BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF039A20

Length=592
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP08481.1|  unnamed protein product                                298   2e-96   Coffea canephora [robusta coffee]
ref|XP_011090165.1|  PREDICTED: serine--glyoxylate aminotransferase     296   6e-96   Sesamum indicum [beniseed]
ref|XP_010277598.1|  PREDICTED: serine--glyoxylate aminotransferase     294   4e-95   Nelumbo nucifera [Indian lotus]
gb|KDO44954.1|  hypothetical protein CISIN_1g0157291mg                  290   4e-94   Citrus sinensis [apfelsine]
ref|XP_003600160.1|  Alanine glyoxylate aminotransferase                292   4e-94   
ref|XP_003600159.1|  Alanine glyoxylate aminotransferase                291   6e-94   Medicago truncatula
ref|XP_011080387.1|  PREDICTED: serine--glyoxylate aminotransfera...    291   7e-94   Sesamum indicum [beniseed]
gb|KDO44953.1|  hypothetical protein CISIN_1g0157291mg                  291   8e-94   Citrus sinensis [apfelsine]
ref|XP_006470731.1|  PREDICTED: serine--glyoxylate aminotransfera...    291   9e-94   Citrus sinensis [apfelsine]
ref|XP_004499480.1|  PREDICTED: serine--glyoxylate aminotransfera...    291   1e-93   
ref|XP_006446249.1|  hypothetical protein CICLE_v10015490mg             290   1e-93   Citrus clementina [clementine]
ref|XP_010045046.1|  PREDICTED: serine--glyoxylate aminotransferase     290   2e-93   Eucalyptus grandis [rose gum]
ref|XP_007146302.1|  hypothetical protein PHAVU_006G029100g             290   2e-93   Phaseolus vulgaris [French bean]
gb|AGV54322.1|  serine glyoxylate aminotransferase 2                    290   2e-93   Phaseolus vulgaris [French bean]
ref|XP_006584642.1|  PREDICTED: enzymatic resistance protein isof...    290   2e-93   Glycine max [soybeans]
ref|NP_001237048.1|  enzymatic resistance protein                       290   3e-93   
gb|ACJ61247.1|  serine glyoxylate aminotransferase 3                    290   3e-93   Glycine max [soybeans]
gb|AFK40703.1|  unknown                                                 289   3e-93   Medicago truncatula
gb|EPS59280.1|  serine-glyoxylate aminotransferase                      289   5e-93   Genlisea aurea
ref|XP_008227244.1|  PREDICTED: serine--glyoxylate aminotransferase     289   5e-93   Prunus mume [ume]
ref|XP_009342610.1|  PREDICTED: serine--glyoxylate aminotransferase     288   7e-93   Pyrus x bretschneideri [bai li]
ref|XP_008363560.1|  PREDICTED: serine--glyoxylate aminotransferase     288   9e-93   Malus domestica [apple tree]
ref|XP_006369572.1|  hypothetical protein POPTR_0001s26020g             285   1e-92   
ref|XP_006349776.1|  PREDICTED: serine--glyoxylate aminotransfera...    288   1e-92   Solanum tuberosum [potatoes]
gb|KHN28521.1|  Serine--glyoxylate aminotransferase                     288   2e-92   Glycine soja [wild soybean]
ref|NP_001276276.1|  serine--glyoxylate aminotransferase-like           288   2e-92   Glycine max [soybeans]
ref|NP_001265946.1|  Hop-interacting protein THI032                     288   2e-92   Solanum lycopersicum
dbj|BAJ33858.1|  unnamed protein product                                288   4e-92   Eutrema halophilum
ref|XP_008359496.1|  PREDICTED: serine--glyoxylate aminotransferase     286   4e-92   
emb|CDY37208.1|  BnaA09g08290D                                          286   5e-92   Brassica napus [oilseed rape]
ref|XP_007212264.1|  hypothetical protein PRUPE_ppa006653mg             286   5e-92   Prunus persica
ref|XP_006843377.1|  hypothetical protein AMTR_s00053p00093890          286   6e-92   Amborella trichopoda
ref|XP_011032100.1|  PREDICTED: serine--glyoxylate aminotransfera...    286   6e-92   Populus euphratica
ref|XP_008812510.1|  PREDICTED: serine--glyoxylate aminotransferase     286   6e-92   Phoenix dactylifera
gb|ACJ61246.1|  serine glyoxylate aminotransferase 2                    286   6e-92   Glycine max [soybeans]
ref|XP_002313371.1|  aminotransferase 2 family protein                  286   7e-92   
emb|CDX81443.1|  BnaC09g08540D                                          286   8e-92   
ref|XP_004291746.1|  PREDICTED: serine--glyoxylate aminotransferase     286   9e-92   Fragaria vesca subsp. vesca
ref|XP_011043786.1|  PREDICTED: serine--glyoxylate aminotransferase     286   9e-92   Populus euphratica
ref|XP_009112244.1|  PREDICTED: serine--glyoxylate aminotransferase     285   1e-91   Brassica rapa
ref|XP_006409690.1|  hypothetical protein EUTSA_v10022711mg             285   1e-91   
gb|ABQ81925.1|  aminotransferase 2                                      285   1e-91   Cucumis melo [Oriental melon]
ref|XP_008449670.1|  PREDICTED: serine--glyoxylate aminotransfera...    285   1e-91   Cucumis melo [Oriental melon]
ref|XP_009338530.1|  PREDICTED: serine--glyoxylate aminotransfera...    285   2e-91   
ref|XP_002298306.1|  hypothetical protein POPTR_0001s26020g             285   2e-91   Populus trichocarpa [western balsam poplar]
gb|AAL62332.1|AF461048_1  aminotransferase 2                            285   2e-91   Cucumis melo [Oriental melon]
ref|XP_006369573.1|  hypothetical protein POPTR_0001s26020g             284   2e-91   
ref|NP_001284445.1|  serine--glyoxylate aminotransferase-like           285   2e-91   Cucumis melo [Oriental melon]
ref|XP_009619693.1|  PREDICTED: serine--glyoxylate aminotransferase     285   2e-91   Nicotiana tomentosiformis
ref|XP_009775939.1|  PREDICTED: serine--glyoxylate aminotransferase     285   2e-91   Nicotiana sylvestris
ref|XP_010938608.1|  PREDICTED: serine--glyoxylate aminotransfera...    285   3e-91   Elaeis guineensis
gb|ABK96624.1|  unknown                                                 285   3e-91   Populus trichocarpa x Populus deltoides
gb|ABA00460.1|  serine-glyoxylate aminotransferase                      284   4e-91   Spirodela polyrhiza
ref|XP_009136209.1|  PREDICTED: serine--glyoxylate aminotransfera...    284   4e-91   Brassica rapa
emb|CDX89604.1|  BnaC03g45180D                                          284   4e-91   
gb|ABQ81922.1|  aminotransferase 2                                      284   4e-91   Cucumis sativus [cucumbers]
gb|AGL09527.1|  alanine-glyoxylate aminotransferase                     280   5e-91   Piper nigrum
ref|XP_004140203.1|  PREDICTED: serine--glyoxylate aminotransfera...    283   7e-91   Cucumis sativus [cucumbers]
gb|AGL09526.1|  alanine-glyoxylate aminotransferase                     279   2e-90   Peperomia prostrata
ref|XP_010094254.1|  Serine--glyoxylate aminotransferase                281   2e-90   Morus notabilis
gb|ABQ81924.1|  aminotransferase 2                                      282   2e-90   Cucumis sativus [cucumbers]
gb|AGT38285.1|  serine--glyoxylate aminotransferase                     282   2e-90   Gossypium hirsutum [American cotton]
ref|XP_007015204.1|  Alanine:glyoxylate aminotransferase isoform 1      282   2e-90   
ref|XP_006297832.1|  hypothetical protein CARUB_v10013869mg             282   3e-90   Capsella rubella
gb|AAL47679.1|  aminotransferase 1                                      281   3e-90   Cucumis melo [Oriental melon]
gb|KDP35982.1|  hypothetical protein JCGZ_08377                         281   4e-90   Jatropha curcas
gb|AAQ56192.1|  aminotransferase 1                                      281   5e-90   Cucumis melo [Oriental melon]
ref|XP_002885871.1|  hypothetical protein ARALYDRAFT_480305             281   5e-90   
gb|KHG29969.1|  Serine--glyoxylate aminotransferase -like protein       281   5e-90   Gossypium arboreum [tree cotton]
gb|AGL09524.1|  alanine-glyoxylate aminotransferase                     277   6e-90   Calycanthus occidentalis [California-allspice]
ref|XP_009410322.1|  PREDICTED: serine--glyoxylate aminotransfera...    281   7e-90   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002531124.1|  serine-pyruvate aminotransferase, putative         280   1e-89   Ricinus communis
ref|XP_010488837.1|  PREDICTED: serine--glyoxylate aminotransfera...    280   1e-89   Camelina sativa [gold-of-pleasure]
ref|XP_010518509.1|  PREDICTED: serine--glyoxylate aminotransfera...    280   1e-89   Camelina sativa [gold-of-pleasure]
ref|NP_001284450.1|  serine--glyoxylate aminotransferase                280   1e-89   Cucumis melo [Oriental melon]
gb|AAQ56193.1|  aminotransferase 2                                      280   1e-89   Cucumis melo [Oriental melon]
gb|AGL09530.1|  alanine-glyoxylate aminotransferase                     276   2e-89   Xymalos monospora
ref|XP_010909203.1|  PREDICTED: serine--glyoxylate aminotransferase     280   2e-89   Elaeis guineensis
ref|NP_178969.1|  alanine--glyoxylate aminotransferase                  280   2e-89   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010557501.1|  PREDICTED: serine--glyoxylate aminotransferase     280   2e-89   Tarenaya hassleriana [spider flower]
gb|KJB54389.1|  hypothetical protein B456_009G074800                    280   2e-89   Gossypium raimondii
ref|XP_009415566.1|  PREDICTED: serine--glyoxylate aminotransferase     279   3e-89   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004139054.1|  PREDICTED: serine--glyoxylate aminotransfera...    279   3e-89   Cucumis sativus [cucumbers]
ref|XP_010467178.1|  PREDICTED: serine--glyoxylate aminotransfera...    280   4e-89   Camelina sativa [gold-of-pleasure]
gb|KHG14448.1|  Serine--glyoxylate aminotransferase -like protein       279   4e-89   Gossypium arboreum [tree cotton]
gb|AAB95218.1|  putative serine-glyoxylate aminotransferase             276   7e-88   Fritillaria agrestis
gb|ABR26028.1|  serine-glyoxylate aminotransferase                      269   7e-88   Oryza sativa Indica Group [Indian rice]
gb|AGL09523.1|  alanine-glyoxylate aminotransferase                     270   3e-87   Asarum caudatum
dbj|BAJ90006.1|  predicted protein                                      274   3e-87   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003574732.2|  PREDICTED: serine--glyoxylate aminotransferase     275   4e-87   Brachypodium distachyon [annual false brome]
ref|XP_010673724.1|  PREDICTED: serine--glyoxylate aminotransferase     273   7e-87   Beta vulgaris subsp. vulgaris [field beet]
gb|EMS66805.1|  Serine--glyoxylate aminotransferase                     272   2e-86   Triticum urartu
ref|NP_001062170.1|  Os08g0502700                                       270   1e-85   
ref|XP_006659561.1|  PREDICTED: serine--glyoxylate aminotransfera...    269   2e-85   Oryza brachyantha
ref|XP_002279236.1|  PREDICTED: serine--glyoxylate aminotransferase     269   3e-85   Vitis vinifera
ref|XP_004973838.1|  PREDICTED: serine--glyoxylate aminotransfera...    269   3e-85   Setaria italica
emb|CAN84001.1|  hypothetical protein VITISV_007680                     269   3e-85   Vitis vinifera
ref|XP_004973837.1|  PREDICTED: serine--glyoxylate aminotransfera...    269   1e-84   
ref|XP_002444789.1|  hypothetical protein SORBIDRAFT_07g028080          266   6e-84   Sorghum bicolor [broomcorn]
ref|XP_004491262.1|  PREDICTED: serine--glyoxylate aminotransfera...    262   2e-82   Cicer arietinum [garbanzo]
ref|XP_003617296.1|  Alanine glyoxylate aminotransferase                261   3e-82   Medicago truncatula
gb|AGL09528.1|  alanine-glyoxylate aminotransferase                     256   9e-82   Saururus cernuus [swamp lily]
gb|ABF70331.1|  aminotransferase 1                                      257   6e-81   Cucumis sativus [cucumbers]
tpg|DAA47863.1|  TPA: hypothetical protein ZEAMMB73_595389              252   3e-79   
ref|NP_001148339.1|  LOC100281949                                       253   5e-79   Zea mays [maize]
gb|AGL09525.1|  alanine-glyoxylate aminotransferase                     234   2e-73   Manekia incurva
gb|AGL09529.1|  alanine-glyoxylate aminotransferase                     231   2e-72   Thottea sp. JN-2013
gb|AGL09531.1|  alanine-glyoxylate aminotransferase                     230   6e-72   Zippelia begoniifolia
ref|XP_008666464.1|  PREDICTED: serine--glyoxylate aminotransfera...    227   6e-71   Zea mays [maize]
gb|ABR16109.1|  unknown                                                 230   1e-70   Picea sitchensis
gb|ACN39798.1|  unknown                                                 231   2e-70   Picea sitchensis
gb|ABK24112.1|  unknown                                                 231   2e-70   Picea sitchensis
ref|XP_001783551.1|  predicted protein                                  230   3e-70   
