 (83%), Gaps = 3/112 (3%)
 Frame = +3

Query  231  LGEHFFYWFFEAVE-DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            +G + FYWF +A   DP+SKPL+LW NGGPGCSSIA+G AEE+GPFH+  DGK L++NPY
Sbjct  64   VGRNLFYWFIQADHVDPTSKPLLLWFNGGPGCSSIAYGEAEEIGPFHINSDGKNLHFNPY  123

Query  408  SWNLAANLLFVDSPAGVGYSYS--NTSSDILTHGDKRTAEDSLEFLLKWFER  557
            SWN  AN+L++DSP GVG+SYS  N+S DIL +GDKRTAED+L FLLKWFER
Sbjct  124  SWNQVANILYIDSPVGVGFSYSTKNSSDDILNNGDKRTAEDNLIFLLKWFER  175


 Score = 52.8 bits (125),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 39/69 (57%), Gaps = 3/69 (4%)
 Frame = +2

Query  50   MSALSWGCLLFVLL--LATSIDGGKGSSSVDQQKLDAV-LDLPGLGFNVSFAHYSGYVTV  220
            M+   W  +LF+++  LA        +    QQ  D +   LPG  FN+SF HYSGY+TV
Sbjct  1    MANSKWSQILFIVIITLANLFQCNIATDPFVQQGQDNIGRALPGQNFNISFEHYSGYITV  60

Query  221  NQESGRALF  247
            N++ GR LF
Sbjct  61   NEDVGRNLF  69



>ref|XP_009141519.1| PREDICTED: serine carboxypeptidase-like 26 [Brassica rapa]
Length=447

 Score =   164 bits (414),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            S G   FYW  E+ + P SKPLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY
Sbjct  53   SAGRALFYWLTESSQHPESKPLVLWLNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPY  112

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  ANLLF++SPAGVG+SYSNT+SD+ T GD+RTAED+  FL+KWFER
Sbjct  113  AWNKLANLLFLESPAGVGFSYSNTTSDLYTAGDQRTAEDAYVFLVKWFER  162


 Score = 53.1 bits (126),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            SS  D Q+ D +  LPG   +VSF+HYSGYVTVN+ +GRALF
Sbjct  18   SSCRDAQEKDRISRLPGEPNDVSFSHYSGYVTVNESAGRALF  59



>ref|XP_010111113.1| Serine carboxypeptidase-like 29 [Morus notabilis]
 gb|EXC30159.1| Serine carboxypeptidase-like 29 [Morus notabilis]
Length=495

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 96/127 (76%), Gaps = 19/127 (15%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGG-------------------PGCSSIAFGLAEEV  356
            G   FYWFFEA EDP+SKP+VLWLNGG                   PGCSSIA+G AEE+
Sbjct  70   GRALFYWFFEAAEDPASKPIVLWLNGGLPALLVFHLLCLVTMKSLGPGCSSIAYGEAEEI  129

Query  357  GPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEF  536
            GPFH++ D KTLY NPYSWN  AN+LF+DSP GVG+SYSN SSD+L++GDKRTA+D+LEF
Sbjct  130  GPFHIKPDAKTLYLNPYSWNQVANILFIDSPVGVGFSYSNASSDLLSNGDKRTAKDNLEF  189

Query  537  LLKWFER  557
            LLKWFER
Sbjct  190  LLKWFER  196


 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 34/58 (59%), Gaps = 3/58 (5%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGPFF*ASCSLAQW  310
            QQ+LD V  LPG  F VSF HYSGYV VN+ESGRALF         P   AS  +  W
Sbjct  38   QQRLDRVEKLPGQNFIVSFEHYSGYVRVNEESGRALFYWFFEAAEDP---ASKPIVLW  92



>emb|CDY40438.1| BnaA04g20790D [Brassica napus]
Length=447

 Score =   163 bits (412),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            S G   FYW  E+ + P SKPLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY
Sbjct  53   SAGRALFYWLTESSDHPESKPLVLWLNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPY  112

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  ANLLF++SPAGVG+SYSNT+SD+ T GD+RTAED+  FL+KWFER
Sbjct  113  AWNKLANLLFLESPAGVGFSYSNTTSDLYTAGDQRTAEDAYVFLVKWFER  162


 Score = 53.1 bits (126),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            SS  D Q+ D +  LPG   +VSF+HYSGYVTVN+ +GRALF
Sbjct  18   SSCRDSQENDRISHLPGEPNDVSFSHYSGYVTVNESAGRALF  59



>ref|XP_003548016.1| PREDICTED: serine carboxypeptidase-like 27-like [Glycine max]
Length=493

 Score =   155 bits (392),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 87/110 (79%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E  A  +PSS+PLVLWLNGGPGCSSI +G AEE+GPF +  DG +LY NPY
Sbjct  57   GRALFYWLVETPASIEPSSRPLVLWLNGGPGCSSIGYGAAEEIGPFRINSDGNSLYSNPY  116

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  AN+LF+DSPAGVG+SYSNT+SD+ T GD+RTAED+  FL+ WFER
Sbjct  117  AWNNLANILFLDSPAGVGFSYSNTTSDLYTAGDQRTAEDAYTFLVNWFER  166


 Score = 60.1 bits (144),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFL  250
            C  F + L  SI  G   +S ++Q+ D +  LPG   NV FAHYSGYVTVN+E+GRALF 
Sbjct  3    CSQFSVFLLLSIFVGICLASTEEQERDRIAKLPGQPENVLFAHYSGYVTVNEEAGRALFY  62

Query  251  LVL  259
             ++
Sbjct  63   WLV  65



>ref|XP_003595891.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES66142.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=473

 Score =   164 bits (414),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 90/109 (83%), Gaps = 1/109 (1%)
 Frame = +3

Query  234  GEHFFYWFFEAVE-DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  410
            G + FYWF +A   DP+SKPL+LWLNGGPGCSSIA+G AEE+GPFH+  DGK L++NPY 
Sbjct  66   GRNLFYWFIQADHVDPTSKPLLLWLNGGPGCSSIAYGEAEEIGPFHINSDGKNLHFNPYY  125

Query  411  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            WN  AN L+++SP GVG+SYS  SSDIL +GDKRTAED+L FLLKWFER
Sbjct  126  WNQVANFLYIESPVGVGFSYSKNSSDILNNGDKRTAEDNLIFLLKWFER  174


 Score = 51.2 bits (121),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 4/74 (5%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSSVD---QQKLDAV-LDLPGLGFNVSFAHYSGYVT  217
            M+   W  +  + L    +     + + D   QQ+ D +   LPG  FN+SF HYSGY+T
Sbjct  1    MANSEWSQIFAITLATIFLCNNNFTFATDPFVQQEHDRIDRPLPGQNFNISFEHYSGYIT  60

Query  218  VNQESGRALFLLVL  259
            VN+++GR LF   +
Sbjct  61   VNEDAGRNLFYWFI  74



>ref|XP_006294202.1| hypothetical protein CARUB_v10023198mg [Capsella rubella]
 gb|EOA27100.1| hypothetical protein CARUB_v10023198mg [Capsella rubella]
Length=451

 Score =   162 bits (410),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  228  SLGEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            S G   FYW  E+   ++P SKPLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY N
Sbjct  53   SAGRALFYWLTESPPSQNPESKPLVLWLNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHN  112

Query  402  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            PYSWN  ANLLF++SPAGVG+SYSNT+SD+ T GDKRTAED+  FLLKWFER
Sbjct  113  PYSWNKLANLLFLESPAGVGFSYSNTTSDLYTAGDKRTAEDAYVFLLKWFER  164


 Score = 51.6 bits (122),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            D+Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALF
Sbjct  22   DEQEKDRIYHLPGEPNDVSFSHFSGYITVNESAGRALF  59



>gb|KFK36474.1| hypothetical protein AALP_AA4G129400 [Arabis alpina]
Length=449

 Score =   161 bits (408),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  228  SLGEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            S G   FYW  E+   ++P SKPLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY N
Sbjct  53   SAGRALFYWLTESPPSQNPESKPLVLWLNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHN  112

Query  402  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            PYSWN  ANLLF++SPAGVG+SYSNT+SD+ T GDKRTAED+  FL+KWFER
Sbjct  113  PYSWNKLANLLFLESPAGVGFSYSNTTSDLYTAGDKRTAEDAYVFLVKWFER  164


 Score = 52.0 bits (123),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            SSS+  Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALF
Sbjct  18   SSSIYDQENDRITHLPGEPNDVSFSHFSGYITVNESAGRALF  59



>ref|XP_011076996.1| PREDICTED: serine carboxypeptidase-like 27 [Sesamum indicum]
Length=461

 Score =   159 bits (401),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 87/110 (79%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA     P S+PLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY
Sbjct  63   GRALFYWLTEAPAYRGPDSRPLVLWLNGGPGCSSVAYGAAEEIGPFRINSDGKTLYLNPY  122

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            SWN  ANLLF++SPAGVG+SYSNTSSD+ T GD+RTAED+  FL+ WFER
Sbjct  123  SWNKLANLLFLESPAGVGFSYSNTSSDLYTVGDQRTAEDAYAFLVGWFER  172


 Score = 54.7 bits (130),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            C + +L L + +  G   S++DQ++ D +  LPG   NV F  YSGY+TVNQ+SGRALF
Sbjct  10   CAICILWLNSFVGIGYSLSNLDQER-DRITYLPGQPQNVGFNQYSGYITVNQQSGRALF  67



>ref|NP_181121.1| serine carboxypeptidase-like 26 [Arabidopsis thaliana]
 sp|Q9ZQQ0.1|SCP26_ARATH RecName: Full=Serine carboxypeptidase-like 26; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD21479.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM15111.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM65590.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|ABJ17113.1| At2g35780 [Arabidopsis thaliana]
 gb|AEC09160.1| serine carboxypeptidase-like 26 [Arabidopsis thaliana]
Length=452

 Score =   162 bits (409),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  228  SLGEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            S G   FYW  E+   E+P SKPLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY N
Sbjct  54   SAGRALFYWLTESPPSENPESKPLVLWLNGGPGCSSVAYGAAEEIGPFRINPDGKTLYHN  113

Query  402  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            PYSWN  ANLLF++SPAGVG+SYSNT+SD+ T GD+RTAED+  FL+KWFER
Sbjct  114  PYSWNKLANLLFLESPAGVGFSYSNTTSDLYTAGDQRTAEDAYVFLVKWFER  165


 Score = 51.2 bits (121),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +2

Query  119  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
             S S  +Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALF
Sbjct  18   ASCSRHEQEKDRIFHLPGEPNDVSFSHFSGYITVNESAGRALF  60



>ref|XP_006410747.1| hypothetical protein EUTSA_v10016650mg [Eutrema salsugineum]
 gb|ESQ52200.1| hypothetical protein EUTSA_v10016650mg [Eutrema salsugineum]
Length=449

 Score =   161 bits (407),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +3

Query  228  SLGEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            S G   FYW  E+   + P SKPLVLWLNGGPGCSSIAFG AEE+GPF +  DGKTLY N
Sbjct  53   SAGRALFYWLTESPPSQHPESKPLVLWLNGGPGCSSIAFGAAEEIGPFRINPDGKTLYHN  112

Query  402  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            PY+WN  ANLLF++SPAGVG+SYSNT+SD+ T GD+RTAED+  FL+KWFER
Sbjct  113  PYAWNQLANLLFLESPAGVGFSYSNTTSDLYTAGDQRTAEDAYVFLVKWFER  164


 Score = 50.8 bits (120),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            D+Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALF
Sbjct  22   DEQEKDRISHLPGEPNDVSFSHFSGYITVNESAGRALF  59



>gb|ACA61621.1| hypothetical protein AP7_B10.1 [Arabidopsis lyrata subsp. petraea]
Length=450

 Score =   163 bits (412),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  228  SLGEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            S G   FYW  E+   ++P SKPLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY N
Sbjct  52   SAGRALFYWLTESPPSQNPESKPLVLWLNGGPGCSSVAYGAAEEIGPFRINPDGKTLYHN  111

Query  402  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            PYSWN  ANLLF++SPAGVG+SYSNT+SD+ T GDKRTAED+  FL+KWFER
Sbjct  112  PYSWNKVANLLFLESPAGVGFSYSNTTSDLYTAGDKRTAEDAYVFLVKWFER  163


 Score = 48.9 bits (115),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  128  SVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            S  +Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALF
Sbjct  19   SRHEQEKDRISHLPGEPNDVSFSHFSGYITVNESAGRALF  58



>ref|XP_002881414.1| hypothetical protein ARALYDRAFT_482550 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57673.1| hypothetical protein ARALYDRAFT_482550 [Arabidopsis lyrata subsp. 
lyrata]
Length=450

 Score =   162 bits (411),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  228  SLGEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            S G   FYW  E+   ++P SKPLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY N
Sbjct  52   SAGRALFYWLTESPPSQNPESKPLVLWLNGGPGCSSVAYGAAEEIGPFRINPDGKTLYHN  111

Query  402  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            PYSWN  ANLLF++SPAGVG+SYSNT+SD+ T GDKRTAED+  FL+KWFER
Sbjct  112  PYSWNKVANLLFLESPAGVGFSYSNTTSDLYTAGDKRTAEDAYVFLVKWFER  163


 Score = 49.3 bits (116),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  128  SVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            S  +Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALF
Sbjct  19   SRHEQEKDRISHLPGEPNDVSFSHFSGYITVNESAGRALF  58



>ref|XP_006589433.1| PREDICTED: serine carboxypeptidase-like 27-like [Glycine max]
Length=460

 Score =   156 bits (395),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 87/110 (79%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA     P S+PLVLWLNGGPGCSSIA+G +EE+GPFH+  DGK+LY NPY
Sbjct  60   GRSLFYWLVEAPVKRGPKSRPLVLWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNPY  119

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  AN+LF+DSPAGVG+SYSN S+D+ T GD++TAED+  FL+ WFER
Sbjct  120  AWNNLANVLFLDSPAGVGFSYSNKSTDLYTFGDQKTAEDAYTFLVNWFER  169


 Score = 54.7 bits (130),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            +S ++ QK D +  LPG   NV FA YSGYVTVN++SGR+LF  ++
Sbjct  23   ASPIEDQKRDRITQLPGQPKNVGFAQYSGYVTVNEQSGRSLFYWLV  68



>gb|KHN13367.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=493

 Score =   150 bits (380),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 86/110 (78%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E  A  +PSS+PLVLWLNGGPGCSSI +G AEE+GPF +  DG +LY NPY
Sbjct  57   GRALFYWLVETPASIEPSSRPLVLWLNGGPGCSSIGYGAAEEIGPFRINSDGNSLYSNPY  116

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN +  ++F+DSPAGVG+SYSNT+SD+ T GD+RTAED+  FL+ WFER
Sbjct  117  AWNNSVVIVFLDSPAGVGFSYSNTTSDLYTAGDQRTAEDAYTFLVNWFER  166


 Score = 60.1 bits (144),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFL  250
            C  F + L  SI  G   +S ++Q+ D +  LPG   NV FAHYSGYVTVN+E+GRALF 
Sbjct  3    CSQFSVFLLLSIFVGICLASTEEQERDRIAKLPGQPENVLFAHYSGYVTVNEEAGRALFY  62

Query  251  LVL  259
             ++
Sbjct  63   WLV  65



>ref|XP_010505098.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=453

 Score =   159 bits (402),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 89/110 (81%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAVE--DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E+    +P SKPLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY
Sbjct  57   GRALFYWLTESPPSLNPDSKPLVLWLNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPY  116

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            SWN  ANLLF++SPAGVG+SYSNT+SD+ T GDKRTAED+  FL+KWFER
Sbjct  117  SWNQLANLLFLESPAGVGFSYSNTTSDLYTAGDKRTAEDAYVFLVKWFER  166


 Score = 51.6 bits (122),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            D+Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALF
Sbjct  24   DEQEKDRIYHLPGEPNDVSFSHFSGYITVNEPAGRALF  61



>ref|XP_010509560.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=451

 Score =   159 bits (401),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 89/110 (81%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAVE--DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E+    +P SKPLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY
Sbjct  55   GRALFYWLTESPPSLNPESKPLVLWLNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPY  114

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            SWN  ANLLF++SPAGVG+SYSNT+SD+ T GDKRTAED+  FL+KWFER
Sbjct  115  SWNQLANLLFLESPAGVGFSYSNTTSDLYTAGDKRTAEDAYVFLVKWFER  164


 Score = 51.6 bits (122),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            D+Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALF
Sbjct  22   DEQEKDRIYHLPGEPNDVSFSHFSGYITVNEPAGRALF  59



>gb|KHG25905.1| Serine carboxypeptidase-like 27 [Gossypium arboreum]
Length=470

 Score =   154 bits (390),  Expect(2) = 9e-46, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 87/110 (79%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYWF E+     P ++PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY+NPY
Sbjct  58   GRALFYWFIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYFNPY  117

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  AN LF++SPAGVG+SY+NT+SD+ T GDKRTAED+  FL+ W ER
Sbjct  118  AWNKLANTLFLESPAGVGFSYTNTTSDLYTSGDKRTAEDAYVFLVNWLER  167


 Score = 55.8 bits (133),  Expect(2) = 9e-46, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 37/62 (60%), Gaps = 4/62 (6%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLL  253
             LFVLL   +      SSS   Q LD + +LPG   NV F  YSGYVTVN+E+GRALF  
Sbjct  9    FLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAGRALFYW  64

Query  254  VL  259
             +
Sbjct  65   FI  66



>ref|XP_009378094.1| PREDICTED: serine carboxypeptidase-like 27 [Pyrus x bretschneideri]
Length=455

 Score =   162 bits (411),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 91/113 (81%), Gaps = 2/113 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            R  G   FYW  E+ E+  P S+PLVLWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY 
Sbjct  54   RKAGRALFYWLTESPENRQPESRPLVLWLNGGPGCSSVAYGAAEEIGPFHIRPDGKTLYL  113

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            NPY+WN  ANLLF++SPAGVG+SY+NTSSD+ T GD+RTA+D+  FL+ WFER
Sbjct  114  NPYAWNNLANLLFLESPAGVGFSYTNTSSDLYTAGDQRTAQDAYAFLVNWFER  166


 Score = 47.8 bits (112),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 8/59 (14%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            C+L + L      GG  +S+ DQ + D +  LPG   NV FA YSGYVTVN+++GRALF
Sbjct  11   CILLLFL------GGCFASNQDQVR-DRITQLPGQP-NVGFAQYSGYVTVNRKAGRALF  61



>ref|XP_002315293.2| hypothetical protein POPTR_0010s22700g [Populus trichocarpa]
 gb|EEF01464.2| hypothetical protein POPTR_0010s22700g [Populus trichocarpa]
Length=469

 Score =   161 bits (407),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 87/110 (79%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA  +  P SKPLVLWLNGGPGCSS+A+G +EEVGPF V  DGKTL+ NPY
Sbjct  68   GRALFYWLIEAPKIVKPKSKPLVLWLNGGPGCSSVAYGASEEVGPFRVRPDGKTLHLNPY  127

