BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF039C05

Length=379
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAJ91931.1|  predicted protein                                      219   2e-70   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AGH32904.1|  translation elongation factor 1-alpha                   219   4e-70   Camellia oleifera [abura-tsubaki]
gb|KJB73625.1|  hypothetical protein B456_011G2412001                   218   5e-70   Gossypium raimondii
gb|KJB73629.1|  hypothetical protein B456_011G2414002                   219   5e-70   Gossypium raimondii
gb|AFW76433.1|  putative translation elongation factor Tu family ...    217   1e-69   
gb|EAY88762.1|  hypothetical protein OsI_10238                          218   2e-69   Oryza sativa Indica Group [Indian rice]
ref|XP_004172806.1|  PREDICTED: elongation factor 1-alpha-like          216   2e-69   
ref|XP_002538495.1|  elongation factor 1-alpha, putative                218   2e-69   Ricinus communis
emb|CDP07148.1|  unnamed protein product                                225   2e-69   Coffea canephora [robusta coffee]
emb|CDY09214.1|  BnaA02g06400D                                          217   2e-69   Brassica napus [oilseed rape]
ref|XP_006307727.1|  hypothetical protein CARUB_v100096371mg            217   3e-69   
emb|CDP08919.1|  unnamed protein product                                226   3e-69   Coffea canephora [robusta coffee]
gb|ACG70967.1|  translation elongation factor 1                         219   3e-69   Ziziphus jujuba [Chinese jujube]
gb|AFW77598.1|  putative translation elongation factor Tu family ...    217   3e-69   
gb|AEQ94148.1|  elongation factor 1                                     219   3e-69   Elaeis guineensis
gb|AEG78681.1|  elongation factor 1 alpha                               218   4e-69   Erythroxylum coca [coca]
ref|XP_008465824.1|  PREDICTED: elongation factor 1-alpha-like          220   6e-69   Cucumis melo [Oriental melon]
gb|AEK98799.1|  translation elongation factor 1 alfa                    218   2e-68   Carthamus tinctorius
emb|CDO98621.1|  unnamed protein product                                221   3e-68   Coffea canephora [robusta coffee]
ref|XP_007009762.1|  GTP binding Elongation factor Tu family prot...    221   4e-68   
gb|AFW87115.1|  putative translation elongation factor Tu family ...    217   4e-68   
gb|KDP29085.1|  hypothetical protein JCGZ_16474                         222   4e-68   Jatropha curcas
ref|XP_010248287.1|  PREDICTED: elongation factor 1-alpha               221   5e-68   Nelumbo nucifera [Indian lotus]
gb|AFK35720.1|  unknown                                                 212   7e-68   Medicago truncatula
gb|AFO67216.1|  putative elongation factor 1-alpha                      218   8e-68   Aralia elata
ref|XP_010542596.1|  PREDICTED: elongation factor 1-alpha-like          222   9e-68   Tarenaya hassleriana [spider flower]
gb|KHG28979.1|  Elongation factor 1-alpha                               222   9e-68   Gossypium arboreum [tree cotton]
ref|NP_001290506.1|  elongation factor 1-alpha                          222   9e-68   Elaeis guineensis
ref|XP_008783722.1|  PREDICTED: elongation factor 1-alpha isoform X1    222   9e-68   
gb|KCW51623.1|  hypothetical protein EUGRSUZ_J01112                     219   9e-68   Eucalyptus grandis [rose gum]
gb|ABA12220.1|  translation elongation factor 1A-4                      222   9e-68   Gossypium hirsutum [American cotton]
ref|XP_010920912.1|  PREDICTED: elongation factor 1-alpha-like          222   1e-67   Elaeis guineensis
ref|XP_010542598.1|  PREDICTED: elongation factor 1-alpha-like          222   1e-67   Tarenaya hassleriana [spider flower]
ref|XP_008792062.1|  PREDICTED: elongation factor 1-alpha               222   1e-67   Phoenix dactylifera
gb|AGY80449.1|  elongation factor 1-alpha                               222   1e-67   Dendrocalamus latiflorus [sweet bamboo]
gb|KCW65375.1|  hypothetical protein EUGRSUZ_G02807                     221   1e-67   Eucalyptus grandis [rose gum]
ref|XP_007151593.1|  hypothetical protein PHAVU_004G060000g             222   1e-67   Phaseolus vulgaris [French bean]
gb|ABA12219.1|  translation elongation factor 1A-3                      222   1e-67   Gossypium hirsutum [American cotton]
ref|XP_010541344.1|  PREDICTED: elongation factor 1-alpha               222   1e-67   Tarenaya hassleriana [spider flower]
gb|ABA12217.1|  translation elongation factor 1A-1                      222   1e-67   Gossypium hirsutum [American cotton]
ref|XP_010535587.1|  PREDICTED: elongation factor 1-alpha               222   1e-67   Tarenaya hassleriana [spider flower]
gb|AFJ04514.1|  elongation factor 1-alpha                               222   1e-67   Vernicia fordii [tung oil tree]
ref|XP_010916901.1|  PREDICTED: elongation factor 1-alpha               222   1e-67   Elaeis guineensis
ref|XP_003536362.1|  PREDICTED: elongation factor 1-alpha-like is...    222   1e-67   Glycine max [soybeans]
gb|AGI15328.1|  elongation factor 1                                     222   1e-67   Aegiceras corniculatum
ref|NP_001151074.1|  elongation factor 1-alpha                          222   1e-67   
ref|XP_011091454.1|  PREDICTED: elongation factor 1-alpha-like          222   1e-67   Sesamum indicum [beniseed]
ref|XP_011089339.1|  PREDICTED: elongation factor 1-alpha isoform X1    222   1e-67   Sesamum indicum [beniseed]
gb|EPS66069.1|  elongation factor 1-alpha                               222   1e-67   Genlisea aurea
ref|XP_009358244.1|  PREDICTED: elongation factor 1-alpha-like          222   1e-67   Pyrus x bretschneideri [bai li]
ref|XP_003547695.1|  PREDICTED: elongation factor 1-alpha isoform 2     222   1e-67   Glycine max [soybeans]
gb|KHN42761.1|  Elongation factor 1-alpha                               222   1e-67   Glycine soja [wild soybean]
ref|XP_010032227.1|  PREDICTED: elongation factor 1-alpha-like          222   1e-67   Eucalyptus grandis [rose gum]
ref|XP_010067278.1|  PREDICTED: elongation factor 1-alpha-like          222   1e-67   Eucalyptus grandis [rose gum]
ref|XP_008792073.1|  PREDICTED: elongation factor 1-alpha-like          222   1e-67   Phoenix dactylifera
gb|KHG26926.1|  Elongation factor 1-alpha                               222   1e-67   Gossypium arboreum [tree cotton]
ref|XP_010521772.1|  PREDICTED: elongation factor 1-alpha-like          222   1e-67   Tarenaya hassleriana [spider flower]
ref|XP_010557310.1|  PREDICTED: elongation factor 1-alpha-like          222   1e-67   Tarenaya hassleriana [spider flower]
ref|XP_011089874.1|  PREDICTED: elongation factor 1-alpha               222   1e-67   Sesamum indicum [beniseed]
ref|XP_009381507.1|  PREDICTED: elongation factor 1-alpha-like          222   1e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008789061.1|  PREDICTED: elongation factor 1-alpha-like          222   1e-67   Phoenix dactylifera
gb|ABF94275.1|  Elongation factor 1-alpha, putative, expressed          219   1e-67   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010937806.1|  PREDICTED: elongation factor 1-alpha-like          222   1e-67   Elaeis guineensis
ref|XP_004251154.1|  PREDICTED: elongation factor 1-alpha-like          222   1e-67   Solanum lycopersicum
ref|XP_006340223.1|  PREDICTED: elongation factor 1-alpha-like          222   1e-67   Solanum tuberosum [potatoes]
gb|ABA12225.1|  translation elongation factor 1A-9                      222   1e-67   Gossypium hirsutum [American cotton]
gb|AFW90638.1|  elongation factor 1-alpha-like protein                  218   1e-67   Solanum tuberosum [potatoes]
gb|KHG01531.1|  Elongation factor 1-alpha                               222   1e-67   Gossypium arboreum [tree cotton]
ref|XP_001763198.1|  predicted protein                                  219   1e-67   
gb|KDP29083.1|  hypothetical protein JCGZ_16472                         222   1e-67   Jatropha curcas
gb|ABA12224.1|  translation elongation factor 1A-8                      222   1e-67   Gossypium hirsutum [American cotton]
gb|AAY56337.1|  elongation factor-1 alpha                               222   1e-67   Musa acuminata [banana]
gb|ADR70875.1|  eukaryotic translation elongation factor 1-alpha        222   1e-67   Hevea brasiliensis [jebe]
ref|XP_010937512.1|  PREDICTED: elongation factor 1-alpha               222   1e-67   Elaeis guineensis
dbj|BAA34348.1|  elongation factor-1 alpha                              222   1e-67   Nicotiana paniculata
gb|ABA12223.1|  translation elongation factor 1A-7                      222   1e-67   Gossypium hirsutum [American cotton]
gb|KHG23927.1|  Elongation factor 1-alpha                               222   1e-67   Gossypium arboreum [tree cotton]
ref|XP_007009760.1|  GTP binding Elongation factor Tu family prot...    222   1e-67   Theobroma cacao [chocolate]
ref|XP_009762748.1|  PREDICTED: elongation factor 1-alpha-like          222   1e-67   Nicotiana sylvestris
gb|AAX54511.1|  elongation factor 1 alpha                               222   1e-67   Actinidia deliciosa [Chinese gooseberry]
ref|XP_006846237.1|  hypothetical protein AMTR_s00012p00237190          222   1e-67   Amborella trichopoda
ref|XP_003604587.1|  Elongation factor 1-alpha                          222   1e-67   Medicago truncatula
gb|ABA12221.1|  translation elongation factor 1A-5                      222   1e-67   Gossypium hirsutum [American cotton]
ref|XP_009403064.1|  PREDICTED: elongation factor 1-alpha-like          222   1e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002277159.1|  PREDICTED: elongation factor 1-alpha               222   1e-67   Vitis vinifera
gb|AAD56020.1|AF181492_1  elongation factor-1 alpha 3                   222   1e-67   Lilium longiflorum [Easter lily]
gb|AAD56019.1|AF181491_1  elongation factor-1 alpha 2                   222   1e-67   Lilium longiflorum [Easter lily]
ref|XP_010937804.1|  PREDICTED: elongation factor 1-alpha-like          222   1e-67   Elaeis guineensis
ref|XP_011089340.1|  PREDICTED: elongation factor 1-alpha isoform X2    222   1e-67   
ref|XP_010032221.1|  PREDICTED: elongation factor 1-alpha isoform X1    222   1e-67   Eucalyptus grandis [rose gum]
sp|O49169.1|EF1A_MANES  RecName: Full=Elongation factor 1-alpha; ...    222   1e-67   Manihot esculenta [manioc]
ref|XP_007009751.1|  GTP binding Elongation factor Tu family prot...    222   1e-67   Theobroma cacao [chocolate]
ref|XP_010032224.1|  PREDICTED: elongation factor 1-alpha isoform X3    222   1e-67   
ref|XP_006856244.1|  hypothetical protein AMTR_s00059p00216110          222   1e-67   Amborella trichopoda
ref|XP_002460859.1|  hypothetical protein SORBIDRAFT_02g036420          222   1e-67   Sorghum bicolor [broomcorn]
ref|XP_009613861.1|  PREDICTED: elongation factor 1-alpha-like          222   1e-67   Nicotiana tomentosiformis
gb|AHA84124.1|  elongation factor 1-alpha                               222   1e-67   Phaseolus vulgaris [French bean]
ref|XP_009388387.1|  PREDICTED: elongation factor 1-alpha-like          222   1e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004512426.1|  PREDICTED: elongation factor 1-alpha-like          222   1e-67   Cicer arietinum [garbanzo]
gb|EPS66340.1|  elongation factor 1-alpha                               221   1e-67   Genlisea aurea
ref|XP_009593325.1|  PREDICTED: elongation factor 1-alpha               222   1e-67   Nicotiana tomentosiformis
ref|XP_009403341.1|  PREDICTED: elongation factor 1-alpha-like          222   1e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002528028.1|  elongation factor 1-alpha, putative                222   1e-67   
ref|XP_010244958.1|  PREDICTED: elongation factor 1-alpha-like          222   2e-67   Nelumbo nucifera [Indian lotus]
gb|ADR70874.1|  eukaryotic translation elongation factor 1-alpha        221   2e-67   Hevea brasiliensis [jebe]
gb|AHZ58493.1|  translation elongation factor alpha                     221   2e-67   Syntrichia caninervis
ref|XP_003604823.1|  Elongation factor 1-alpha                          221   2e-67   
gb|AAL69396.1|  elongation factor 1-alpha                               221   2e-67   Elaeis oleifera
ref|XP_010043711.1|  PREDICTED: elongation factor 1-alpha               221   2e-67   Eucalyptus grandis [rose gum]
ref|XP_002279598.1|  PREDICTED: elongation factor 1-alpha               221   2e-67   Vitis vinifera
gb|AES62210.2|  GTP-binding elongation factor Tu family protein         221   2e-67   Medicago truncatula