tpg|DAA47874.1|  TPA: hypothetical protein ZEAMMB73_131074              226   4e-70   
ref|XP_001755667.1|  predicted protein                                  229   8e-70   
ref|XP_002983655.1|  hypothetical protein SELMODRAFT_228964             227   7e-69   
ref|XP_002990557.1|  hypothetical protein SELMODRAFT_448066             227   7e-69   Selaginella moellendorffii
emb|CBI24214.3|  unnamed protein product                                223   6e-68   Vitis vinifera
gb|ADO24297.1|  aminotransferase                                        214   1e-67   Valeriana jatamansi
gb|AEX09293.1|  alanine glyoxylate aminotransferase                     219   2e-66   Peperomia rupiseda
gb|AEX09255.1|  alanine glyoxylate aminotransferase                     219   3e-66   Peperomia bracteata
gb|AEX09262.1|  alanine glyoxylate aminotransferase                     218   4e-66   Peperomia aff. ovatopeltata JN-2011
gb|AEX09248.1|  alanine glyoxylate aminotransferase                     218   4e-66   Peperomia questionis
gb|AEX09252.1|  alanine glyoxylate aminotransferase                     217   7e-66   Peperomia exclamationis
gb|AEX09288.1|  alanine glyoxylate aminotransferase                     217   1e-65   Peperomia parvisagittata
gb|AEX09287.1|  alanine glyoxylate aminotransferase                     216   1e-65   Peperomia cerrateae
gb|AEX09282.1|  alanine glyoxylate aminotransferase                     216   1e-65   Peperomia cerrateae
gb|AEX09251.1|  alanine glyoxylate aminotransferase                     216   1e-65   Peperomia schizandra
gb|AEX09308.1|  alanine glyoxylate aminotransferase                     217   1e-65   Peperomia polycephala
gb|AEX09305.1|  alanine glyoxylate aminotransferase                     217   1e-65   Peperomia pseudoverruculosa
gb|AEX09246.1|  alanine glyoxylate aminotransferase                     216   2e-65   Peperomia elatior
gb|AEX09250.1|  alanine glyoxylate aminotransferase                     217   2e-65   Peperomia schizandra
gb|ADG26437.1|  putative aminotransferase                               209   2e-65   Valeriana jatamansi
ref|XP_001763095.1|  predicted protein                                  218   2e-65   
gb|AEX09273.1|  alanine glyoxylate aminotransferase                     217   2e-65   Peperomia cerrateae
gb|AEX09249.1|  alanine glyoxylate aminotransferase                     216   2e-65   Peperomia aff. gracillima JN-2011
gb|AEX09245.1|  alanine glyoxylate aminotransferase                     216   2e-65   Peperomia putlaensis
gb|AEX09263.1|  alanine glyoxylate aminotransferase                     216   4e-65   Peperomia putlaensis
gb|AEX09266.1|  alanine glyoxylate aminotransferase                     215   5e-65   Peperomia peruviana
gb|AEX09244.1|  alanine glyoxylate aminotransferase                     215   5e-65   Peperomia basiradicans
gb|AEX09268.1|  alanine glyoxylate aminotransferase                     216   5e-65   Peperomia peruviana
gb|AEX09283.1|  alanine glyoxylate aminotransferase                     215   5e-65   Peperomia peruviana
gb|AEX09300.1|  alanine glyoxylate aminotransferase                     216   5e-65   Peperomia parvifolia
gb|AEX09310.1|  alanine glyoxylate aminotransferase                     214   5e-65   Peperomia wernerrauhii
gb|AEX09274.1|  alanine glyoxylate aminotransferase                     216   5e-65   Peperomia peruviana
gb|AEX09302.1|  alanine glyoxylate aminotransferase                     215   5e-65   Peperomia sp. JN-2011
gb|AEX09306.1|  alanine glyoxylate aminotransferase                     216   6e-65   Peperomia peruviana
gb|AEX09301.1|  alanine glyoxylate aminotransferase                     215   6e-65   Peperomia sp. JN-2011
gb|AEX09286.1|  alanine glyoxylate aminotransferase                     215   7e-65   Peperomia cyclaminoides
gb|AEX09277.1|  alanine glyoxylate aminotransferase                     215   7e-65   Peperomia cyclaminoides
gb|AEX09295.1|  alanine glyoxylate aminotransferase                     215   7e-65   Peperomia pugnicaudex
gb|AEX09275.1|  alanine glyoxylate aminotransferase                     215   7e-65   Peperomia parvisagittata
gb|AEX09257.1|  alanine glyoxylate aminotransferase                     215   7e-65   Peperomia bracteata
gb|AEX09311.1|  alanine glyoxylate aminotransferase                     215   8e-65   Peperomia andina
gb|AEX09270.1|  alanine glyoxylate aminotransferase                     215   8e-65   Peperomia verruculosa
gb|AEX09253.1|  alanine glyoxylate aminotransferase                     215   8e-65   Peperomia bracteata
gb|AEX09298.1|  alanine glyoxylate aminotransferase                     215   1e-64   Peperomia cerrateae
gb|AEX09260.1|  alanine glyoxylate aminotransferase                     214   1e-64   Peperomia aff. ovatopeltata JN-2011
gb|EMT09291.1|  Serine--glyoxylate aminotransferase                     213   1e-64   
gb|AEX09309.1|  alanine glyoxylate aminotransferase                     214   1e-64   Peperomia wernerrauhii
gb|AEX09256.1|  alanine glyoxylate aminotransferase                     214   2e-64   Peperomia bracteata
gb|AEX09258.1|  alanine glyoxylate aminotransferase                     214   2e-64   Peperomia bracteata
gb|AEX09304.1|  alanine glyoxylate aminotransferase                     214   3e-64   Peperomia chutanka
gb|AEX09292.1|  alanine glyoxylate aminotransferase                     213   4e-64   Peperomia klopfensteinii
gb|AEX09299.1|  alanine glyoxylate aminotransferase                     213   4e-64   Peperomia cerrateae
gb|AEX09254.1|  alanine glyoxylate aminotransferase                     213   5e-64   Peperomia bracteata
gb|AEX09242.1|  alanine glyoxylate aminotransferase                     212   6e-64   Peperomia aff. pinoi JN-2011
gb|AEX09294.1|  alanine glyoxylate aminotransferase                     211   3e-63   Peperomia sp. JN-2011
gb|AEX09276.1|  alanine glyoxylate aminotransferase                     211   4e-63   Peperomia parvisagittata
gb|AEX09267.1|  alanine glyoxylate aminotransferase                     210   9e-63   Peperomia radiatinervosa
ref|XP_002969615.1|  hypothetical protein SELMODRAFT_267279             207   2e-61   Selaginella moellendorffii
ref|XP_002970880.1|  hypothetical protein SELMODRAFT_147375             207   2e-61   Selaginella moellendorffii
gb|EYU35937.1|  hypothetical protein MIMGU_mgv1a026291mg                202   7e-60   Erythranthe guttata [common monkey flower]
gb|AEX09303.1|  alanine glyoxylate aminotransferase                     196   9e-58   Peperomia ayacuchoana
gb|AEX09259.1|  alanine glyoxylate aminotransferase                     196   2e-57   Peperomia bracteata
gb|AEX09307.1|  alanine glyoxylate aminotransferase                     194   5e-57   Peperomia verruculosa
gb|AEX09291.1|  alanine glyoxylate aminotransferase                     193   1e-56   Peperomia jalcaensis
gb|AEX09284.1|  alanine glyoxylate aminotransferase                     193   1e-56   Peperomia peruviana
gb|AEX09272.1|  alanine glyoxylate aminotransferase                     192   2e-56   Peperomia cyclaminoides
gb|AEX09265.1|  alanine glyoxylate aminotransferase                     193   2e-56   Peperomia radiatinervosa
gb|AEX09264.1|  alanine glyoxylate aminotransferase                     191   1e-55   Peperomia radiatinervosa
gb|ACN36238.1|  unknown                                                 190   2e-55   Zea mays [maize]
gb|AEX09285.1|  alanine glyoxylate aminotransferase                     188   1e-54   Peperomia radiatinervosa
ref|XP_005709273.1|  serine--glyoxylate transaminase                    186   5e-53   Galdieria sulphuraria
gb|AEX09271.1|  alanine glyoxylate aminotransferase                     184   5e-53   Peperomia peruviana
gb|AEX09261.1|  alanine glyoxylate aminotransferase                     180   1e-51   Peperomia aff. ovatopeltata JN-2011
gb|AEX09247.1|  alanine glyoxylate aminotransferase                     180   1e-51   Peperomia cavispicata
ref|XP_005648727.1|  serine glyoxylate aminotransferase                 181   5e-51   Coccomyxa subellipsoidea C-169
ref|WP_017485211.1|  serine--glyoxylate aminotransferase                180   7e-51   Methylobacterium sp. MB200
gb|AEX09281.1|  alanine glyoxylate aminotransferase                     177   2e-50   Peperomia cyclaminoides
ref|WP_015950680.1|  serine--glyoxylate aminotransferase                177   5e-50   Methylorubrum extorquens
dbj|BAQ46928.1|  serine--glyoxylate aminotransferase                    177   7e-50   Methylobacterium aquaticum
gb|AEX09269.1|  alanine glyoxylate aminotransferase                     176   7e-50   Peperomia peruviana
gb|AEX09290.1|  alanine glyoxylate aminotransferase                     175   8e-50   Peperomia dolabella
gb|AEX09243.1|  alanine glyoxylate aminotransferase                     174   8e-50   Peperomia sp. JN-2011
ref|WP_012453656.1|  serine--glyoxylate aminotransferase                177   9e-50   Methylorubrum populi
ref|WP_020188076.1|  hypothetical protein                               177   1e-49   Methylopila sp. 73B
ref|WP_003597639.1|  serine--glyoxylate aminotransferase                176   1e-49   Methylobacteriaceae
ref|WP_012253362.1|  serine--glyoxylate aminotransferase                176   2e-49   Methylobacteriaceae
ref|WP_041930245.1|  serine--glyoxylate aminotransferase                176   2e-49   
ref|WP_026610206.1|  serine--glyoxylate aminotransferase                176   3e-49   Methylocaldum szegediense
gb|ABM96214.1|  serine-glyoxylate aminotransferase                      176   3e-49   Methylibium petroleiphilum PM1
ref|WP_010960683.1|  serine--glyoxylate aminotransferase                176   3e-49   Methylococcus capsulatus
ref|WP_026362994.1|  serine--glyoxylate aminotransferase                176   3e-49   Methylopila sp. M107
gb|AEX09280.1|  alanine glyoxylate aminotransferase                     174   3e-49   Peperomia peruviana
ref|WP_014149643.1|  serine--glyoxylate aminotransferase                175   5e-49   Methylomicrobium alcaliphilum
gb|ADO24296.1|  aminotransferase                                        166   7e-49   Valeriana jatamansi
ref|WP_027156802.1|  serine--glyoxylate aminotransferase                174   8e-49   Methylobacter luteus
ref|WP_017840623.1|  serine--glyoxylate aminotransferase                174   1e-48   Methylomicrobium buryatense
ref|XP_003615391.1|  Alanine glyoxylate aminotransferase                172   1e-48   
ref|WP_036230592.1|  MULTISPECIES: serine--glyoxylate aminotransf...    174   1e-48   Methylibium
ref|WP_018238561.1|  serine--glyoxylate aminotransferase                174   2e-48   Ensifer sp. BR816
ref|WP_014762956.1|  serine--glyoxylate aminotransferase                174   2e-48   Sinorhizobium fredii
gb|AEX09289.1|  alanine glyoxylate aminotransferase                     171   2e-48   Peperomia gigantea
ref|WP_026597137.1|  serine--glyoxylate aminotransferase                172   6e-48   Methylobacterium sp. 77
ref|WP_027147316.1|  MULTISPECIES: serine--glyoxylate aminotransf...    171   1e-47   Methylobacter
ref|WP_037416404.1|  serine--glyoxylate aminotransferase                171   1e-47   Sinorhizobium sp. CCBAU 05631
ref|WP_026622911.1|  serine--glyoxylate aminotransferase                171   1e-47   Ensifer sp. WSM1721
ref|WP_036253086.1|  serine--glyoxylate aminotransferase                171   1e-47   Methylobacter sp. BBA5.1
ref|WP_018410273.1|  serine--glyoxylate aminotransferase                171   1e-47   Methyloversatilis thermotolerans
ref|WP_034858116.1|  serine--glyoxylate aminotransferase                171   2e-47   Ensifer sojae
ref|WP_003535479.1|  serine--glyoxylate aminotransferase                171   2e-47   Sinorhizobium meliloti
ref|WP_026175686.1|  serine--glyoxylate aminotransferase                171   2e-47   Methylobacterium sp. 88A
ref|WP_027172630.1|  serine--glyoxylate aminotransferase                171   2e-47   Methylobacterium
ref|WP_007559580.1|  serine--glyoxylate aminotransferase                171   2e-47   Methylobacterium
ref|WP_014329402.1|  serine--glyoxylate aminotransferase                170   3e-47   Sinorhizobium fredii
ref|WP_006890572.1|  serine--glyoxylate aminotransferase                170   4e-47   Methylobacter tundripaludum
ref|WP_031437003.1|  serine--glyoxylate aminotransferase                170   4e-47   Methylobacter tundripaludum