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  ANLLF+DSPAGVG+SYSNTSSD  T GDKRTA+D+  FL+ WFER
Sbjct  128  AWNKVANLLFLDSPAGVGFSYSNTSSDTYTVGDKRTAKDAYTFLVNWFER  177


 Score = 48.9 bits (115),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 40/65 (62%), Gaps = 3/65 (5%)
 Frame = +2

Query  74   LLFVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            LL+VL LAT   S         +++Q+ D ++ L G   NVSF+ +SGY+TV+  +GRAL
Sbjct  12   LLYVLNLATLLLSTIAATNHGHLEEQRRDKIIKLQGQPPNVSFSQFSGYITVDPLAGRAL  71

Query  245  FLLVL  259
            F  ++
Sbjct  72   FYWLI  76



>ref|XP_002534550.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF27834.1| serine carboxypeptidase, putative [Ricinus communis]
Length=385

 Score =   160 bits (406),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 88/110 (80%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA  +  P SKPLVLWLNGGPGCSS+A+G +EEVGPF V  DGKTLY NPY
Sbjct  68   GRALFYWLIEAPKMARPKSKPLVLWLNGGPGCSSVAYGASEEVGPFRVRSDGKTLYLNPY  127

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  ANLLF+DSPAGVG+SYSNTSSDI   GDKRT++D+ +FL+ WF+R
Sbjct  128  TWNKVANLLFLDSPAGVGFSYSNTSSDIYAVGDKRTSQDAHKFLINWFKR  177


 Score = 48.9 bits (115),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 40/63 (63%), Gaps = 1/63 (2%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFL  250
             L F  LL ++I   +  S+ ++Q+ D ++ LPG   NV F+ YSGYVTV+  +GRALF 
Sbjct  15   ALSFATLLLSTI-SARLISNKEEQERDRIIKLPGQPPNVYFSQYSGYVTVDPLAGRALFY  73

Query  251  LVL  259
             ++
Sbjct  74   WLI  76



>ref|XP_010547376.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
 ref|XP_010547377.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
 ref|XP_010547378.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
Length=457

 Score =   155 bits (392),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 89/110 (81%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E+  +  P ++PLVLWLNGGPGCSS+A+G AEE+GPF +  DGK+LY NPY
Sbjct  58   GRALFYWLTESPVNRVPKARPLVLWLNGGPGCSSVAYGAAEEIGPFRIRPDGKSLYLNPY  117

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  ANLLF++SPAGVG+SY+NT+SD+ T GD+RTAED+  FL+KWFER
Sbjct  118  AWNKLANLLFLESPAGVGFSYTNTTSDLYTTGDERTAEDAYTFLVKWFER  167


 Score = 54.3 bits (129),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            +S ++ QK D + +LPG   NVSF+ YSGYVTVN++ GRALF
Sbjct  21   ASYLEDQKRDRIRELPGQPRNVSFSQYSGYVTVNEQRGRALF  62



>gb|KJB78939.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=432

 Score =   154 bits (388),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 86/110 (78%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYWF E+     P ++PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY
Sbjct  58   GRALFYWFIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNPY  117

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  AN LF++SPAGVG+SY+NT+SD+ T GDKRTAED+  FL+ W ER
Sbjct  118  AWNKLANTLFLESPAGVGFSYTNTTSDLYTSGDKRTAEDAYVFLVNWLER  167


 Score = 55.8 bits (133),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 37/62 (60%), Gaps = 4/62 (6%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLL  253
             LFVLL   +      SSS   Q LD + +LPG   NV F  YSGYVTVN+E+GRALF  
Sbjct  9    FLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAGRALFYW  64

Query  254  VL  259
             +
Sbjct  65   FI  66



>gb|KJB78940.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
 gb|KJB78941.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=375

 Score =   154 bits (388),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 86/110 (78%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYWF E+     P ++PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY
Sbjct  58   GRALFYWFIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNPY  117

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  AN LF++SPAGVG+SY+NT+SD+ T GDKRTAED+  FL+ W ER
Sbjct  118  AWNKLANTLFLESPAGVGFSYTNTTSDLYTSGDKRTAEDAYVFLVNWLER  167


 Score = 55.8 bits (133),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 37/62 (60%), Gaps = 4/62 (6%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLL  253
             LFVLL   +      SSS   Q LD + +LPG   NV F  YSGYVTVN+E+GRALF  
Sbjct  9    FLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAGRALFYW  64

Query  254  VL  259
             +
Sbjct  65   FI  66



>ref|XP_007143689.1| hypothetical protein PHAVU_007G093300g [Phaseolus vulgaris]
 gb|ESW15683.1| hypothetical protein PHAVU_007G093300g [Phaseolus vulgaris]
Length=459

 Score =   155 bits (391),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 86/107 (80%), Gaps = 2/107 (2%)
 Frame = +3

Query  243  FFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  416
             FYW  EA     P S+PLVLWLNGGPGCSSIA+G +EE+GPFH+  DG++LY NPY+WN
Sbjct  63   LFYWLVEAPVSRGPRSRPLVLWLNGGPGCSSIAYGASEEIGPFHIRPDGRSLYLNPYAWN  122

Query  417  LAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
              AN+LF+DSPAGVG+SYSN ++D+ T GD+RTAED+  FL+ WFER
Sbjct  123  KLANILFLDSPAGVGFSYSNKTADLYTFGDQRTAEDAYAFLVNWFER  169


 Score = 54.3 bits (129),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +2

Query  80   FVLLLATSIDGGKG-SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLV  256
            F L+L  SI G    +S ++ QK D +  LPG   NV FA YSGYVTVN++S RALF  +
Sbjct  8    FYLVLLLSICGVVSLASPIEDQKRDRITQLPGQPKNVGFAQYSGYVTVNEQSERALFYWL  67

Query  257  L  259
            +
Sbjct  68   V  68



>ref|XP_009592854.1| PREDICTED: serine carboxypeptidase-like 27 [Nicotiana tomentosiformis]
Length=456

 Score =   162 bits (410),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 90/110 (82%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E+    +P  +PL+LWLNGGPGCSS+A+G AEE+GPFH++ DGKTLY NPY
Sbjct  58   GRALFYWLIESPVSRNPEKRPLILWLNGGPGCSSVAYGAAEEIGPFHIDSDGKTLYLNPY  117

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            SWN  ANLLF++SPAGVG+SY+NTSSD+   GD+RTAED+ +FL+KWFER
Sbjct  118  SWNNLANLLFLESPAGVGFSYTNTSSDLYNAGDQRTAEDTYQFLVKWFER  167


 Score = 47.0 bits (110),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            +Q  D +  LPG   NV F  YSGYVTVN+++GRALF  ++
Sbjct  26   EQLRDKITYLPGQPANVQFNQYSGYVTVNEQAGRALFYWLI  66



>ref|XP_009802382.1| PREDICTED: serine carboxypeptidase-like 27 [Nicotiana sylvestris]
Length=456

 Score =   161 bits (408),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 89/110 (81%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E+    +P  +PL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPY
Sbjct  58   GRALFYWLIESPMSRNPEKRPLILWLNGGPGCSSVAYGAAEEIGPFHINSDGKTLYLNPY  117

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            SWN  ANLLF++SPAGVG+SY+NTSSD+   GD+RTAED+ +FL+KWFER
Sbjct  118  SWNNLANLLFLESPAGVGFSYTNTSSDLYNAGDQRTAEDTYQFLVKWFER  167


 Score = 47.8 bits (112),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (58%), Gaps = 0/62 (0%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLL  253
            L FV+ L+    G    S   +Q  D +  LPG   NV F  YSGYVTVN+++GRALF  
Sbjct  5    LPFVICLSLLFLGSCYCSINVEQLRDKITYLPGQPANVEFNQYSGYVTVNEQAGRALFYW  64

Query  254  VL  259
            ++
Sbjct  65   LI  66



>gb|KJB78942.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=422

 Score =   153 bits (387),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 86/110 (78%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYWF E+     P ++PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY
Sbjct  58   GRALFYWFIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNPY  117

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  AN LF++SPAGVG+SY+NT+SD+ T GDKRTAED+  FL+ W ER
Sbjct  118  AWNKLANTLFLESPAGVGFSYTNTTSDLYTSGDKRTAEDAYVFLVNWLER  167


 Score = 55.5 bits (132),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 37/62 (60%), Gaps = 4/62 (6%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLL  253
             LFVLL   +      SSS   Q LD + +LPG   NV F  YSGYVTVN+E+GRALF  
Sbjct  9    FLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAGRALFYW  64

Query  254  VL  259
             +
Sbjct  65   FI  66



>gb|KJB78938.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=470

 Score =   153 bits (387),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 86/110 (78%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYWF E+     P ++PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY
Sbjct  58   GRALFYWFIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNPY  117

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  AN LF++SPAGVG+SY+NT+SD+ T GDKRTAED+  FL+ W ER
Sbjct  118  AWNKLANTLFLESPAGVGFSYTNTTSDLYTSGDKRTAEDAYVFLVNWLER  167


 Score = 55.5 bits (132),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 37/62 (60%), Gaps = 4/62 (6%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLL  253
             LFVLL   +      SSS   Q LD + +LPG   NV F  YSGYVTVN+E+GRALF  
Sbjct  9    FLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAGRALFYW  64

Query  254  VL  259
             +
Sbjct  65   FI  66



>ref|XP_010516783.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=454

 Score =   157 bits (397),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 88/110 (80%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAVE--DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E+    +P SKPLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY
Sbjct  58   GRALFYWLTESPPSLNPESKPLVLWLNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPY  117

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            SWN  ANLLF++SPAGVG+SYSNT+SD+ T GDKRTAED+  FL+ WFER
Sbjct  118  SWNQLANLLFLESPAGVGFSYSNTTSDLYTAGDKRTAEDAYVFLVNWFER  167


 Score = 51.6 bits (122),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            D+Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALF
Sbjct  25   DEQEKDRIYHLPGEPNDVSFSHFSGYITVNEPAGRALF  62



>emb|CAN75200.1| hypothetical protein VITISV_014887 [Vitis vinifera]
Length=524

 Score =   167 bits (423),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 94/136 (69%), Gaps = 28/136 (21%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA EDPSSKPLVLWLNGGPGCSSIA+G +EE+GPFH+++DGKTLY NPYSW
Sbjct  63   GRALFYWFIEAAEDPSSKPLVLWLNGGPGCSSIAYGQSEEIGPFHIKEDGKTLYLNPYSW  122

Query  414  N----------------------------LAANLLFVDSPAGVGYSYSNTSSDILTHGDK  509
            N                              AN+LF+DSP GVG+SYSNTSSD+ T+GD 
Sbjct  123  NQDIDLQVKVYMFRRNNDVRFSIAERISITIANILFLDSPVGVGFSYSNTSSDVSTNGDI  182

Query  510  RTAEDSLEFLLKWFER  557
            RTA+DSL FLLKW ER
Sbjct  183  RTAKDSLAFLLKWLER  198


 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 46/77 (60%), Gaps = 1/77 (1%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSS-VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  226
            M +L W  +L +L     ++    SS  + QQ+LD V  LPG  FN+SFAHYSGYVTVN+
Sbjct  1    MLSLKWVFVLQILFTLIYLNTPASSSDPLVQQRLDKVQHLPGQAFNISFAHYSGYVTVNE  60

Query  227  ESGRALFLLVL*GCGGP  277
             SGRALF   +     P
Sbjct  61   NSGRALFYWFIEAAEDP  77



>ref|XP_002315292.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF01463.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=460

 Score =   159 bits (401),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 87/110 (79%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA     P S+PLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY
Sbjct  59   GRALFYWLVEAPTSRRPESRPLVLWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNPY  118

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  ANLLF++SPAGVG+SYSNTSSD+ T GD+RTAED+  FL+ WFER
Sbjct  119  AWNKLANLLFLESPAGVGFSYSNTSSDLYTAGDQRTAEDAYTFLVNWFER  168


 Score = 49.3 bits (116),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 40/69 (58%), Gaps = 5/69 (7%)
 Frame = +2

Query  53   SALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  232
            S LS  CLL  L + + I      + ++ Q  D +  LPG   +V F  YSGYVTVNQ+S
Sbjct  4    SLLSILCLLVSLFVYSCI-----CAPLEDQGRDKITYLPGQPGSVEFNQYSGYVTVNQQS  58

Query  233  GRALFLLVL  259
            GRALF  ++
Sbjct  59   GRALFYWLV  67



>gb|KHN17121.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=459

 Score =   153 bits (386),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 86/110 (78%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA     P S+ LVLWLNGGPGCSSIA+G +EE+GPFH+  DGK+LY NPY
Sbjct  59   GRSLFYWLVEAPVRRGPRSRSLVLWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNPY  118

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  AN+LF+DSPAGVG+SYSN S+D+ T GD++TAED+  FL+ WFER
Sbjct  119  AWNNLANVLFLDSPAGVGFSYSNKSTDLYTFGDQKTAEDAYTFLVNWFER  168


 Score = 54.7 bits (130),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            +S ++ QK D +  LPG   NV FA YSGYVTVN++SGR+LF  ++
Sbjct  22   ASPIEDQKRDRITQLPGQPKNVGFAQYSGYVTVNEQSGRSLFYWLV  67



>ref|XP_010264739.1| PREDICTED: serine carboxypeptidase-like 27 [Nelumbo nucifera]
Length=458

 Score =   155 bits (393),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 89/113 (79%), Gaps = 2/113 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYW  EA     P S+PLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTL++
Sbjct  57   QQAGRALFYWLTEAPASRRPESRPLVLWLNGGPGCSSVAYGAAEEIGPFRIHPDGKTLFF  116

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            NPY+WN  AN+LF++SPAGVG+SYSNTSSD+ T GD+RTAED+  F++ WFER
Sbjct  117  NPYAWNNLANILFLESPAGVGFSYSNTSSDLYTAGDQRTAEDAYTFIVNWFER  169


 Score = 52.4 bits (124),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            +S +  Q+ D + +LPG   NV FA YSGYVTV+Q++GRALF
Sbjct  23   TSPLQDQERDKITELPGQPTNVGFAQYSGYVTVDQQAGRALF  64



>ref|XP_002312023.1| hypothetical protein POPTR_0008s04130g [Populus trichocarpa]
 gb|EEE89390.1| hypothetical protein POPTR_0008s04130g [Populus trichocarpa]
Length=466

 Score =   157 bits (398),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 87/110 (79%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAVE--DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA +   P SKPLVLWLNGGPGCSS+A+G +EEVGPF V  DG+TL+ NPY
Sbjct  66   GRALFYWLIEAPKTVKPRSKPLVLWLNGGPGCSSVAYGASEEVGPFRVRPDGETLHLNPY  125

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  ANLLF+DSPAGVG+SYSNTSSDI T GD+RTAED+  FL+ W ER
Sbjct  126  AWNKVANLLFLDSPAGVGFSYSNTSSDIYTVGDERTAEDAYTFLINWLER  175


 Score = 50.1 bits (118),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 40/74 (54%), Gaps = 4/74 (5%)
 Frame = +2

Query  50   MSALSWGCLLFVLL----LATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVT  217
            M   S  C LF +L    L  S         +++Q+ D ++ LPG   NVSF+ +SGY+T
Sbjct  1    MRIKSSSCFLFSVLNFAILLLSTPAVTTHDHLEEQRRDRIMKLPGQPPNVSFSQFSGYIT  60

Query  218  VNQESGRALFLLVL  259
            V+   GRALF  ++
Sbjct  61   VDPVEGRALFYWLI  74



>ref|XP_011040962.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=468

 Score =   159 bits (402),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 86/110 (78%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E   +  P SKPL+LWLNGGPGCSS+A+G +EEVGPF V  DGKTL+ NPY
Sbjct  68   GRALFYWLIEVPKIVKPKSKPLILWLNGGPGCSSVAYGASEEVGPFRVRPDGKTLHLNPY  127

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  ANLLF+DSPAGVG+SYSNTSSD  T GDKRTA+D+  FL+ WFER
Sbjct  128  AWNKVANLLFLDSPAGVGFSYSNTSSDTYTVGDKRTAKDAYTFLVNWFER  177


 Score = 48.5 bits (114),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 40/65 (62%), Gaps = 3/65 (5%)
 Frame = +2

Query  74   LLFVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            LL+VL LAT   S         +++Q+ D ++ L G   NVSF+ +SGY+TV+  +GRAL
Sbjct  12   LLYVLNLATLLLSTIAATNHGHLEEQRRDKIIKLHGQPPNVSFSQFSGYITVDPLAGRAL  71

Query  245  FLLVL  259
            F  ++
Sbjct  72   FYWLI  76



>ref|XP_007009790.1| Serine carboxypeptidase-like 28 [Theobroma cacao]
 gb|EOY18600.1| Serine carboxypeptidase-like 28 [Theobroma cacao]
Length=464

 Score =   161 bits (408),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 87/110 (79%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  +A     P+SKPLVLWLNGGPGCSS+A+G +EEVGPF V  DGKTL  NPY
Sbjct  60   GRALFYWLIKAPFKSQPASKPLVLWLNGGPGCSSVAYGASEEVGPFRVRSDGKTLRLNPY  119

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  ANLLF+DSPAGVG+SYSNTSSDI T GDKRTAED+  FL+KW ER
Sbjct  120  AWNQEANLLFLDSPAGVGFSYSNTSSDIYTVGDKRTAEDAYTFLIKWLER  169


 Score = 46.2 bits (108),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  119  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            G +   +Q+ D ++ LPG    V+F+ YSGY+TV+ ++GRALF  ++
Sbjct  22   GGNHRKEQERDRIVKLPGQPPKVNFSQYSGYITVDPKAGRALFYWLI  68



>gb|KFK38250.1| hypothetical protein AALP_AA3G088900 [Arabis alpina]
Length=461

 Score =   149 bits (377),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 84/110 (76%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E+     P S+PLVLWLNGGPGCSS+A+G AEE+GPF V  DGKTLY   Y
Sbjct  62   GRALFYWLVESPLTRVPKSRPLVLWLNGGPGCSSVAYGAAEEIGPFRVGSDGKTLYSKLY  121

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  ANLLF++SPAGVG+SY+NT+SD+   GD+RTAEDS  FL+ WFER
Sbjct  122  AWNKLANLLFLESPAGVGFSYTNTTSDLYITGDQRTAEDSYRFLVNWFER  171


 Score = 58.2 bits (139),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  116  KGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
              S+ V++QK D +++LPG   N+ F  YSGY+TVNQE GRALF  ++
Sbjct  23   NASTYVEEQKRDRIIELPGQPSNIDFRQYSGYITVNQEHGRALFYWLV  70



>ref|XP_007009788.1| Serine carboxypeptidase-like 27 isoform 2 [Theobroma cacao]
 gb|EOY18598.1| Serine carboxypeptidase-like 27 isoform 2 [Theobroma cacao]
Length=423

 Score =   155 bits (391),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 86/110 (78%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E      P ++PLVLWLNGGPGCSS+A+G AEE+GPFH+  DG+TLY N Y
Sbjct  58   GRALFYWLIELPVSRSPETRPLVLWLNGGPGCSSLAYGAAEEIGPFHIRPDGRTLYLNRY  117