gb|KEH43536.1|  GTP-binding elongation factor Tu family protein         221   2e-67   Medicago truncatula
ref|XP_010521578.1|  PREDICTED: elongation factor 1-alpha               221   2e-67   Tarenaya hassleriana [spider flower]
gb|ABA12222.1|  translation elongation factor 1A-6                      221   2e-67   Gossypium hirsutum [American cotton]
dbj|BAC22125.1|  eukaryotic elongation factor 1A                        221   2e-67   Bruguiera sexangula
gb|EYU18869.1|  hypothetical protein MIMGU_mgv1a010191mg                218   2e-67   Erythranthe guttata [common monkey flower]
gb|AES74993.2|  GTP-binding elongation factor Tu family protein         221   2e-67   Medicago truncatula
gb|EYU36203.1|  hypothetical protein MIMGU_mgv1a006301mg                221   2e-67   Erythranthe guttata [common monkey flower]
ref|XP_009342341.1|  PREDICTED: elongation factor 1-alpha               221   2e-67   Pyrus x bretschneideri [bai li]
ref|NP_001077483.1|  elongation factor 1-alpha 2                        219   3e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009617039.1|  PREDICTED: elongation factor 1-alpha               221   3e-67   Nicotiana tomentosiformis
ref|XP_006381487.1|  hypothetical protein POPTR_0006s13310g             221   3e-67   Populus trichocarpa [western balsam poplar]
ref|XP_002284964.1|  PREDICTED: elongation factor 1-alpha               221   3e-67   Vitis vinifera
gb|ABB16977.1|  elongation factor 1-alpha-like protein                  217   3e-67   Solanum tuberosum [potatoes]
gb|EEE58429.1|  hypothetical protein OsJ_09630                          220   3e-67   Oryza sativa Japonica Group [Japonica rice]
sp|O24534.1|EF1A_VICFA  RecName: Full=Elongation factor 1-alpha; ...    221   4e-67   Vicia faba [broad bean]
ref|XP_006646939.1|  PREDICTED: elongation factor 1-alpha-like          220   4e-67   Oryza brachyantha
ref|NP_001049145.1|  Os03g0177400                                       220   4e-67   
ref|XP_008463920.1|  PREDICTED: elongation factor 1-alpha               220   4e-67   Cucumis melo [Oriental melon]
gb|ABA12218.1|  translation elongation factor 1A-2                      220   4e-67   Gossypium hirsutum [American cotton]
gb|AAD27590.1|AF121261_1  elongation factor 1-alpha 1                   220   4e-67   Lilium longiflorum [Easter lily]
ref|XP_004138964.1|  PREDICTED: elongation factor 1-alpha-like          220   4e-67   Cucumis sativus [cucumbers]
dbj|BAA23658.1|  EF-1 alpha                                             220   4e-67   Oryza sativa [red rice]
ref|XP_008457229.1|  PREDICTED: elongation factor 1-alpha               220   5e-67   Cucumis melo [Oriental melon]
gb|AIZ68131.1|  translation elongation factor 1-alpha                   220   5e-67   Ornithogalum longebracteatum [sea-onion]
gb|KHG15275.1|  Elongation factor 1-alpha                               220   5e-67   Gossypium arboreum [tree cotton]
gb|KJB09231.1|  hypothetical protein B456_001G130700                    220   5e-67   Gossypium raimondii
gb|AGH32502.1|  translation elongation factor-1 alpha                   220   5e-67   Stylosanthes guianensis [stylo]
gb|KHN14872.1|  Elongation factor 1-alpha                               220   5e-67   Glycine soja [wild soybean]
gb|AAC15413.1|  translation elongation factor-1 alpha                   220   5e-67   Oryza sativa Japonica Group [Japonica rice]
sp|P29521.1|EF1A1_DAUCA  RecName: Full=Elongation factor 1-alpha;...    220   5e-67   Daucus carota [carrots]
ref|XP_006424633.1|  hypothetical protein CICLE_v10028443mg             220   5e-67   Citrus clementina [clementine]
ref|XP_006424629.1|  hypothetical protein CICLE_v10028446mg             220   5e-67   Citrus clementina [clementine]
ref|XP_003558459.1|  PREDICTED: elongation factor 1-alpha               220   5e-67   Brachypodium distachyon [annual false brome]
dbj|BAO57272.1|  elongation factor 1-alpha                              220   5e-67   Ipomoea nil [qian niu]
ref|XP_003553292.1|  PREDICTED: elongation factor 1-alpha isoform 1     220   5e-67   Glycine max [soybeans]
ref|XP_004149547.1|  PREDICTED: elongation factor 1-alpha-like          220   5e-67   Cucumis sativus [cucumbers]
gb|KJB76528.1|  hypothetical protein B456_012G093800                    220   6e-67   Gossypium raimondii
gb|ADI24333.1|  elongation factor 1-alpha                               220   6e-67   Miscanthus sinensis
ref|XP_011004182.1|  PREDICTED: elongation factor 1-alpha-like          220   6e-67   Populus euphratica
ref|NP_001152668.1|  LOC100286309                                       220   6e-67   Zea mays [maize]
ref|NP_001105587.1|  elongation factor 1-alpha                          220   6e-67   Zea mays [maize]
gb|ABU63160.1|  elongation factor                                       220   6e-67   Saccharum officinarum [noble cane]
gb|EMS52529.1|  Elongation factor 1-alpha                               220   6e-67   Triticum urartu
ref|XP_007207457.1|  hypothetical protein PRUPE_ppa005717mg             220   6e-67   Prunus persica
gb|AFP44110.1|  elongation factor 1-alpha                               220   6e-67   Lycoris longituba
ref|XP_001753059.1|  predicted protein                                  220   6e-67   
ref|XP_011026991.1|  PREDICTED: elongation factor 1-alpha isoform X1    220   6e-67   Populus euphratica
ref|XP_009380678.1|  PREDICTED: elongation factor 1-alpha-like          220   6e-67   
sp|Q41803.1|EF1A_MAIZE  RecName: Full=Elongation factor 1-alpha; ...    220   6e-67   Zea mays [maize]
gb|AFC88830.1|  putative elongation factor 1-alpha                      220   6e-67   Miscanthus sinensis
gb|KHG27341.1|  Elongation factor 1-alpha                               220   6e-67   Gossypium arboreum [tree cotton]
ref|XP_009421379.1|  PREDICTED: elongation factor 1-alpha-like          220   6e-67   
ref|XP_004163381.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    220   6e-67   
ref|NP_001288407.1|  elongation factor 1-alpha-like                     220   6e-67   Zea mays [maize]
gb|AFQ37422.1|  translation elongation factor-1 alpha 1                 220   6e-67   Larix kaempferi [karamatsu]
gb|AIZ74328.1|  translation elongation factor 1-alpha                   220   6e-67   Pinus massoniana [Chinese red pine]
ref|NP_001105565.1|  elongation factor alpha5                           220   6e-67   
sp|Q03033.1|EF1A_WHEAT  RecName: Full=Elongation factor 1-alpha; ...    220   6e-67   Triticum aestivum [Canadian hard winter wheat]
gb|ABR17675.1|  unknown                                                 220   7e-67   Picea sitchensis
ref|XP_001753167.1|  predicted protein                                  220   7e-67   
ref|XP_008349743.1|  PREDICTED: elongation factor 1-alpha isoform X2    219   7e-67   
ref|XP_004157309.1|  PREDICTED: elongation factor 1-alpha-like          220   7e-67   
gb|ACN40740.1|  unknown                                                 220   7e-67   Picea sitchensis
ref|XP_008224492.1|  PREDICTED: elongation factor 1-alpha               220   7e-67   Prunus mume [ume]
ref|XP_009783256.1|  PREDICTED: elongation factor 1-alpha               220   7e-67   Nicotiana sylvestris
gb|ACG31866.1|  elongation factor 1-alpha                               220   7e-67   Zea mays [maize]
ref|XP_008656156.1|  PREDICTED: elongation factor 1-alpha-like is...    220   7e-67   Zea mays [maize]
ref|XP_007143679.1|  hypothetical protein PHAVU_007G092500g             220   7e-67   Phaseolus vulgaris [French bean]
ref|XP_009392715.1|  PREDICTED: elongation factor 1-alpha-like          220   7e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004307410.1|  PREDICTED: elongation factor 1-alpha               220   7e-67   Fragaria vesca subsp. vesca
ref|XP_001763194.1|  predicted protein                                  220   7e-67   
ref|NP_001105933.1|  elongation factor alpha2                           220   7e-67   
ref|XP_008656153.1|  PREDICTED: elongation factor 1-alpha-like          220   7e-67   Zea mays [maize]
ref|XP_004962249.1|  PREDICTED: elongation factor 1-alpha-like          220   7e-67   
ref|XP_009793830.1|  PREDICTED: elongation factor 1-alpha-like          220   7e-67   Nicotiana sylvestris
ref|XP_008358325.1|  PREDICTED: elongation factor 1-alpha               220   7e-67   Malus domestica [apple tree]
ref|NP_001105934.1|  elongation factor alpha7                           220   7e-67   
dbj|BAH19898.1|  AT1G07930                                              220   7e-67   Arabidopsis thaliana [mouse-ear cress]
gb|KDO48480.1|  hypothetical protein CISIN_1g0132372mg                  220   7e-67   Citrus sinensis [apfelsine]
ref|NP_001288465.1|  elongation factor 1-alpha-like                     220   7e-67   Zea mays [maize]
ref|XP_001766482.1|  predicted protein                                  220   7e-67   
gb|ACG34498.1|  elongation factor 1-alpha                               220   7e-67   Zea mays [maize]
ref|XP_007222129.1|  hypothetical protein PRUPE_ppa005702mg             220   7e-67   Prunus persica
ref|NP_200847.1|  elongation factor 1-alpha 4                           220   7e-67   Arabidopsis thaliana [mouse-ear cress]
gb|KHG20498.1|  Elongation factor 1-alpha                               220   7e-67   Gossypium arboreum [tree cotton]
ref|XP_008385284.1|  PREDICTED: elongation factor 1-alpha-like          220   7e-67   
ref|XP_011040946.1|  PREDICTED: elongation factor 1-alpha-like is...    220   7e-67   Populus euphratica
gb|KHN18669.1|  Elongation factor 1-alpha                               220   8e-67   Glycine soja [wild soybean]
ref|NP_001237425.1|  elongation factor-1A                               220   8e-67   
ref|XP_009144204.1|  PREDICTED: elongation factor 1-alpha 1-like        220   8e-67   Brassica rapa
ref|XP_006280459.1|  hypothetical protein CARUB_v10026391mg             220   8e-67   Capsella rubella
gb|AAL32631.1|  putative elongation factor 1-a                          220   8e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007151789.1|  hypothetical protein PHAVU_004G075100g             220   8e-67   Phaseolus vulgaris [French bean]
ref|XP_007205199.1|  hypothetical protein PRUPE_ppa005718mg             220   8e-67   Prunus persica
gb|AGT16893.1|  elongation factor 1-alpha                               220   8e-67   Saccharum hybrid cultivar R570
ref|NP_001105617.1|  elongation factor alpha3                           220   8e-67   Zea mays [maize]
ref|NP_001280807.1|  elongation factor 1-alpha-like                     220   8e-67   Malus domestica [apple tree]
ref|XP_009131916.1|  PREDICTED: elongation factor 1-alpha 1-like        220   8e-67   Brassica rapa
ref|XP_007015466.1|  GTP binding Elongation factor Tu family prot...    220   8e-67   Theobroma cacao [chocolate]
ref|XP_007015463.1|  GTP binding Elongation factor Tu family protein    220   8e-67   
gb|ACS68200.1|  elongation factor 1 alpha                               220   8e-67   Brassica napus [oilseed rape]
ref|XP_009148045.1|  PREDICTED: elongation factor 1-alpha 1             220   8e-67   Brassica rapa
gb|AAL57653.1|  At1g07930/T6D22_3                                       220   8e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009420035.1|  PREDICTED: elongation factor 1-alpha               220   8e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004309883.1|  PREDICTED: elongation factor 1-alpha-like          220   8e-67   Fragaria vesca subsp. vesca
sp|P43643.1|EF1A_TOBAC  RecName: Full=Elongation factor 1-alpha; ...    220   8e-67   Nicotiana tabacum [American tobacco]
gb|ACR38047.1|  unknown                                                 220   8e-67   Zea mays [maize]
gb|ACI96243.1|  elongation factor 1-alpha                               220   8e-67   Prunus persica
ref|XP_004962277.1|  PREDICTED: elongation factor 1-alpha-like is...    220   8e-67   Setaria italica
ref|XP_009126611.1|  PREDICTED: elongation factor 1-alpha 1-like        220   8e-67   Brassica rapa
gb|AFW77593.1|  putative translation elongation factor Tu family ...    220   8e-67   
ref|XP_006600131.1|  PREDICTED: elongation factor-1A isoform X1         220   8e-67   
ref|XP_004309880.1|  PREDICTED: elongation factor 1-alpha               220   8e-67   Fragaria vesca subsp. vesca
gb|AAL79774.1|AF331849_1  elongation factor 1 alpha                     220   8e-67   Saccharum hybrid cultivar CP65-357
ref|XP_006417745.1|  hypothetical protein EUTSA_v10007619mg             220   8e-67   Eutrema salsugineum [saltwater cress]