ref|WP_028223486.1|  serine--glyoxylate aminotransferase                170   4e-47   Paraburkholderia oxyphila
ref|WP_031434945.1|  serine--glyoxylate aminotransferase                169   6e-47   Methylomarinum vadi
ref|WP_028755163.1|  serine--glyoxylate aminotransferase                169   6e-47   Rhizobium leucaenae
ref|WP_027999163.1|  serine--glyoxylate aminotransferase                169   6e-47   Sinorhizobium arboris
ref|WP_040961132.1|  serine--glyoxylate aminotransferase                169   7e-47   Sinorhizobium fredii
ref|WP_040580464.1|  serine--glyoxylate aminotransferase                169   7e-47   
ref|WP_018329867.1|  serine--glyoxylate aminotransferase                169   8e-47   Rhizobium giardinii
ref|WP_012320605.1|  MULTISPECIES: serine--glyoxylate aminotransf...    169   8e-47   Methylobacterium
ref|WP_015933415.1|  serine--glyoxylate aminotransferase                169   9e-47   Methylobacterium nodulans
ref|WP_026616975.1|  serine--glyoxylate aminotransferase                169   1e-46   Sinorhizobium/Ensifer group
ref|WP_026608295.1|  serine--glyoxylate aminotransferase                169   1e-46   Methylocapsa acidiphila
ref|WP_035937801.1|  serine--glyoxylate aminotransferase                169   1e-46   Caballeronia glathei
ref|XP_001702107.1|  serine glyoxylate aminotransferase                 169   1e-46   Chlamydomonas reinhardtii
ref|WP_005371842.1|  MULTISPECIES: serine--glyoxylate aminotransf...    168   1e-46   Methylomicrobium agile
ref|XP_003617694.1|  Alanine glyoxylate aminotransferase                167   2e-46   
ref|WP_012709136.1|  serine--glyoxylate aminotransferase                168   2e-46   Sinorhizobium fredii
ref|XP_001702106.1|  serine glyoxylate aminotransferase                 169   2e-46   Chlamydomonas reinhardtii
ref|WP_037131645.1|  serine--glyoxylate aminotransferase                168   2e-46   Rhizobium sp. CF097
ref|WP_037384071.1|  serine--glyoxylate aminotransferase                168   2e-46   Sinorhizobium americanum
ref|WP_012590731.1|  serine--glyoxylate aminotransferase                168   2e-46   Methylocella silvestris
gb|ACJ84853.1|  unknown                                                 159   2e-46   Medicago truncatula
ref|WP_035994918.1|  serine--glyoxylate aminotransferase                168   3e-46   Paraburkholderia caribensis
ref|WP_007585769.1|  serine--glyoxylate aminotransferase                168   3e-46   Paraburkholderia hospita
ref|WP_042673896.1|  serine--glyoxylate aminotransferase                168   3e-46   Methylobacterium sp. B34
ref|WP_042306504.1|  serine--glyoxylate aminotransferase                168   3e-46   Paraburkholderia terrae
ref|WP_020092657.1|  serine--glyoxylate aminotransferase                168   3e-46   Methylobacterium
ref|WP_024298006.1|  serine--glyoxylate aminotransferase                167   3e-46   Methylosarcina lacus
ref|WP_007742731.1|  serine--glyoxylate aminotransferase                168   3e-46   Burkholderiaceae
ref|WP_010687105.1|  Aminotransferase class V                           168   3e-46   Methylobacterium mesophilicum
ref|XP_002953765.1|  hypothetical protein VOLCADRAFT_75980              168   4e-46   Volvox carteri f. nagariensis
ref|WP_028367172.1|  serine--glyoxylate aminotransferase                168   4e-46   Burkholderia sp. UYPR1.413
ref|WP_043385155.1|  MULTISPECIES: serine--glyoxylate aminotransf...    167   4e-46   Methylobacterium
gb|AIQ91949.1|  Aminotransferase class V                                168   5e-46   Methylobacterium oryzae CBMB20
ref|WP_035525480.1|  serine--glyoxylate aminotransferase                167   5e-46   Paraburkholderia sacchari
ref|WP_026223456.1|  serine--glyoxylate aminotransferase                167   5e-46   Methylosarcina fibrata
ref|WP_026190999.1|  serine--glyoxylate aminotransferase                167   5e-46   Methylobacterium sp. WSM2598
ref|WP_012336184.1|  serine--glyoxylate aminotransferase                167   6e-46   Methylobacterium sp. 4-46
ref|WP_012405153.1|  serine--glyoxylate aminotransferase                167   7e-46   Paraburkholderia phymatum
ref|WP_027168976.1|  serine--glyoxylate aminotransferase                167   7e-46   Mesorhizobium sp. WSM3224
ref|WP_028212654.1|  serine--glyoxylate aminotransferase                167   8e-46   Paraburkholderia mimosarum
ref|WP_036271184.1|  serine--glyoxylate aminotransferase                166   9e-46   Methyloversatilis universalis
ref|WP_043355705.1|  serine--glyoxylate aminotransferase                166   1e-45   Methylobacterium
ref|WP_022947294.1|  serine--glyoxylate aminotransferase                166   1e-45   Methylohalobius crimeensis
ref|WP_013819317.1|  serine--glyoxylate aminotransferase                166   1e-45   Methylomonas methanica
ref|WP_006203221.1|  serine--glyoxylate aminotransferase                166   1e-45   Mesorhizobium amorphae
ref|XP_005851882.1|  hypothetical protein CHLNCDRAFT_33614              167   2e-45   Chlorella variabilis
ref|WP_027061369.1|  serine--glyoxylate aminotransferase                165   2e-45   Mesorhizobium loti
ref|WP_027029542.1|  serine--glyoxylate aminotransferase                165   2e-45   Mesorhizobium loti
ref|WP_023496630.1|  serine--glyoxylate aminotransferase SgaA           165   3e-45   Methyloglobulus morosus
ref|WP_019867322.1|  serine--glyoxylate aminotransferase                165   3e-45   Methylovulum miyakonense
ref|WP_036260471.1|  serine--glyoxylate aminotransferase                165   4e-45   Methylocapsa aurea
ref|WP_023829410.1|  serine--glyoxylate aminotransferase                164   4e-45   
ref|WP_008058631.1|  serine--glyoxylate aminotransferase                164   5e-45   
ref|WP_029644281.1|  serine--glyoxylate aminotransferase                164   7e-45   
ref|WP_043363897.1|  serine--glyoxylate aminotransferase                164   8e-45   
ref|WP_040969922.1|  serine--glyoxylate aminotransferase                164   8e-45   
ref|WP_023670792.1|  serine--glyoxylate aminotransferase                164   1e-44   
ref|WP_023805485.1|  serine--glyoxylate aminotransferase                164   1e-44   
ref|WP_023714322.1|  serine--glyoxylate aminotransferase                163   1e-44   
ref|WP_023690293.1|  serine--glyoxylate aminotransferase                163   2e-44   
ref|WP_027051273.1|  serine--glyoxylate aminotransferase                163   2e-44   
ref|WP_023712721.1|  MULTISPECIES: serine--glyoxylate aminotransf...    163   2e-44   
ref|WP_023818017.1|  serine--glyoxylate aminotransferase                163   2e-44   
ref|WP_023700366.1|  serine--glyoxylate aminotransferase                163   2e-44   
ref|WP_023822176.1|  serine--glyoxylate aminotransferase                163   2e-44   
ref|WP_027146511.1|  serine--glyoxylate aminotransferase                162   2e-44   
ref|WP_015317366.1|  serine--glyoxylate aminotransferase                162   3e-44   
ref|WP_024925735.1|  MULTISPECIES: serine--glyoxylate aminotransf...    162   3e-44   
ref|WP_023690974.1|  MULTISPECIES: serine--glyoxylate aminotransf...    162   3e-44   
ref|WP_023698325.1|  serine--glyoxylate aminotransferase                162   4e-44   
ref|WP_023706127.1|  MULTISPECIES: serine--glyoxylate aminotransf...    162   4e-44   
ref|WP_023731220.1|  MULTISPECIES: serine--glyoxylate aminotransf...    162   4e-44   
ref|WP_023685219.1|  serine--glyoxylate aminotransferase                162   4e-44   
ref|WP_042643125.1|  serine--glyoxylate aminotransferase                162   5e-44   
ref|WP_041003840.1|  serine--glyoxylate aminotransferase                162   6e-44   
ref|WP_023753463.1|  MULTISPECIES: serine--glyoxylate aminotransf...    161   6e-44   
ref|WP_018267457.1|  serine--glyoxylate aminotransferase                161   6e-44   
ref|WP_040981991.1|  serine--glyoxylate aminotransferase                161   7e-44   
ref|WP_041007618.1|  serine--glyoxylate aminotransferase                161   7e-44   
ref|WP_043774228.1|  serine--glyoxylate aminotransferase                161   8e-44   
ref|WP_023833857.1|  serine--glyoxylate aminotransferase                161   9e-44   
ref|WP_023746858.1|  MULTISPECIES: serine--glyoxylate aminotransf...    161   9e-44   
ref|WP_023741624.1|  serine--glyoxylate aminotransferase                161   1e-43   
ref|WP_023739129.1|  MULTISPECIES: serine--glyoxylate aminotransf...    161   1e-43   
ref|WP_013894918.1|  serine--glyoxylate aminotransferase                160   1e-43   
ref|WP_032930697.1|  serine--glyoxylate aminotransferase                160   1e-43   
ref|WP_015314900.1|  serine--glyoxylate aminotransferase                160   2e-43   
ref|WP_031597721.1|  serine--glyoxylate aminotransferase                160   2e-43   
ref|WP_027044922.1|  serine--glyoxylate aminotransferase                160   2e-43   
ref|WP_003613273.1|  serine--glyoxylate aminotransferase                160   2e-43   
ref|WP_023827347.1|  serine--glyoxylate aminotransferase                160   2e-43   
ref|WP_036293367.1|  serine--glyoxylate aminotransferase                160   2e-43   
ref|WP_026227793.1|  serine--glyoxylate aminotransferase                160   2e-43   
ref|WP_041011880.1|  serine--glyoxylate aminotransferase                160   2e-43   
ref|WP_019858769.1|  serine--glyoxylate aminotransferase                160   2e-43   
ref|WP_037283573.1|  serine--glyoxylate aminotransferase                160   2e-43   
ref|WP_023763335.1|  serine--glyoxylate aminotransferase                160   3e-43   
ref|WP_024878012.1|  MULTISPECIES: serine--glyoxylate aminotransf...    159   4e-43   
ref|WP_010910076.1|  serine--glyoxylate aminotransferase                159   4e-43   
ref|WP_023782620.1|  serine--glyoxylate aminotransferase                159   4e-43   
gb|KJB83533.1|  hypothetical protein B456_013G252200                    158   5e-43   
ref|WP_023779196.1|  serine--glyoxylate aminotransferase                159   7e-43   
ref|WP_018405893.1|  serine--glyoxylate aminotransferase                159   9e-43   
ref|WP_014955398.1|  serine--glyoxylate aminotransferase                158   1e-42   
ref|WP_023769804.1|  MULTISPECIES: serine--glyoxylate aminotransf...    158   1e-42   
ref|WP_014890662.1|  serine--glyoxylate aminotransferase                158   1e-42   
ref|WP_009211467.1|  serine--glyoxylate aminotransferase                158   2e-42   
ref|WP_029648781.1|  serine--glyoxylate aminotransferase                158   2e-42   
ref|WP_013529882.1|  serine--glyoxylate aminotransferase                158   2e-42   
ref|WP_028097617.1|  serine--glyoxylate aminotransferase                157   2e-42   
ref|WP_036274731.1|  serine--glyoxylate aminotransferase                157   3e-42   
ref|WP_040618186.1|  serine--glyoxylate aminotransferase                157   4e-42   
ref|WP_020482091.1|  serine--glyoxylate aminotransferase                156   4e-42   
ref|WP_026604426.1|  serine--glyoxylate aminotransferase                156   5e-42   
ref|WP_024351906.1|  serine--glyoxylate aminotransferase                156   6e-42   
ref|WP_020085137.1|  serine--glyoxylate aminotransferase                156   6e-42   
ref|WP_016921634.1|  serine--glyoxylate aminotransferase                156   8e-42   
ref|WP_037268413.1|  serine--glyoxylate aminotransferase                156   8e-42   
ref|WP_037245168.1|  serine--glyoxylate aminotransferase                156   9e-42   
ref|WP_033156535.1|  serine--glyoxylate aminotransferase                155   9e-42   
ref|WP_009817966.1|  serine--glyoxylate aminotransferase                155   1e-41   
gb|AFZ62596.1|  serine-glyoxylate aminotransferase                      155   1e-41   
ref|WP_023434100.1|  Serine--glyoxylate aminotransferase                155   1e-41   
ref|WP_041319044.1|  serine--glyoxylate aminotransferase                155   1e-41   
ref|WP_020592928.1|  hypothetical protein                               155   2e-41   
ref|WP_038511699.1|  serine--glyoxylate aminotransferase                155   2e-41   
ref|WP_036284904.1|  serine--glyoxylate aminotransferase                154   3e-41   
ref|WP_037133426.1|  serine--glyoxylate aminotransferase                154   3e-41   
ref|WP_024505109.1|  serine--glyoxylate aminotransferase                154   3e-41   
ref|WP_013949995.1|  MULTISPECIES: serine--glyoxylate aminotransf...    154   4e-41   