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  AN+LF++SPAGVG+SYSNT+SD+ T GD+RTAED+  FL+ WFER
Sbjct  118  AWNNLANMLFLESPAGVGFSYSNTTSDLYTAGDRRTAEDAYAFLVNWFER  167


 Score = 52.8 bits (125),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  125  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            SS   Q LD + +LPG   NV F  YSGYVTVN+++GRALF  ++
Sbjct  22   SSFGDQNLDKITELPGQPKNVEFNQYSGYVTVNEQAGRALFYWLI  66



>ref|XP_004142401.1| PREDICTED: serine carboxypeptidase-like 27-like [Cucumis sativus]
 ref|XP_004157517.1| PREDICTED: serine carboxypeptidase-like 27-like [Cucumis sativus]
 gb|KGN52285.1| hypothetical protein Csa_5G623490 [Cucumis sativus]
Length=455

 Score =   157 bits (397),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 90/113 (80%), Gaps = 2/113 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYW  E      P+S+PLVLWLNGGPGCSS+A+G AEE+GPFH++ DG+TLY 
Sbjct  54   KQAGRALFYWLTETPTSRVPNSRPLVLWLNGGPGCSSVAYGAAEEIGPFHIKPDGRTLYL  113

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            NPY+WN  ANLLF++SPAGVG+SYSNT+SD+ T GD++TAED+  FL+ WFER
Sbjct  114  NPYAWNKLANLLFLESPAGVGFSYSNTTSDLYTAGDQKTAEDAHRFLVNWFER  166


 Score = 50.1 bits (118),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
              ++ LL + +    GS + +Q++ D +  LPG   NV FA YSGYVTV++++GRALF
Sbjct  5    FFYLCLLLSLVAISYGSYNAEQER-DRITQLPGQPKNVDFAQYSGYVTVDKQAGRALF  61



>ref|XP_009141517.1| PREDICTED: serine carboxypeptidase-like 28 [Brassica rapa]
Length=469

 Score =   160 bits (404),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA +   +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  NPY+W
Sbjct  72   GRALFYWLTEAPKPSDTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNPYAW  131

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            NL ANLLF+DSPAGVG+SY+NTSSD LT GDKRT ED+  FL++W ER
Sbjct  132  NLEANLLFLDSPAGVGFSYTNTSSDELTVGDKRTGEDAYRFLVRWMER  179


 Score = 47.4 bits (111),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSS--SVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            C+  + ++   +D    SS  + +Q+  D +L LPG   N++F+ +SGYVTVN  +GRAL
Sbjct  16   CIFLLSMIIALLDVVMSSSEDAKEQKMRDRILSLPGQPPNLNFSQFSGYVTVNSAAGRAL  75

Query  245  F  247
            F
Sbjct  76   F  76



>ref|XP_006407773.1| hypothetical protein EUTSA_v10020705mg [Eutrema salsugineum]
 gb|ESQ49226.1| hypothetical protein EUTSA_v10020705mg [Eutrema salsugineum]
Length=456

 Score =   150 bits (380),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 85/110 (77%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E  A  DP S+PLVLWLNGGPGCSS+A+G AEE+GPF V  DGKTL+   Y
Sbjct  57   GRALFYWLVESPATRDPKSRPLVLWLNGGPGCSSVAYGAAEEIGPFRVGSDGKTLHPKLY  116

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  ANLLF++SPAGVG+SY+NT+SD+ T GD+RTAED+  FL+ W ER
Sbjct  117  AWNKLANLLFLESPAGVGFSYTNTTSDLYTTGDQRTAEDAYRFLVNWLER  166


 Score = 56.2 bits (134),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  119  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
             SS V++QK D + +LPG   NV F  YSGY+TVN+E GRALF  ++
Sbjct  19   ASSYVEEQKRDRISELPGQPSNVDFRQYSGYITVNEERGRALFYWLV  65



>ref|XP_007009787.1| Serine carboxypeptidase-like 27 isoform 1 [Theobroma cacao]
 gb|EOY18597.1| Serine carboxypeptidase-like 27 isoform 1 [Theobroma cacao]
Length=552

 Score =   154 bits (389),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 86/110 (78%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E      P ++PLVLWLNGGPGCSS+A+G AEE+GPFH+  DG+TLY N Y
Sbjct  121  GRALFYWLIELPVSRSPETRPLVLWLNGGPGCSSLAYGAAEEIGPFHIRPDGRTLYLNRY  180

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  AN+LF++SPAGVG+SYSNT+SD+ T GD+RTAED+  FL+ WFER
Sbjct  181  AWNNLANMLFLESPAGVGFSYSNTTSDLYTAGDRRTAEDAYAFLVNWFER  230


 Score = 52.8 bits (125),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  125  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            SS   Q LD + +LPG   NV F  YSGYVTVN+++GRALF  ++
Sbjct  85   SSFGDQNLDKITELPGQPKNVEFNQYSGYVTVNEQAGRALFYWLI  129



>ref|XP_003556225.1| PREDICTED: serine carboxypeptidase-like 27-like isoform 1 [Glycine 
max]
 gb|KHN00830.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=460

 Score =   152 bits (384),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 86/110 (78%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA     P S+ LVLWLNGGPGCSSIA+G +EE+GPFH+  DGK+LY NPY
Sbjct  60   GRSLFYWLVEAPVRRGPRSRSLVLWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNPY  119

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  AN+LF+DSPAGVG+SYSN ++D+ T GD++TAED+  FL+ WFER
Sbjct  120  AWNNLANVLFLDSPAGVGFSYSNKTTDLYTFGDQKTAEDAYTFLVNWFER  169


 Score = 54.3 bits (129),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            +S ++ QK D +  LPG   NV FA YSGYVTVN++SGR+LF  ++
Sbjct  23   ASPIEDQKKDRITQLPGQPKNVGFAQYSGYVTVNEQSGRSLFYWLV  68



>ref|XP_008368824.1| PREDICTED: serine carboxypeptidase-like 27 [Malus domestica]
Length=455

 Score =   160 bits (404),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 90/113 (80%), Gaps = 2/113 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            R  G   FYW  E+ E+  P S+PLVLWLNGGPGCSS+A+G AEE+G FH+  DGKTLY 
Sbjct  54   RKAGRALFYWLTESPENRQPESRPLVLWLNGGPGCSSVAYGAAEEIGAFHIRPDGKTLYL  113

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            NPY+WN  ANLLF++SPAGVG+SY+NTSSD+ T GD+RTAED+  FL+ WFER
Sbjct  114  NPYAWNNLANLLFLESPAGVGFSYTNTSSDLYTAGDQRTAEDAYAFLVNWFER  166


 Score = 46.6 bits (109),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = +2

Query  125  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            +S+  Q  D +  LPG   NV FA YSGYVTVN+++GRALF
Sbjct  22   ASIQDQVRDRITQLPGQP-NVGFAQYSGYVTVNRKAGRALF  61



>ref|XP_010669644.1| PREDICTED: serine carboxypeptidase-like 27 [Beta vulgaris subsp. 
vulgaris]
Length=456

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            +S G   FYW  E+  +P +KPLVLWLNGGPGCSSIA+G AEE+GPFH++ DGKTL+ NP
Sbjct  54   KSAGRTLFYWLTESPSNPETKPLVLWLNGGPGCSSIAYGAAEEIGPFHIQSDGKTLFLNP  113

Query  405  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            YSWN  ANLLF++SPAGVG+SYSN SSD+ T GD RTA+DS +FL++WF R
Sbjct  114  YSWNNEANLLFLESPAGVGFSYSNRSSDLYTVGDSRTAKDSYKFLVRWFNR  164



>ref|XP_008446902.1| PREDICTED: serine carboxypeptidase-like 27 [Cucumis melo]
Length=457

 Score =   157 bits (398),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 91/113 (81%), Gaps = 2/113 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYW  E      P+S+PLVLWLNGGPGCSS+A+G AEE+GPFH++ DG+TLY 
Sbjct  56   KQAGRALFYWLTETPTSRVPNSRPLVLWLNGGPGCSSVAYGAAEEIGPFHIKPDGRTLYL  115

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            NPY+WN  ANLLF++SPAGVG+SYSNT+SD+ T GD++TAED+ +FL+ WFER
Sbjct  116  NPYAWNKLANLLFLESPAGVGFSYSNTTSDLYTAGDQKTAEDAHKFLVNWFER  168


 Score = 48.9 bits (115),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  119  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            GS + +Q++ D +  LPG   NV FA YSGYVTV++++GRALF
Sbjct  22   GSYNAEQER-DRITQLPGQPKNVDFAQYSGYVTVDKQAGRALF  63



>gb|KJB76571.1| hypothetical protein B456_012G095000 [Gossypium raimondii]
Length=472

 Score =   160 bits (405),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 87/110 (79%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA     P +KPLVLWLNGGPGCSSIA+G +EEVGPF V +DGK+L  NPY
Sbjct  68   GRALFYWLTEAPAKSRPETKPLVLWLNGGPGCSSIAYGASEEVGPFRVREDGKSLRLNPY  127

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  ANLLF+DSPAGVG+SYSNTSSDI T GDKRTAED+  FL+KW ER
Sbjct  128  AWNQEANLLFLDSPAGVGFSYSNTSSDIYTAGDKRTAEDAYTFLMKWLER  177


 Score = 45.8 bits (107),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            L++ L++ + +          +Q  D ++ LPG   NV F+ YSGY+TV  ++GRALF
Sbjct  15   LVYFLVIGSLVVWSAEGGHRKEQARDRIVKLPGQPRNVKFSQYSGYITVEAKAGRALF  72



>gb|AFK37459.1| unknown [Lotus japonicus]
Length=463

 Score =   155 bits (393),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA   P +KPLVLWLNGGPGCSS+A+G +EE+GPF + K G +L+ N Y+W
Sbjct  63   GRALFYWFTEATTSPQNKPLVLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLFLNKYAW  122

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF++SPAGVG+SY+NTSSD+ T GDKRTA+D+L FLL+W  R
Sbjct  123  NKEANILFLESPAGVGFSYTNTSSDLTTSGDKRTAQDALIFLLRWMAR  170


 Score = 50.4 bits (119),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +2

Query  68   GCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            G LLF+  L  S      SS   +Q+LD +  LPG    V+FA +SGYVTVN+E GRALF
Sbjct  9    GLLLFLCALIFSFSCILASSVPKEQELDRISALPGQP-PVTFAQFSGYVTVNEEHGRALF  67



>emb|CDY40439.1| BnaA04g20780D [Brassica napus]
Length=469

 Score =   159 bits (402),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  NPY+W
Sbjct  72   GRALFYWLTEAPTPSDTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNPYAW  131

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            NL ANLLF+DSPAGVG+SY+NTSSD LT GDKRT ED+  FL++W ER
Sbjct  132  NLDANLLFLDSPAGVGFSYTNTSSDELTVGDKRTGEDAYRFLVRWMER  179


 Score = 47.0 bits (110),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSS--SVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            C+  + ++   +D    SS  + +Q+  D +L LPG   N++F+ +SGYVTVN  +GRAL
Sbjct  16   CIFLLSMIIALLDVVMSSSEDAKEQKMRDRILSLPGQPPNLNFSQFSGYVTVNSAAGRAL  75

Query  245  F  247
            F
Sbjct  76   F  76



>gb|EYU39591.1| hypothetical protein MIMGU_mgv1a009171mg [Erythranthe guttata]
Length=350

 Score =   157 bits (398),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 87/110 (79%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA  +  P S+PLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY N Y
Sbjct  63   GRALFYWLTEAPTNRGPDSRPLVLWLNGGPGCSSVAYGAAEEIGPFRINSDGKTLYSNSY  122

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            SWN  ANLLF++SPAGVGYSYSNTSSD+ T GD+RTAED+  FL+ WFER
Sbjct  123  SWNKLANLLFLESPAGVGYSYSNTSSDLYTVGDQRTAEDAYAFLVNWFER  172


 Score = 48.5 bits (114),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 35/59 (59%), Gaps = 1/59 (2%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            C + +L L   +  G    + DQ+  D +  LPG   N+ F  YSGYVTVNQ+SGRALF
Sbjct  10   CSICLLWLNLFVGIGYSLYNADQEN-DRITYLPGQPENIGFDQYSGYVTVNQQSGRALF  67



>ref|XP_009147009.1| PREDICTED: serine carboxypeptidase-like 27 isoform X1 [Brassica 
rapa]
Length=459

 Score =   152 bits (384),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 85/110 (77%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E+    DP S+PLVLWLNGGPGCSS+A+G  EEVGPF V  DGKTLY   Y
Sbjct  60   GRALFYWLVESPTTRDPKSRPLVLWLNGGPGCSSVAYGATEEVGPFRVGSDGKTLYNKLY  119

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  ANLLF++SPAGVG+SY+N++SD+ T GD+RTAEDS  FL+ WFER
Sbjct  120  AWNKLANLLFLESPAGVGFSYTNSTSDLYTTGDQRTAEDSYRFLVNWFER  169


 Score = 52.8 bits (125),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            V++QK D +  LPG   NV F  YSGYVTVN++ GRALF  ++
Sbjct  26   VEEQKRDRITQLPGQPSNVDFRQYSGYVTVNEQRGRALFYWLV  68



>ref|XP_009147010.1| PREDICTED: serine carboxypeptidase-like 27 isoform X2 [Brassica 
rapa]
Length=450

 Score =   152 bits (383),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 85/110 (77%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E+    DP S+PLVLWLNGGPGCSS+A+G  EEVGPF V  DGKTLY   Y
Sbjct  60   GRALFYWLVESPTTRDPKSRPLVLWLNGGPGCSSVAYGATEEVGPFRVGSDGKTLYNKLY  119

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  ANLLF++SPAGVG+SY+N++SD+ T GD+RTAEDS  FL+ WFER
Sbjct  120  AWNKLANLLFLESPAGVGFSYTNSTSDLYTTGDQRTAEDSYRFLVNWFER  169


 Score = 53.1 bits (126),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            V++QK D +  LPG   NV F  YSGYVTVN++ GRALF  ++
Sbjct  26   VEEQKRDRITQLPGQPSNVDFRQYSGYVTVNEQRGRALFYWLV  68



>ref|XP_011031766.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=466

 Score =   154 bits (390),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 86/110 (78%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA  +  P SKPLVLWLNGGPGCSS+A+G +EEVGPF V  DG+TL+ NPY
Sbjct  66   GRALFYWLNEAPKIVKPRSKPLVLWLNGGPGCSSVAYGASEEVGPFRVRPDGETLHLNPY  125

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  ANLLF+DSPAGVG+SYSNTSSD+ T GD RTA+D+  FL+ W ER
Sbjct  126  AWNKVANLLFLDSPAGVGFSYSNTSSDVYTVGDGRTAKDAYTFLINWLER  175


 Score = 50.4 bits (119),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 39/70 (56%), Gaps = 4/70 (6%)
 Frame = +2

Query  50   MSALSWGCLLF-VLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVT  217
            M   S  C LF VL  AT   S         +++Q+ D ++ LPG   NVSF+ +SGY+T
Sbjct  1    MRIKSSSCFLFSVLNFATLLLSTPAVTNHDHLEEQRRDRIIKLPGQPPNVSFSQFSGYIT  60

Query  218  VNQESGRALF  247
            V+   GRALF
Sbjct  61   VDPVEGRALF  70



>emb|CDY35977.1| BnaA05g29730D [Brassica napus]
Length=459

 Score =   152 bits (383),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 86/110 (78%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E+    DP S+PLVLWLNGGPGCSS+A+G AEEVGPF V  DGKTL+   Y
Sbjct  60   GRALFYWLVESPTTRDPKSRPLVLWLNGGPGCSSVAYGAAEEVGPFRVGSDGKTLHNKLY  119

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  ANLLF++SPAGVG+SY+N++SD+ T GD+RTAEDS  FL+ WFER
Sbjct  120  AWNKLANLLFLESPAGVGFSYTNSTSDLYTTGDQRTAEDSYRFLVNWFER  169


 Score = 52.8 bits (125),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            V++QK D +  LPG   NV F  YSGYVTVN++ GRALF  ++
Sbjct  26   VEEQKRDRITQLPGQPSNVDFRQYSGYVTVNEQRGRALFYWLV  68



>emb|CDY28004.1| BnaC05g44060D [Brassica napus]
Length=459

 Score =   151 bits (382),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 86/110 (78%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E+    DP S+PLVLWLNGGPGCSS+A+G AEEVGPF V  DGKTL+   Y
Sbjct  60   GRALFYWLVESPTTRDPKSRPLVLWLNGGPGCSSVAYGAAEEVGPFRVGSDGKTLHPKLY  119

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  ANLLF++SPAGVG+SY+N++SD+ T GD+RTAEDS  FL+ WFER
Sbjct  120  AWNKLANLLFLESPAGVGFSYTNSTSDLYTTGDQRTAEDSYRFLVNWFER  169


 Score = 52.8 bits (125),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            V++QK D +  LPG   NV F  YSGYVTVN++ GRALF  ++
Sbjct  26   VEEQKRDRITQLPGQPSNVDFRQYSGYVTVNEQRGRALFYWLV  68



>gb|ACA61622.1| hypothetical protein AP7_B10.2 [Arabidopsis lyrata subsp. petraea]
Length=200

 Score =   156 bits (394),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G + FYW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF +  DGKTL  N Y+W
Sbjct  49   GRNLFYWLTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEVGPFRINPDGKTLRLNLYAW  108

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+DSPAGVG+SY+NTSSD LT GDKRT ED+  FL++W ER
Sbjct  109  NKVANVLFLDSPAGVGFSYTNTSSDKLTVGDKRTGEDAYRFLVRWMER  156



>ref|XP_008381976.1| PREDICTED: serine carboxypeptidase-like 27 [Malus domestica]
Length=455

 Score =   162 bits (410),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 108/166 (65%), Gaps = 15/166 (9%)
 Frame = +3

Query  87   FSWPPVLMVGKGLLLWISKNWTQSWICQ-------GLASMSALHTILGM*L*TRSLGEHF  245
            F++P +L++  G      ++  +  I Q       G A  S   T+       R  G   
Sbjct  7    FAFPCILLLFLGGCFASVQDQVRDRITQLPGQPTVGFAQYSGYVTV------NRKAGRAL  60

Query  246  FYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNL  419
            FYW  E  A   P S+PL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPY+WN 
Sbjct  61   FYWLTESPANRRPESRPLMLWLNGGPGCSSVAYGAAEEIGPFHIRPDGKTLYLNPYAWNN  120

Query  420  AANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
             ANLLF++SPAGVG+SY+NTSSD+ T GD+RTAED+  FL+ WFER
Sbjct  121  LANLLFLESPAGVGFSYTNTSSDLYTAGDQRTAEDAYAFLVNWFER  166



>ref|XP_009333715.1| PREDICTED: serine carboxypeptidase-like 27 [Pyrus x bretschneideri]
Length=455

 Score =   162 bits (410),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 108/166 (65%), Gaps = 15/166 (9%)
 Frame = +3