ref|XP_008380545.1|  PREDICTED: elongation factor 1-alpha-like          220   8e-67   Malus domestica [apple tree]
gb|ABD66517.1|  EF-1 alpha                                              220   8e-67   Gymnadenia conopsea
ref|XP_010032225.1|  PREDICTED: elongation factor 1-alpha-like          220   8e-67   Eucalyptus grandis [rose gum]
ref|XP_009342345.1|  PREDICTED: elongation factor 1-alpha-like          219   8e-67   Pyrus x bretschneideri [bai li]
ref|XP_006858667.1|  hypothetical protein AMTR_s00066p00072310          219   8e-67   Amborella trichopoda
gb|AEQ75495.1|  elongation factor 1-alpha                               219   8e-67   Rosa multiflora [Japanese rose]
gb|AAK25877.1|AF360167_1  putative translation elongation factor ...    220   8e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006378755.1|  hypothetical protein POPTR_0010s22560g             220   8e-67   
ref|XP_004489551.1|  PREDICTED: elongation factor 1-alpha-like          219   8e-67   Cicer arietinum [garbanzo]
ref|XP_008224543.1|  PREDICTED: elongation factor 1-alpha               219   9e-67   Prunus mume [ume]
ref|XP_006436251.1|  hypothetical protein CICLE_v10033471mg             219   9e-67   Citrus clementina [clementine]
dbj|BAM13877.1|  elongation factor 1 alpha                              219   9e-67   Arum maculatum [cuckoo-pint]
gb|AAN31833.1|  putative translation elongation factor eEF-1 alph...    219   9e-67   Arabidopsis thaliana [mouse-ear cress]
gb|EYU18863.1|  hypothetical protein MIMGU_mgv1a006280mg                219   9e-67   Erythranthe guttata [common monkey flower]
ref|XP_006387491.1|  hypothetical protein POPTR_0966s00200g             219   9e-67   Populus trichocarpa [western balsam poplar]
ref|XP_004984833.1|  PREDICTED: elongation factor 1-alpha-like          219   9e-67   Setaria italica
gb|AAF99703.1|  elongation factor                                       219   9e-67   Saccharum officinarum [noble cane]
ref|XP_011031783.1|  PREDICTED: elongation factor 1-alpha-like          219   9e-67   Populus euphratica
ref|XP_001753181.1|  predicted protein                                  219   9e-67   
sp|P25698.2|EF1A_SOYBN  RecName: Full=Elongation factor 1-alpha; ...    219   9e-67   Glycine max [soybeans]
ref|XP_001763201.1|  predicted protein                                  219   9e-67   
gb|AGV54713.1|  elongation factor 1-alpha                               219   9e-67   Phaseolus vulgaris [French bean]
ref|XP_011026992.1|  PREDICTED: elongation factor 1-alpha isoform X2    219   1e-66   Populus euphratica
ref|NP_001032107.1|  elongation factor 1-alpha 4                        218   1e-66   
ref|XP_007218005.1|  hypothetical protein PRUPE_ppa005706mg             219   1e-66   Prunus persica
ref|XP_010456376.1|  PREDICTED: elongation factor 1-alpha 1 isofo...    218   1e-66   
gb|AGC94754.1|  elongation factor 1 alpha                               219   1e-66   Euphorbia lathyris
ref|XP_010032223.1|  PREDICTED: elongation factor 1-alpha isoform X2    219   1e-66   Eucalyptus grandis [rose gum]
ref|XP_008790814.1|  PREDICTED: elongation factor 1-alpha-like          219   1e-66   Phoenix dactylifera
gb|AGV54654.1|  elongation factor 1-alpha                               219   1e-66   Phaseolus vulgaris [French bean]
ref|XP_008233357.1|  PREDICTED: elongation factor 1-alpha-like          219   1e-66   Prunus mume [ume]
gb|KDP29086.1|  hypothetical protein JCGZ_16475                         219   1e-66   Jatropha curcas
ref|XP_002315287.1|  hypothetical protein POPTR_0010s22620g             219   1e-66   
gb|AAR82894.1|  elongation factor 1-alpha                               219   1e-66   Cichorium intybus [radicchio]
ref|XP_007027265.1|  GTP binding Elongation factor Tu family protein    222   1e-66   
gb|ABF00115.1|  elongation factor 1-alpha                               219   1e-66   Litchi chinensis [litchi]
ref|XP_010939624.1|  PREDICTED: elongation factor 1-alpha-like          219   1e-66   Elaeis guineensis
gb|AAN77897.1|  elongation factor 1 alpha                               219   1e-66   Stevia rebaudiana
ref|NP_001234035.1|  elongation factor 1-alpha                          219   1e-66   Solanum lycopersicum
gb|AID52924.1|  elongation factor 1-alpha                               219   1e-66   Carthamus tinctorius
gb|ABV26710.1|  elongation factor 1 alpha                               219   1e-66   Gerbera hybrid cultivar
sp|P34823.1|EF1A2_DAUCA  RecName: Full=Elongation factor 1-alpha;...    219   1e-66   Daucus carota [carrots]
ref|XP_002518073.1|  elongation factor 1-alpha, putative                219   1e-66   Ricinus communis
gb|ABB86283.1|  elongation factor-1 alpha-like                          219   1e-66   Solanum tuberosum [potatoes]
gb|AHB86963.1|  elongation factor 1-alpha                               219   1e-66   Sedum alfredii
gb|ADD71925.1|  translation elongation factor 1 alpha                   218   1e-66   Actaea racemosa
dbj|BAC23049.1|  Elongation factor 1-alpha                              219   2e-66   Solanum tuberosum [potatoes]
gb|ABB72813.1|  elongation factor 1-alpha-like protein                  219   2e-66   Solanum tuberosum [potatoes]
ref|NP_001274875.1|  elongation factor 1-alpha-like protein             219   2e-66   Solanum tuberosum [potatoes]
ref|XP_008380544.1|  PREDICTED: elongation factor 1-alpha-like          219   2e-66   Malus domestica [apple tree]
dbj|BAC66180.1|  elongation factor 1A                                   219   2e-66   Avicennia marina
gb|AGJ50595.1|  EF1alpha                                                219   2e-66   Pericallis cruenta
gb|AEN79476.1|  elongation factor 1-alpha                               219   2e-66   Ziziphus jujuba [Chinese jujube]
dbj|BAL14665.1|  elongation factor 1-alpha                              219   2e-66   
gb|AHE76183.1|  elongation factor 1-alpha                               219   2e-66   
ref|XP_006343452.1|  PREDICTED: elongation factor 1-alpha-like          219   2e-66   
gb|AIX10769.1|  elongation factor 1 alpha                               219   2e-66   
gb|AFQ37423.1|  translation elongation factor-1 alpha 2                 219   2e-66   
emb|CDX95108.1|  BnaC05g05630D                                          220   2e-66   
ref|XP_002312029.1|  ADR12-2 family protein                             219   2e-66   
ref|XP_002311107.1|  ADR12-2 family protein                             219   2e-66   
gb|AAK32834.1|AF361822_1  At1g07930/T6D22_3                             219   2e-66   
gb|EMS59091.1|  Elongation factor 1-alpha                               220   2e-66   
gb|AGI78242.1|  elongation factor 1 alpha                               218   2e-66   
ref|XP_002311106.1|  ADR12-2 family protein                             219   2e-66   
dbj|BAM13874.1|  elongation factor 1 alpha                              218   2e-66   
ref|NP_001105935.1|  elongation factor alpha8                           218   2e-66   
emb|CAA34456.1|  elongation factor 1-alpha                              218   2e-66   
ref|XP_009126609.1|  PREDICTED: elongation factor 1-alpha 1-like        218   3e-66   
ref|XP_003618775.1|  Elongation factor 1-alpha                          226   3e-66   
gb|ACN41180.1|  unknown                                                 218   4e-66   
gb|ABK24265.1|  unknown                                                 218   4e-66   
gb|ABK25072.1|  unknown                                                 218   4e-66   
gb|ABK24843.1|  unknown                                                 218   4e-66   
ref|XP_003591959.1|  Elongation factor 1-alpha                          221   4e-66   
gb|AES59072.2|  GTP-binding elongation factor Tu family protein         218   4e-66   
ref|XP_003588821.1|  Elongation factor 1-alpha                          218   5e-66   
gb|ABX82323.1|  elongation factor 1 subunit alpha                       210   7e-66   
ref|XP_002968422.1|  hypothetical protein SELMODRAFT_169717             217   7e-66   
ref|XP_002968419.1|  hypothetical protein SELMODRAFT_270693             217   8e-66   
ref|XP_005650451.1|  translation elongation factor                      217   1e-65   
dbj|BAF02151.1|  elongation factor 1-alpha                              217   1e-65   
dbj|BAC22126.1|  eukaryotic elongation factor 1A                        217   1e-65   
ref|XP_010669658.1|  PREDICTED: elongation factor 1-alpha-like          216   1e-65   
gb|KJB76560.1|  hypothetical protein B456_012G094600                    216   1e-65   
ref|XP_010669657.1|  PREDICTED: elongation factor 1-alpha               216   1e-65   
gb|EMS49772.1|  Elongation factor 1-alpha                               216   1e-65   
dbj|BAC22127.1|  eukaryotic elongation factor 1A                        216   2e-65   
gb|EMT12343.1|  Elongation factor 1-alpha                               216   2e-65   
sp|P34824.1|EF1A1_HORVU  RecName: Full=Elongation factor 1-alpha;...    216   2e-65   
ref|XP_010669660.1|  PREDICTED: elongation factor 1-alpha-like          216   2e-65   
gb|ACN59918.1|  translation elongation factor-1 alpha                   209   2e-65   
gb|AEE98364.1|  elongation factor 1-alpha                               216   2e-65   
gb|EMS65134.1|  Elongation factor 1-alpha                               220   2e-65   
ref|XP_002970583.1|  hypothetical protein SELMODRAFT_171512             216   2e-65   
ref|XP_002970579.1|  hypothetical protein SELMODRAFT_270852             216   3e-65   
gb|ABF94276.1|  Elongation factor 1-alpha, putative, expressed          216   4e-65   
ref|NP_001104939.1|  elongation factor alpha6                           215   4e-65   
gb|AER42621.1|  elongation factor 1 alpha                               215   5e-65   
dbj|BAK08744.1|  elongation factor 1-alpha                              215   6e-65   
dbj|BAK08818.1|  elongation factor 1-alpha                              215   6e-65   
dbj|BAK08819.1|  elongation factor 1-alpha                              215   6e-65   
sp|Q40034.1|EF1A2_HORVU  RecName: Full=Elongation factor 1-alpha;...    214   1e-64   
ref|XP_004143833.1|  PREDICTED: uncharacterized protein LOC101220517    221   1e-64   
gb|ACN40081.1|  unknown                                                 214   1e-64   
gb|AGD99674.1|  eukaryotic elongation factor 1A                         214   2e-64   
gb|AAK82537.1|  At1g07930/T6D22_3                                       213   3e-64   
ref|XP_011031813.1|  PREDICTED: LOW QUALITY PROTEIN: HBS1-like pr...    221   3e-64   
ref|XP_002892424.1|  T6D22.2                                            219   6e-64   
gb|AAF79822.1|AC026875_2  T6D22.2                                       219   8e-64   
gb|EMT09703.1|  Elongation factor 1-alpha                               218   9e-64   
ref|XP_011031786.1|  PREDICTED: elongation factor 1-alpha-like          209   1e-63   
ref|XP_002488881.1|  hypothetical protein SORBIDRAFT_2635s002010        202   1e-63   
gb|AGF25313.1|  elongation factor 1-alpha                               204   1e-63   
dbj|BAG80668.1|  elongation factor 1 alpha                              209   2e-63   
dbj|BAK23239.1|  eukaryotic translation elongation factor 1 alpha       210   3e-63   
gb|AAL79775.1|  elongation factor 1 alpha                               210   4e-63   
gb|AHY22512.1|  elongation factor-1 alpha                               201   4e-63   
ref|XP_002488910.1|  hypothetical protein SORBIDRAFT_2002s002020        202   5e-63   
gb|AAD28440.1|  elongation factor 1-alpha                               209   6e-63   
ref|XP_004413149.1|  PREDICTED: elongation factor 1-alpha 1             200   9e-63   
ref|XP_004696599.1|  PREDICTED: elongation factor 1-alpha 1             198   1e-62   
emb|CAC27139.1|  translation elongation factor-1 alpha                  209   1e-62   
dbj|BAC56481.1|  similar to elongation factor 1 alpha                   200   1e-62   
ref|XP_006835853.1|  PREDICTED: elongation factor 1-alpha 1             201   1e-62   
dbj|BAI52945.1|  elongation factor-1 alpha                              200   1e-62   
gb|ADG23121.1|  elongation factor 1-alpha                               199   2e-62   
gb|AAY56745.1|  elongation factor 1-alpha                               201   2e-62   
emb|CAA65798.1|  EF1-alpha                                              201   2e-62   
gb|ELK00147.1|  Elongation factor 1-alpha 1                             201   2e-62   
ref|NP_872243.1|  Protein EEF-1A.2, isoform c                           203   2e-62   