ref|WP_027163728.1|  serine--glyoxylate aminotransferase                154   4e-41   
gb|AHJ64409.1|  Serine-pyruvate aminotransferase                        155   4e-41   
ref|WP_037429329.1|  hypothetical protein                               147   5e-41   
ref|WP_043847105.1|  serine--glyoxylate aminotransferase                154   6e-41   
ref|WP_011630756.1|  serine--glyoxylate aminotransferase                153   7e-41   
ref|WP_038515723.1|  serine--glyoxylate aminotransferase                153   7e-41   
ref|WP_037336675.1|  serine--glyoxylate aminotransferase                153   7e-41   
ref|WP_008280158.1|  serine--glyoxylate aminotransferase                153   8e-41   
sp|O08374.2|SGAA_HYPME  RecName: Full=Serine--glyoxylate aminotra...    153   8e-41   
gb|AHJ67030.1|  hypothetical protein GbCGDNIH2_0048                     153   1e-40   
gb|AHJ61786.1|  Serine-pyruvate aminotransferase                        153   1e-40   
ref|WP_005162865.1|  Serine--glyoxylate aminotransferase                152   1e-40   
ref|WP_033390460.1|  serine--glyoxylate aminotransferase                152   2e-40   
ref|WP_020636555.1|  serine--glyoxylate aminotransferase                152   2e-40   
ref|WP_037437029.1|  hypothetical protein                               145   3e-40   
ref|WP_006005059.1|  serine--glyoxylate aminotransferase                151   6e-40   
ref|WP_044852944.1|  serine--glyoxylate aminotransferase                150   7e-40   
ref|WP_010239996.1|  serine--glyoxylate aminotransferase                150   8e-40   
ref|WP_038514775.1|  serine--glyoxylate aminotransferase                150   1e-39   
ref|WP_006344742.1|  serine--glyoxylate aminotransferase                150   1e-39   
gb|KIZ03753.1|  serine--glyoxylate transaminase                         150   1e-39   
ref|WP_013217108.1|  serine--glyoxylate aminotransferase                150   2e-39   
ref|WP_028431641.1|  serine--glyoxylate aminotransferase                149   2e-39   
ref|WP_015599474.1|  serine--glyoxylate aminotransferase                149   2e-39   
ref|XP_005539023.1|  serine-glyoxylate aminotransferase                 150   2e-39   
ref|WP_037399714.1|  serine--glyoxylate aminotransferase                140   1e-38   
ref|WP_025312373.1|  serine--glyoxylate aminotransferase                147   1e-38   
ref|WP_043870950.1|  serine--glyoxylate aminotransferase                147   2e-38   
ref|WP_042195193.1|  serine--glyoxylate aminotransferase                146   3e-38   
ref|WP_037126267.1|  serine--glyoxylate aminotransferase                145   7e-38   
ref|WP_007815045.1|  serine--glyoxylate aminotransferase                145   1e-37   
ref|WP_019140317.1|  serine--glyoxylate aminotransferase                145   2e-37   
ref|WP_043769964.1|  serine--glyoxylate aminotransferase                144   2e-37   
ref|WP_028435927.1|  serine--glyoxylate aminotransferase                144   3e-37   
ref|WP_030670113.1|  serine--glyoxylate aminotransferase                144   3e-37   
ref|WP_040829642.1|  serine--glyoxylate aminotransferase                144   3e-37   
ref|WP_036336347.1|  serine--glyoxylate aminotransferase                144   3e-37   
ref|WP_016574932.1|  Serine-glyoxylate aminotransferase                 144   3e-37   
ref|WP_014743098.1|  serine--glyoxylate aminotransferase                143   3e-37   
ref|WP_040742470.1|  serine--glyoxylate aminotransferase                143   4e-37   
ref|WP_030358204.1|  MULTISPECIES: serine--glyoxylate aminotransf...    143   4e-37   
ref|WP_030566583.1|  serine--glyoxylate aminotransferase                143   5e-37   
ref|WP_026641447.1|  serine--glyoxylate aminotransferase                143   5e-37   
ref|WP_020084034.1|  serine--glyoxylate aminotransferase                143   6e-37   
ref|WP_019015661.1|  hypothetical protein                               143   6e-37   
ref|WP_026847044.1|  serine--glyoxylate aminotransferase                142   7e-37   
gb|ABZ06421.1|  putative aminotransferase class-V                       141   8e-37   
ref|WP_016640027.1|  putative Serine--glyoxylate aminotransferase       142   1e-36   
ref|WP_010968118.1|  serine--glyoxylate aminotransferase                142   1e-36   
ref|WP_006224393.1|  serine--glyoxylate aminotransferase                142   1e-36   
ref|WP_029016266.1|  serine--glyoxylate aminotransferase                142   1e-36   
ref|WP_008943383.1|  serine--glyoxylate aminotransferase                142   1e-36   
ref|WP_038008200.1|  MULTISPECIES: serine--glyoxylate aminotransf...    142   1e-36   
ref|WP_041345074.1|  serine--glyoxylate aminotransferase                142   2e-36   
ref|WP_024570173.1|  MULTISPECIES: serine--glyoxylate aminotransf...    142   2e-36   
gb|ABA05667.1|  aminotransferase, class V                               142   2e-36   
ref|WP_037263007.1|  serine--glyoxylate aminotransferase                142   2e-36   
ref|WP_012177563.1|  serine--glyoxylate aminotransferase                141   2e-36   
ref|WP_028356096.1|  serine--glyoxylate aminotransferase                141   2e-36   
gb|EST32977.1|  serine--glyoxylate aminotransferase                     141   2e-36   
ref|WP_039689210.1|  serine--glyoxylate aminotransferase                141   2e-36   
ref|WP_011454286.1|  serine--glyoxylate aminotransferase                141   2e-36   
ref|WP_031228637.1|  serine--glyoxylate aminotransferase                141   2e-36   
ref|WP_042083882.1|  serine--glyoxylate aminotransferase                141   2e-36   
ref|WP_006219842.1|  serine--glyoxylate aminotransferase                141   3e-36   
ref|WP_020666968.1|  serine--glyoxylate aminotransferase                141   3e-36   
ref|WP_008641541.1|  MULTISPECIES: Serine-glyoxylate aminotransfe...    140   5e-36   
ref|WP_008840237.1|  class V aminotransferase                           137   5e-36   
ref|WP_013046086.1|  serine--glyoxylate aminotransferase                140   6e-36   
ref|WP_009796741.1|  serine--glyoxylate aminotransferase                140   6e-36   
ref|WP_014869675.1|  serine--glyoxylate aminotransferase                140   6e-36   
ref|WP_007351739.1|  serine--glyoxylate aminotransferase                140   7e-36   
ref|WP_034483968.1|  serine--glyoxylate aminotransferase                140   7e-36   
ref|WP_007004225.1|  serine--glyoxylate aminotransferase                140   7e-36   
ref|WP_019452138.1|  serine--glyoxylate aminotransferase                140   8e-36   
ref|WP_011520033.1|  serine--glyoxylate aminotransferase                140   8e-36   
ref|WP_037057439.1|  serine--glyoxylate aminotransferase                140   8e-36   
ref|WP_007811273.1|  serine--glyoxylate aminotransferase                140   8e-36   
ref|WP_029455333.1|  serine--glyoxylate aminotransferase                140   9e-36   
ref|WP_013695939.1|  serine--glyoxylate aminotransferase                139   9e-36   
ref|XP_011399157.1|  Serine-glyoxylate aminotransferase                 139   1e-35   
ref|WP_040808396.1|  serine--glyoxylate aminotransferase                139   1e-35   
emb|CAD13310.1|  serine-glyoxylate aminotransferase                     139   1e-35   
ref|WP_011513322.1|  MULTISPECIES: serine--glyoxylate aminotransf...    139   1e-35   
ref|WP_014982904.1|  serine--glyoxylate aminotransferase                139   1e-35   
ref|WP_034505845.1|  serine--glyoxylate aminotransferase                139   1e-35   
ref|WP_008546137.1|  serine--glyoxylate aminotransferase                139   2e-35   
ref|WP_042997765.1|  serine--glyoxylate aminotransferase                139   2e-35   
ref|WP_008757940.1|  serine--glyoxylate aminotransferase                139   2e-35   
ref|WP_029895536.1|  serine--glyoxylate aminotransferase                138   3e-35   
ref|WP_043619319.1|  serine--glyoxylate aminotransferase                138   3e-35   
ref|WP_015895604.1|  serine--glyoxylate aminotransferase                138   3e-35   
gb|ACF06940.1|  aminotransferase class V                                136   3e-35   
ref|WP_037459311.1|  serine--glyoxylate aminotransferase                138   3e-35   
ref|WP_040651093.1|  serine--glyoxylate aminotransferase                138   3e-35   
gb|AAY68344.1|  putative serine-pyruvate aminotransferase               138   3e-35   
ref|WP_028796360.1|  serine--glyoxylate aminotransferase                138   4e-35   
ref|WP_017971680.1|  serine--glyoxylate aminotransferase                138   4e-35   
ref|WP_028923528.1|  serine--glyoxylate aminotransferase                138   4e-35   
ref|WP_018387201.1|  serine--glyoxylate aminotransferase                138   4e-35   
ref|WP_029454537.1|  serine--glyoxylate aminotransferase                138   4e-35   
ref|WP_041317230.1|  serine--glyoxylate aminotransferase                138   4e-35   
ref|WP_039396834.1|  serine--glyoxylate aminotransferase                138   4e-35   
ref|WP_033449479.1|  serine--glyoxylate aminotransferase                138   5e-35   
gb|AHB47648.1|  serine--glyoxylate aminotransferase                     138   5e-35   
ref|WP_003815469.1|  serine--glyoxylate aminotransferase                138   5e-35   
ref|WP_037247820.1|  serine--glyoxylate aminotransferase                137   5e-35   
ref|WP_011569032.1|  serine--glyoxylate aminotransferase                137   5e-35   
ref|WP_015040670.1|  serine--glyoxylate aminotransferase                137   5e-35   
ref|WP_010929438.1|  serine--glyoxylate aminotransferase                137   5e-35   
ref|WP_027284153.1|  serine--glyoxylate aminotransferase                137   6e-35   
ref|WP_042112271.1|  serine--glyoxylate aminotransferase                137   6e-35   
ref|WP_040700437.1|  serine--glyoxylate aminotransferase                137   6e-35   
ref|WP_043145413.1|  serine--glyoxylate aminotransferase                137   7e-35   
ref|WP_013961473.1|  serine--glyoxylate aminotransferase                137   7e-35   
ref|WP_042259673.1|  serine--glyoxylate aminotransferase                137   8e-35   
ref|WP_007436752.1|  serine--glyoxylate aminotransferase                137   8e-35   
ref|WP_018260236.1|  serine--glyoxylate aminotransferase                137   9e-35   
gb|EAQ23658.1|  probable serine-glyoxylate aminotransferase             138   9e-35   
ref|WP_025589533.1|  serine--glyoxylate aminotransferase                137   9e-35   
ref|WP_012333270.1|  serine--glyoxylate aminotransferase                137   9e-35   
ref|WP_014906063.1|  MULTISPECIES: serine--glyoxylate aminotransf...    137   1e-34   
ref|WP_043363725.1|  serine--glyoxylate aminotransferase                137   1e-34   
ref|WP_015929396.1|  serine--glyoxylate aminotransferase                137   1e-34   
ref|WP_037249159.1|  serine--glyoxylate aminotransferase                136   1e-34   
ref|WP_010808567.1|  aminotransferase class V                           136   2e-34   
ref|WP_044591882.1|  serine--glyoxylate aminotransferase                136   2e-34   
ref|WP_037308357.1|  serine--glyoxylate aminotransferase                136   2e-34   
ref|WP_038380823.1|  serine--glyoxylate aminotransferase                136   2e-34   
ref|WP_033453548.1|  serine--glyoxylate aminotransferase                136   2e-34   
ref|WP_044456571.1|  serine--glyoxylate aminotransferase                136   2e-34   
ref|WP_003817883.1|  serine--glyoxylate aminotransferase                136   2e-34   
ref|WP_033449717.1|  serine--glyoxylate aminotransferase                136   2e-34   
ref|WP_004567895.1|  serine--glyoxylate aminotransferase                136   2e-34   
ref|WP_043355494.1|  serine--glyoxylate aminotransferase                136   2e-34   
ref|WP_040441411.1|  serine--glyoxylate aminotransferase                136   2e-34   
ref|WP_011280657.1|  serine--glyoxylate aminotransferase                135   2e-34   
ref|WP_008279759.1|  serine--glyoxylate aminotransferase                136   2e-34   
ref|WP_041319754.1|  serine--glyoxylate aminotransferase                136   3e-34   
gb|ABQ37680.1|  serine-glyoxylate aminotransferase                      135   3e-34   
ref|WP_041750914.1|  serine--glyoxylate aminotransferase                135   3e-34   
ref|WP_025610388.1|  serine--glyoxylate aminotransferase                135   3e-34   