Query  87   FSWPPVLMVGKGLLLWISKNWTQSWICQ-------GLASMSALHTILGM*L*TRSLGEHF  245
            F++P +L++  G      ++  +  I Q       G A  S   T+       R  G   
Sbjct  7    FAFPCILLLFLGGCFASVQDQVRDRITQLPGQPTVGFAQYSGYVTV------NRKAGRAL  60

Query  246  FYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNL  419
            FYW  E  A   P S+PL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPY+WN 
Sbjct  61   FYWLTESPANRRPESRPLMLWLNGGPGCSSVAYGAAEEIGPFHIRPDGKTLYLNPYAWNN  120

Query  420  AANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
             ANLLF++SPAGVG+SY+NTSSD+ T GD+RTAED+  FL+ WFER
Sbjct  121  LANLLFLESPAGVGFSYTNTSSDLYTAGDQRTAEDAYAFLVNWFER  166



>ref|XP_010460785.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=457

 Score =   152 bits (383),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 86/110 (78%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E+    DP S+PLVLWLNGGPGCSS+A+G AEE+GPF V  DGKTL+   Y
Sbjct  58   GRALFYWLVESPLTRDPKSRPLVLWLNGGPGCSSVAYGGAEEIGPFRVGSDGKTLHPKLY  117

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  ANLLF+++PAGVG+SYSNTSSD+ T GD+RTAEDS  FL+ WFER
Sbjct  118  AWNKLANLLFLEAPAGVGFSYSNTSSDLYTTGDQRTAEDSYRFLVNWFER  167


 Score = 52.4 bits (124),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 37/62 (60%), Gaps = 0/62 (0%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLL  253
             L ++LL T       SS V++Q  D +  LPG   NV F  YSGYVTVN+E GRALF  
Sbjct  5    FLVIILLFTISSSWSASSYVEEQLRDRISKLPGQPSNVDFRQYSGYVTVNEERGRALFYW  64

Query  254  VL  259
            ++
Sbjct  65   LV  66



>gb|EPS66906.1| hypothetical protein M569_07869, partial [Genlisea aurea]
Length=410

 Score =   155 bits (393),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 87/112 (78%), Gaps = 2/112 (2%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            + G   FYW  EA  D  P S+PL+LWLNGGPGCSSIA+G AEE+GPF +  +GKTLY N
Sbjct  53   TAGRALFYWLTEASVDSVPDSRPLLLWLNGGPGCSSIAYGAAEEIGPFRINSNGKTLYLN  112

Query  402  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
             YSWN   NLLF++SPAGVGYSYSNTSSD+ T GD+RTAEDS  FL+ WFE+
Sbjct  113  SYSWNKLVNLLFLESPAGVGYSYSNTSSDLYTAGDRRTAEDSYAFLVSWFEK  164


 Score = 48.5 bits (114),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            S SV  Q+ D +  LPG   N++F  YSGYVTVN  +GRALF
Sbjct  18   SWSVQDQESDRITYLPGQPENIAFNQYSGYVTVNHTAGRALF  59



>emb|CBI31484.3| unnamed protein product [Vitis vinifera]
Length=483

 Score =   155 bits (392),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 88/110 (80%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA +   P+S+PL+LWLNGGPGCSS+A+G +EEVGPF V  DGKTL+ NPY
Sbjct  79   GRALFYWLIEAPKSRGPASRPLILWLNGGPGCSSVAYGASEEVGPFRVRPDGKTLHLNPY  138

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  ANLLF+DSPAGVG+SYSNTSSD+   GDKRTA+D+ +FL+ W +R
Sbjct  139  AWNAEANLLFLDSPAGVGFSYSNTSSDLPNVGDKRTAKDAYKFLINWLQR  188


 Score = 48.9 bits (115),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 40/64 (63%), Gaps = 4/64 (6%)
 Frame = +2

Query  71   CLL-FVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            C+L F +LL +S   G  + + + Q  D ++ LPG   NV F+ YSGY+TV+  +GRALF
Sbjct  27   CVLGFFILLVSS---GATAGNREDQVRDRIVKLPGEPPNVGFSQYSGYITVDPRAGRALF  83

Query  248  LLVL  259
              ++
Sbjct  84   YWLI  87



>ref|XP_002274699.1| PREDICTED: serine carboxypeptidase-like 28 [Vitis vinifera]
Length=472

 Score =   155 bits (391),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 88/110 (80%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA +   P+S+PL+LWLNGGPGCSS+A+G +EEVGPF V  DGKTL+ NPY
Sbjct  68   GRALFYWLIEAPKSRGPASRPLILWLNGGPGCSSVAYGASEEVGPFRVRPDGKTLHLNPY  127

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  ANLLF+DSPAGVG+SYSNTSSD+   GDKRTA+D+ +FL+ W +R
Sbjct  128  AWNAEANLLFLDSPAGVGFSYSNTSSDLPNVGDKRTAKDAYKFLINWLQR  177


 Score = 48.9 bits (115),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 40/64 (63%), Gaps = 4/64 (6%)
 Frame = +2

Query  71   CLL-FVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            C+L F +LL +S   G  + + + Q  D ++ LPG   NV F+ YSGY+TV+  +GRALF
Sbjct  16   CVLGFFILLVSS---GATAGNREDQVRDRIVKLPGEPPNVGFSQYSGYITVDPRAGRALF  72

Query  248  LLVL  259
              ++
Sbjct  73   YWLI  76



>ref|XP_004307401.1| PREDICTED: serine carboxypeptidase-like 27 [Fragaria vesca subsp. 
vesca]
 ref|XP_011469671.1| PREDICTED: serine carboxypeptidase-like 27 [Fragaria vesca subsp. 
vesca]
Length=458

 Score =   162 bits (409),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 89/113 (79%), Gaps = 2/113 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYW  E  A   P S+PLVLWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY 
Sbjct  57   KQAGRALFYWLVESPAQRGPESRPLVLWLNGGPGCSSVAYGAAEEIGPFHIRPDGKTLYL  116

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            NPY+WN  ANLLF++SPAGVG+SYSNTSSD+ T GD+RTAED+  FL+ WFER
Sbjct  117  NPYAWNNLANLLFLESPAGVGFSYSNTSSDLYTAGDQRTAEDAYTFLVNWFER  169


 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            +SS+  Q  D +  LPG   NV F  YSGYVT N+++GRALF  ++
Sbjct  23   ASSIQDQVRDRITQLPGQPANVGFRQYSGYVTANKQAGRALFYWLV  68



>ref|NP_187456.1| serine carboxypeptidase-like 27 [Arabidopsis thaliana]
 sp|Q9SFB5.1|SCP27_ARATH RecName: Full=Serine carboxypeptidase-like 27; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF21209.1|AC013483_33 putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAT71955.1| At3g07990 [Arabidopsis thaliana]
 gb|AAU95440.1| At3g07990 [Arabidopsis thaliana]
 gb|AEE74628.1| serine carboxypeptidase-like 27 [Arabidopsis thaliana]
Length=459

 Score =   152 bits (384),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 86/110 (78%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E+    DP S+PLVLWLNGGPGCSS+A+G AEE+GPF V  DGKTL+   Y
Sbjct  60   GRALFYWLVESPLARDPKSRPLVLWLNGGPGCSSVAYGAAEEIGPFRVGSDGKTLHSKLY  119

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  ANLLF++SPAGVG+SYSNT+SD+ T GD+RTAEDS  FL+ WFER
Sbjct  120  AWNKLANLLFLESPAGVGFSYSNTTSDLYTTGDQRTAEDSYIFLVNWFER  169


 Score = 51.2 bits (121),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            SS V++Q  D + +LPG   NV F  YSGYVTV++E GRALF  ++
Sbjct  23   SSYVEEQLRDRISNLPGQPSNVDFRQYSGYVTVHEERGRALFYWLV  68



>ref|XP_006350225.1| PREDICTED: serine carboxypeptidase-like 27-like [Solanum tuberosum]
Length=456

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 90/113 (80%), Gaps = 2/113 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYW  E+    +P  +PLVLWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY 
Sbjct  55   QQAGRALFYWLIESPSNRNPEKRPLVLWLNGGPGCSSVAYGAAEEIGPFHINADGKTLYL  114

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            NPYSWN  ANLLF++SPAGVG+SY+NTSSD+   GD+RTAED+ +FL+KWFER
Sbjct  115  NPYSWNNLANLLFLESPAGVGFSYTNTSSDLYDAGDQRTAEDTYQFLIKWFER  167


 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLL  253
            L +V+ L+    G   S S  +Q+ D +  LPG   NV F+ YSGYVTVNQ++GRALF  
Sbjct  5    LCYVIFLSFLFVGSCYSFSNVEQENDRITYLPGQPENVQFSQYSGYVTVNQQAGRALFYW  64

Query  254  VL  259
            ++
Sbjct  65   LI  66



>ref|XP_010464446.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=459

 Score =   152 bits (385),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 86/110 (78%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E+    DP S+PLVLWLNGGPGCSS+A+G AEE+GPF V  DGKTL+   Y
Sbjct  60   GRALFYWLVESPLTRDPKSRPLVLWLNGGPGCSSVAYGGAEEIGPFRVGSDGKTLHPKLY  119

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  ANLLF++SPAGVG+SYSNTSSD+ T GD+RTAEDS  FL+ WFER
Sbjct  120  AWNKLANLLFLESPAGVGFSYSNTSSDLYTTGDQRTAEDSYRFLVNWFER  169


 Score = 50.1 bits (118),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            V++Q  D +  LPG   NV F  YSGYVTVN+E GRALF  ++
Sbjct  26   VEEQLRDRISKLPGQPSNVDFRQYSGYVTVNEERGRALFYWLV  68



>emb|CDO99730.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 91/113 (81%), Gaps = 2/113 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYWF E  A   P S+PL+LWLNGGPGCSS+A+G  EE+GPF V+ DGKTL++
Sbjct  59   KKAGRALFYWFIESPASRAPESRPLLLWLNGGPGCSSVAYGATEEIGPFRVKPDGKTLFF  118

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            NPYSWN  ANLLFV+SPAGVG+SYSNTSSD+ T GD+RTAED+  FL++WFER
Sbjct  119  NPYSWNKLANLLFVESPAGVGFSYSNTSSDLYTAGDQRTAEDAYTFLVQWFER  171


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (62%), Gaps = 1/63 (2%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQ-QKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFL  250
            L FV++L   +  G   S ++Q Q+ D +  LPG   NV F  YSGYVTVN+++GRALF 
Sbjct  8    LFFVVVLPLFLLFGTCYSRINQDQERDRIKSLPGQPANVDFDQYSGYVTVNKKAGRALFY  67

Query  251  LVL  259
              +
Sbjct  68   WFI  70



>ref|XP_010486379.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=459

 Score =   152 bits (385),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 86/110 (78%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E+    DP S+PLVLWLNGGPGCSS+A+G AEE+GPF V  DGKTL+   Y
Sbjct  60   GRALFYWLVESPLTRDPKSRPLVLWLNGGPGCSSVAYGGAEEIGPFRVGSDGKTLHPKLY  119

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  ANLLF++SPAGVG+SYSNTSSD+ T GD+RTAEDS  FL+ WFER
Sbjct  120  AWNKLANLLFLESPAGVGFSYSNTSSDLYTTGDQRTAEDSYRFLVSWFER  169


 Score = 50.1 bits (118),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            V++Q  D +  LPG   NV F  YSGYVTVN+E GRALF  ++
Sbjct  26   VEEQLRDRISKLPGQPSNVDFRQYSGYVTVNEERGRALFYWLV  68



>gb|AES62200.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=491

 Score =   145 bits (367),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 85/110 (77%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA     P+S+PLVLWLNGGPGCSSIA+G +EE+GPF +  DGK+L+ N Y
Sbjct  59   GRALFYWLIEAPLNRGPNSRPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLFLNRY  118

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  AN+LF+DSPAGVG+SY N ++D+ T GD++TAED+  FL+ WFER
Sbjct  119  AWNNLANILFLDSPAGVGFSYCNKTTDLYTFGDQKTAEDAYIFLVNWFER  168


 Score = 56.6 bits (135),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 2/66 (3%)
 Frame = +2

Query  68   GCLLFVLLLATSI--DGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRA  241
            G  +F ++L  SI   G   +SS++ QK D +  LPG   NV F  YSGYVTVN++SGRA
Sbjct  2    GYSIFYIVLFVSIFCVGISLASSIEDQKRDKIRQLPGQPKNVGFEQYSGYVTVNEQSGRA  61

Query  242  LFLLVL  259
            LF  ++
Sbjct  62   LFYWLI  67



>ref|XP_003591950.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES62201.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=459

 Score =   145 bits (367),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 85/110 (77%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA     P+S+PLVLWLNGGPGCSSIA+G +EE+GPF +  DGK+L+ N Y
Sbjct  59   GRALFYWLIEAPLNRGPNSRPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLFLNRY  118

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  AN+LF+DSPAGVG+SY N ++D+ T GD++TAED+  FL+ WFER
Sbjct  119  AWNNLANILFLDSPAGVGFSYCNKTTDLYTFGDQKTAEDAYIFLVNWFER  168


 Score = 56.6 bits (135),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 2/66 (3%)
 Frame = +2

Query  68   GCLLFVLLLATSI--DGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRA  241
            G  +F ++L  SI   G   +SS++ QK D +  LPG   NV F  YSGYVTVN++SGRA
Sbjct  2    GYSIFYIVLFVSIFCVGISLASSIEDQKRDKIRQLPGQPKNVGFEQYSGYVTVNEQSGRA  61

Query  242  LFLLVL  259
            LF  ++
Sbjct  62   LFYWLI  67



>ref|XP_003591949.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 ref|XP_003638560.1| Serine carboxypeptidase-like protein [Medicago truncatula]
Length=461

 Score =   145 bits (367),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 85/110 (77%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA     P+S+PLVLWLNGGPGCSSIA+G +EE+GPF +  DGK+L+ N Y
Sbjct  59   GRALFYWLIEAPLNRGPNSRPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLFLNRY  118

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  AN+LF+DSPAGVG+SY N ++D+ T GD++TAED+  FL+ WFER
Sbjct  119  AWNNLANILFLDSPAGVGFSYCNKTTDLYTFGDQKTAEDAYIFLVNWFER  168


 Score = 56.2 bits (134),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 2/66 (3%)
 Frame = +2

Query  68   GCLLFVLLLATSI--DGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRA  241
            G  +F ++L  SI   G   +SS++ QK D +  LPG   NV F  YSGYVTVN++SGRA
Sbjct  2    GYSIFYIVLFVSIFCVGISLASSIEDQKRDKIRQLPGQPKNVGFEQYSGYVTVNEQSGRA  61

Query  242  LFLLVL  259
            LF  ++
Sbjct  62   LFYWLI  67



>ref|XP_010067291.1| PREDICTED: serine carboxypeptidase-like 28 [Eucalyptus grandis]
 gb|KCW65387.1| hypothetical protein EUGRSUZ_G02817 [Eucalyptus grandis]
Length=467

 Score =   160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 87/112 (78%), Gaps = 2/112 (2%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVE--DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            S G   FYW  E      P+SKPLVLWLNGGPGCSS+A+G +EEVGPF V  +GKTLY N
Sbjct  63   SAGRALFYWLIEVPRHLRPASKPLVLWLNGGPGCSSVAYGASEEVGPFRVRPNGKTLYLN  122

Query  402  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            PY+WN  ANLLF+DSPAGVG+SYSNTSSD+ T GDKRTA+D+  FL+ W ER
Sbjct  123  PYAWNREANLLFLDSPAGVGFSYSNTSSDVYTPGDKRTAQDAFTFLMNWLER  174


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            QQK D ++ LPG   NV+F+ Y+GYVTV+  +GRALF  ++
Sbjct  33   QQKKDKIVKLPGQPANVTFSQYAGYVTVDPSAGRALFYWLI  73



>ref|XP_004236634.1| PREDICTED: serine carboxypeptidase-like 27 [Solanum lycopersicum]
Length=456

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 90/113 (80%), Gaps = 2/113 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYW  E+    +P  +PLVLWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY 
Sbjct  55   QQAGRALFYWLIESPSTRNPEKRPLVLWLNGGPGCSSVAYGAAEEIGPFHINADGKTLYL  114

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            NPYSWN  ANLLF++SPAGVG+SY+NT+SD+   GD+RTAED+ +F++KWFER
Sbjct  115  NPYSWNNLANLLFLESPAGVGFSYTNTTSDLYDAGDQRTAEDTYQFVIKWFER  167


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 38/62 (61%), Gaps = 0/62 (0%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLL  253
            L +V+ L+    G   S    +Q+ D +  LPG   NV F+ YSGYVTVNQ++GRALF  
Sbjct  5    LCYVMFLSFLFVGSCYSFYNVEQENDRITYLPGQPENVQFSQYSGYVTVNQQAGRALFYW  64

Query  254  VL  259
            ++
Sbjct  65   LI  66



>ref|XP_002312024.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEE89391.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=460

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 89/113 (79%), Gaps = 2/113 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYW  EA     P S+PLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY+
Sbjct  56   QQAGRALFYWLVEAPTSRSPESRPLVLWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYF  115

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            NPY+WN  ANLLF++SPAGVG+SYSNTSSD+ T GD+RTAED+  FL+ WFER
Sbjct  116  NPYAWNKLANLLFLESPAGVGFSYSNTSSDLYTAGDQRTAEDAYTFLVNWFER  168


 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  125  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            S ++ Q+ D +  LPG   NV F  YSGYVTVNQ++GRALF  ++
Sbjct  23   SPLEDQQRDKITSLPGQPVNVEFNQYSGYVTVNQQAGRALFYWLV  67



>ref|XP_008233341.1| PREDICTED: serine carboxypeptidase-like 27 [Prunus mume]
 ref|XP_008233342.1| PREDICTED: serine carboxypeptidase-like 27 [Prunus mume]
Length=455

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 96/131 (73%), Gaps = 8/131 (6%)
 Frame = +3

Query  171  GLASMSALHTILGM*L*TRSLGEHFFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGL  344
            G A  S   T+       +  G   FYW  E+ ++  P S+PLVLWLNGGPGCSS+A+G 
Sbjct  42   GFAQFSGYVTV------NKKAGRALFYWLIESPKNRGPESRPLVLWLNGGPGCSSVAYGA  95

Query  345  AEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAED  524
            AEE+GPF +  DGKTLY NPY+WN  ANLLF++SPAGVG+SYSNT++D+ T+GD+RTAED
Sbjct  96   AEEIGPFRIRPDGKTLYLNPYTWNNLANLLFLESPAGVGFSYSNTTTDLYTNGDQRTAED  155

Query  525  SLEFLLKWFER  557
            +  FL+ WFER
Sbjct  156  AYAFLINWFER  166



>ref|NP_181120.2| serine carboxypeptidase-like 28 [Arabidopsis thaliana]
 sp|Q8S8K6.2|SCP28_ARATH RecName: Full=Serine carboxypeptidase-like 28; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEC09159.1| serine carboxypeptidase-like 28 [Arabidopsis thaliana]
Length=462

 Score =   152 bits (385),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  N Y+W
Sbjct  64   GRALFYWLTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNLYAW  123