ref|XP_003421836.1|  PREDICTED: elongation factor 1-alpha 2             211   2e-62   
emb|CAF89665.1|  unnamed protein product                                204   2e-62   
ref|XP_855343.2|  PREDICTED: spidroin-2-like                            211   2e-62   
ref|XP_009490089.1|  PREDICTED: elongation factor 1-alpha 2-like        201   3e-62   
dbj|BAE48211.1|  elongation factor 1 alpha                              201   3e-62   
ref|XP_010995318.1|  PREDICTED: elongation factor 1-alpha 2             210   3e-62   
gb|ABC74971.1|  elongation factor 1 alpha                               201   4e-62   
ref|XP_011279138.1|  PREDICTED: elongation factor 1-alpha 2             210   4e-62   
gb|AAQ15281.1|  elongation factor 1 alpha                               201   5e-62   
emb|CAA68246.1|  factor 1-alpha                                         201   5e-62   
gb|EDL77726.1|  rCG25445, isoform CRA_g                                 200   5e-62   
ref|XP_009435907.1|  PREDICTED: elongation factor 1-alpha 2             201   6e-62   
gb|AAQ15280.1|  elongation factor 1 alpha                               201   8e-62   
ref|XP_007087142.1|  PREDICTED: elongation factor 1-alpha 2             209   8e-62   
ref|XP_010834950.1|  PREDICTED: elongation factor 1-alpha 2             210   9e-62   
emb|CAF89666.1|  unnamed protein product                                203   1e-61   
gb|KFG54794.1|  elongation factor 1-alpha                               197   1e-61   
gb|KFH06452.1|  elongation factor 1-alpha                               196   1e-61   
gb|AGH70141.1|  eukaryotic translation elongation factor 1 alpha        199   1e-61   
ref|XP_003781883.1|  PREDICTED: elongation factor 1-alpha 1-like        198   1e-61   
gb|ELW50063.1|  Putative elongation factor 1-alpha-like 3               200   1e-61   
gb|KFG35314.1|  elongation factor 1-alpha                               196   1e-61   
gb|EDL26406.1|  mCG15232, isoform CRA_g                                 201   2e-61   
gb|EDL77725.1|  rCG25445, isoform CRA_f                                 201   2e-61   
gb|EDL77722.1|  rCG25445, isoform CRA_c                                 201   2e-61   
gb|KFG37329.1|  elongation factor 1-alpha                               196   2e-61   
ref|XP_005993540.1|  PREDICTED: elongation factor 1-alpha 2             204   2e-61   
ref|XP_010736052.1|  PREDICTED: elongation factor 1-alpha-like          196   2e-61   
gb|KFG40096.1|  elongation factor 1-alpha                               196   2e-61   
gb|AFV81460.1|  elongation factor 1-alpha                               196   2e-61   
gb|EDL26403.1|  mCG15232, isoform CRA_d                                 201   2e-61   
emb|CDP93911.1|  Protein Bm5195, isoform b                              199   2e-61   
gb|AAV71174.1|  elongation factor 1-alpha                               199   2e-61   
ref|XP_004062574.1|  PREDICTED: elongation factor 1-alpha 2             208   2e-61   
gb|AAR89627.1|  elongation factor 1 alpha                               199   2e-61   
gb|ADN94290.1|  elongation factor 1                                     204   3e-61   
ref|XP_006078264.1|  PREDICTED: elongation factor 1-alpha 1-like        200   3e-61   
ref|XP_004635811.1|  PREDICTED: elongation factor 1-alpha 1-like        204   3e-61   
gb|KFQ31255.1|  Elongation factor 1-alpha 2                             206   3e-61   
gb|EJW71788.1|  elongation factor 1-alpha                               199   3e-61   
gb|ELR44723.1|  Elongation factor 1-alpha 2                             206   3e-61   
ref|XP_003794755.1|  PREDICTED: elongation factor 1-alpha 1-like        198   4e-61   
gb|AIM46986.1|  translation elongation factor 1-alpha                   205   4e-61   
ref|XP_006870724.1|  PREDICTED: elongation factor 1-alpha 1-like        195   4e-61   
gb|ADI60310.1|  elongation factor 1-alpha                               205   4e-61   
ref|XP_006235797.1|  PREDICTED: elongation factor 1-alpha 2 isofo...    206   4e-61   
gb|ADJ18335.1|  elongation factor 1 alpha                               194   4e-61   
ref|XP_006104297.1|  PREDICTED: elongation factor 1-alpha 2             202   5e-61   
ref|NP_001275481.1|  elongation factor 1-alpha-like                     204   5e-61   
ref|XP_004074126.1|  PREDICTED: elongation factor 1-alpha               205   6e-61   
ref|XP_008072606.1|  PREDICTED: putative elongation factor 1-alph...    198   6e-61   
gb|AAT91089.1|  elongation factor 1-alpha                               205   6e-61   
tpg|DAA16277.1|  TPA: EF1a-like protein-like                            201   6e-61   
ref|XP_003968867.1|  PREDICTED: elongation factor 1-alpha-like          205   6e-61   
gb|ADX97228.1|  elongation factor 1 alpha                               198   6e-61   
ref|XP_002604722.1|  hypothetical protein BRAFLDRAFT_122567             205   7e-61   
ref|XP_010736036.1|  PREDICTED: elongation factor 1-alpha               204   7e-61   
gb|ACN10382.1|  Elongation factor 1-alpha, oocyte form                  198   7e-61   
gb|ELW65822.1|  Elongation factor 1-alpha 1                             201   7e-61   
ref|XP_006268032.1|  PREDICTED: elongation factor 1-alpha, oocyte...    204   8e-61   
ref|XP_006639575.1|  PREDICTED: elongation factor 1-alpha 2-like        204   8e-61   
gb|EHH19518.1|  hypothetical protein EGK_02189                          204   8e-61   
dbj|BAN33726.1|  elongation factor 1alpha                               204   8e-61   
ref|XP_008329252.1|  PREDICTED: elongation factor 1-alpha               204   8e-61   
gb|EDL77724.1|  rCG25445, isoform CRA_e                                 201   9e-61   
ref|XP_006130557.1|  PREDICTED: elongation factor 1-alpha, oocyte...    204   9e-61   
ref|XP_005302147.1|  PREDICTED: elongation factor 1-alpha 1-like        204   9e-61   
gb|EDL26401.1|  mCG15232, isoform CRA_b                                 201   9e-61   
ref|XP_007067667.1|  PREDICTED: elongation factor 1-alpha, oocyte...    204   9e-61   
gb|ETW34463.1|  elongation factor 1-alpha                               194   1e-60   
ref|XP_006019355.1|  PREDICTED: elongation factor 1-alpha, oocyte...    204   1e-60   
sp|Q41011.1|EF1A_PEA  RecName: Full=Elongation factor 1-alpha; Sh...    204   1e-60   
ref|NP_001002371.1|  elongation factor 1-alpha 2                        204   1e-60   
gb|ADJ18332.1|  elongation factor 1 alpha                               204   1e-60   
dbj|BAF64485.1|  elongation factor 1 alpha isoform 2                    204   1e-60   
ref|XP_011217823.1|  PREDICTED: putative elongation factor 1-alph...    200   1e-60   
ref|XP_007664608.1|  PREDICTED: elongation factor 1-alpha 1-like        196   1e-60   
dbj|BAD35019.1|  elongation factor 1 alpha                              204   1e-60   
gb|ADJ18333.1|  elongation factor 1 alpha                               204   1e-60   
dbj|BAG60202.1|  unnamed protein product                                202   1e-60   
ref|XP_005739860.1|  PREDICTED: elongation factor 1-alpha-like          204   1e-60   
emb|CDQ86379.1|  unnamed protein product                                200   1e-60   
gb|ADJ18334.1|  elongation factor 1 alpha                               204   1e-60   
ref|XP_004572773.1|  PREDICTED: elongation factor 1-alpha-like          204   1e-60   
emb|CDR18720.1|  elongation factor 1-alpha, putative                    195   1e-60   
ref|XP_006872109.1|  PREDICTED: elongation factor 1-alpha 1-like        199   1e-60   
ref|XP_011231232.1|  PREDICTED: elongation factor 1-alpha 2             203   1e-60   
gb|EHB17794.1|  Elongation factor 1-alpha 2                             203   1e-60   
dbj|GAN00818.1|  hypothetical protein MAM1_0002c00242                   197   1e-60   
ref|XP_008329250.1|  PREDICTED: elongation factor 1-alpha-like          204   1e-60   
ref|XP_006167177.1|  PREDICTED: elongation factor 1-alpha 2             202   2e-60   
ref|XP_009793886.1|  PREDICTED: elongation factor 1-alpha-like          199   2e-60   
ref|NP_571338.1|  elongation factor 1-alpha                             204   2e-60   
ref|XP_001118614.1|  PREDICTED: elongation factor 1-alpha 1-like        197   2e-60   
gb|AAO49408.1|AF485331_1  elongation factor 1-alpha                     204   2e-60   
gb|KFW90563.1|  Elongation factor 1-alpha 2                             204   2e-60   
gb|EFB18810.1|  hypothetical protein PANDA_015263                       203   2e-60   
ref|XP_005993968.1|  PREDICTED: elongation factor 1-alpha, oocyte...    204   2e-60   
ref|XP_007245773.1|  PREDICTED: elongation factor 1-alpha-like          204   2e-60   
dbj|BAB64567.1|  elongation factor-1 alpha                              204   2e-60   
gb|AAI28792.1|  Zgc:109885 protein                                      204   2e-60   
gb|KFO53270.1|  Elongation factor 1-alpha 2                             204   2e-60   
ref|XP_001085675.2|  PREDICTED: elongation factor 1-alpha 2-like ...    202   2e-60   
ref|XP_005325458.1|  PREDICTED: elongation factor 1-alpha 2             203   2e-60   
ref|NP_001035074.1|  eukaryotic translation elongation factor 1 a...    204   2e-60   
dbj|BAJ07356.1|  elongation factor 1                                    196   2e-60   
dbj|BAO56800.1|  elongation factor 1-alpha                              204   2e-60   
ref|XP_005802896.1|  PREDICTED: elongation factor 1-alpha-like          204   2e-60   
ref|XP_009502156.1|  PREDICTED: elongation factor 1-alpha 2             204   2e-60   
gb|KGL80348.1|  Elongation factor 1-alpha 2                             202   2e-60   
ref|XP_002799708.1|  PREDICTED: elongation factor 1-alpha 1-like        202   2e-60   
gb|KFP67571.1|  Elongation factor 1-alpha 2                             203   2e-60   
gb|AIM48895.1|  elongation factor 1-alpha                               203   2e-60   
gb|EMC83487.1|  Elongation factor 1-alpha 2                             204   2e-60   
gb|AAA41967.1|  statin-related protein                                  204   2e-60   
gb|KFO77542.1|  Elongation factor 1-alpha 2                             204   2e-60   
ref|XP_010072036.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    204   2e-60   
gb|AAV38607.1|  eukaryotic translation elongation factor 1 alpha 2      204   2e-60   
ref|XP_004785941.1|  PREDICTED: elongation factor 1-alpha 2 isofo...    203   2e-60   
gb|KFP28483.1|  Elongation factor 1-alpha 2                             203   2e-60   
ref|XP_008155341.1|  PREDICTED: elongation factor 1-alpha 2             203   2e-60   
ref|XP_006896948.1|  PREDICTED: elongation factor 1-alpha 2             203   2e-60   
ref|XP_007655497.1|  PREDICTED: elongation factor 1-alpha-like          200   2e-60   
gb|KFR06778.1|  Elongation factor 1-alpha 2                             204   2e-60   
ref|XP_004586009.1|  PREDICTED: elongation factor 1-alpha 2             203   2e-60   
ref|XP_007059884.1|  PREDICTED: elongation factor 1-alpha 2             203   2e-60   
gb|KFO87544.1|  Elongation factor 1-alpha 2                             204   2e-60   
gb|KFV74107.1|  Elongation factor 1-alpha 2                             204   2e-60   
gb|KFV47908.1|  Elongation factor 1-alpha 2                             204   2e-60   
ref|XP_002747797.1|  PREDICTED: elongation factor 1-alpha 2             203   2e-60   
ref|NP_031932.1|  elongation factor 1-alpha 2                           203   2e-60   
ref|XP_004410177.1|  PREDICTED: elongation factor 1-alpha 2 isofo...    203   2e-60   
ref|XP_005885616.1|  PREDICTED: elongation factor 1-alpha 2             203   2e-60   
ref|XP_005965035.1|  PREDICTED: putative elongation factor 1-alph...    202   2e-60   
gb|AEE61578.1|  unknown                                                 203   2e-60   
ref|XP_010208031.1|  PREDICTED: elongation factor 1-alpha 2             203   2e-60   
gb|AAX43357.1|  eukaryotic translation elongation factor 1 alpha 2      203   2e-60   
ref|XP_004620338.1|  PREDICTED: elongation factor 1-alpha 2 isofo...    203   2e-60   
ref|NP_001949.1|  elongation factor 1-alpha 2                           203   2e-60   
ref|XP_004370231.1|  PREDICTED: elongation factor 1-alpha 2 isofo...    203   2e-60   
ref|XP_006994680.1|  PREDICTED: elongation factor 1-alpha 2 isofo...    203   2e-60   
ref|NP_001080856.1|  eukaryotic translation elongation factor 1 a...    203   2e-60   
ref|XP_009818875.1|  PREDICTED: elongation factor 1-alpha 2             203   2e-60   