>emb|CDP08481.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   298 bits (763),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/148 (94%), Positives = 144/148 (97%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYVN PGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TK LLEDVKKIFKT SG
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKILLEDVKKIFKTESG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDV+ESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVIESEWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANLD+LASKLAEDTAHTIKAICIVHNET
Sbjct  121  ANLDILASKLAEDTAHTIKAICIVHNET  148



>ref|XP_011090165.1| PREDICTED: serine--glyoxylate aminotransferase [Sesamum indicum]
Length=401

 Score =   296 bits (759),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIPDQV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPDQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDVVESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVVESEWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANLDVLASK+AED AHTIKAICIVHNET
Sbjct  121  ANLDVLASKIAEDKAHTIKAICIVHNET  148



>ref|XP_010277598.1| PREDICTED: serine--glyoxylate aminotransferase [Nelumbo nucifera]
 ref|XP_010277599.1| PREDICTED: serine--glyoxylate aminotransferase [Nelumbo nucifera]
Length=401

 Score =   294 bits (753),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 140/148 (95%), Positives = 144/148 (97%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV APGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYVYAPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDV+ESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVIESEWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANLD+LASKLA DTAHTIKAICIVHNET
Sbjct  121  ANLDILASKLAADTAHTIKAICIVHNET  148



>gb|KDO44954.1| hypothetical protein CISIN_1g0157291mg [Citrus sinensis]
Length=367

 Score =   290 bits (743),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 137/148 (93%), Positives = 144/148 (97%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+ APG+NHLFVPGPV+IPDQVIRAM RNNEDYRSPAVPALTKTLLED+KKIFKTTSG
Sbjct  1    MDYMYAPGKNHLFVPGPVHIPDQVIRAMNRNNEDYRSPAVPALTKTLLEDIKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRI+SFLIGQFSLLWIDQQQRLNFNVDVVES+WG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIISFLIGQFSLLWIDQQQRLNFNVDVVESDWGEG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A LDVLASKLA DTAHTIKAICIVHNET
Sbjct  121  AKLDVLASKLAADTAHTIKAICIVHNET  148



>ref|XP_003600160.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES70411.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=408

 Score =   292 bits (747),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 135/148 (91%), Positives = 144/148 (97%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYVN PGRNHLFVPGPVNIPDQVIRAM+RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPDQVIRAMSRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRIVSF+IGQFSLLW+DQQQRL FNVDVVESEWG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFVIGQFSLLWVDQQQRLKFNVDVVESEWGRG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A+LD+L SKLA D+AHTIKAICIVHNET
Sbjct  121  ADLDILESKLASDSAHTIKAICIVHNET  148



>ref|XP_003600159.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES70410.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=401

 Score =   291 bits (745),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 135/148 (91%), Positives = 144/148 (97%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYVN PGRNHLFVPGPVNIPDQVIRAM+RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPDQVIRAMSRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRIVSF+IGQFSLLW+DQQQRL FNVDVVESEWG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFVIGQFSLLWVDQQQRLKFNVDVVESEWGRG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A+LD+L SKLA D+AHTIKAICIVHNET
Sbjct  121  ADLDILESKLASDSAHTIKAICIVHNET  148



>ref|XP_011080387.1| PREDICTED: serine--glyoxylate aminotransferase-like [Sesamum 
indicum]
Length=401

 Score =   291 bits (745),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 137/148 (93%), Positives = 142/148 (96%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+QVIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKT SG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTASG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRIV+FLIGQFSLLWIDQQQRLNFNVDVVESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVTFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANL++LASK+AED  HTIKAICIVHNET
Sbjct  121  ANLEILASKIAEDREHTIKAICIVHNET  148



>gb|KDO44953.1| hypothetical protein CISIN_1g0157291mg [Citrus sinensis]
Length=401

 Score =   291 bits (745),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 137/148 (93%), Positives = 144/148 (97%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+ APG+NHLFVPGPV+IPDQVIRAM RNNEDYRSPAVPALTKTLLED+KKIFKTTSG
Sbjct  1    MDYMYAPGKNHLFVPGPVHIPDQVIRAMNRNNEDYRSPAVPALTKTLLEDIKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRI+SFLIGQFSLLWIDQQQRLNFNVDVVES+WG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIISFLIGQFSLLWIDQQQRLNFNVDVVESDWGEG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A LDVLASKLA DTAHTIKAICIVHNET
Sbjct  121  AKLDVLASKLAADTAHTIKAICIVHNET  148



>ref|XP_006470731.1| PREDICTED: serine--glyoxylate aminotransferase-like [Citrus sinensis]
Length=401

 Score =   291 bits (744),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 137/148 (93%), Positives = 144/148 (97%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+ APG+NHLFVPGPV+IPDQVIRAM RNNEDYRSPAVPALTKTLLED+KKIFKTTSG
Sbjct  1    MDYMYAPGKNHLFVPGPVHIPDQVIRAMNRNNEDYRSPAVPALTKTLLEDIKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRI+SFLIGQFSLLWIDQQQRLNFNVDVVES+WG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIISFLIGQFSLLWIDQQQRLNFNVDVVESDWGEG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A LDVLASKLA DTAHTIKAICIVHNET
Sbjct  121  AKLDVLASKLAADTAHTIKAICIVHNET  148



>ref|XP_004499480.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cicer arietinum]
Length=401

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/148 (92%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYVN PGRNHLFVPGPVNIPDQVIRAM+RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPDQVIRAMSRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PT GTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQQRL FNVDVVESEWG+G
Sbjct  61   TPFLFPTXGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGKG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANLD+L SKLA D+AHTIKAICIVHNET
Sbjct  121  ANLDILESKLASDSAHTIKAICIVHNET  148



>ref|XP_006446249.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 ref|XP_006446250.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 gb|ESR59489.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 gb|ESR59490.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
Length=401

 Score =   290 bits (743),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/148 (93%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+ APG+NHLFVPGPV IPDQVIRAM RNNEDYRSPAVPALTKTLLED+KKIFKTTSG
Sbjct  1    MDYMYAPGKNHLFVPGPVQIPDQVIRAMNRNNEDYRSPAVPALTKTLLEDIKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRI+SFLIGQFSLLWIDQQQRLNFNVDVVES+WG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIISFLIGQFSLLWIDQQQRLNFNVDVVESDWGEG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A LDVLASKLA DTAHTIKAICIVHNET
Sbjct  121  AKLDVLASKLAADTAHTIKAICIVHNET  148



>ref|XP_010045046.1| PREDICTED: serine--glyoxylate aminotransferase [Eucalyptus grandis]
 ref|XP_010045047.1| PREDICTED: serine--glyoxylate aminotransferase [Eucalyptus grandis]
 gb|KCW87200.1| hypothetical protein EUGRSUZ_B03720 [Eucalyptus grandis]
Length=401

 Score =   290 bits (742),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/148 (91%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIPDQVIRAM RNNEDYRSPA+PALTK LLEDVKKIFKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPDQVIRAMNRNNEDYRSPAIPALTKILLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDR +SF+IGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRTISFMIGQFSLLWIDQQQRLGFNVDVVESEWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANLD+LASKLA DTAHTIKA+CIVHNET
Sbjct  121  ANLDILASKLAADTAHTIKAVCIVHNET  148



>ref|XP_007146302.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 ref|XP_007146303.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 gb|ESW18296.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 gb|ESW18297.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
Length=401

 Score =   290 bits (741),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/148 (92%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
             PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61   IPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESDWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A LDVL SK+A DTAHTIKAICIVHNET
Sbjct  121  AKLDVLESKIASDTAHTIKAICIVHNET  148



>gb|AGV54322.1| serine glyoxylate aminotransferase 2 [Phaseolus vulgaris]
Length=401

 Score =   290 bits (741),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/148 (92%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
             PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61   IPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESDWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A LDVL SK+A DTAHTIKAICIVHNET
Sbjct  121  AKLDVLESKIASDTAHTIKAICIVHNET  148



>ref|XP_006584642.1| PREDICTED: enzymatic resistance protein isoform X1 [Glycine max]
 gb|ACE63506.1| alanine:glyoxylate aminotransferase [Vigna radiata]
 gb|ACU23313.1| unknown [Glycine max]
 gb|KHM99689.1| Serine--glyoxylate aminotransferase [Glycine soja]
Length=401

 Score =   290 bits (741),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/148 (91%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWG G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGHG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A LDVL SK+A DT+HTIKAICIVHNET
Sbjct  121  AKLDVLESKIASDTSHTIKAICIVHNET  148



>ref|NP_001237048.1| enzymatic resistance protein [Glycine max]
 gb|AAZ94162.1| enzymatic resistance protein [Glycine max]
Length=401

 Score =   290 bits (741),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 135/148 (91%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWG G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGHG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A LDVL SK+A DT+HTIKAICIVHNET
Sbjct  121  AKLDVLESKIASDTSHTIKAICIVHNET  148



>gb|ACJ61247.1| serine glyoxylate aminotransferase 3 [Glycine max]
Length=401

 Score =   290 bits (741),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 135/148 (91%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWG G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGHG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A LDVL SK+A DT+HTIKAICIVHNET
Sbjct  121  AKLDVLESKIASDTSHTIKAICIVHNET  148



>gb|AFK40703.1| unknown [Medicago truncatula]
Length=401

 Score =   289 bits (740),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 134/148 (91%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYVN PGRNHLFVPGPVNIPDQVIRAM+RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPDQVIRAMSRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWES LTNTLSPGDRIVSF+IGQFSLLW+DQQQRL FNVDVVESEWG+G
Sbjct  61   TPFLIPTTGTGAWESVLTNTLSPGDRIVSFVIGQFSLLWVDQQQRLKFNVDVVESEWGRG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A+LD+L SKLA D+AHTIKAICIVHNET
Sbjct  121  ADLDILESKLASDSAHTIKAICIVHNET  148



>gb|EPS59280.1| serine-glyoxylate aminotransferase [Genlisea aurea]
Length=401

 Score =   289 bits (739),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 136/148 (92%), Positives = 142/148 (96%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+QVIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGRG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A+LD+LASK+A+D  H IKAICIVHNET
Sbjct  121  ADLDILASKIAQDKDHAIKAICIVHNET  148



>ref|XP_008227244.1| PREDICTED: serine--glyoxylate aminotransferase [Prunus mume]
Length=401

 Score =   289 bits (739),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 136/148 (92%), Positives = 142/148 (96%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TK LLEDVKKIFKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPAMTKILLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDVVESEWGQG
Sbjct  61   TPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVVESEWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANLD+LASKLAEDTAHTIKAICIVHNET
Sbjct  121  ANLDILASKLAEDTAHTIKAICIVHNET  148



>ref|XP_009342610.1| PREDICTED: serine--glyoxylate aminotransferase [Pyrus x bretschneideri]
 ref|XP_009342611.1| PREDICTED: serine--glyoxylate aminotransferase [Pyrus x bretschneideri]
Length=401

 Score =   288 bits (738),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 136/148 (92%), Positives = 142/148 (96%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVK+IFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPAMTKTLLEDVKQIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61   TPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANLDVL SK+AEDTAHTIKAICIVHNET
Sbjct  121  ANLDVLESKIAEDTAHTIKAICIVHNET  148



>ref|XP_008363560.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
Length=401

 Score =   288 bits (738),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 136/148 (92%), Positives = 142/148 (96%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61   TPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESDWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANLDVL SK+AEDTAHTIKAICIVHNET
Sbjct  121  ANLDVLESKIAEDTAHTIKAICIVHNET  148



>ref|XP_006369572.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66141.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=321