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+DSPAGVG+SY+NTSSD LT GDKRT ED+  FL++W ER
Sbjct  124  NKVANVLFLDSPAGVGFSYTNTSSDELTVGDKRTGEDAYRFLVRWLER  171


 Score = 48.5 bits (114),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 36/59 (61%), Gaps = 5/59 (8%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            C++  LL   S D  K     +Q+  D ++ LPG   N++F+ +SGYVTV+  +GRALF
Sbjct  15   CMVIALLDVVSSDDAK-----EQKMKDKIISLPGQPPNLNFSQFSGYVTVDPAAGRALF  68



>ref|XP_011040963.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=460

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 89/113 (79%), Gaps = 2/113 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYW  EA     P S+PLVLWLNGGPGCSS+A+G AEE+GPF + +DGKTLY 
Sbjct  56   KQSGRALFYWLVEAPTSRRPESRPLVLWLNGGPGCSSVAYGAAEEIGPFRIRRDGKTLYS  115

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            NPY+WN  ANLLF++SPAGVG+SYSNTSSD+ T GD+RTAED+  FL+ WFER
Sbjct  116  NPYAWNKLANLLFLESPAGVGFSYSNTSSDLYTAGDQRTAEDAYTFLVNWFER  168



>ref|XP_010505097.1| PREDICTED: serine carboxypeptidase-like 28 [Camelina sativa]
Length=469

 Score =   153 bits (387),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 85/110 (77%), Gaps = 0/110 (0%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            + G   FYW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF +  DGKTL +N Y
Sbjct  66   TAGRALFYWLTEAPRPSDTKPLVLWLNGGPGCSSIAYGASEEVGPFRINPDGKTLRFNIY  125

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  AN+LF+DSPAGVG+SY+NTSSD LT GDKRT ED+  FL++W ER
Sbjct  126  AWNKVANVLFLDSPAGVGFSYTNTSSDELTVGDKRTGEDAYRFLVRWMER  175


 Score = 48.1 bits (113),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 36/61 (59%), Gaps = 2/61 (3%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVD--QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            C+  V ++   +D    S   D  Q+  D ++ LPG   N++F+ +SGYVTV+  +GRAL
Sbjct  12   CMFLVCMMIALLDVVSSSDDADKEQKTKDKIISLPGQPPNLNFSQFSGYVTVDSTAGRAL  71

Query  245  F  247
            F
Sbjct  72   F  72



>emb|CDP11023.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   160 bits (405),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            S G+ FFYWF E+ EDPSSKPL LWLNGGP CSSIAFG AEE+GPF    DGK++Y NPY
Sbjct  82   SAGKAFFYWFVESAEDPSSKPLALWLNGGPACSSIAFGEAEEIGPFRPTADGKSVYLNPY  141

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  AN++FV+SPAG G+SYSNTSSD+   GD+ T +D+L F+L W ER
Sbjct  142  AWNQVANIIFVESPAGTGFSYSNTSSDLYNTGDRSTGKDNLAFILGWLER  191


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 39/63 (62%), Gaps = 3/63 (5%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGPFF*ASCSL  301
            +  + +QKLD VL LPG  FN+SFAHYSGY+TVN  +G+A F   +     P   +S  L
Sbjct  47   ADKIIEQKLDQVLKLPGQNFNLSFAHYSGYITVNASAGKAFFYWFVESAEDP---SSKPL  103

Query  302  AQW  310
            A W
Sbjct  104  ALW  106



>ref|XP_010258045.1| PREDICTED: serine carboxypeptidase-like 25 [Nelumbo nucifera]
Length=471

 Score =   155 bits (391),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EAV +P SKPLV+WLNGGPGCSS+A+G +EE+GPF + K G  LY N +SW
Sbjct  67   GRALFYWLTEAVHEPLSKPLVVWLNGGPGCSSVAYGASEEIGPFRLNKSGSGLYLNKFSW  126

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  ANLLF+++PAGVG+SYSN SSD+L  GD+RTA+DSLEFL++W  R
Sbjct  127  NTVANLLFLETPAGVGFSYSNRSSDLLDTGDRRTAKDSLEFLIRWLGR  174


 Score = 46.2 bits (108),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 36/58 (62%), Gaps = 3/58 (5%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            +LF  LL  S+    G+ +  +++ D +  LPG    VSF  +SGYVTVNQ +GRALF
Sbjct  17   VLFAFLLLVSVGASHGAGA--EEEADRIKALPGQP-KVSFQQFSGYVTVNQVAGRALF  71



>ref|XP_009399563.1| PREDICTED: serine carboxypeptidase 24-like [Musa acuminata subsp. 
malaccensis]
Length=458

 Score =   152 bits (383),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EAV D + KPLVLWLNGGPGCSS+A+G +EE+GPF +++ G +LY N +SW
Sbjct  57   GRALFYWLTEAVTDAAKKPLVLWLNGGPGCSSVAYGASEEIGPFRIDRTGSSLYLNKFSW  116

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  ANLLF++SPAGVG+SY+N SSD+ + GD+RTA+D+L FL++W  R
Sbjct  117  NREANLLFLESPAGVGFSYANVSSDLQSVGDERTAQDALAFLIRWMSR  164


 Score = 49.3 bits (116),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = +2

Query  125  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            ++ D+Q LD +  LPG    VSFA ++GYVTVNQE GRALF
Sbjct  22   AAADRQALDRISALPGQP-RVSFAQFAGYVTVNQERGRALF  61



>emb|CBI21207.3| unnamed protein product [Vitis vinifera]
Length=471

 Score =   155 bits (391),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EAV DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SW
Sbjct  67   GRALFYWLNEAVHDPLSKPLVIWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNKFSW  126

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  ANLLF+++PAGVG+SYSN SSD+L  GD+RTA+DSL FL++W ER
Sbjct  127  NTLANLLFLETPAGVGFSYSNKSSDLLDTGDRRTAKDSLVFLVRWLER  174


 Score = 45.8 bits (107),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 37/61 (61%), Gaps = 4/61 (7%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSV---DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            LL +LL+A    G  G + V   ++++ D +  LPG    VSF  YSGYVTVN  +GRAL
Sbjct  12   LLSLLLIAVVDAGSHGVNGVRGGEEEEADRITALPGQP-KVSFQQYSGYVTVNHVAGRAL  70

Query  245  F  247
            F
Sbjct  71   F  71



>ref|XP_011469672.1| PREDICTED: serine carboxypeptidase-like 27 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=455

 Score =   159 bits (403),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 88/113 (78%), Gaps = 2/113 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYW  E  A   P S+PLVLWL GGPGCSS+A+G AEE+GPFH+  DGKTLY 
Sbjct  57   KQAGRALFYWLVESPAQRGPESRPLVLWLTGGPGCSSVAYGAAEEIGPFHIRPDGKTLYL  116

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            NPY+WN  ANLLF++SPAGVG+SY+NTSSD+ T GD+RTAED+  FL+ WFER
Sbjct  117  NPYAWNNLANLLFLESPAGVGFSYTNTSSDLYTAGDQRTAEDAYTFLVNWFER  169


 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            +SS+  Q  D +  LPG   NV F  YSGYVT N+++GRALF  ++
Sbjct  23   ASSIQDQVRDRITQLPGQPANVGFRQYSGYVTANKQAGRALFYWLV  68



>ref|XP_002280058.1| PREDICTED: serine carboxypeptidase-like 25 [Vitis vinifera]
Length=473

 Score =   155 bits (391),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EAV DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SW
Sbjct  69   GRALFYWLNEAVHDPLSKPLVIWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNKFSW  128

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  ANLLF+++PAGVG+SYSN SSD+L  GD+RTA+DSL FL++W ER
Sbjct  129  NTLANLLFLETPAGVGFSYSNKSSDLLDTGDRRTAKDSLVFLVRWLER  176


 Score = 45.8 bits (107),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 37/62 (60%), Gaps = 4/62 (6%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSV---DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRA  241
             LL +LL+A    G  G + V   ++++ D +  LPG    VSF  YSGYVTVN  +GRA
Sbjct  13   VLLSLLLIAVVDAGSHGVNGVRGGEEEEADRITALPGQP-KVSFQQYSGYVTVNHVAGRA  71

Query  242  LF  247
            LF
Sbjct  72   LF  73



>ref|XP_011031767.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=460

 Score =   159 bits (403),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 89/113 (79%), Gaps = 2/113 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYW  EA     P ++PLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY+
Sbjct  56   QQAGRALFYWLVEAPTSRSPEARPLVLWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYF  115

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            NPY+WN  ANLLF++SPAGVG+SYSNTSSD+ T GD+RTAED+  FL+ WFER
Sbjct  116  NPYAWNKLANLLFLESPAGVGFSYSNTSSDLYTAGDQRTAEDAYTFLVNWFER  168


 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  125  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            S ++ Q+ D +  LPG   NV F  YSGYVTVNQ++GRALF  ++
Sbjct  23   SPLEDQQRDKITSLPGQPVNVEFNQYSGYVTVNQQAGRALFYWLV  67



>ref|XP_006297634.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
 gb|EOA30532.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
Length=434

 Score =   151 bits (381),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 85/110 (77%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E+     P S+PLVLWLNGGPGCSS+A+G AEE+GPF V  DGKTL+   Y
Sbjct  63   GRALFYWLVESPLTRSPKSRPLVLWLNGGPGCSSVAYGAAEEIGPFRVGSDGKTLHPKLY  122

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  ANLLF++SPAGVG+SYSNT+SD+ T GD+RTAEDS  FL+ WFER
Sbjct  123  AWNKLANLLFLESPAGVGFSYSNTTSDLYTTGDQRTAEDSYRFLVNWFER  172


 Score = 49.3 bits (116),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            V++Q  D + +LPG   NV F  YSGYVTVN++ GRALF  ++
Sbjct  29   VEEQLRDRISELPGQPSNVDFRQYSGYVTVNEKRGRALFYWLV  71



>ref|XP_009386999.1| PREDICTED: serine carboxypeptidase-like 27 [Musa acuminata subsp. 
malaccensis]
Length=474

 Score =   156 bits (394),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA       PLVLWLNGGPGCSSIA+G +EE+GPF ++ DGKTLY NPY+W
Sbjct  75   GRALFYWLVEAPPSAQPAPLVLWLNGGPGCSSIAYGASEELGPFRIDSDGKTLYLNPYAW  134

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+DSPAGVG+SY+NTSSD+ T GD RTA D+  FL+KWFER
Sbjct  135  NTVANVLFLDSPAGVGFSYTNTSSDLHTSGDHRTAVDAYNFLVKWFER  182


 Score = 44.3 bits (103),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 28/45 (62%), Gaps = 1/45 (2%)
 Frame = +2

Query  125  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            S  +QQ+ D V  LPG    V FA YSGYVTV   +GRALF  ++
Sbjct  40   SPAEQQEQDRVARLPGQP-RVDFAQYSGYVTVEARAGRALFYWLV  83



>ref|XP_004307399.1| PREDICTED: serine carboxypeptidase-like 27 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=458

 Score =   159 bits (402),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 88/113 (78%), Gaps = 2/113 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYW  E  A   P S+PLVLWL GGPGCSS+A+G AEE+GPFH+  DGKTLY 
Sbjct  57   KQAGRALFYWLVESPAQRGPESRPLVLWLTGGPGCSSVAYGAAEEIGPFHIRPDGKTLYL  116

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            NPY+WN  ANLLF++SPAGVG+SY+NTSSD+ T GD+RTAED+  FL+ WFER
Sbjct  117  NPYAWNNLANLLFLESPAGVGFSYTNTSSDLYTAGDQRTAEDAYTFLVNWFER  169


 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            +SS+  Q  D +  LPG   NV F  YSGYVT N+++GRALF  ++
Sbjct  23   ASSIQDQVRDRITQLPGQPANVGFRQYSGYVTANKQAGRALFYWLV  68



>ref|XP_006297635.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
 gb|EOA30533.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
Length=460

 Score =   150 bits (380),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 85/110 (77%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E+     P S+PLVLWLNGGPGCSS+A+G AEE+GPF V  DGKTL+   Y
Sbjct  61   GRALFYWLVESPLTRSPKSRPLVLWLNGGPGCSSVAYGAAEEIGPFRVGSDGKTLHPKLY  120

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  ANLLF++SPAGVG+SYSNT+SD+ T GD+RTAEDS  FL+ WFER
Sbjct  121  AWNKLANLLFLESPAGVGFSYSNTTSDLYTTGDQRTAEDSYRFLVNWFER  170


 Score = 49.7 bits (117),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            V++Q  D + +LPG   NV F  YSGYVTVN++ GRALF  ++
Sbjct  27   VEEQLRDRISELPGQPSNVDFRQYSGYVTVNEKRGRALFYWLV  69



>gb|KDP25725.1| hypothetical protein JCGZ_23946 [Jatropha curcas]
Length=456

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 90/113 (80%), Gaps = 2/113 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYW  E  A   P S+PLVLWLNGGPGCSS+A+G AEE+GPF ++ DGKTL++
Sbjct  55   QQAGRALFYWLIESPASRGPESRPLVLWLNGGPGCSSVAYGAAEEIGPFRIKPDGKTLFF  114

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            NPY+WN  ANLLF++SPAGVG+SYSNT+SD+ T GD+RTAEDS  FL+ WFER
Sbjct  115  NPYAWNKLANLLFLESPAGVGFSYSNTTSDLYTAGDQRTAEDSYAFLVNWFER  167


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            SS+++ Q+ D +  LPG   NV F  YSGYVTVNQ++GRALF  ++
Sbjct  21   SSTLEDQERDKITYLPGQPTNVEFNQYSGYVTVNQQAGRALFYWLI  66



>gb|ABR16028.1| unknown [Picea sitchensis]
Length=479

 Score =   148 bits (374),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 85/110 (77%), Gaps = 0/110 (0%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            S G   FYWFFEA +  S KPLVLWLNGGPGCSS+ +G A+E+GPF V+ +G  L  N Y
Sbjct  67   SHGRALFYWFFEAEDKSSKKPLVLWLNGGPGCSSVGYGAAQELGPFQVKTNGTGLSLNTY  126

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            SWN  ANLLF++SP GVG+SY+NTSSD+L   D+ TAEDS EFLL+WF+R
Sbjct  127  SWNKEANLLFLESPVGVGFSYTNTSSDLLELNDQFTAEDSYEFLLRWFKR  176


 Score = 51.2 bits (121),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 37/59 (63%), Gaps = 4/59 (7%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            C+ F+ +L  + D   G ++   Q+ D V +LPG     SFAHY+GY+TVN+  GRALF
Sbjct  19   CIYFLFMLVVNGDHKDGLTA---QQADRVYNLPGQP-KASFAHYAGYITVNESHGRALF  73



>ref|XP_010032541.1| PREDICTED: serine carboxypeptidase-like 25 [Eucalyptus grandis]
 gb|KCW51926.1| hypothetical protein EUGRSUZ_J01381 [Eucalyptus grandis]
Length=520

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA  DPSSKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SW
Sbjct  112  GRALFYWLTEAYSDPSSKPLVVWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNKFSW  171

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  ANLLF+++PAGVG+SYSN SSD+L  GD+RTAEDSLEFL++W ER
Sbjct  172  NTEANLLFLETPAGVGFSYSNRSSDLLDTGDRRTAEDSLEFLVRWMER  219



>ref|XP_006294164.1| hypothetical protein CARUB_v10023157mg [Capsella rubella]
 gb|EOA27062.1| hypothetical protein CARUB_v10023157mg [Capsella rubella]
Length=464

 Score =   153 bits (386),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            + G   FYW  EA     +KPLVLWLNGGPGCSSIA+G +EE+GPF V  DGKTL  N Y
Sbjct  64   TAGRALFYWLTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEIGPFRVNPDGKTLRLNIY  123

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  AN+LF+DSPAGVG+SY+NTSSD LT GDKRT ED+  FL++W ER
Sbjct  124  AWNKVANVLFLDSPAGVGFSYTNTSSDELTVGDKRTGEDAYRFLVRWMER  173


 Score = 46.6 bits (109),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 39/61 (64%), Gaps = 7/61 (11%)
 Frame = +2

Query  71   CLLFVLL--LATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            C++  LL  +++S DG K      Q+  D ++ LPG   N++F+ +SGYVTV+  +GRAL
Sbjct  15   CMVIALLDQVSSSDDGDKV-----QKMKDKIISLPGQPPNLNFSQFSGYVTVDSTAGRAL  69

Query  245  F  247
            F
Sbjct  70   F  70



>gb|AFK43035.1| unknown [Medicago truncatula]
Length=459

 Score =   143 bits (360),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 84/110 (76%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA     P+S+PLVLWLNGGPGCSSIA+G +EE+GPF +  DGK+L+ N Y
Sbjct  59   GRALFYWLIEAPLNRGPNSRPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLFLNRY  118

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  AN+LF+DSPAGVG+SY N ++D+ T GD++TAE +  FL+ WFER
Sbjct  119  AWNNLANILFLDSPAGVGFSYCNKTTDLYTFGDQKTAEGAYIFLVNWFER  168


 Score = 56.6 bits (135),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 2/66 (3%)
 Frame = +2

Query  68   GCLLFVLLLATSI--DGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRA  241
            G  +F ++L  SI   G   +SS++ QK D +  LPG   NV F  YSGYVTVN++SGRA
Sbjct  2    GYSIFYIVLFVSIFCVGISLASSIEDQKRDKIRQLPGQPKNVGFEQYSGYVTVNEQSGRA  61

Query  242  LFLLVL  259
            LF  ++
Sbjct  62   LFYWLI  67



>ref|XP_010253608.1| PREDICTED: serine carboxypeptidase-like 27 [Nelumbo nucifera]
Length=458

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 89/113 (79%), Gaps = 2/113 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYW  EA  +  P S+PLVLWLNGGPGCSS+A+G AEE+GPFH+  DGKTL+ 
Sbjct  57   QQAGRALFYWLVEAPANRRPESRPLVLWLNGGPGCSSVAYGAAEEIGPFHIRSDGKTLFL  116

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            NPY+WN  ANLLF++SPAGVG+SYSNTSSD+ T GD+RTAED+  FL+ W ER
Sbjct  117  NPYAWNNLANLLFLESPAGVGFSYSNTSSDLYTAGDQRTAEDAYAFLVNWIER  169


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            SS +  Q+ D ++ LPG   NV F+ YSGYVTVNQ++GRALF  ++
Sbjct  23   SSPLQDQERDRIIQLPGQPNNVGFSQYSGYVTVNQQAGRALFYWLV  68



>ref|XP_010260054.1| PREDICTED: serine carboxypeptidase-like 25 isoform X2 [Nelumbo 
nucifera]
Length=421

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EAV+DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + + G  LY N +SW
Sbjct  58   GRALFYWLTEAVQDPVSKPLVVWLNGGPGCSSVAYGASEEIGPFRLNRSGSGLYINKFSW  117

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N+ ANLLF+++PAGVG+SY+N SSD+L  GD+RTA+DSLEFL++W +R
Sbjct  118  NILANLLFLETPAGVGFSYTNRSSDLLDTGDQRTAKDSLEFLIRWLDR  165