>dbj|BAJ91931.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=144

 Score =   219 bits (558),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AGH32904.1| translation elongation factor 1-alpha, partial [Camellia oleifera]
Length=149

 Score =   219 bits (557),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|KJB73625.1| hypothetical protein B456_011G2412001, partial [Gossypium raimondii]
Length=144

 Score =   218 bits (556),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|KJB73629.1| hypothetical protein B456_011G2414002, partial [Gossypium raimondii]
Length=154

 Score =   219 bits (557),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AFW76433.1| putative translation elongation factor Tu family protein [Zea 
mays]
Length=130

 Score =   217 bits (552),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|EAY88762.1| hypothetical protein OsI_10238 [Oryza sativa Indica Group]
Length=156

 Score =   218 bits (554),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_004172806.1| PREDICTED: elongation factor 1-alpha-like, partial [Cucumis sativus]
Length=128

 Score =   216 bits (551),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_002538495.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF23888.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=167

 Score =   218 bits (554),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/107 (97%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>emb|CDP07148.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   225 bits (574),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>emb|CDY09214.1| BnaA02g06400D [Brassica napus]
Length=160

 Score =   217 bits (553),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_006307727.1| hypothetical protein CARUB_v100096371mg, partial [Capsella rubella]
 gb|EOA40625.1| hypothetical protein CARUB_v100096371mg, partial [Capsella rubella]
Length=154

 Score =   217 bits (552),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>emb|CDP08919.1| unnamed protein product [Coffea canephora]
Length=432

 Score =   226 bits (575),  Expect = 3e-69, Method: Composition-based stats.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|ACG70967.1| translation elongation factor 1, partial [Ziziphus jujuba]
Length=227

 Score =   219 bits (558),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AFW77598.1| putative translation elongation factor Tu family protein [Zea 
mays]
Length=167

 Score =   217 bits (553),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AEQ94148.1| elongation factor 1 [Elaeis guineensis]
Length=221

 Score =   219 bits (558),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AEG78681.1| elongation factor 1 alpha [Erythroxylum coca]
Length=211

 Score =   218 bits (556),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_008465824.1| PREDICTED: elongation factor 1-alpha-like [Cucumis melo]
Length=273

 Score =   220 bits (560),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AEK98799.1| translation elongation factor 1 alfa [Carthamus tinctorius]
Length=248

 Score =   218 bits (554),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETNKYYCTVIDAPGHRDFIKNMITGTS  107



>emb|CDO98621.1| unnamed protein product [Coffea canephora]
Length=355

 Score =   221 bits (563),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_007009762.1| GTP binding Elongation factor Tu family protein isoform 3, partial 
[Theobroma cacao]
 gb|EOY18572.1| GTP binding Elongation factor Tu family protein isoform 3, partial 
[Theobroma cacao]
Length=367

 Score =   221 bits (563),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AFW87115.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW87116.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW87117.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
 gb|AFW87118.1| putative translation elongation factor Tu family protein isoform 
4 [Zea mays]
 gb|AFW87119.1| putative translation elongation factor Tu family protein isoform 
5 [Zea mays]
Length=255

 Score =   217 bits (553),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|KDP29085.1| hypothetical protein JCGZ_16474 [Jatropha curcas]
Length=418

 Score =   222 bits (566),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_010248287.1| PREDICTED: elongation factor 1-alpha, partial [Nelumbo nucifera]
Length=382

 Score =   221 bits (563),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AFK35720.1| unknown [Medicago truncatula]
Length=126

 Score =   212 bits (540),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMIT  369
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMI+
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMIS  104



>gb|AFO67216.1| putative elongation factor 1-alpha, partial [Aralia elata]
Length=287

 Score =   218 bits (554),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_010542596.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   222 bits (566),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|KHG28979.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=447

 Score =   222 bits (566),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|NP_001290506.1| elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010922532.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 gb|AAT45847.1| elongation factor 1-alpha 1 [Elaeis guineensis]
Length=447

 Score =   222 bits (566),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_008783722.1| PREDICTED: elongation factor 1-alpha isoform X1 [Phoenix dactylifera]
Length=447

 Score =   222 bits (566),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|KCW51623.1| hypothetical protein EUGRSUZ_J01112 [Eucalyptus grandis]
Length=330

 Score =   219 bits (557),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|ABA12220.1| translation elongation factor 1A-4 [Gossypium hirsutum]
 gb|KJB62497.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62498.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62499.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
 gb|KJB62500.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
Length=447

 Score =   222 bits (566),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_010920912.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_010542598.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_008792062.1| PREDICTED: elongation factor 1-alpha [Phoenix dactylifera]
Length=447

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AGY80449.1| elongation factor 1-alpha [Dendrocalamus latiflorus]
Length=447

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|KCW65375.1| hypothetical protein EUGRSUZ_G02807 [Eucalyptus grandis]
Length=428

 Score =   221 bits (564),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_007151593.1| hypothetical protein PHAVU_004G060000g [Phaseolus vulgaris]
 gb|ESW23587.1| hypothetical protein PHAVU_004G060000g [Phaseolus vulgaris]
Length=447

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|ABA12219.1| translation elongation factor 1A-3 [Gossypium hirsutum]
Length=448

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_010541344.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|ABA12217.1| translation elongation factor 1A-1 [Gossypium hirsutum]
Length=447

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_010535587.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AFJ04514.1| elongation factor 1-alpha, partial [Vernicia fordii]
Length=438

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_010916901.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010910504.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_003536362.1| PREDICTED: elongation factor 1-alpha-like isoformX2 [Glycine 
max]
 ref|XP_006589439.1| PREDICTED: elongation factor 1-alpha-like isoform X3 [Glycine 
max]
 ref|XP_006589440.1| PREDICTED: elongation factor 1-alpha-like isoform X4 [Glycine 
max]
 gb|KHN17117.1| Elongation factor 1-alpha [Glycine soja]
Length=448