 Score =   285 bits (730),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 132/148 (89%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY   PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPESVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+IPTTGTGAWESALTNTLSPGDR VSF+IGQFSLLWIDQQ+RL FNVDVVES+WGQG
Sbjct  61   TPFIIPTTGTGAWESALTNTLSPGDRTVSFMIGQFSLLWIDQQKRLGFNVDVVESDWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANLD+LASKLAEDTAHTIKA+CIVHNET
Sbjct  121  ANLDILASKLAEDTAHTIKAVCIVHNET  148



>ref|XP_006349776.1| PREDICTED: serine--glyoxylate aminotransferase-like [Solanum 
tuberosum]
Length=401

 Score =   288 bits (736),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/148 (91%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYVN PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQ+RLNF+VDVVES+WGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLNFDVDVVESDWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANL+VLASK+AED +HTIKA+CIVHNET
Sbjct  121  ANLEVLASKIAEDKSHTIKAVCIVHNET  148



>gb|KHN28521.1| Serine--glyoxylate aminotransferase [Glycine soja]
Length=401

 Score =   288 bits (736),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/148 (91%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKT +G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTITG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
             PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61   IPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A LDVL SK+A DT+HTIKAICIVHNET
Sbjct  121  AKLDVLESKIASDTSHTIKAICIVHNET  148



>ref|NP_001276276.1| serine--glyoxylate aminotransferase-like [Glycine max]
 gb|ACU18294.1| unknown [Glycine max]
Length=401

 Score =   288 bits (736),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/148 (91%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKT +G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTITG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
             PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61   IPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A LDVL SK+A DT+HTIKAICIVHNET
Sbjct  121  AKLDVLESKIASDTSHTIKAICIVHNET  148



>ref|NP_001265946.1| Hop-interacting protein THI032 [Solanum lycopersicum]
 ref|XP_010314658.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314659.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314661.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314662.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314663.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 gb|AEW69795.1| Hop-interacting protein THI032 [Solanum lycopersicum]
Length=401

 Score =   288 bits (736),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/148 (91%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYVN PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQ+RLNF+VDVVES+WGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLNFDVDVVESDWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANL+VLASK+AED +HTIKA+CIVHNET
Sbjct  121  ANLEVLASKIAEDKSHTIKAVCIVHNET  148



>dbj|BAJ33858.1| unnamed protein product [Thellungiella halophila]
Length=438

 Score =   288 bits (737),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 134/149 (90%), Positives = 143/149 (96%), Gaps = 0/149 (0%)
 Frame = +3

Query  144  KMDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTS  323
            KMDY+N PGR+HLFVPGPVNIP+QVIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTS
Sbjct  37   KMDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTS  96

Query  324  GTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQ  503
            GTPF+ PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQ
Sbjct  97   GTPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQ  156

Query  504  GANLDVLASKLAEDTAHTIKAICIVHNET  590
            GANL VLASKL++D  H+IKAICIVHNET
Sbjct  157  GANLQVLASKLSQDQNHSIKAICIVHNET  185



>ref|XP_008359496.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
 ref|XP_008359497.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
Length=401

 Score =   286 bits (733),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 134/148 (91%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+ V+R+M RNNEDYRSPAVPA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEAVLRSMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANLD+L SK+AEDTAHTIKAICIVHNET
Sbjct  121  ANLDILESKIAEDTAHTIKAICIVHNET  148



>emb|CDY37208.1| BnaA09g08290D [Brassica napus]
Length=401

 Score =   286 bits (733),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 134/148 (91%), Positives = 142/148 (96%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+N PGR+HLFVPGPVNIP+QVIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+ PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61   TPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANL VLASKL++D  HTIKAICIVHNET
Sbjct  121  ANLQVLASKLSQDQNHTIKAICIVHNET  148



>ref|XP_007212264.1| hypothetical protein PRUPE_ppa006653mg [Prunus persica]
 gb|EMJ13463.1| hypothetical protein PRUPE_ppa006653mg [Prunus persica]
Length=401

 Score =   286 bits (732),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 135/148 (91%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TK LLEDVKKIFKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPAMTKILLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T F+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDVVESEWGQG
Sbjct  61   TSFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVVESEWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANLD+LASKLAEDTAHTIKAICIVHNET
Sbjct  121  ANLDILASKLAEDTAHTIKAICIVHNET  148



>ref|XP_006843377.1| hypothetical protein AMTR_s00053p00093890 [Amborella trichopoda]
 gb|ERN05052.1| hypothetical protein AMTR_s00053p00093890 [Amborella trichopoda]
Length=401

 Score =   286 bits (732),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 135/148 (91%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSP DRIVSFL+GQFSLLWIDQQQRLNFNVDV+ESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPRDRIVSFLMGQFSLLWIDQQQRLNFNVDVIESEWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANLD LASKLAED  HTIKAICIVHNET
Sbjct  121  ANLDALASKLAEDRGHTIKAICIVHNET  148



>ref|XP_011032100.1| PREDICTED: serine--glyoxylate aminotransferase-like [Populus 
euphratica]
Length=401

 Score =   286 bits (732),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 135/148 (91%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY   PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
             PFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61   IPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLGFNVDVVESDWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANLD+LASKLAEDTAHTIKA+CIVHNET
Sbjct  121  ANLDILASKLAEDTAHTIKAVCIVHNET  148



>ref|XP_008812510.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812512.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812513.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812514.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
Length=401

 Score =   286 bits (732),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 136/148 (92%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL F+VDV+ESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFDVDVIESEWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANLD+LA KLA D AHTIKAICIVHNET
Sbjct  121  ANLDILAMKLAADRAHTIKAICIVHNET  148



>gb|ACJ61246.1| serine glyoxylate aminotransferase 2 [Glycine max]
Length=401

 Score =   286 bits (732),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 133/148 (90%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKT +G
Sbjct  1    MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTITG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
             PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61   IPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A LDVL SK+A DT+HTIKAICI HNET
Sbjct  121  AKLDVLESKIASDTSHTIKAICIAHNET  148



>ref|XP_002313371.1| aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEE87326.1| aminotransferase 2 family protein [Populus trichocarpa]
Length=401

 Score =   286 bits (731),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 135/148 (91%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY   PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
             PFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61   IPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLGFNVDVVESDWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANLD+LASKLAEDTAHTIKA+CIVHNET
Sbjct  121  ANLDILASKLAEDTAHTIKAVCIVHNET  148



>emb|CDX81443.1| BnaC09g08540D [Brassica napus]
Length=401

 Score =   286 bits (731),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 133/148 (90%), Positives = 142/148 (96%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+N PGR+HLFVPGPVNIP+QV+RAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMNGPGRHHLFVPGPVNIPEQVVRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+ PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61   TPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANL VLASKL++D  HTIKAICIVHNET
Sbjct  121  ANLQVLASKLSQDQNHTIKAICIVHNET  148



>ref|XP_004291746.1| PREDICTED: serine--glyoxylate aminotransferase [Fragaria vesca 
subsp. vesca]
Length=401

 Score =   286 bits (731),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 134/148 (91%), Positives = 142/148 (96%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MD V APGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPA+PA+TK LLEDVKKIFKTT+G
Sbjct  1    MDNVYAPGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAIPAMTKILLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDVVESEWGQG
Sbjct  61   TPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVVESEWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANLD+LASKLAEDTAHTIKA+CIVHNET
Sbjct  121  ANLDILASKLAEDTAHTIKAVCIVHNET  148



>ref|XP_011043786.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
 ref|XP_011043787.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
 ref|XP_011043788.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
Length=401

 Score =   286 bits (731),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 133/148 (90%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY   PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPESVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+IPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQ+RL FNVDVVES+WGQG
Sbjct  61   TPFIIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLGFNVDVVESDWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANLD+LASKLAEDTAHTIKA+CIVHNET
Sbjct  121  ANLDILASKLAEDTAHTIKAVCIVHNET  148



>ref|XP_009112244.1| PREDICTED: serine--glyoxylate aminotransferase [Brassica rapa]
Length=401

 Score =   285 bits (730),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/148 (90%), Positives = 142/148 (96%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+N PGR+HLFVPGPVNIP+QVIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+ PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61   TPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANL VLA+KL++D  HTIKAICIVHNET
Sbjct  121  ANLQVLAAKLSQDQNHTIKAICIVHNET  148



>ref|XP_006409690.1| hypothetical protein EUTSA_v10022711mg [Eutrema salsugineum]
 gb|ESQ51143.1| hypothetical protein EUTSA_v10022711mg [Eutrema salsugineum]
Length=401

 Score =   285 bits (730),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/148 (90%), Positives = 142/148 (96%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+N PGR+HLFVPGPVNIP+QVIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+ PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61   TPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANL VLASKL++D  H+IKAICIVHNET
Sbjct  121  ANLQVLASKLSQDQNHSIKAICIVHNET  148



>gb|ABQ81925.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   285 bits (730),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/148 (91%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDV+ESEWG+G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A LDVLA+KLA DT HTIKA+CIVHNET
Sbjct  121  AKLDVLAAKLAADTDHTIKAVCIVHNET  148



>ref|XP_008449670.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
melo]
 gb|AAQ56195.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   285 bits (729),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/148 (91%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDV+ESEWG+G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A LDVLA+KLA DT HTIKA+CIVHNET
Sbjct  121  AKLDVLAAKLAADTDHTIKAVCIVHNET  148



>ref|XP_009338530.1| PREDICTED: serine--glyoxylate aminotransferase-like [Pyrus x 
bretschneideri]
Length=401

 Score =   285 bits (729),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/148 (89%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+ V+R+M RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEAVLRSMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+IPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61   TPFMIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANLD+L SK+AEDTAHTIKAICIVHNET
Sbjct  121  ANLDILESKIAEDTAHTIKAICIVHNET  148



>ref|XP_002298306.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 ref|XP_006369570.1| aminotransferase 2 family protein [Populus trichocarpa]
 ref|XP_006369571.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|EEE83111.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66139.1| aminotransferase 2 family protein [Populus trichocarpa]
 gb|ERP66140.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=401

 Score =   285 bits (729),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/148 (89%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY   PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPESVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+IPTTGTGAWESALTNTLSPGDR VSF+IGQFSLLWIDQQ+RL FNVDVVES+WGQG
Sbjct  61   TPFIIPTTGTGAWESALTNTLSPGDRTVSFMIGQFSLLWIDQQKRLGFNVDVVESDWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANLD+LASKLAEDTAHTIKA+CIVHNET
Sbjct  121  ANLDILASKLAEDTAHTIKAVCIVHNET  148



>gb|AAL62332.1|AF461048_1 aminotransferase 2 [Cucumis melo]
Length=401

 Score =   285 bits (729),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/148 (91%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDV+ESEWG+G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A LDVLA+KLA DT HTIKA+CIVHNET
Sbjct  121  AKLDVLAAKLAADTDHTIKAVCIVHNET  148



>ref|XP_006369573.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66142.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=381

 Score =   284 bits (727),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/148 (89%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY   PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPESVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+IPTTGTGAWESALTNTLSPGDR VSF+IGQFSLLWIDQQ+RL FNVDVVES+WGQG
Sbjct  61   TPFIIPTTGTGAWESALTNTLSPGDRTVSFMIGQFSLLWIDQQKRLGFNVDVVESDWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANLD+LASKLAEDTAHTIKA+CIVHNET
Sbjct  121  ANLDILASKLAEDTAHTIKAVCIVHNET  148



>ref|NP_001284445.1| serine--glyoxylate aminotransferase-like [Cucumis melo]
 gb|ABQ81923.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   285 bits (728),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/148 (91%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDV+ESEWG+G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A LDVLA+KLA DT HTIKA+CIVHNET
Sbjct  121  AKLDVLAAKLAADTDHTIKAVCIVHNET  148



>ref|XP_009619693.1| PREDICTED: serine--glyoxylate aminotransferase [Nicotiana tomentosiformis]
Length=401

 Score =   285 bits (728),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/148 (90%), Positives = 142/148 (96%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYVN PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTK LLEDVKKIFKTTSG
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKVLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNF+VDVVES+WGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFDVDVVESDWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A+L+ LASK+A D +HTIKAICIVHNET
Sbjct  121  ADLEALASKIAADKSHTIKAICIVHNET  148



>ref|XP_009775939.1| PREDICTED: serine--glyoxylate aminotransferase [Nicotiana sylvestris]
Length=401

 Score =   285 bits (728),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/148 (90%), Positives = 142/148 (96%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYVN PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTK LLEDVKKIFKTTSG
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKVLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNF+VDVVES+WGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFDVDVVESDWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A+L+ LASK+A D +HTIKAICIVHNET
Sbjct  121  ADLEALASKIAADKSHTIKAICIVHNET  148



>ref|XP_010938608.1| PREDICTED: serine--glyoxylate aminotransferase-like [Elaeis guineensis]
Length=401

 Score =   285 bits (728),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/148 (91%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTL+EDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLIEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL F+VDV+ESEWG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFDVDVIESEWGRG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANLD+LA KLA DTAHTIKAICIVHNET
Sbjct  121  ANLDMLAMKLATDTAHTIKAICIVHNET  148