>ref|XP_002882565.1| hypothetical protein ARALYDRAFT_478140 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58824.1| hypothetical protein ARALYDRAFT_478140 [Arabidopsis lyrata subsp. 
lyrata]
Length=456

 Score =   150 bits (380),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 85/110 (77%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E+    DP  +PLVLWLNGGPGCSS+A+G AEE+GPF V  DGKTL+   Y
Sbjct  57   GRALFYWLVESPSTRDPKFRPLVLWLNGGPGCSSVAYGAAEEIGPFRVGSDGKTLHPKLY  116

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  ANLLF++SPAGVG+SYSNT+SD+ T GD+RTAEDS  FL+ WFER
Sbjct  117  AWNQLANLLFLESPAGVGFSYSNTTSDLYTTGDQRTAEDSYRFLVNWFER  166


 Score = 48.1 bits (113),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +2

Query  119  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
             +S V++Q  D +  LPG   NV F  YSGYVTVN+  GRALF  ++
Sbjct  19   NASYVEEQLRDRISKLPGQPSNVDFRQYSGYVTVNEVRGRALFYWLV  65



>gb|KCW65386.1| hypothetical protein EUGRSUZ_G02816 [Eucalyptus grandis]
Length=467

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 89/113 (79%), Gaps = 2/113 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            R  G   FYW  E  A   P S+PLVLWLNGGPGCSS+A+GLAEE+GPF +  DGKTLY 
Sbjct  66   RQAGRALFYWLVESPASRRPESRPLVLWLNGGPGCSSVAYGLAEEIGPFRIRPDGKTLYS  125

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            NPY+W+  ANLLF++SPAG+G+SY+NT+SD+ T GD+RTAED+  FL+ WFER
Sbjct  126  NPYAWSKLANLLFLESPAGIGFSYTNTTSDLYTTGDQRTAEDAYAFLVNWFER  178



>ref|XP_010067290.1| PREDICTED: serine carboxypeptidase-like 27 [Eucalyptus grandis]
Length=528

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 89/113 (79%), Gaps = 2/113 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            R  G   FYW  E  A   P S+PLVLWLNGGPGCSS+A+GLAEE+GPF +  DGKTLY 
Sbjct  127  RQAGRALFYWLVESPASRRPESRPLVLWLNGGPGCSSVAYGLAEEIGPFRIRPDGKTLYS  186

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            NPY+W+  ANLLF++SPAG+G+SY+NT+SD+ T GD+RTAED+  FL+ WFER
Sbjct  187  NPYAWSKLANLLFLESPAGIGFSYTNTTSDLYTTGDQRTAEDAYAFLVNWFER  239



>ref|XP_006410746.1| hypothetical protein EUTSA_v10016610mg [Eutrema salsugineum]
 gb|ESQ52199.1| hypothetical protein EUTSA_v10016610mg [Eutrema salsugineum]
Length=465

 Score =   153 bits (386),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  N Y+W
Sbjct  70   GRALFYWLTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNIYAW  129

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+DSPAGVG+SY+NTSSD LT GDKRT ED+ +FL++W ER
Sbjct  130  NKVANVLFLDSPAGVGFSYTNTSSDELTVGDKRTGEDTYKFLVRWIER  177


 Score = 45.4 bits (106),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 37/60 (62%), Gaps = 6/60 (10%)
 Frame = +2

Query  71   CLLFVLL-LATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            C++  LL + TS D  K     +Q+  D ++ LPG    ++F+ +SGYVTV+  +GRALF
Sbjct  20   CMVIALLDVVTSSDDAK-----EQKMKDKIISLPGQPPQLNFSQFSGYVTVDSAAGRALF  74



>ref|XP_003591947.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES62198.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=458

 Score =   146 bits (369),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 85/110 (77%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA     P+SKPLVLWLNGGPGCSSIA+G +EE+GPF +  DGK+LY NPY
Sbjct  59   GRALFYWLTEAPLSHGPNSKPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLYLNPY  118

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  AN+LF++SPAGVG+SY N ++D+   GD++TAED+  FL+ WFER
Sbjct  119  AWNNLANILFLESPAGVGFSYCNKTTDMQNFGDQKTAEDAYIFLVNWFER  168


 Score = 52.0 bits (123),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +2

Query  83   VLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            VL L     G   +SS+ +QK D +  LPG    V F  YSGYVTVN+ESGRALF
Sbjct  9    VLFLTIFCVGISLASSIKEQKRDKIKWLPGQPKIVGFEQYSGYVTVNEESGRALF  63



>ref|XP_004496292.1| PREDICTED: serine carboxypeptidase-like 27-like isoform X1 [Cicer 
arietinum]
Length=462

 Score =   148 bits (374),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 86/107 (80%), Gaps = 2/107 (2%)
 Frame = +3

Query  243  FFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  416
             FYW  E+  +  P+ +PLVLWLNGGPGCSSIA+G +EE+GPFH+  DGK+LY NPY+WN
Sbjct  64   LFYWLIESPMNRGPNLRPLVLWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNPYAWN  123

Query  417  LAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
              AN+LF+DSPAGVG+SY N ++D+ T GD++TAED+  FL+ WFER
Sbjct  124  NLANILFLDSPAGVGFSYCNKTTDLYTFGDQKTAEDAYVFLVNWFER  170


 Score = 49.7 bits (117),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            S+S++ Q+ D +  LPG   NV F  YSGYVTVN+E+ RALF  ++
Sbjct  24   SASMEDQRRDKIKLLPGQPKNVGFEQYSGYVTVNEENERALFYWLI  69



>ref|XP_004496293.1| PREDICTED: serine carboxypeptidase-like 27-like isoform X2 [Cicer 
arietinum]
Length=419

 Score =   148 bits (374),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 86/107 (80%), Gaps = 2/107 (2%)
 Frame = +3

Query  243  FFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  416
             FYW  E+  +  P+ +PLVLWLNGGPGCSSIA+G +EE+GPFH+  DGK+LY NPY+WN
Sbjct  64   LFYWLIESPMNRGPNLRPLVLWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNPYAWN  123

Query  417  LAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
              AN+LF+DSPAGVG+SY N ++D+ T GD++TAED+  FL+ WFER
Sbjct  124  NLANILFLDSPAGVGFSYCNKTTDLYTFGDQKTAEDAYVFLVNWFER  170


 Score = 49.7 bits (117),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            S+S++ Q+ D +  LPG   NV F  YSGYVTVN+E+ RALF  ++
Sbjct  24   SASMEDQRRDKIKLLPGQPKNVGFEQYSGYVTVNEENERALFYWLI  69



>gb|KDP25724.1| hypothetical protein JCGZ_23945 [Jatropha curcas]
Length=467

 Score =   153 bits (387),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 85/110 (77%), Gaps = 2/110 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAVE--DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA +   P  KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL+ NPY
Sbjct  66   GRALFYWLTEAPKTVQPKLKPLVLWLNGGPGCSSIAYGASEEVGPFRVRPDGKTLHLNPY  125

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  ANLLF+DSPAGVG+SYSNTSSDI   GDKRTA+D+  FL+ W +R
Sbjct  126  AWNKEANLLFLDSPAGVGFSYSNTSSDISNVGDKRTAKDAYTFLVNWLKR  175


 Score = 44.7 bits (104),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            + +Q+ D ++ LPG   NV+F+ YSGY++V+  +GRALF
Sbjct  32   LKEQEKDRIIKLPGQPSNVNFSQYSGYISVDPVAGRALF  70



>ref|XP_002881413.1| hypothetical protein ARALYDRAFT_321290 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57672.1| hypothetical protein ARALYDRAFT_321290 [Arabidopsis lyrata subsp. 
lyrata]
Length=462

 Score =   152 bits (383),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G + FYW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  N Y+W
Sbjct  64   GRNLFYWLTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNLYAW  123

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+DSPAGVG+SY+NTSSD LT GDKR  ED+  FL++W ER
Sbjct  124  NKVANVLFLDSPAGVGFSYTNTSSDELTVGDKRAGEDAYRFLVRWMER  171


 Score = 45.8 bits (107),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 5/59 (8%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            C++  +L   S D  K     +Q+  D ++ LPG   N++F+ +SGYVTV+  +GR LF
Sbjct  15   CMVIAILDVVSSDDAK-----EQKMKDKIISLPGQPPNLNFSQFSGYVTVDSAAGRNLF  68



>ref|XP_010260044.1| PREDICTED: serine carboxypeptidase-like 25 isoform X1 [Nelumbo 
nucifera]
Length=462

 Score =   157 bits (398),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EAV+DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + + G  LY N +SW
Sbjct  58   GRALFYWLTEAVQDPVSKPLVVWLNGGPGCSSVAYGASEEIGPFRLNRSGSGLYINKFSW  117

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N+ ANLLF+++PAGVG+SY+N SSD+L  GD+RTA+DSLEFL++W +R
Sbjct  118  NILANLLFLETPAGVGFSYTNRSSDLLDTGDQRTAKDSLEFLIRWLDR  165



>gb|KDO48447.1| hypothetical protein CISIN_1g012819mg [Citrus sinensis]
Length=456

 Score =   157 bits (397),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 87/113 (77%), Gaps = 2/113 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYW  E  A   P S+PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY 
Sbjct  55   QQAGRALFYWLIESPASRKPESRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYL  114

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            NPYSWN  ANLLF++SPAGVG+SY+NT+SD+ T GD RTAED+  FL+ WFER
Sbjct  115  NPYSWNKLANLLFLESPAGVGFSYTNTTSDLYTAGDGRTAEDAYTFLVNWFER  167



>gb|KJB76564.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=333

 Score =   154 bits (390),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 87/113 (77%), Gaps = 2/113 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYW  E+     P S+PLVLWLNGGPGCSSIA+G AEE+GPF +  DGKTLY 
Sbjct  51   QQAGRALFYWLIESPVSRKPESRPLVLWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYL  110

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N Y+WN  AN+LF++SPAGVG+SY+NT+SD+ T GDKRTAED+  FL+ WFER
Sbjct  111  NRYAWNNLANVLFLESPAGVGFSYTNTTSDLYTTGDKRTAEDAYVFLVNWFER  163


 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            S+    Q LD + +LPG   NV F  YSGYVTVNQ++GRALF  ++
Sbjct  17   STCFGDQTLDKITELPGQPKNVGFNQYSGYVTVNQQAGRALFYWLI  62



>ref|XP_006436271.1| hypothetical protein CICLE_v10031497mg [Citrus clementina]
 ref|XP_006485878.1| PREDICTED: serine carboxypeptidase-like 27-like [Citrus sinensis]
 gb|ESR49511.1| hypothetical protein CICLE_v10031497mg [Citrus clementina]
Length=456

 Score =   157 bits (396),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 87/113 (77%), Gaps = 2/113 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYW  E  A   P S+PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY 
Sbjct  55   QQAGRALFYWLIESPASRKPESRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYL  114

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            NPYSWN  ANLLF++SPAGVG+SY+NT+SD+ T GD RTAED+  FL+ WFER
Sbjct  115  NPYSWNKLANLLFLESPAGVGFSYTNTTSDLYTAGDGRTAEDAYTFLVNWFER  167



>gb|AAM15112.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
Length=447

 Score =   152 bits (385),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  N Y+W
Sbjct  49   GRALFYWLTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNLYAW  108

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF+DSPAGVG+SY+NTSSD LT GDKRT ED+  FL++W ER
Sbjct  109  NKVANVLFLDSPAGVGFSYTNTSSDELTVGDKRTGEDAYRFLVRWLER  156


 Score = 45.1 bits (105),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 35/58 (60%), Gaps = 5/58 (9%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            ++  LL   S D  K     +Q+  D ++ LPG   N++F+ +SGYVTV+  +GRALF
Sbjct  1    MVIALLDVVSSDDAK-----EQKMKDKIISLPGQPPNLNFSQFSGYVTVDPAAGRALF  53



>ref|XP_010920885.1| PREDICTED: serine carboxypeptidase-like 27 [Elaeis guineensis]
Length=506

 Score =   157 bits (398),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA       PLVLWLNGGPGCSSIA+G +EE+GPF +  DGKTL+ NPY+W
Sbjct  81   GRALFYWFIEAPPATQPAPLVLWLNGGPGCSSIAYGASEEIGPFRIHPDGKTLFLNPYAW  140

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  ANLLF+DSPAGVG+SYSNTSSD+ T GD+RTA D+ +FLL WFER
Sbjct  141  NSEANLLFLDSPAGVGFSYSNTSSDLYTAGDQRTAIDAYKFLLNWFER  188



>ref|XP_010265559.1| PREDICTED: serine carboxypeptidase 24-like isoform X1 [Nelumbo 
nucifera]
Length=456

 Score =   153 bits (386),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA  DP +KPLVLWLNGGPGCSSIA+G +EE+GPF + KDG +LY N YSW
Sbjct  56   GRALFYWFTEATTDPQNKPLVLWLNGGPGCSSIAYGASEEIGPFRINKDGSSLYLNKYSW  115

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF++SPAGVG+SY+NTSS++   GD+RTA ++  F+++W  R
Sbjct  116  NKEANILFLESPAGVGFSYTNTSSELKHSGDRRTAREAFLFMVRWMTR  163


 Score = 44.3 bits (103),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 38/64 (59%), Gaps = 5/64 (8%)
 Frame = +2

Query  56   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  235
            A  W  +L +L ++     G G S+ +Q+ LD +  LPG    V+F+ YSGY+TV+   G
Sbjct  2    ASQWRTILMILFISLI---GVGESATEQE-LDRISALPGQP-QVTFSQYSGYITVDSTHG  56

Query  236  RALF  247
            RALF
Sbjct  57   RALF  60



>ref|XP_006850617.1| hypothetical protein AMTR_s00034p00161680 [Amborella trichopoda]
 gb|ERN12198.1| hypothetical protein AMTR_s00034p00161680 [Amborella trichopoda]
Length=461

 Score =   147 bits (370),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 85/111 (77%), Gaps = 0/111 (0%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            ++ G   FYW  E+   PS +PLVLWLNGGPGCSS+A+G AEE+GPFH+  DGK+L+ NP
Sbjct  61   QNAGRALFYWLTESPTRPSLRPLVLWLNGGPGCSSVAYGAAEELGPFHINPDGKSLFLNP  120

Query  405  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            Y+WN  AN+LF+DSPAGVG+SYSN+SSD+   GD +TA D+  FL+ W  R
Sbjct  121  YAWNKLANILFLDSPAGVGFSYSNSSSDLKHPGDNQTAADAYAFLVNWLGR  171


 Score = 50.1 bits (118),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNV-SFAHYSGYVTVNQESGRALF  247
            L+F+       +   G SS D Q+ D +++LPG   NV  F+ YSGYVTV+Q +GRALF
Sbjct  10   LMFLGFCLLIWEAEAGISSSDDQERDRIIELPGEPANVVDFSQYSGYVTVDQNAGRALF  68



>dbj|BAO04184.1| hypothetical protein [Delphinium grandiflorum]
Length=456

 Score =   150 bits (380),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA    ++ PL+LWLNGGPGCSSIA+G AEE+GPF +  +G+TL+ NPYSW
Sbjct  60   GRALFYWLVEAEAAAATAPLILWLNGGPGCSSIAYGSAEEIGPFRIHPNGRTLFSNPYSW  119

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  ANLLF+DSPAGVGYSY+NT+SD+ T GD+RTAEDS  FLL W ER
Sbjct  120  NKLANLLFLDSPAGVGYSYTNTTSDLYTTGDQRTAEDSYAFLLNWLER  167


 Score = 46.2 bits (108),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            + ++ D + +LPG   NV F+ YSGYVTV+Q++GRALF  ++
Sbjct  27   EDEEGDKISELPGQPGNVGFSQYSGYVTVDQDAGRALFYWLV  68



>emb|CDO99728.1| unnamed protein product [Coffea canephora]
Length=470

 Score =   150 bits (380),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 87/110 (79%), Gaps = 3/110 (3%)
 Frame = +3

Query  234  GEHFFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E  A E P +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  +PY
Sbjct  68   GRALFYWLIESPASEKPETKPLVLWLNGGPGCSSIAYGASEEVGPFRVSPDGKTLGLSPY  127

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  ANLLF+DSPAGVG+SYSNTS D++T GDKRTA+D+  FL +W+ER
Sbjct  128  AWNKVANLLFLDSPAGVGFSYSNTSFDMVT-GDKRTAKDAYNFLKRWYER  176


 Score = 46.2 bits (108),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
             Q+ D ++ LPG   N++F+ YSGYVTV++ +GRALF  ++
Sbjct  36   HQESDRIIRLPGQPANITFSQYSGYVTVDKIAGRALFYWLI  76



>gb|KJB76565.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=342

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 87/113 (77%), Gaps = 2/113 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYW  E+     P S+PLVLWLNGGPGCSSIA+G AEE+GPF +  DGKTLY 
Sbjct  51   QQAGRALFYWLIESPVSRKPESRPLVLWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYL  110

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N Y+WN  AN+LF++SPAGVG+SY+NT+SD+ T GDKRTAED+  FL+ WFER
Sbjct  111  NRYAWNNLANVLFLESPAGVGFSYTNTTSDLYTTGDKRTAEDAYVFLVNWFER  163


 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            S+    Q LD + +LPG   NV F  YSGYVTVNQ++GRALF  ++
Sbjct  17   STCFGDQTLDKITELPGQPKNVGFNQYSGYVTVNQQAGRALFYWLI  62



>ref|XP_010089631.1| Serine carboxypeptidase-like 25 [Morus notabilis]
 gb|EXB38102.1| Serine carboxypeptidase-like 25 [Morus notabilis]
Length=479

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = +3

Query  222  TRSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            +R  G   FYW  EAV +P S+PLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N
Sbjct  68   SRVAGRALFYWLTEAVHEPLSRPLVVWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLN  127

Query  402  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
             +SWN  ANLLF+++PAGVG+SYSN SSD+L  GD+RTA+DSLEFL++W +R
Sbjct  128  KFSWNTVANLLFLETPAGVGFSYSNRSSDLLDTGDRRTAKDSLEFLIRWLDR  179



>ref|XP_010509563.1| PREDICTED: serine carboxypeptidase-like 28 [Camelina sativa]
Length=467

 Score =   150 bits (380),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            + G   FYW  E      +KPLVLWLNGGPGCSSIA+G +EE+GPF +  DGKTL +N Y
Sbjct  66   TAGRALFYWLTETPRPSDTKPLVLWLNGGPGCSSIAYGASEEIGPFRINPDGKTLRFNIY  125

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  AN+LF+DSPAGVG+SY+NTSSD +T GDKRT ED+  FL++W ER
Sbjct  126  AWNKVANVLFLDSPAGVGFSYTNTSSDEVTVGDKRTGEDAYRFLVRWMER  175


 Score = 45.4 bits (106),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = +2

Query  71   CLLFVLLLATSID--GGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            C+L V ++   +D    +  ++ +Q+  D ++ LPG    ++F+ +SGYVTV+  +GRAL
Sbjct  12   CMLVVCMVIALVDVVSSRDDANKEQKIKDKIIALPGQPPKLNFSQFSGYVTVDSTAGRAL  71