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AGI15328.1| elongation factor 1 [Aegiceras corniculatum]
Length=449

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|NP_001151074.1| elongation factor 1-alpha [Zea mays]
 gb|ACG41520.1| elongation factor 1-alpha [Zea mays]
 tpg|DAA63136.1| TPA: putative translation elongation factor Tu family protein 
[Zea mays]
Length=447

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_011091454.1| PREDICTED: elongation factor 1-alpha-like [Sesamum indicum]
Length=449

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_011089339.1| PREDICTED: elongation factor 1-alpha isoform X1 [Sesamum indicum]
 ref|XP_011089346.1| PREDICTED: elongation factor 1-alpha-like [Sesamum indicum]
Length=449

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|EPS66069.1| elongation factor 1-alpha, partial [Genlisea aurea]
Length=446

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_009358244.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
 ref|XP_009338285.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_003547695.1| PREDICTED: elongation factor 1-alpha isoform 2 [Glycine max]
 gb|KHN27573.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|KHN42761.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_010032227.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
 gb|KCW51630.1| hypothetical protein EUGRSUZ_J01121 [Eucalyptus grandis]
Length=447

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_010067278.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
Length=447

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_008792073.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|KHG26926.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=448

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_010521772.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_010557310.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
 ref|XP_010557311.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_011089874.1| PREDICTED: elongation factor 1-alpha [Sesamum indicum]
Length=449

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_009381507.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381508.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381509.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_008789061.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
 ref|XP_008789062.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
 ref|XP_008789063.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|ABF94275.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
Length=347

 Score =   219 bits (558),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_010937806.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_004251154.1| PREDICTED: elongation factor 1-alpha-like [Solanum lycopersicum]
Length=447

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_006340223.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
Length=447

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|ABA12225.1| translation elongation factor 1A-9 [Gossypium hirsutum]
Length=448

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AFW90638.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=309

 Score =   218 bits (555),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/107 (97%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|KHG01531.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB63252.1| hypothetical protein B456_010G2044001 [Gossypium raimondii]
Length=447

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_001763198.1| predicted protein [Physcomitrella patens]
 gb|EDQ72075.1| predicted protein [Physcomitrella patens]
Length=352

 Score =   219 bits (558),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETMKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|KDP29083.1| hypothetical protein JCGZ_16472 [Jatropha curcas]
Length=447

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|ABA12224.1| translation elongation factor 1A-8 [Gossypium hirsutum]
Length=449

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AAY56337.1| elongation factor-1 alpha [Musa acuminata]
Length=447

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|ADR70875.1| eukaryotic translation elongation factor 1-alpha [Hevea brasiliensis]
Length=449

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_010937512.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>dbj|BAA34348.1| elongation factor-1 alpha [Nicotiana paniculata]
Length=447

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|ABA12223.1| translation elongation factor 1A-7 [Gossypium hirsutum]
Length=448

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|KHG23927.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_007009760.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007009761.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18570.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18571.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_009762748.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AAX54511.1| elongation factor 1 alpha [Actinidia deliciosa]
Length=447

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_006846237.1| hypothetical protein AMTR_s00012p00237190 [Amborella trichopoda]
 gb|ERN07912.1| hypothetical protein AMTR_s00012p00237190 [Amborella trichopoda]
Length=447

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_003604587.1| Elongation factor 1-alpha [Medicago truncatula]
 gb|AES86784.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=447

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|ABA12221.1| translation elongation factor 1A-5 [Gossypium hirsutum]
Length=448

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_009403064.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_002277159.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_010658430.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN76417.1| hypothetical protein VITISV_018410 [Vitis vinifera]
 emb|CAN69000.1| hypothetical protein VITISV_022484 [Vitis vinifera]
Length=447

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AAD56020.1|AF181492_1 elongation factor-1 alpha 3 [Lilium longiflorum]
Length=447

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AAD56019.1|AF181491_1 elongation factor-1 alpha 2 [Lilium longiflorum]
Length=447

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_010937804.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
 ref|XP_010937805.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_011089340.1| PREDICTED: elongation factor 1-alpha isoform X2 [Sesamum indicum]
 ref|XP_011089341.1| PREDICTED: elongation factor 1-alpha isoform X3 [Sesamum indicum]
 ref|XP_011089342.1| PREDICTED: elongation factor 1-alpha isoform X4 [Sesamum indicum]
 ref|XP_011089875.1| PREDICTED: elongation factor 1-alpha [Sesamum indicum]
Length=449

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_010032221.1| PREDICTED: elongation factor 1-alpha isoform X1 [Eucalyptus grandis]
 ref|XP_010032222.1| PREDICTED: elongation factor 1-alpha isoform X1 [Eucalyptus grandis]
Length=449

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>sp|O49169.1|EF1A_MANES RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Manihot 
esculenta]
 gb|AAC39447.1| elongation factor 1-alpha [Manihot esculenta]
Length=449

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_007009751.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007009752.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18561.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18562.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_010032224.1| PREDICTED: elongation factor 1-alpha isoform X3 [Eucalyptus grandis]
Length=447

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_006856244.1| hypothetical protein AMTR_s00059p00216110 [Amborella trichopoda]
 gb|ERN17711.1| hypothetical protein AMTR_s00059p00216110 [Amborella trichopoda]
Length=447

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_002460859.1| hypothetical protein SORBIDRAFT_02g036420 [Sorghum bicolor]
 gb|EER97380.1| hypothetical protein SORBIDRAFT_02g036420 [Sorghum bicolor]
Length=447

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_009613861.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009626606.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009597916.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
Length=447

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AHA84124.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=447

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_009388387.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_004512426.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
 ref|XP_004512427.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
Length=448

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|EPS66340.1| elongation factor 1-alpha, partial [Genlisea aurea]
Length=441

 Score =   221 bits (564),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_009593325.1| PREDICTED: elongation factor 1-alpha [Nicotiana tomentosiformis]
Length=447

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_009403341.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_002528028.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF34346.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_010244958.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
 ref|XP_010244959.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
Length=449

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|ADR70874.1| eukaryotic translation elongation factor 1-alpha [Hevea brasiliensis]
Length=449

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AHZ58493.1| translation elongation factor alpha [Syntrichia caninervis]
Length=447

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_003604823.1| Elongation factor 1-alpha [Medicago truncatula]
Length=448

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AAL69396.1| elongation factor 1-alpha [Elaeis oleifera]
Length=447

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_010043711.1| PREDICTED: elongation factor 1-alpha [Eucalyptus grandis]
 gb|KCW85696.1| hypothetical protein EUGRSUZ_B02473 [Eucalyptus grandis]
Length=449

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_002279598.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN66350.1| hypothetical protein VITISV_044270 [Vitis vinifera]
Length=447

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AES62210.2| GTP-binding elongation factor Tu family protein [Medicago truncatula]
 gb|KEH43534.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=448

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|KEH43536.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=448

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_010521578.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|ABA12222.1| translation elongation factor 1A-6 [Gossypium hirsutum]
 gb|KHG08414.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB16823.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
 gb|KJB16824.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
 gb|KJB16825.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
Length=447

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHIN+VVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINLVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>dbj|BAC22125.1| eukaryotic elongation factor 1A [Bruguiera sexangula]
Length=449

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|EYU18869.1| hypothetical protein MIMGU_mgv1a010191mg [Erythranthe guttata]
 gb|EYU18870.1| hypothetical protein MIMGU_mgv1a010191mg [Erythranthe guttata]
Length=319

 Score =   218 bits (554),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AES74993.2| GTP-binding elongation factor Tu family protein [Medicago truncatula]
 gb|KEH25376.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=447

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|EYU36203.1| hypothetical protein MIMGU_mgv1a006301mg [Erythranthe guttata]
Length=449

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_009342341.1| PREDICTED: elongation factor 1-alpha [Pyrus x bretschneideri]
Length=447

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTS  107



>ref|NP_001077483.1| elongation factor 1-alpha 2 [Arabidopsis thaliana]
 gb|AEE28214.1| Elongation factor 1-alpha [Arabidopsis thaliana]
Length=372

 Score =   219 bits (557),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_009617039.1| PREDICTED: elongation factor 1-alpha [Nicotiana tomentosiformis]
Length=447

 Score =   221 bits (563),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_006381487.1| hypothetical protein POPTR_0006s13310g [Populus trichocarpa]
 gb|ABK95720.1| unknown [Populus trichocarpa]
 gb|ERP59284.1| hypothetical protein POPTR_0006s13310g [Populus trichocarpa]
Length=447

 Score =   221 bits (563),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_002284964.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_002284924.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_010651131.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN64511.1| hypothetical protein VITISV_035691 [Vitis vinifera]
Length=447

 Score =   221 bits (562),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTS  107



>gb|ABB16977.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=319

 Score =   217 bits (552),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/107 (97%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|EEE58429.1| hypothetical protein OsJ_09630 [Oryza sativa Japonica Group]
Length=427

 Score =   220 bits (561),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>sp|O24534.1|EF1A_VICFA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Vicia 
faba]
 emb|CAA10847.1| elongation factor 1-alpha (EF1-a) [Vicia faba]
Length=447

 Score =   221 bits (562),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFET+KYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETSKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_006646939.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
Length=447

 Score =   220 bits (561),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|NP_001049145.1| Os03g0177400 [Oryza sativa Japonica Group]
 ref|NP_001049146.1| Os03g0177500 [Oryza sativa Japonica Group]
 ref|NP_001049147.1| Os03g0177900 [Oryza sativa Japonica Group]
 ref|NP_001049148.1| Os03g0178000 [Oryza sativa Japonica Group]
 ref|XP_006649493.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
 ref|XP_006649494.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
 sp|O64937.2|EF1A_ORYSJ RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Oryza 
sativa Japonica Group]
 dbj|BAA23657.1| EF-1 alpha [Oryza sativa]
 dbj|BAA23659.1| EF-1 alpha [Oryza sativa]
 dbj|BAA23660.1| EF-1 alpha [Oryza sativa]
 gb|ABF94269.1| Elongation factor 1-alpha, putative [Oryza sativa Japonica Group]
 gb|ABF94270.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94273.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94274.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11059.1| Os03g0177400 [Oryza sativa Japonica Group]
 dbj|BAF11060.1| Os03g0177500 [Oryza sativa Japonica Group]
 dbj|BAF11061.1| Os03g0177900 [Oryza sativa Japonica Group]
 dbj|BAF11062.1| Os03g0178000 [Oryza sativa Japonica Group]
 gb|EAZ25788.1| hypothetical protein OsJ_09631 [Oryza sativa Japonica Group]
 gb|EAZ25791.1| hypothetical protein OsJ_09634 [Oryza sativa Japonica Group]
 gb|EAZ25792.1| hypothetical protein OsJ_09635 [Oryza sativa Japonica Group]
 dbj|BAG87945.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93078.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97075.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74621.1| hypothetical protein OsI_10237 [Oryza sativa Indica Group]
 gb|EEC74622.1| hypothetical protein OsI_10241 [Oryza sativa Indica Group]
 gb|EEC74623.1| hypothetical protein OsI_10242 [Oryza sativa Indica Group]
 gb|ADM86871.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86885.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86886.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86887.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
Length=447

 Score =   220 bits (561),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_008463920.1| PREDICTED: elongation factor 1-alpha [Cucumis melo]
Length=448

 Score =   220 bits (561),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKAHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|ABA12218.1| translation elongation factor 1A-2 [Gossypium hirsutum]
 gb|KHG05237.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB14364.1| hypothetical protein B456_002G121500 [Gossypium raimondii]
Length=447

 Score =   220 bits (561),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AAD27590.1|AF121261_1 elongation factor 1-alpha 1 [Lilium longiflorum]
Length=447