>gb|ABK96624.1| unknown [Populus trichocarpa x Populus deltoides]
Length=401

 Score =   285 bits (728),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 134/148 (91%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY   PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
             PFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61   IPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLGFNVDVVESDWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            AN D+LASKLAEDTAHTIKA+CIVHNET
Sbjct  121  ANFDILASKLAEDTAHTIKAVCIVHNET  148



>gb|ABA00460.1| serine-glyoxylate aminotransferase [Spirodela polyrhiza]
Length=401

 Score =   284 bits (727),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 136/148 (92%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES+WG G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGLG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANLDVLA KLA D +H+IKAICIVHNET
Sbjct  121  ANLDVLAEKLAADHSHSIKAICIVHNET  148



>ref|XP_009136209.1| PREDICTED: serine--glyoxylate aminotransferase-like [Brassica 
rapa]
 ref|XP_009136210.1| PREDICTED: serine--glyoxylate aminotransferase-like [Brassica 
rapa]
 emb|CDX93112.1| BnaA03g38340D [Brassica napus]
Length=401

 Score =   284 bits (726),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 132/148 (89%), Positives = 142/148 (96%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+N PGR+HLFVPGPVNIP+QVIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+ PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVES+WGQG
Sbjct  61   TPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANL VLASKL++D  H+IKAICIVHNET
Sbjct  121  ANLQVLASKLSQDQNHSIKAICIVHNET  148



>emb|CDX89604.1| BnaC03g45180D [Brassica napus]
Length=401

 Score =   284 bits (726),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 132/148 (89%), Positives = 142/148 (96%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+N PGR+HLFVPGPVNIP+QVIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+ PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVES+WGQG
Sbjct  61   TPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANL VLASKL++D  H+IKAICIVHNET
Sbjct  121  ANLQVLASKLSQDQNHSIKAICIVHNET  148



>gb|ABQ81922.1| aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   284 bits (726),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 133/148 (90%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKT+SG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTSSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDV+ESEWG+G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A LDVLA+KLA DT HTIKA+CIVHNET
Sbjct  121  AKLDVLAAKLAADTDHTIKAVCIVHNET  148



>gb|AGL09527.1| alanine-glyoxylate aminotransferase, partial [Piper nigrum]
Length=275

 Score =   280 bits (715),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 133/142 (94%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP
Sbjct  1    PGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  60

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  524
            TTGTGAWESALTNTLSPGDRI+SFLIGQFSLLWIDQQQRL FNVDVVES+WGQGANLD+L
Sbjct  61   TTGTGAWESALTNTLSPGDRIISFLIGQFSLLWIDQQQRLGFNVDVVESDWGQGANLDIL  120

Query  525  ASKLAEDTAHTIKAICIVHNET  590
            ASKLA DT HTIKAICIVHNET
Sbjct  121  ASKLASDTTHTIKAICIVHNET  142



>ref|XP_004140203.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 ref|XP_004156042.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 gb|KGN48108.1| Aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   283 bits (725),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 133/148 (90%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDV+ES+WG+G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESDWGEG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A LDVLA+KLA DT HTIKA+CIVHNET
Sbjct  121  AKLDVLAAKLAADTDHTIKAVCIVHNET  148



>gb|AGL09526.1| alanine-glyoxylate aminotransferase, partial [Peperomia prostrata]
Length=289

 Score =   279 bits (713),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSGTPF+IP
Sbjct  1    PGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSGTPFIIP  60

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  524
            TTGTGAWESALTNTLSPGDRI+SFLIGQFSLLWIDQQQRL FNVDVVES+WGQGANLD+L
Sbjct  61   TTGTGAWESALTNTLSPGDRIISFLIGQFSLLWIDQQQRLGFNVDVVESDWGQGANLDIL  120

Query  525  ASKLAEDTAHTIKAICIVHNET  590
            ASKLA DTAH+IKAICIVHNET
Sbjct  121  ASKLASDTAHSIKAICIVHNET  142



>ref|XP_010094254.1| Serine--glyoxylate aminotransferase [Morus notabilis]
 gb|EXB55505.1| Serine--glyoxylate aminotransferase [Morus notabilis]
Length=358

 Score =   281 bits (719),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/148 (89%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYVN PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PA+TK LLEDVK IFKTTSG
Sbjct  1    MDYVNGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPAMTKVLLEDVKMIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESDWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANL+VL +KLAED AH+IKAICIVHNET
Sbjct  121  ANLEVLEAKLAEDRAHSIKAICIVHNET  148



>gb|ABQ81924.1| aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   282 bits (722),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/148 (90%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF  PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDV+ESEWG+G
Sbjct  61   TPFSFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A LDVLA+KLA DT HTIKA+CIVHNET
Sbjct  121  AKLDVLAAKLAADTDHTIKAVCIVHNET  148



>gb|AGT38285.1| serine--glyoxylate aminotransferase [Gossypium hirsutum]
 gb|KJB83532.1| hypothetical protein B456_013G252200 [Gossypium raimondii]
Length=401

 Score =   282 bits (722),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/148 (90%), Positives = 138/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY   PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDYFYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61   TPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANLDVLA KLA D  HTIKAICIVHNET
Sbjct  121  ANLDVLAEKLAADRTHTIKAICIVHNET  148



>ref|XP_007015204.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 ref|XP_007015205.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 ref|XP_007015206.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32823.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32824.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32825.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
Length=401

 Score =   282 bits (722),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/148 (89%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PA+TKTLLEDVK IFKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPAMTKTLLEDVKMIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG
Sbjct  61   TPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANL++LA KLA D  HTIKAICIVHNET
Sbjct  121  ANLEILAEKLASDYTHTIKAICIVHNET  148



>ref|XP_006297832.1| hypothetical protein CARUB_v10013869mg [Capsella rubella]
 gb|EOA30730.1| hypothetical protein CARUB_v10013869mg [Capsella rubella]
Length=401

 Score =   282 bits (721),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 132/148 (89%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVES+WGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANL VLASKL+ED +H+IKAICIVHNET
Sbjct  121  ANLQVLASKLSEDASHSIKAICIVHNET  148



>gb|AAL47679.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   281 bits (720),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/148 (91%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV APG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPALTKTLLEDVKKIFK+T+G
Sbjct  1    MDYVYAPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKSTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T FLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES+WGQG
Sbjct  61   TTFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANLDVL SKLA D  HTIKAICIVHNET
Sbjct  121  ANLDVLESKLATDGGHTIKAICIVHNET  148



>gb|KDP35982.1| hypothetical protein JCGZ_08377 [Jatropha curcas]
Length=401

 Score =   281 bits (720),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 132/148 (89%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYMYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVESDWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANLD+LA KLA DTAHTIKA+CIVHNET
Sbjct  121  ANLDILAEKLAADTAHTIKAVCIVHNET  148



>gb|AAQ56192.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   281 bits (719),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 133/148 (90%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV APG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPALTKTLLEDVKKIFK+T+G
Sbjct  1    MDYVYAPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKSTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T FLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDV+ES+WGQG
Sbjct  61   TTFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVIESDWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANLDVL SKLA D  HTIKAICIVHNET
Sbjct  121  ANLDVLESKLATDGGHTIKAICIVHNET  148



>ref|XP_002885871.1| hypothetical protein ARALYDRAFT_480305 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62130.1| hypothetical protein ARALYDRAFT_480305 [Arabidopsis lyrata subsp. 
lyrata]
Length=401

 Score =   281 bits (719),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 133/148 (90%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANL VLASKL++D  HTIKAICIVHNET
Sbjct  121  ANLQVLASKLSQDENHTIKAICIVHNET  148



>gb|KHG29969.1| Serine--glyoxylate aminotransferase -like protein [Gossypium 
arboreum]
Length=401

 Score =   281 bits (719),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 131/148 (89%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDYVYGPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDR V+FLIGQFSLLWIDQQQRLNFNVDVVESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRTVTFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANLD+LA KLA D +HTIKAICIVHNET
Sbjct  121  ANLDILAEKLAADHSHTIKAICIVHNET  148



>gb|AGL09524.1| alanine-glyoxylate aminotransferase, partial [Calycanthus occidentalis]
Length=289

 Score =   277 bits (709),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 132/142 (93%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTK LLEDVKKIFKTT+ TPF+IP
Sbjct  1    PGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKILLEDVKKIFKTTTATPFVIP  60

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  524
            TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDV+ES+WGQGANLDVL
Sbjct  61   TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVIESDWGQGANLDVL  120

Query  525  ASKLAEDTAHTIKAICIVHNET  590
            ASKLA DTAHTIKAICIVHNET
Sbjct  121  ASKLAADTAHTIKAICIVHNET  142



>ref|XP_009410322.1| PREDICTED: serine--glyoxylate aminotransferase-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410323.1| PREDICTED: serine--glyoxylate aminotransferase-like [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   281 bits (718),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 132/148 (89%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MD+  APGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDFFYAPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGD+IVSFLIGQFSLLWIDQQQRLNFNVDV+ESEWG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDKIVSFLIGQFSLLWIDQQQRLNFNVDVIESEWGRG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A+LD LASKLA D +H+IKA+CIVHNET
Sbjct  121  ADLDALASKLAADWSHSIKAVCIVHNET  148



>ref|XP_002531124.1| serine-pyruvate aminotransferase, putative [Ricinus communis]
 gb|EEF31258.1| serine-pyruvate aminotransferase, putative [Ricinus communis]
Length=401

 Score =   280 bits (717),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/148 (89%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL F+VDVV+S+WGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFDVDVVKSQWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANLD+LASKLA D+AHTIKA+CIVHNET
Sbjct  121  ANLDILASKLAADSAHTIKAVCIVHNET  148



>ref|XP_010488837.1| PREDICTED: serine--glyoxylate aminotransferase-like [Camelina 
sativa]
Length=401

 Score =   280 bits (717),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/148 (89%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANL VLASKL++D  H+IKAICIVHNET
Sbjct  121  ANLQVLASKLSQDENHSIKAICIVHNET  148



>ref|XP_010518509.1| PREDICTED: serine--glyoxylate aminotransferase isoform X1 [Camelina 
sativa]
 ref|XP_010518516.1| PREDICTED: serine--glyoxylate aminotransferase isoform X1 [Camelina 
sativa]
 ref|XP_010518525.1| PREDICTED: serine--glyoxylate aminotransferase isoform X2 [Camelina 
sativa]
Length=401

 Score =   280 bits (717),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/148 (89%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANL VLASKL++D  H+IKAICIVHNET
Sbjct  121  ANLQVLASKLSQDENHSIKAICIVHNET  148



>ref|NP_001284450.1| serine--glyoxylate aminotransferase [Cucumis melo]
 gb|AAQ56194.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   280 bits (717),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/148 (90%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV APG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPAL KTLLEDVKKIFK+T+G
Sbjct  1    MDYVYAPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPALAKTLLEDVKKIFKSTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T FLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES+WGQG
Sbjct  61   TTFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANLDVL SKLA D  HTIKAICIVHNET
Sbjct  121  ANLDVLESKLATDGGHTIKAICIVHNET  148



>gb|AAQ56193.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   280 bits (716),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/148 (89%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T FL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWID+QQRLNF VDV+ESEWG+G
Sbjct  61   TLFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDRQQRLNFKVDVIESEWGEG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A LDVLA+KLA DT HTIKA+CIVHNET
Sbjct  121  AKLDVLAAKLAADTDHTIKAVCIVHNET  148



>gb|AGL09530.1| alanine-glyoxylate aminotransferase, partial [Xymalos monospora]
Length=289

 Score =   276 bits (706),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/142 (93%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTK LLEDVKKIFKT +GTPFLIP
Sbjct  1    PGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKILLEDVKKIFKTATGTPFLIP  60

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  524
            TTGTGAWES LTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL
Sbjct  61   TTGTGAWESTLTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  120

Query  525  ASKLAEDTAHTIKAICIVHNET  590
            ASKLA D AHTIKAICIVHNET
Sbjct  121  ASKLAADRAHTIKAICIVHNET  142



>ref|XP_010909203.1| PREDICTED: serine--glyoxylate aminotransferase [Elaeis guineensis]
 ref|XP_010909204.1| PREDICTED: serine--glyoxylate aminotransferase [Elaeis guineensis]
Length=402

 Score =   280 bits (716),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/149 (90%), Positives = 141/149 (95%), Gaps = 1/149 (1%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES-EWGQ  503
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL F+VDV+ES EWGQ
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFDVDVIESGEWGQ  120

Query  504  GANLDVLASKLAEDTAHTIKAICIVHNET  590
            GANLD+LA+KLA D A+TIKAICIVHNET
Sbjct  121  GANLDILATKLAADRAYTIKAICIVHNET  149