Query  245  F  247
            F
Sbjct  72   F  72



>gb|EYU39590.1| hypothetical protein MIMGU_mgv1a0101821mg, partial [Erythranthe 
guttata]
Length=183

 Score =   149 bits (376),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 85/105 (81%), Gaps = 1/105 (1%)
 Frame = +3

Query  243  FFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLA  422
             FYWF EA + P SKPLVLWLNGGPGCSSIA+G +EEVGPF V  DG+TL  +  SWN  
Sbjct  63   LFYWFIEATKKPESKPLVLWLNGGPGCSSIAYGASEEVGPFRVGADGRTLSLSHTSWNKE  122

Query  423  ANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            ANL+F+DSPAGVG+SYSN SSD+ T GD+RTA+D+ +FL KWF+R
Sbjct  123  ANLVFLDSPAGVGFSYSNDSSDLKT-GDQRTAKDAYKFLTKWFQR  166



>ref|XP_007219592.1| hypothetical protein PRUPE_ppa023509mg, partial [Prunus persica]
 gb|EMJ20791.1| hypothetical protein PRUPE_ppa023509mg, partial [Prunus persica]
Length=397

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 88/107 (82%), Gaps = 2/107 (2%)
 Frame = +3

Query  243  FFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  416
             FYW  E+ ++  P S+PLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY+WN
Sbjct  2    LFYWLIESPKNRGPESRPLVLWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYLNPYTWN  61

Query  417  LAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
              ANLLF++SPAGVG+SYSNT++D+ T GD+RTAED+  FL+ WFER
Sbjct  62   NLANLLFLESPAGVGFSYSNTTTDLYTTGDQRTAEDAYAFLVNWFER  108



>ref|XP_010516781.1| PREDICTED: serine carboxypeptidase-like 28 [Camelina sativa]
Length=465

 Score =   151 bits (381),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            + G   FYW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  + Y
Sbjct  64   TAGRALFYWLTEAPSPSDTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNTDGKTLRLSIY  123

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +WN  AN+LF+DSPAGVG+SY+NTSSD LT GDKRT ED+  FL++W ER
Sbjct  124  AWNKVANVLFLDSPAGVGFSYTNTSSDELTVGDKRTGEDAYRFLVRWMER  173


 Score = 44.7 bits (104),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 37/61 (61%), Gaps = 2/61 (3%)
 Frame = +2

Query  71   CLLFVLLLATSID--GGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            C+L V ++   +D       ++ +Q+  D ++ LPG    ++F+ +SGYVTV+  +GRAL
Sbjct  10   CMLLVCMVIALLDVVSSSDDANKEQKMKDKIISLPGQPPKLNFSQFSGYVTVDSTAGRAL  69

Query  245  F  247
            F
Sbjct  70   F  70



>emb|CDY43258.1| BnaC05g48510D [Brassica napus]
Length=473

 Score =   148 bits (373),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA   P SKPLV+WLNGGPGCSS+A+G +EE+GPF + K G  LY N ++W
Sbjct  63   GRSLFYWLTEASHLPLSKPLVIWLNGGPGCSSVAYGASEEIGPFRIRKGGSGLYLNKFAW  122

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  ANLLF+++PAGVG+SY+N SSD+   GD RTA+DSL+FL+KW +R
Sbjct  123  NSIANLLFLEAPAGVGFSYTNRSSDLFNTGDIRTAKDSLQFLIKWLQR  170


 Score = 47.8 bits (112),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 36/63 (57%), Gaps = 5/63 (8%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSV----DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  238
            C+LF  L+A  I   +G S       Q + D +  LPG   NV+F  +SGYVTV + SGR
Sbjct  6    CVLFTTLMAILIMTSQGRSQAREGEKQAEADRITSLPGQP-NVTFEQFSGYVTVAKHSGR  64

Query  239  ALF  247
            +LF
Sbjct  65   SLF  67



>ref|XP_007032751.1| Serine carboxypeptidase-like 25 isoform 4 [Theobroma cacao]
 gb|EOY03677.1| Serine carboxypeptidase-like 25 isoform 4 [Theobroma cacao]
Length=363

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 85/111 (77%), Gaps = 0/111 (0%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            ++ G   FYW  EA  DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N 
Sbjct  59   KAAGRALFYWLTEAANDPLSKPLVIWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNK  118

Query  405  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +SWN  ANLLF+++PAGVG+SYSN SSD+   GD+RTA DSLEFL++W +R
Sbjct  119  FSWNNVANLLFLETPAGVGFSYSNHSSDLFDTGDRRTAMDSLEFLIRWLDR  169



>ref|XP_009414289.1| PREDICTED: serine carboxypeptidase-like 27 [Musa acuminata subsp. 
malaccensis]
Length=472

 Score =   147 bits (372),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA       PLVLWLNGGPGCSS+A+G +EE+GPF +  DGKTLY NPY+W
Sbjct  76   GRALFYWLVEAAPAAQPAPLVLWLNGGPGCSSVAYGASEELGPFRIRSDGKTLYLNPYAW  135

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF++SPAGVG+SYSNTSSD+ T GD RTA D+ +FL+ WFER
Sbjct  136  NTVANVLFLESPAGVGFSYSNTSSDLYTAGDNRTAADAYKFLVNWFER  183


 Score = 47.8 bits (112),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 36/59 (61%), Gaps = 1/59 (2%)
 Frame = +2

Query  83   VLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            +LLL  S+      +  +QQ+LD +  LPG    V FA YSGYVTV+  +GRALF  ++
Sbjct  27   LLLLVGSLAAAAACTPAEQQELDRIARLPGQP-PVDFAQYSGYVTVDARAGRALFYWLV  84



>gb|EYU44197.1| hypothetical protein MIMGU_mgv1a005600mg [Erythranthe guttata]
Length=477

 Score =   152 bits (385),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  E+V+ P SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SW
Sbjct  69   GRALFYWLTESVQQPLSKPLVVWLNGGPGCSSVAYGASEEIGPFKISKTSSGLYLNKFSW  128

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N+ ANLLF+++PAGVG+SYSN SSD+   GD+RTA+DSLEFL++W +R
Sbjct  129  NILANLLFLETPAGVGFSYSNRSSDLFDTGDRRTAKDSLEFLVRWLDR  176


 Score = 42.7 bits (99),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = +2

Query  83   VLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            ++LL   ++    ++ +++++ D +  LPG    V+F  +SGYVTV+Q  GRALF
Sbjct  20   IVLLLHGVNSAASATHLEEEEADRITGLPGQP-KVNFQQFSGYVTVSQVPGRALF  73



>ref|XP_009147382.1| PREDICTED: serine carboxypeptidase-like 25 [Brassica rapa]
 emb|CDY37553.1| BnaA05g34180D [Brassica napus]
Length=473

 Score =   147 bits (372),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA   P SKPLV+WLNGGPGCSS+A+G +EE+GPF + K G  LY N ++W
Sbjct  63   GRSLFYWLTEASHLPLSKPLVIWLNGGPGCSSVAYGASEEIGPFRISKGGSGLYLNKFAW  122

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  ANLLF+++PAGVG+SY+N SSD+   GD RTA+DSL+FL+KW +R
Sbjct  123  NSIANLLFLEAPAGVGFSYTNRSSDLFNTGDIRTAKDSLQFLIKWLQR  170


 Score = 47.8 bits (112),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 36/63 (57%), Gaps = 5/63 (8%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSV----DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  238
            C+LF  L+A  I   +G S       Q + D +  LPG   NV+F  +SGYVTV + SGR
Sbjct  6    CVLFTTLMAILIMTSQGRSQAREGEKQAEADRITSLPGQP-NVTFEQFSGYVTVAKHSGR  64

Query  239  ALF  247
            +LF
Sbjct  65   SLF  67



>gb|KJB07560.1| hypothetical protein B456_001G032600 [Gossypium raimondii]
Length=405

 Score =   151 bits (382),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA   P  KPL+LWLNGGPGCSS+A+G +EE+GPF + K G +LY N YSW
Sbjct  86   GRALFYWFTEATTVPEKKPLLLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYSW  145

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N+ AN+LF++SPAGVG+SY+NTSSD+   GD RTA+D+L FL +W  R
Sbjct  146  NMEANILFLESPAGVGFSYTNTSSDLKDSGDDRTAQDALIFLTRWMSR  193


 Score = 43.5 bits (101),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 38/64 (59%), Gaps = 9/64 (14%)
 Frame = +2

Query  56   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  235
            ++ +  LLF ++ A ++          QQ+LD +  LPG    V F+ +SGYVTVN++ G
Sbjct  36   SICYSLLLFGIVAANAVP--------KQQELDRISSLPGQP-PVGFSQFSGYVTVNEKHG  86

Query  236  RALF  247
            RALF
Sbjct  87   RALF  90



>gb|KFK36473.1| hypothetical protein AALP_AA4G129300 [Arabis alpina]
Length=439

 Score =   151 bits (381),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGK+L+ N Y+W
Sbjct  42   GRALFYWLTEAPSPSGTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKSLHLNLYAW  101

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  ANLLF+DSPAGVG+SY+N SSD LT GDKRT ED+  FL++W ER
Sbjct  102  NKVANLLFLDSPAGVGFSYTNASSDELTVGDKRTGEDAYRFLVRWMER  149


 Score = 43.9 bits (102),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  116  KGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            + + + +Q+  D ++ LPG   +++F+ YSGYVTV+  +GRALF
Sbjct  3    RNNDAKEQKMKDKIISLPGQPPHLNFSQYSGYVTVDSAAGRALF  46



>ref|XP_006845845.1| hypothetical protein AMTR_s00154p00033550 [Amborella trichopoda]
 gb|ERN07520.1| hypothetical protein AMTR_s00154p00033550 [Amborella trichopoda]
Length=475

 Score =   152 bits (385),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
             +G   FYW  EA  +P S+PLVLWLNGGPGCSSIA+G +EE+GPF ++K    LY N +
Sbjct  66   QVGRALFYWLTEAELEPESRPLVLWLNGGPGCSSIAYGASEEIGPFRIKKSASGLYLNKF  125

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            SWN  ANLLF++SP GVGYSY+NTSSD+   GD +TA+DSL+FLL+WF+R
Sbjct  126  SWNKVANLLFLESPVGVGYSYTNTSSDLTNFGDLQTAKDSLQFLLRWFDR  175


 Score = 42.4 bits (98),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 1/37 (3%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            +++ D +L LPG    VSF  +SGYVTVN++ GRALF
Sbjct  37   EEEQDRILRLPGQP-EVSFKQFSGYVTVNEQVGRALF  72



>ref|XP_002452974.1| hypothetical protein SORBIDRAFT_04g035810 [Sorghum bicolor]
 gb|EES05950.1| hypothetical protein SORBIDRAFT_04g035810 [Sorghum bicolor]
Length=488

 Score =   153 bits (387),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            R  G   FYW  EAV D ++KPLVLWLNGGPGCSS+A+G +EE+GPF ++ +G  L+ N 
Sbjct  85   RDGGRALFYWLTEAVGDAAAKPLVLWLNGGPGCSSVAYGASEEIGPFRIKPNGTGLFLNK  144

Query  405  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            YSWN  ANLLF++SPAGVG+SY+NT+SD+ T GD+RTA+D+L+FL+ W  R
Sbjct  145  YSWNREANLLFLESPAGVGFSYTNTTSDLKTTGDERTAQDALQFLISWMSR  195


 Score = 41.2 bits (95),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 25/33 (76%), Gaps = 1/33 (3%)
 Frame = +2

Query  149  DAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            D V+ LPG    V+FA YSGYVTVN++ GRALF
Sbjct  61   DRVVALPGQP-AVAFAQYSGYVTVNRDGGRALF  92



>ref|XP_011079399.1| PREDICTED: serine carboxypeptidase 24 [Sesamum indicum]
Length=462

 Score =   150 bits (379),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA  +  +KPLVLWLNGGPGCSS+A+G +EE+GPF + K G +LY N YSW
Sbjct  61   GRALFYWLTEATSNAHTKPLVLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYSW  120

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF++SPAGVG+SY+NTSS++   GDKRTA+D+L FL++W  R
Sbjct  121  NRVANILFLESPAGVGFSYTNTSSNLKDSGDKRTAQDALVFLIRWMHR  168


 Score = 44.3 bits (103),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            +L +  L++S+     ++    Q+LD +  LPG    V+F+ +SGYVTVN++ GRALF
Sbjct  9    VLLLCFLSSSVLTALLAALPADQELDRISALPGQP-PVNFSQFSGYVTVNEQQGRALF  65



>ref|XP_002529402.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF32998.1| serine carboxypeptidase, putative [Ricinus communis]
Length=469

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA   P  KPLVLWLNGGPGCSS+A+G +EE+GPF + + G +LY N YSW
Sbjct  66   GRALFYWLTEATSSPHHKPLVLWLNGGPGCSSVAYGASEEIGPFRINRTGSSLYLNKYSW  125

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF++SPAGVG+SY+NTSSD+   GDKRTA+D+L FLL+WF R
Sbjct  126  NTEANILFLESPAGVGFSYTNTSSDLKDSGDKRTAQDALVFLLRWFSR  173



>ref|XP_006408447.1| hypothetical protein EUTSA_v10020652mg [Eutrema salsugineum]
 gb|ESQ49900.1| hypothetical protein EUTSA_v10020652mg [Eutrema salsugineum]
Length=472

 Score =   148 bits (373),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 85/111 (77%), Gaps = 0/111 (0%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            +S+G   FYW  EA   P SKPLV+WLNGGPGCSS+A+G +EE+GPF + K G  LY N 
Sbjct  58   KSVGRSLFYWLTEASHLPLSKPLVIWLNGGPGCSSVAYGASEEIGPFRISKGGSGLYLNK  117

Query  405  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            ++WN  ANLLF+++PAGVG+SY+N SSD+   GD RTA+DSL+FL++W  R
Sbjct  118  FAWNSLANLLFLEAPAGVGFSYTNRSSDLFNTGDSRTAKDSLQFLIEWLRR  168


 Score = 46.6 bits (109),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 38/63 (60%), Gaps = 5/63 (8%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSV----DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  238
            C++F + +AT +   +G S +     + + D +  LPG   NV+F  +SGYVTV++  GR
Sbjct  4    CVIFTIFMATLVMTSQGRSQIGGGEKEAEADRITSLPGQP-NVTFEQFSGYVTVDKSVGR  62

Query  239  ALF  247
            +LF
Sbjct  63   SLF  65



>gb|KJB07562.1| hypothetical protein B456_001G032600 [Gossypium raimondii]
Length=448

 Score =   151 bits (381),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA   P  KPL+LWLNGGPGCSS+A+G +EE+GPF + K G +LY N YSW
Sbjct  86   GRALFYWFTEATTVPEKKPLLLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYSW  145

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N+ AN+LF++SPAGVG+SY+NTSSD+   GD RTA+D+L FL +W  R
Sbjct  146  NMEANILFLESPAGVGFSYTNTSSDLKDSGDDRTAQDALIFLTRWMSR  193


 Score = 43.5 bits (101),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 38/64 (59%), Gaps = 9/64 (14%)
 Frame = +2

Query  56   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  235
            ++ +  LLF ++ A ++          QQ+LD +  LPG    V F+ +SGYVTVN++ G
Sbjct  36   SICYSLLLFGIVAANAVP--------KQQELDRISSLPGQP-PVGFSQFSGYVTVNEKHG  86

Query  236  RALF  247
            RALF
Sbjct  87   RALF  90



>ref|XP_006373363.1| hypothetical protein POPTR_0017s12960g [Populus trichocarpa]
 gb|ERP51160.1| hypothetical protein POPTR_0017s12960g [Populus trichocarpa]
Length=432

 Score =   154 bits (389),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 85/111 (77%), Gaps = 0/111 (0%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            +++G   FYW  EAV DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N 
Sbjct  61   KAVGRALFYWLTEAVHDPLSKPLVVWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNK  120

Query  405  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +SWN  ANLLF+++PAGVG+SYSN SSD+L  GD RTA DSLEFLL W  R
Sbjct  121  FSWNSVANLLFLETPAGVGFSYSNRSSDVLDTGDVRTAMDSLEFLLGWMNR  171



>ref|XP_011009401.1| PREDICTED: serine carboxypeptidase-like 25 isoform X1 [Populus 
euphratica]
Length=469

 Score =   155 bits (391),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            + +G   FYW  EAV DPSSKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N 
Sbjct  62   KVVGRALFYWLTEAVHDPSSKPLVVWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNK  121

Query  405  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +SWN  ANLLF+++PAGVG+SYSN SSD+L  GD RTA+DSLEFL+ W  R
Sbjct  122  FSWNSVANLLFLETPAGVGFSYSNRSSDLLDTGDIRTAKDSLEFLVGWMNR  172



>gb|KJB07564.1| hypothetical protein B456_001G032600 [Gossypium raimondii]
Length=488

 Score =   151 bits (381),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA   P  KPL+LWLNGGPGCSS+A+G +EE+GPF + K G +LY N YSW
Sbjct  86   GRALFYWFTEATTVPEKKPLLLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYSW  145

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N+ AN+LF++SPAGVG+SY+NTSSD+   GD RTA+D+L FL +W  R
Sbjct  146  NMEANILFLESPAGVGFSYTNTSSDLKDSGDDRTAQDALIFLTRWMSR  193


 Score = 43.5 bits (101),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 38/64 (59%), Gaps = 9/64 (14%)
 Frame = +2

Query  56   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  235
            ++ +  LLF ++ A ++          QQ+LD +  LPG    V F+ +SGYVTVN++ G
Sbjct  36   SICYSLLLFGIVAANAVP--------KQQELDRISSLPGQP-PVGFSQFSGYVTVNEKHG  86

Query  236  RALF  247
            RALF
Sbjct  87   RALF  90



>gb|KJB07559.1| hypothetical protein B456_001G032600 [Gossypium raimondii]
Length=488

 Score =   150 bits (380),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA   P  KPL+LWLNGGPGCSS+A+G +EE+GPF + K G +LY N YSW
Sbjct  86   GRALFYWFTEATTVPEKKPLLLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYSW  145

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N+ AN+LF++SPAGVG+SY+NTSSD+   GD RTA+D+L FL +W  R
Sbjct  146  NMEANILFLESPAGVGFSYTNTSSDLKDSGDDRTAQDALIFLTRWMSR  193


 Score = 43.5 bits (101),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 38/64 (59%), Gaps = 9/64 (14%)
 Frame = +2

Query  56   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  235
            ++ +  LLF ++ A ++          QQ+LD +  LPG    V F+ +SGYVTVN++ G
Sbjct  36   SICYSLLLFGIVAANAVP--------KQQELDRISSLPGQP-PVGFSQFSGYVTVNEKHG  86

Query  236  RALF  247
            RALF
Sbjct  87   RALF  90



>ref|XP_004288721.2| PREDICTED: serine carboxypeptidase 24 [Fragaria vesca subsp. 
vesca]
Length=470

 Score =   155 bits (391),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA   P +KPLVLW NGGPGCSS+A+G +EE+GPF + + G +LY N YSW
Sbjct  70   GRALFYWFTEATASPHNKPLVLWFNGGPGCSSVAYGASEEIGPFRINRTGSSLYLNKYSW  129