 Score =   220 bits (561),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_004138964.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
 ref|XP_004162426.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=447

 Score =   220 bits (561),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>dbj|BAA23658.1| EF-1 alpha [Oryza sativa]
Length=447

 Score =   220 bits (561),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_008457229.1| PREDICTED: elongation factor 1-alpha [Cucumis melo]
Length=447

 Score =   220 bits (561),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AIZ68131.1| translation elongation factor 1-alpha [Ornithogalum saundersiae]
Length=447

 Score =   220 bits (561),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|KHG15275.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=431

 Score =   220 bits (560),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|KJB09231.1| hypothetical protein B456_001G130700 [Gossypium raimondii]
 gb|KJB09232.1| hypothetical protein B456_001G130700 [Gossypium raimondii]
Length=447

 Score =   220 bits (561),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AGH32502.1| translation elongation factor-1 alpha [Stylosanthes guianensis]
Length=447

 Score =   220 bits (561),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|KHN14872.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   220 bits (561),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AAC15413.1| translation elongation factor-1 alpha [Oryza sativa Japonica 
Group]
Length=447

 Score =   220 bits (561),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>sp|P29521.1|EF1A1_DAUCA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Daucus 
carota]
 emb|CAA42843.1| elongation factor 1A [Daucus carota]
Length=449

 Score =   220 bits (561),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETNKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_006424633.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
 ref|XP_006488149.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37873.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
Length=447

 Score =   220 bits (561),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_006424629.1| hypothetical protein CICLE_v10028446mg [Citrus clementina]
 ref|XP_006424632.1| hypothetical protein CICLE_v10028445mg [Citrus clementina]
 ref|XP_006488147.1| PREDICTED: elongation factor 1-alpha isoform X1 [Citrus sinensis]
 ref|XP_006488148.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37869.1| hypothetical protein CICLE_v10028446mg [Citrus clementina]
 gb|ESR37872.1| hypothetical protein CICLE_v10028445mg [Citrus clementina]
Length=447

 Score =   220 bits (561),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_003558459.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
 ref|XP_003577316.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
 ref|XP_003581689.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
 ref|XP_010228997.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
 ref|XP_010228998.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
Length=447

 Score =   220 bits (561),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>dbj|BAO57272.1| elongation factor 1-alpha [Ipomoea nil]
Length=447

 Score =   220 bits (561),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_003553292.1| PREDICTED: elongation factor 1-alpha isoform 1 [Glycine max]
Length=447

 Score =   220 bits (561),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_004149547.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=449

 Score =   220 bits (561),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|KJB76528.1| hypothetical protein B456_012G093800 [Gossypium raimondii]
Length=449

 Score =   220 bits (561),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|ADI24333.1| elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score =   220 bits (561),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_011004182.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
 ref|XP_011010862.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
Length=447

 Score =   220 bits (561),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|NP_001152668.1| LOC100286309 [Zea mays]
 ref|XP_008647989.1| PREDICTED: LOC100286309 isoform X1 [Zea mays]
 gb|ACG48827.1| elongation factor 1-alpha [Zea mays]
 gb|AFW76430.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW76431.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW76432.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   220 bits (561),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|NP_001105587.1| elongation factor 1-alpha [Zea mays]
 gb|AAB64207.1| elongation factor 1-alpha [Zea mays]
 gb|ACG32939.1| elongation factor 1-alpha [Zea mays]
 gb|AFW87114.1| LOW QUALITY PROTEIN: putative translation elongation factor Tu 
family protein [Zea mays]
Length=447

 Score =   220 bits (561),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|ABU63160.1| elongation factor [Saccharum officinarum]
 gb|AGT15989.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT15990.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT16629.1| elongation factor 1 alpha [Saccharum hybrid cultivar R570]
Length=447

 Score =   220 bits (561),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|EMS52529.1| Elongation factor 1-alpha [Triticum urartu]
 gb|EMS55225.1| Elongation factor 1-alpha [Triticum urartu]
Length=447

 Score =   220 bits (561),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_007207457.1| hypothetical protein PRUPE_ppa005717mg [Prunus persica]
 gb|EMJ08656.1| hypothetical protein PRUPE_ppa005717mg [Prunus persica]
Length=447

 Score =   220 bits (560),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AFP44110.1| elongation factor 1-alpha [Lycoris longituba]
Length=447

 Score =   220 bits (560),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_001753059.1| predicted protein [Physcomitrella patens]
 gb|EDQ82100.1| predicted protein [Physcomitrella patens]
Length=447

 Score =   220 bits (560),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETVKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_011026991.1| PREDICTED: elongation factor 1-alpha isoform X1 [Populus euphratica]
 ref|XP_011026997.1| PREDICTED: elongation factor 1-alpha [Populus euphratica]
 ref|XP_011040951.1| PREDICTED: elongation factor 1-alpha [Populus euphratica]
Length=449

 Score =   220 bits (561),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_009380678.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380679.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380680.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   220 bits (560),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>sp|Q41803.1|EF1A_MAIZE RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Zea 
mays]
 dbj|BAA08249.1| alpha subunit of tlanslation elongation factor 1 [Zea mays]
Length=447

 Score =   220 bits (560),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AFC88830.1| putative elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score =   220 bits (560),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|KHG27341.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score =   220 bits (560),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_009421379.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   220 bits (560),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_004163381.1| PREDICTED: LOW QUALITY PROTEIN: elongation factor 1-alpha-like 
[Cucumis sativus]
Length=449

 Score =   220 bits (560),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|NP_001288407.1| elongation factor 1-alpha-like [Zea mays]
 gb|ACF87009.1| unknown [Zea mays]
Length=447

 Score =   220 bits (560),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AFQ37422.1| translation elongation factor-1 alpha 1 [Larix kaempferi]
Length=447

 Score =   220 bits (560),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AIZ74328.1| translation elongation factor 1-alpha [Pinus massoniana]
Length=448

 Score =   220 bits (560),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|NP_001105565.1| elongation factor alpha5 [Zea mays]
 gb|AAF42979.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   220 bits (560),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>sp|Q03033.1|EF1A_WHEAT RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Triticum 
aestivum]
 gb|AAA34306.1| translation elongation factor 1 alpha-subunit [Triticum aestivum]
 emb|CAA90651.1| elongation factor 1-alpha [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85443.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87634.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMT04563.1| Elongation factor 1-alpha [Aegilops tauschii]
 gb|EMT21642.1| Elongation factor 1-alpha [Aegilops tauschii]
 gb|EMT30905.1| Elongation factor 1-alpha [Aegilops tauschii]
Length=447

 Score =   220 bits (560),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|ABR17675.1| unknown [Picea sitchensis]
Length=448

 Score =   220 bits (560),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_001753167.1| predicted protein [Physcomitrella patens]
 gb|EDQ82208.1| predicted protein [Physcomitrella patens]
Length=447

 Score =   220 bits (560),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETVKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_008349743.1| PREDICTED: elongation factor 1-alpha isoform X2 [Malus domestica]
Length=397

 Score =   219 bits (557),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_004157309.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=449

 Score =   220 bits (560),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETAKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|ACN40740.1| unknown [Picea sitchensis]
 gb|ACN41072.1| unknown [Picea sitchensis]
Length=448

 Score =   220 bits (560),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_008224492.1| PREDICTED: elongation factor 1-alpha [Prunus mume]
Length=447

 Score =   220 bits (560),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_009783256.1| PREDICTED: elongation factor 1-alpha [Nicotiana sylvestris]
 dbj|BAA09709.1| elongation factor-1 alpha [Nicotiana tabacum]
Length=447

 Score =   220 bits (560),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|ACG31866.1| elongation factor 1-alpha [Zea mays]
Length=447

 Score =   220 bits (560),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_008656156.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Zea mays]
 gb|AFW81467.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW81468.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW81469.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   220 bits (560),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_007143679.1| hypothetical protein PHAVU_007G092500g [Phaseolus vulgaris]
 gb|ESW15673.1| hypothetical protein PHAVU_007G092500g [Phaseolus vulgaris]
Length=448

 Score =   220 bits (560),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_009392715.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009392716.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   220 bits (560),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_004307410.1| PREDICTED: elongation factor 1-alpha [Fragaria vesca subsp. vesca]
Length=447

 Score =   220 bits (560),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_001763194.1| predicted protein [Physcomitrella patens]
 ref|XP_001763195.1| predicted protein [Physcomitrella patens]
 ref|XP_001763196.1| predicted protein [Physcomitrella patens]
 gb|EDQ72071.1| predicted protein [Physcomitrella patens]
 gb|EDQ72072.1| predicted protein [Physcomitrella patens]
 gb|EDQ72073.1| predicted protein [Physcomitrella patens]
Length=447

 Score =   220 bits (560),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETVKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|NP_001105933.1| elongation factor alpha2 [Zea mays]
 gb|AAF42976.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   220 bits (560),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_008656153.1| PREDICTED: elongation factor 1-alpha-like [Zea mays]
 ref|XP_008656154.1| PREDICTED: elongation factor 1-alpha-like [Zea mays]
 gb|AFW81463.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW81464.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW81465.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   220 bits (560),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_004962249.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962250.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962268.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962269.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962270.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Setaria 
italica]
 ref|XP_004962271.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Setaria 
italica]
Length=447

 Score =   220 bits (560),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_009793830.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score =   220 bits (560),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_008358325.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 ref|XP_008385282.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
Length=447

 Score =   220 bits (560),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|NP_001105934.1| elongation factor alpha7 [Zea mays]
 gb|AAF42981.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   220 bits (560),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>dbj|BAH19898.1| AT1G07930 [Arabidopsis thaliana]
Length=449

 Score =   220 bits (560),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|KDO48480.1| hypothetical protein CISIN_1g0132372mg [Citrus sinensis]
Length=447

 Score =   220 bits (560),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|NP_001288465.1| elongation factor 1-alpha-like [Zea mays]
 ref|XP_008647262.1| PREDICTED: elongation factor alpha2 isoform X1 [Zea mays]
 gb|ACG25290.1| elongation factor 1-alpha [Zea mays]
 gb|AFW77596.1| putative translation elongation factor Tu family protein [Zea 
mays]
 gb|AFW77599.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW77600.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
Length=447

 Score =   220 bits (560),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_001766482.1| predicted protein [Physcomitrella patens]
 gb|EDQ68810.1| predicted protein [Physcomitrella patens]
Length=447

 Score =   220 bits (560),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETVKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|ACG34498.1| elongation factor 1-alpha [Zea mays]
Length=447

 Score =   220 bits (560),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_007222129.1| hypothetical protein PRUPE_ppa005702mg [Prunus persica]
 ref|XP_008224523.1| PREDICTED: elongation factor 1-alpha-like [Prunus mume]
 gb|EMJ23328.1| hypothetical protein PRUPE_ppa005702mg [Prunus persica]
Length=447