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF++SPAGVG+SY+NTS+D++  GDKRTA+D+L FLL+W  R
Sbjct  130  NREANILFLESPAGVGFSYTNTSADLIDSGDKRTAQDALTFLLQWLSR  177


 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 41/71 (58%), Gaps = 3/71 (4%)
 Frame = +2

Query  65   WGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            +  L+F+L L T+      +++  +Q+LD +  LPG    VSF+ YSGYVTVN++ GRAL
Sbjct  17   YSILVFMLSLTTTTINV--AATAKEQELDRITALPGQP-PVSFSQYSGYVTVNKKHGRAL  73

Query  245  FLLVL*GCGGP  277
            F         P
Sbjct  74   FYWFTEATASP  84



>gb|KJB75609.1| hypothetical protein B456_012G048700 [Gossypium raimondii]
Length=327

 Score =   152 bits (383),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  E+   PSSKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SW
Sbjct  77   GRALFYWLTESPNSPSSKPLVIWLNGGPGCSSVAYGASEEIGPFRINKSASGLYLNKFSW  136

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  ANLLF+++PAGVG+SY+N SSD+L  GD+RTA DSLEFL++W +R
Sbjct  137  NNVANLLFLETPAGVGFSYTNRSSDLLDTGDRRTAMDSLEFLIRWLDR  184



>ref|XP_004304228.1| PREDICTED: serine carboxypeptidase-like 25 [Fragaria vesca subsp. 
vesca]
Length=475

 Score =   149 bits (376),  Expect(2) = 6e-41, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 84/110 (76%), Gaps = 1/110 (1%)
 Frame = +3

Query  231  LGEHFFYWFFEA-VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            +G   FYW  EA V+DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LYWN +
Sbjct  67   VGRALFYWLTEAAVKDPLSKPLVIWLNGGPGCSSVAYGASEEIGPFRINKTATGLYWNKF  126

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            SWN  ANLLF+++PAGVG+SYSN S+D+   GD RTA DSL F++ W +R
Sbjct  127  SWNTEANLLFLETPAGVGFSYSNRSADLFDTGDARTARDSLNFIIGWMDR  176


 Score = 45.1 bits (105),  Expect(2) = 6e-41, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 2/58 (3%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            ++ VLLL   I    GS + ++++ D ++ LPG    V+F  +SGYVTVN   GRALF
Sbjct  17   MVSVLLLGLFISASNGSVN-EEEEADRIVSLPGQP-KVTFQQFSGYVTVNHRVGRALF  72



>ref|XP_003549539.1| PREDICTED: serine carboxypeptidase 24-like [Glycine max]
 gb|KHN17498.1| Serine carboxypeptidase 24 [Glycine soja]
Length=460

 Score =   150 bits (380),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  E+   P +KPLVLWLNGGPGCSS+A+G +EE+GPF + K G +LY N Y+W
Sbjct  63   GRALFYWLTESPTSPQNKPLVLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYAW  122

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  A++LF++SPAGVG+SY+NTSSD+ T GDKRTA+D+L FL++W  R
Sbjct  123  NKEASILFLESPAGVGFSYTNTSSDLKTSGDKRTAQDALVFLIRWMSR  170


 Score = 43.1 bits (100),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 1/37 (3%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            +Q+ D +L LPG    V+F+ +SGYVTVN++ GRALF
Sbjct  32   EQEQDRILALPGQP-RVAFSQFSGYVTVNEQHGRALF  67



>ref|XP_009792407.1| PREDICTED: serine carboxypeptidase 24-like [Nicotiana sylvestris]
Length=468

 Score =   154 bits (389),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA   P  KPLVLWLNGGPGCSS+A+G +EE+GPF + K G +LY N YSW
Sbjct  67   GRALFYWLTEATTQPEKKPLVLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYSW  126

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF++SPAGVG+SY+NTSSD+   GDKRTA+D+L FL++W  R
Sbjct  127  NKVANILFLESPAGVGFSYTNTSSDLKDSGDKRTAQDALIFLIRWMSR  174



>ref|XP_006845380.1| hypothetical protein AMTR_s00019p00043630 [Amborella trichopoda]
 gb|ERN07055.1| hypothetical protein AMTR_s00019p00043630 [Amborella trichopoda]
Length=458

 Score =   148 bits (374),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            ++ G   FYW  EA  + + KPLVLWLNGGPGCSSIAFG +EE+GPF V K G +LY N 
Sbjct  57   QTHGRALFYWLTEATSNANEKPLVLWLNGGPGCSSIAFGASEEIGPFRVNKTGHSLYLNK  116

Query  405  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +SWN  ANLLF++SPAGVG+SY+NT+SD+   GD+RTA+D+L FL+KW  R
Sbjct  117  FSWNKDANLLFLESPAGVGFSYTNTTSDLKDSGDERTAQDALVFLIKWLAR  167


 Score = 45.4 bits (106),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 1/38 (3%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            D+++ D +++LPG    VSF  +SGYVTVNQ  GRALF
Sbjct  28   DEREKDRIINLPGQP-KVSFEQFSGYVTVNQTHGRALF  64



>ref|XP_010938508.1| PREDICTED: serine carboxypeptidase II-3-like isoform X2 [Elaeis 
guineensis]
Length=421

 Score =   153 bits (387),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 87/109 (80%), Gaps = 1/109 (1%)
 Frame = +3

Query  234  GEHFFYWFFEAV-EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  410
            G   FY+F EAV +DPSSKPLVLWLNGGPGCSS+ +G  EE+GPF V  DGKTL+ NPY+
Sbjct  103  GRALFYYFTEAVSDDPSSKPLVLWLNGGPGCSSLGYGAMEELGPFRVMSDGKTLFRNPYA  162

Query  411  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            WN  AN+LF++SPAGVG+SYSNT+SD   +GD RTAEDS  FL+ W +R
Sbjct  163  WNTVANVLFLESPAGVGFSYSNTTSDYGENGDSRTAEDSYVFLVNWMDR  211



>gb|KJB76563.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=452

 Score =   154 bits (388),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 87/113 (77%), Gaps = 2/113 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYW  E+     P S+PLVLWLNGGPGCSSIA+G AEE+GPF +  DGKTLY 
Sbjct  51   QQAGRALFYWLIESPVSRKPESRPLVLWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYL  110

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N Y+WN  AN+LF++SPAGVG+SY+NT+SD+ T GDKRTAED+  FL+ WFER
Sbjct  111  NRYAWNNLANVLFLESPAGVGFSYTNTTSDLYTTGDKRTAEDAYVFLVNWFER  163


 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            S+    Q LD + +LPG   NV F  YSGYVTVNQ++GRALF  ++
Sbjct  17   STCFGDQTLDKITELPGQPKNVGFNQYSGYVTVNQQAGRALFYWLI  62



>ref|XP_011000079.1| PREDICTED: serine carboxypeptidase-like 25 [Populus euphratica]
Length=469

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 85/111 (77%), Gaps = 0/111 (0%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            +++G   FYW  EAV DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N 
Sbjct  62   KAVGRALFYWLTEAVHDPLSKPLVVWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNK  121

Query  405  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +SWN  ANLLF+++PAGVG+SYSN SSD+L  GD RTA DSLEFLL W  R
Sbjct  122  FSWNTVANLLFLETPAGVGFSYSNRSSDLLDTGDVRTAMDSLEFLLGWMNR  172



>ref|XP_009420309.1| PREDICTED: serine carboxypeptidase 24-like [Musa acuminata subsp. 
malaccensis]
Length=464

 Score =   147 bits (370),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            +  G   FYW  EA  D + KPLVLWLNGGPGCSS+A+G +EE+GPF + +   +LY N 
Sbjct  63   KEQGRALFYWLTEAATDAAKKPLVLWLNGGPGCSSVAYGASEEIGPFRISRTCSSLYLNQ  122

Query  405  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +SWN  ANLLF++SPAGVG+SY+NTSSD+ T GD+RTA D+L FL+ W  R
Sbjct  123  FSWNREANLLFLESPAGVGFSYTNTSSDLKTSGDERTAGDALMFLIGWMSR  173


 Score = 46.6 bits (109),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 27/39 (69%), Gaps = 1/39 (3%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
             DQQ  D +  LPG    V+FA +SGYVTVN+E GRALF
Sbjct  33   ADQQAHDRITALPGQP-PVTFAQFSGYVTVNKEQGRALF  70



>gb|KHG08205.1| Serine carboxypeptidase-like 27 [Gossypium arboreum]
Length=452

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 87/113 (77%), Gaps = 2/113 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYW  E+     P S+PLVLWLNGGPGCSSIA+G AEE+GPF +  DGKTLY 
Sbjct  51   QQAGRALFYWLIESPVSRKPESRPLVLWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYL  110

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N Y+WN  AN+LF++SPAGVG+SY+NT+SD+ T GDKRTAED+  FL+ WFER
Sbjct  111  NRYAWNNLANVLFLESPAGVGFSYTNTTSDLYTTGDKRTAEDAYVFLVNWFER  163



>gb|KEH38195.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=441

 Score =   140 bits (354),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 80/100 (80%), Gaps = 3/100 (3%)
 Frame = +3

Query  231  LGEHFFYWFFEAVE-DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            +G + FYWF +A   DP+SKPL+LW NGGPGCSSIA+G AEE+GPFH+  DGK L++NPY
Sbjct  64   VGRNLFYWFIQADHVDPTSKPLLLWFNGGPGCSSIAYGEAEEIGPFHINSDGKNLHFNPY  123

Query  408  SWNLAANLLFVDSPAGVGYSYS--NTSSDILTHGDKRTAE  521
            SWN  AN+L++DSP GVG+SYS  N+S DIL +GDKRT  
Sbjct  124  SWNQVANILYIDSPVGVGFSYSTKNSSDDILNNGDKRTGH  163


 Score = 52.8 bits (125),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 39/69 (57%), Gaps = 3/69 (4%)
 Frame = +2

Query  50   MSALSWGCLLFVLL--LATSIDGGKGSSSVDQQKLDAV-LDLPGLGFNVSFAHYSGYVTV  220
            M+   W  +LF+++  LA        +    QQ  D +   LPG  FN+SF HYSGY+TV
Sbjct  1    MANSKWSQILFIVIITLANLFQCNIATDPFVQQGQDNIGRALPGQNFNISFEHYSGYITV  60

Query  221  NQESGRALF  247
            N++ GR LF
Sbjct  61   NEDVGRNLF  69



>ref|XP_002324116.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF04249.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=468

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 85/111 (77%), Gaps = 0/111 (0%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            +++G   FYW  EAV DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N 
Sbjct  61   KAVGRALFYWLTEAVHDPLSKPLVVWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNK  120

Query  405  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            +SWN  ANLLF+++PAGVG+SYSN SSD+L  GD RTA DSLEFLL W  R
Sbjct  121  FSWNSVANLLFLETPAGVGFSYSNRSSDVLDTGDVRTAMDSLEFLLGWMNR  171



>emb|CDP02317.1| unnamed protein product [Coffea canephora]
Length=471

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = +3

Query  243  FFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLA  422
             FYW  EA ++PSSKPLV+WLNGGPGCSS+A+G +EE+GPF + +    LY N +SWN  
Sbjct  69   LFYWLTEAADEPSSKPLVVWLNGGPGCSSVAYGASEEIGPFRINRTASGLYLNKFSWNKL  128

Query  423  ANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            ANLLF+++PAGVG+SYSN SSD+L  GD+RTAEDSL+FL++W ER
Sbjct  129  ANLLFLETPAGVGFSYSNRSSDLLDTGDQRTAEDSLKFLIQWMER  173



>ref|XP_003519151.1| PREDICTED: serine carboxypeptidase 24-like isoform 1 [Glycine 
max]
Length=461

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF E+   P +KPLVLWLNGGPGCSS+A+G +EE+GPF + K G +LY N Y+W
Sbjct  64   GRSLFYWFTESPTSPQNKPLVLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYAW  123

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  AN+LF++SPAGVG+SY+NTSSD+ T GDKRTA+D+L F+++W  R
Sbjct  124  NREANVLFLESPAGVGFSYTNTSSDLKTSGDKRTAQDALIFVIRWMSR  171



>gb|KJB76567.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=482

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 87/113 (77%), Gaps = 2/113 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYW  E+     P S+PLVLWLNGGPGCSSIA+G AEE+GPF +  DGKTLY 
Sbjct  51   QQAGRALFYWLIESPVSRKPESRPLVLWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYL  110

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N Y+WN  AN+LF++SPAGVG+SY+NT+SD+ T GDKRTAED+  FL+ WFER
Sbjct  111  NRYAWNNLANVLFLESPAGVGFSYTNTTSDLYTTGDKRTAEDAYVFLVNWFER  163


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            S+    Q LD + +LPG   NV F  YSGYVTVNQ++GRALF  ++
Sbjct  17   STCFGDQTLDKITELPGQPKNVGFNQYSGYVTVNQQAGRALFYWLI  62



>ref|XP_004954211.1| PREDICTED: serine carboxypeptidase 24-like [Setaria italica]
Length=478

 Score =   150 bits (380),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA  D +SKPLVLWLNGGPGCSS+A+G +EE+GPF ++ +G  L+ N YSW
Sbjct  78   GRALFYWLTEADGDAASKPLVLWLNGGPGCSSVAYGASEEIGPFRIKPNGTGLFLNKYSW  137

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  ANLLF++SPAGVG+SY+NT+SD+ T GD+RTA+D+L+FL+ W  R
Sbjct  138  NREANLLFLESPAGVGFSYTNTTSDLKTTGDERTAQDALQFLISWMSR  185


 Score = 42.4 bits (98),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 24/33 (73%), Gaps = 1/33 (3%)
 Frame = +2

Query  149  DAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            D V  LPG    V+FA YSGYVTVN+E GRALF
Sbjct  51   DRVEALPGQP-PVAFAQYSGYVTVNEERGRALF  82



>dbj|BAK05698.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=372

 Score =   147 bits (371),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA    + KPLVLWLNGGPGCSSI +G AEE+GPF V+K    L WNPYSW
Sbjct  77   GRALFYWFFEATAGAAKKPLVLWLNGGPGCSSIGYGEAEELGPFLVQKGKPELKWNPYSW  136

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  ANL+F++SP GVG+SY+NTSSD+   GDK TA D+  FLL WF+R
Sbjct  137  NKEANLMFLESPVGVGFSYTNTSSDLGKLGDKITAADAYVFLLNWFKR  184


 Score = 45.8 bits (107),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 37/65 (57%), Gaps = 6/65 (9%)
 Frame = +2

Query  68   GCLL--FVLLLATSIDGGKGSSSVD---QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  232
            GC L    LLL  ++ GG G+   +   QQ  D V  LPG    V FA Y+GYVTV++  
Sbjct  18   GCFLGLAFLLLCGAVRGGGGAPDAEAARQQAADRVGRLPGQP-AVKFAQYAGYVTVDEAH  76

Query  233  GRALF  247
            GRALF
Sbjct  77   GRALF  81



>gb|KJB76566.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=484

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 87/113 (77%), Gaps = 2/113 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYW  E+     P S+PLVLWLNGGPGCSSIA+G AEE+GPF +  DGKTLY 
Sbjct  51   QQAGRALFYWLIESPVSRKPESRPLVLWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYL  110

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N Y+WN  AN+LF++SPAGVG+SY+NT+SD+ T GDKRTAED+  FL+ WFER
Sbjct  111  NRYAWNNLANVLFLESPAGVGFSYTNTTSDLYTTGDKRTAEDAYVFLVNWFER  163


 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            S+    Q LD + +LPG   NV F  YSGYVTVNQ++GRALF  ++
Sbjct  17   STCFGDQTLDKITELPGQPKNVGFNQYSGYVTVNQQAGRALFYWLI  62



>ref|XP_003552566.1| PREDICTED: serine carboxypeptidase-like 25-like isoform 1 [Glycine 
max]
Length=467

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA ++P +KPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SW
Sbjct  61   GRALFYWLTEAAQNPLTKPLVIWLNGGPGCSSVAYGASEEIGPFRINKTASGLYINKFSW  120

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            N  ANLLF+++PAGVG+SY+N SSD+L  GD+RTA+DSLEF+++W ER
Sbjct  121  NTVANLLFLEAPAGVGFSYANRSSDLLNTGDRRTAQDSLEFVIQWLER  168



>ref|XP_009771074.1| PREDICTED: serine carboxypeptidase-like 25 [Nicotiana sylvestris]
Length=463

 Score =   146 bits (369),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 83/109 (76%), Gaps = 0/109 (0%)
 Frame = +3

Query  231  LGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  410
            +G   FYW  EA  +P SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +S
Sbjct  58   VGRALFYWLTEADNEPLSKPLVVWLNGGPGCSSVAYGASEEIGPFRINKTSSGLYLNKFS  117

Query  411  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            WN  ANLLF+++PAGVG+SYSN SSD+L  GD RTA+DSL+FL+ W  R
Sbjct  118  WNKLANLLFLETPAGVGFSYSNRSSDLLDTGDYRTAKDSLQFLIHWMNR  166


 Score = 46.2 bits (108),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +2

Query  77   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            + +L+L  ++     ++  +++++D ++ LPG    VSF  YSGYVTVNQ  GRALF
Sbjct  8    VVLLILVAAVCTVNATNYKEEEEVDRIISLPGQP-KVSFQQYSGYVTVNQIVGRALF  63



>ref|XP_002274723.1| PREDICTED: serine carboxypeptidase-like 27 [Vitis vinifera]
 emb|CBI31485.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 87/113 (77%), Gaps = 2/113 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYW  +  A     S+PLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTL+ 
Sbjct  55   KQAGRALFYWLVQSPASRGAESRPLVLWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLFI  114

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            NPY+WN  ANLLF++SPAGVG+SYSNT+SD+ T GD+RTAED+  FL+ WFER
Sbjct  115  NPYAWNNLANLLFLESPAGVGFSYSNTTSDLYTAGDQRTAEDAYTFLINWFER  167


 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            SS ++ Q+ D + +LPG   N+ FA YSGYVTVN+++GRALF  ++
Sbjct  21   SSYLEDQERDRITELPGQPKNIGFAQYSGYVTVNKQAGRALFYWLV  66



>emb|CAN74854.1| hypothetical protein VITISV_028701 [Vitis vinifera]
Length=452

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 87/113 (77%), Gaps = 2/113 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYW  +  A     S+PLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTL+ 
Sbjct  51   KQAGRALFYWLVQSPASRGAESRPLVLWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLFI  110

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFER  557
            NPY+WN  ANLLF++SPAGVG+SYSNT+SD+ T GD+RTAED+  FL+ WFER
Sbjct  111  NPYAWNNLANLLFLESPAGVGFSYSNTTSDLYTAGDQRTAEDAYTFLINWFER  163


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  140  QKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            Q+ D + +LPG   N+ FA YSGYVTVN+++GRALF  ++
Sbjct  23   QERDRITELPGQPKNIGFAQYSGYVTVNKQAGRALFYWLV  62



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 631248065840