 Score =   220 bits (560),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|NP_200847.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 ref|NP_563799.1| elongation factor 1-alpha 3 [Arabidopsis thaliana]
 ref|NP_563800.1| elongation factor 1-alpha 2 [Arabidopsis thaliana]
 ref|NP_563801.1| elongation factor 1-alpha 1 [Arabidopsis thaliana]
 ref|NP_001030993.1| elongation factor 1-alpha 1 [Arabidopsis thaliana]
 ref|NP_001119464.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 ref|XP_002864684.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002889674.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 sp|P0DH99.1|EF1A1_ARATH RecName: Full=Elongation factor 1-alpha 1; Short=EF-1-alpha 1; 
AltName: Full=eEF-1A1 [Arabidopsis thaliana]
 sp|Q8W4H7.2|EF1A2_ARATH RecName: Full=Elongation factor 1-alpha 2; Short=EF-1-alpha 2; 
AltName: Full=eEF-1A2 [Arabidopsis thaliana]
 sp|Q0WL56.2|EF1A3_ARATH RecName: Full=Elongation factor 1-alpha 3; Short=EF-1-alpha 3; 
AltName: Full=eEF-1A3 [Arabidopsis thaliana]
 sp|Q8GTY0.2|EF1A4_ARATH RecName: Full=Elongation factor 1-alpha 4; Short=EF-1-alpha 4; 
AltName: Full=eEF-1A4 [Arabidopsis thaliana]
 gb|AAF79847.1|AC026875_27 T6D22.3 [Arabidopsis thaliana]
 gb|AAL31918.1|AF419586_1 AT5g60390/muf9_40 [Arabidopsis thaliana]
 emb|CAA34453.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CAA34454.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CAA34455.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAB07882.1| EF-1alpha-A1 [Arabidopsis thaliana]
 gb|AAB07883.1| EF-1alpha-A2 [Arabidopsis thaliana]
 gb|AAB07884.1| EF-1alpha-A3 [Arabidopsis thaliana]
 dbj|BAB08224.1| elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana]
 gb|AAK62638.1| At1g07940/T6D22_14 [Arabidopsis thaliana]
 gb|AAL24386.1| elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana]
 gb|AAL31193.1| AT5g60390/muf9_40 [Arabidopsis thaliana]
 gb|AAL86336.1| putative elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM65897.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM67562.1| putative elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM91202.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM91362.1| At5g60390/muf9_40 [Arabidopsis thaliana]
 gb|AAM98236.1| unknown protein [Arabidopsis thaliana]
 gb|AAM98240.1| unknown protein [Arabidopsis thaliana]
 gb|AAN18164.1| At1g07940/T6D22_14 [Arabidopsis thaliana]
 gb|AAO00783.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAO00802.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAO00870.1| Unknown protein [Arabidopsis thaliana]
 gb|AAO29944.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP21177.1| At5g60390/muf9_40 [Arabidopsis thaliana]
 dbj|BAE99963.1| elongation factor 1-alpha [Arabidopsis thaliana]
 dbj|BAE98497.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
 dbj|BAE98750.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
 gb|EFH40943.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65933.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 gb|AED97318.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AED97320.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AEE28212.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28213.1| Elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28215.1| Elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28216.1| Elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   220 bits (560),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|KHG20498.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=447

 Score =   220 bits (560),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_008385284.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
 ref|XP_009338279.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   220 bits (560),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_011040946.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Populus 
euphratica]
Length=449

 Score =   220 bits (560),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|KHN18669.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|NP_001237425.1| elongation factor-1A [Glycine max]
 gb|ACI42861.1| elongation factor-1A [Glycine max]
Length=447

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_009144204.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_006280459.1| hypothetical protein CARUB_v10026391mg [Capsella rubella]
 ref|XP_006304491.1| hypothetical protein CARUB_v10011249mg [Capsella rubella]
 ref|XP_010456336.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010456344.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Camelina sativa]
 ref|XP_010456350.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Camelina sativa]
 ref|XP_010456355.1| PREDICTED: elongation factor 1-alpha 1 isoform X4 [Camelina sativa]
 ref|XP_010456361.1| PREDICTED: elongation factor 1-alpha 1 isoform X5 [Camelina sativa]
 ref|XP_010456369.1| PREDICTED: elongation factor 1-alpha 1 isoform X6 [Camelina sativa]
 ref|XP_010488164.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010488173.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010505603.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010505604.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Camelina sativa]
 ref|XP_010509026.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010517279.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010443836.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010443839.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010458006.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010458008.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010458009.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010475572.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010475573.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010475574.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010483684.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010483687.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 gb|EOA13357.1| hypothetical protein CARUB_v10026391mg [Capsella rubella]
 gb|EOA37389.1| hypothetical protein CARUB_v10011249mg [Capsella rubella]
Length=449

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AAL32631.1| putative elongation factor 1-a [Arabidopsis thaliana]
 gb|AAM47970.1| putative elongation factor 1-a [Arabidopsis thaliana]
Length=449

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_007151789.1| hypothetical protein PHAVU_004G075100g [Phaseolus vulgaris]
 gb|ESW23783.1| hypothetical protein PHAVU_004G075100g [Phaseolus vulgaris]
Length=447

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_007205199.1| hypothetical protein PRUPE_ppa005718mg [Prunus persica]
 gb|EMJ06398.1| hypothetical protein PRUPE_ppa005718mg [Prunus persica]
Length=447

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AGT16893.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
Length=447

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|NP_001105617.1| elongation factor alpha3 [Zea mays]
 gb|AAF42977.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|NP_001280807.1| elongation factor 1-alpha-like [Malus domestica]
 ref|XP_008349742.1| PREDICTED: elongation factor 1-alpha isoform X1 [Malus domestica]
 ref|XP_008366354.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 emb|CAA11705.1| elongation factor 1 alpha subunit [Malus domestica]
Length=447

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_009131916.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_007015466.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY33085.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_007015463.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
 gb|EOY33082.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
Length=449

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|ACS68200.1| elongation factor 1 alpha [Brassica napus]
Length=449

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_009148045.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009110915.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009118409.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Brassica rapa]
 ref|XP_009118410.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Brassica rapa]
 ref|XP_009118411.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Brassica rapa]
 ref|XP_009120571.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 gb|ACS68201.1| elongation factor 1 alpha [Brassica napus]
 gb|AGK07381.1| elongation factor 1-alpha protein [Brassica oleracea var. botrytis]
Length=449

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AAL57653.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_009420035.1| PREDICTED: elongation factor 1-alpha [Musa acuminata subsp. malaccensis]
 ref|XP_009420036.1| PREDICTED: elongation factor 1-alpha [Musa acuminata subsp. malaccensis]
Length=447

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_004309883.1| PREDICTED: elongation factor 1-alpha-like [Fragaria vesca subsp. 
vesca]
Length=447

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>sp|P43643.1|EF1A_TOBAC RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha; AltName: 
Full=Vitronectin-like adhesion protein 1; Short=PVN1 
[Nicotiana tabacum]
 gb|AAA20836.1| vitronectin-like adhesion protein [Nicotiana tabacum]
Length=447

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|ACR38047.1| unknown [Zea mays]
 gb|AFW77623.1| elongation factor alpha1 [Zea mays]
Length=447

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|ACI96243.1| elongation factor 1-alpha [Prunus persica]
Length=447

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_004962277.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Setaria 
italica]
 ref|XP_004962278.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Setaria 
italica]
 ref|XP_004962279.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
Length=447

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_009126611.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
 ref|XP_009126612.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AFW77593.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW77594.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
Length=447

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_006600131.1| PREDICTED: elongation factor-1A isoform X1 [Glycine max]
 gb|KHN40184.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_004309880.1| PREDICTED: elongation factor 1-alpha [Fragaria vesca subsp. vesca]
Length=447

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AAL79774.1|AF331849_1 elongation factor 1 alpha [Saccharum hybrid cultivar CP65-357]
Length=447

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_006417745.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 ref|XP_006417746.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 ref|XP_006417749.1| hypothetical protein EUTSA_v10007620mg [Eutrema salsugineum]
 ref|XP_006417750.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 ref|XP_006417751.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 ref|XP_006400853.1| hypothetical protein EUTSA_v10013526mg [Eutrema salsugineum]
 dbj|BAJ33644.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36098.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 gb|ESQ36099.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 gb|ESQ36102.1| hypothetical protein EUTSA_v10007620mg [Eutrema salsugineum]
 gb|ESQ36103.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 gb|ESQ36104.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 gb|ESQ42306.1| hypothetical protein EUTSA_v10013526mg [Eutrema salsugineum]
Length=449

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_008380545.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
 ref|XP_008365661.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 ref|XP_009374568.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
 ref|XP_009374577.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|ABD66517.1| EF-1 alpha [Gymnadenia conopsea]
Length=447

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_010032225.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
Length=448

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_009342345.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   219 bits (559),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_006858667.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda]
 gb|ERN20134.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda]
Length=447

 Score =   219 bits (559),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AEQ75495.1| elongation factor 1-alpha [Rosa multiflora]
Length=447

 Score =   219 bits (559),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AAK25877.1|AF360167_1 putative translation elongation factor eEF-1 alpha chain A4 [Arabidopsis 
thaliana]
Length=449

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_006378755.1| hypothetical protein POPTR_0010s22560g [Populus trichocarpa]
 gb|ERP56552.1| hypothetical protein POPTR_0010s22560g [Populus trichocarpa]
Length=449

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_004489551.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
 ref|XP_004489552.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
Length=447

 Score =   219 bits (559),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_008224543.1| PREDICTED: elongation factor 1-alpha [Prunus mume]
Length=447

 Score =   219 bits (559),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_006436251.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
 ref|XP_006485903.1| PREDICTED: elongation factor 1-alpha 1-like [Citrus sinensis]
 gb|ESR49491.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
Length=447

 Score =   219 bits (559),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>dbj|BAM13877.1| elongation factor 1 alpha [Arum maculatum]
Length=447

 Score =   219 bits (559),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AAN31833.1| putative translation elongation factor eEF-1 alpha chain (gene 
A4) [Arabidopsis thaliana]
Length=449

 Score =   219 bits (559),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|EYU18863.1| hypothetical protein MIMGU_mgv1a006280mg [Erythranthe guttata]
 gb|EYU18864.1| hypothetical protein MIMGU_mgv1a006280mg [Erythranthe guttata]
 gb|EYU18866.1| hypothetical protein MIMGU_mgv11b005172mg [Erythranthe guttata]
 gb|EYU18867.1| hypothetical protein MIMGU_mgv1a006307mg [Erythranthe guttata]
Length=449

 Score =   219 bits (559),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_006387491.1| hypothetical protein POPTR_0966s00200g [Populus trichocarpa]
 ref|XP_006387492.1| hypothetical protein POPTR_0966s00200g [Populus trichocarpa]
 gb|ABK94386.1| unknown [Populus trichocarpa]
 gb|ERP46405.1| hypothetical protein POPTR_0966s00200g [Populus trichocarpa]
 gb|ERP46406.1| hypothetical protein POPTR_0966s00200g [Populus trichocarpa]
Length=449

 Score =   219 bits (559),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_004984833.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004984834.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
Length=447

 Score =   219 bits (559),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AAF99703.1| elongation factor [Saccharum officinarum]
Length=448

 Score =   219 bits (559),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_011031783.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
 ref|XP_011040944.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Populus 
euphratica]
 ref|XP_011040945.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Populus 
euphratica]
Length=449

 Score =   219 bits (559),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_001753181.1| predicted protein [Physcomitrella patens]
 ref|XP_001753188.1| predicted protein [Physcomitrella patens]
 gb|EDQ82222.1| predicted protein [Physcomitrella patens]
 gb|EDQ82229.1| predicted protein [Physcomitrella patens]
Length=447

 Score =   219 bits (559),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETVKYYCTVIDAPGHRDFIKNMITGTS  107



>sp|P25698.2|EF1A_SOYBN RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Glycine 
max]
 emb|CAA40182.1| eEF-1a [Glycine max]
Length=447

 Score =   219 bits (559),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_001763201.1| predicted protein [Physcomitrella patens]
 gb|EDQ72078.1| predicted protein [Physcomitrella patens]
Length=447

 Score =   219 bits (559),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETMKYYCTVIDAPGHRDFIKNMITGTS  107



>gb|AGV54713.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=447

 Score =   219 bits (559),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 106/107 (99%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|XP_011026992.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026993.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026995.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026996.1| PREDICTED: elongation factor 1-alpha isoform X3 [Populus euphratica]
Length=449

 Score =   219 bits (559),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



>ref|NP_001032107.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AED97319.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
Length=400

 Score =   218 bits (556),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = +1

Query  58   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  237
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  238  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIXNMITGTS  378
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFI NMITGTS
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTS  107



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 551036074875