>ref|NP_178969.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 ref|NP_849951.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 sp|Q56YA5.2|SGAT_ARATH RecName: Full=Serine--glyoxylate aminotransferase; AltName: Full=Alanine--glyoxylate 
aminotransferase; Short=AGT; AltName: 
Full=Asparagine aminotransferase; AltName: Full=Serine--pyruvate 
aminotransferase [Arabidopsis thaliana]
 gb|AAC26854.1| alanine:glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAD28669.1| alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 dbj|BAB20811.1| serine glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAM20136.1| putative alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAM45058.1| putative alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AEC06227.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AEC06228.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
Length=401

 Score =   280 bits (715),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/148 (89%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVES+WGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANL VLASKL++D  HTIKAICIVHNET
Sbjct  121  ANLQVLASKLSQDENHTIKAICIVHNET  148



>ref|XP_010557501.1| PREDICTED: serine--glyoxylate aminotransferase [Tarenaya hassleriana]
 ref|XP_010557502.1| PREDICTED: serine--glyoxylate aminotransferase [Tarenaya hassleriana]
Length=401

 Score =   280 bits (715),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/148 (89%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWG+G
Sbjct  61   TPFIIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGRG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A+L VL+SKL++D  HTIKAICIVHNET
Sbjct  121  ADLQVLSSKLSQDPQHTIKAICIVHNET  148



>gb|KJB54389.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54390.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54392.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54394.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=401

 Score =   280 bits (715),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/148 (88%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPA+PA+TK LLEDVKKIFKT++G
Sbjct  1    MDYVYGPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAIPAMTKNLLEDVKKIFKTSTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANLD+LA KLA D +HTIKAICIVHNET
Sbjct  121  ANLDILAEKLAADHSHTIKAICIVHNET  148



>ref|XP_009415566.1| PREDICTED: serine--glyoxylate aminotransferase [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   279 bits (714),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 131/148 (89%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MD+V  PG+NHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDFVYGPGKNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDVVESEWG+G
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFRVDVVESEWGRG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A+LD LASKL  D +HTIKA+CIVHNET
Sbjct  121  ADLDALASKLEADRSHTIKAVCIVHNET  148



>ref|XP_004139054.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 ref|XP_004166102.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 gb|KGN66521.1| Aminotransferase 1 [Cucumis sativus]
Length=401

 Score =   279 bits (714),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/148 (90%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV APG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPALTKTLLEDVKKIFK+T+G
Sbjct  1    MDYVYAPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKSTAG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T FLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES+WGQG
Sbjct  61   TTFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANLDVL SKLA D   TIKAICIVHNET
Sbjct  121  ANLDVLESKLAADGGQTIKAICIVHNET  148



>ref|XP_010467178.1| PREDICTED: serine--glyoxylate aminotransferase-like [Camelina 
sativa]
Length=454

 Score =   280 bits (717),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/148 (89%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1    MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANL VLASKL++D  H+IKAICIVHNET
Sbjct  121  ANLQVLASKLSQDENHSIKAICIVHNET  148



>gb|KHG14448.1| Serine--glyoxylate aminotransferase -like protein [Gossypium 
arboreum]
Length=401

 Score =   279 bits (713),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/148 (89%), Positives = 138/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MD   APG+NHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1    MDNFYAPGKNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61   TPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANLDVLA KLA D  HTIKAICIVHNET
Sbjct  121  ANLDVLAEKLAADRTHTIKAICIVHNET  148



>gb|AAB95218.1| putative serine-glyoxylate aminotransferase [Fritillaria agrestis]
Length=401

 Score =   276 bits (705),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 129/148 (87%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYR+PA+PALTKTLLEDVKK+FKTT+G
Sbjct  1    MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRAPAIPALTKTLLEDVKKLFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+IPTTGTGAWESALTNTLSPGD IVSFLIGQFSLLWIDQQQRL F VDV+ESEWGQG
Sbjct  61   TPFIIPTTGTGAWESALTNTLSPGDTIVSFLIGQFSLLWIDQQQRLKFKVDVIESEWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANLD LASKLA D  HTIKA+CIVHNET
Sbjct  121  ANLDELASKLAADRTHTIKAVCIVHNET  148



>gb|ABR26028.1| serine-glyoxylate aminotransferase [Oryza sativa Indica Group]
Length=198

 Score =   269 bits (687),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = +3

Query  150  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  329
            DYV  PGRNHLFVPGPVNIPDQVIRAM+R NEDYRSPAVPALTKTLLEDVK+IFKTT+GT
Sbjct  3    DYVYGPGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAVPALTKTLLEDVKQIFKTTTGT  62

Query  330  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  509
            PFL PTTGTGAWESALTNTLSPGD+IVSFLIGQFSLLWIDQQQRLNFNVDVVES+WG GA
Sbjct  63   PFLFPTTGTGAWESALTNTLSPGDKIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGYGA  122

Query  510  NLDVLASKLAEDTAHTIKAICIVHNET  590
            +L  L  KL +D +H+IKAICIVHNET
Sbjct  123  DLAALDYKLRQDPSHSIKAICIVHNET  149



>gb|AGL09523.1| alanine-glyoxylate aminotransferase, partial [Asarum caudatum]
Length=289

 Score =   270 bits (691),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSGTPFLIP
Sbjct  1    PGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSGTPFLIP  60

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  524
            TTGTGAWESALTNTLSPGD+ VSFLIGQFSLLWIDQQQRL FNV+V+ESEWGQGANLD+L
Sbjct  61   TTGTGAWESALTNTLSPGDQTVSFLIGQFSLLWIDQQQRLKFNVNVIESEWGQGANLDIL  120

Query  525  ASKLAEDTAHTIKAICIVHNET  590
            ASKLA D+ H IKAICIVHNET
Sbjct  121  ASKLAADSEHKIKAICIVHNET  142



>dbj|BAJ90006.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90413.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95504.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95684.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   274 bits (701),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/148 (86%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+N PGRNHLFVPGPVNIPDQVIRAM+R NEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYMNGPGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSPGDRIVSF +GQFSLLWIDQQQRL F+VDVVES+WG G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLGFSVDVVESDWGYG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A+L VL SKL  D+ HTIKAICIVHNET
Sbjct  121  ADLGVLESKLRSDSQHTIKAICIVHNET  148



>ref|XP_003574732.2| PREDICTED: serine--glyoxylate aminotransferase [Brachypodium 
distachyon]
Length=461

 Score =   275 bits (704),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = +3

Query  135  EGEKMDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFK  314
            E  KMDYV  PGRNHLFVPGPVNIPD VIRAM+R NEDYRSPAVPALTKTLLEDVKKIFK
Sbjct  57   ENSKMDYVYGPGRNHLFVPGPVNIPDPVIRAMSRQNEDYRSPAVPALTKTLLEDVKKIFK  116

Query  315  TTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESE  494
            TT+GTPFL PTTGTGAWESALTNTLSPGDRIVSF +GQFSLLWIDQQQRLNF VDVVES+
Sbjct  117  TTTGTPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLNFQVDVVESD  176

Query  495  WGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            WG GA+L  L +KL++D AHTIKA+CIVHNET
Sbjct  177  WGHGADLGALETKLSQDAAHTIKAVCIVHNET  208



>ref|XP_010673724.1| PREDICTED: serine--glyoxylate aminotransferase [Beta vulgaris 
subsp. vulgaris]
Length=401

 Score =   273 bits (698),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQ+RL FNVDV+ESEWG+G
Sbjct  61   TPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQKRLGFNVDVIESEWGRG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A+L+ ++SK+A DTAHT+KAICIVHNET
Sbjct  121  ADLEAMSSKIAADTAHTVKAICIVHNET  148



>gb|EMS66805.1| Serine--glyoxylate aminotransferase [Triticum urartu]
Length=401

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+N PGRNHLFVPGPVNIPDQVIRAM+R NEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYMNGPGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSPGDRIVSF +GQFSLLWIDQQQRL F+VDVVES+WG G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLGFSVDVVESDWGYG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A+L  L SKL  D+ HTIKAICIVHNET
Sbjct  121  ADLGALESKLRTDSQHTIKAICIVHNET  148



>ref|NP_001062170.1| Os08g0502700 [Oryza sativa Japonica Group]
 dbj|BAD08917.1| putative aminotransferase [Oryza sativa Japonica Group]
 dbj|BAD09269.1| putative aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF24084.1| Os08g0502700 [Oryza sativa Japonica Group]
 gb|EAZ07527.1| hypothetical protein OsI_29783 [Oryza sativa Indica Group]
 gb|EAZ43252.1| hypothetical protein OsJ_27850 [Oryza sativa Japonica Group]
 dbj|BAG89198.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89373.1| unnamed protein product [Oryza sativa Japonica Group]
Length=402

 Score =   270 bits (690),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = +3

Query  150  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  329
            DYV  PGRNHLFVPGPVNIPDQVIRAM+R NEDYRSPAVPALTKTLLEDVK+IFKTT+GT
Sbjct  3    DYVYGPGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAVPALTKTLLEDVKQIFKTTTGT  62

Query  330  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  509
            PFL PTTGTGAWESALTNTLSPGD+IVSFLIGQFSLLWIDQQQRLNFNVDVVES+WG GA
Sbjct  63   PFLFPTTGTGAWESALTNTLSPGDKIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGYGA  122

Query  510  NLDVLASKLAEDTAHTIKAICIVHNET  590
            +L  L  KL +D +H+IKAICIVHNET
Sbjct  123  DLAALDYKLRQDPSHSIKAICIVHNET  149



>ref|XP_006659561.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X1 
[Oryza brachyantha]
 ref|XP_006659562.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X2 
[Oryza brachyantha]
 ref|XP_006659563.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X3 
[Oryza brachyantha]
Length=402

 Score =   269 bits (688),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = +3

Query  150  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  329
            DY   PGRNHLFVPGPVNIPDQVIRAM R NEDYRSPAVPALTKTLLEDVK+IFKTT+GT
Sbjct  3    DYAYGPGRNHLFVPGPVNIPDQVIRAMNRQNEDYRSPAVPALTKTLLEDVKQIFKTTTGT  62

Query  330  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  509
            PFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDVVES+WGQGA
Sbjct  63   PFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVVESDWGQGA  122

Query  510  NLDVLASKLAEDTAHTIKAICIVHNET  590
            +L  L  KL  D +HTIKAICIVHNET
Sbjct  123  DLAALDYKLRGDPSHTIKAICIVHNET  149



>ref|XP_002279236.1| PREDICTED: serine--glyoxylate aminotransferase [Vitis vinifera]
 ref|XP_010651495.1| PREDICTED: serine--glyoxylate aminotransferase [Vitis vinifera]
Length=401

 Score =   269 bits (687),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MD   APG NHLFVPGPVNIPD VIRAM RNNEDYR+P +PALTK LLEDVKKIFKTT+G
Sbjct  1    MDRYFAPGTNHLFVPGPVNIPDHVIRAMNRNNEDYRAPPIPALTKDLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQ+RL FNVDV+ESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLRFNVDVIESEWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANL++LA K+A D AHTIKA+CIVHNET
Sbjct  121  ANLEILAEKIAADRAHTIKAVCIVHNET  148



>ref|XP_004973838.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X2 
[Setaria italica]
 ref|XP_004973839.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X3 
[Setaria italica]
Length=402

 Score =   269 bits (687),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = +3

Query  150  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  329
            DYV  PGR HLFVPGPVNIPD VIRAM R NEDYRSPAVP LTK LLEDVKKIFKTT+GT
Sbjct  3    DYVYGPGRTHLFVPGPVNIPDPVIRAMNRQNEDYRSPAVPVLTKILLEDVKKIFKTTTGT  62

Query  330  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  509
            PF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVES+WG+GA
Sbjct  63   PFIIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLGFNVDVVESDWGRGA  122

Query  510  NLDVLASKLAEDTAHTIKAICIVHNET  590
            +LDVL +KL +DTAHTIKAI IVHNET
Sbjct  123  DLDVLEAKLRQDTAHTIKAIAIVHNET  149



>emb|CAN84001.1| hypothetical protein VITISV_007680 [Vitis vinifera]
Length=401

 Score =   269 bits (687),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MD   APG NHLFVPGPVNIPD VIRAM RNNEDYR+P +PALTK LLEDVKKIFKTT+G
Sbjct  1    MDRYFAPGTNHLFVPGPVNIPDHVIRAMNRNNEDYRAPPIPALTKDLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQ+RL FNVDV+ESEWGQG
Sbjct  61   TPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLRFNVDVIESEWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANL++LA K+A D AHTIKA+CIVHNET
Sbjct  121  ANLEILAEKIAADRAHTIKAVCIVHNET  148



>ref|XP_004973837.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X1 
[Setaria italica]
Length=437

 Score =   269 bits (687),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = +3

Query  150  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  329
            DYV  PGR HLFVPGPVNIPD VIRAM R NEDYRSPAVP LTK LLEDVKKIFKTT+GT
Sbjct  38   DYVYGPGRTHLFVPGPVNIPDPVIRAMNRQNEDYRSPAVPVLTKILLEDVKKIFKTTTGT  97

Query  330  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  509
            PF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVES+WG+GA
Sbjct  98   PFIIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLGFNVDVVESDWGRGA  157

Query  510  NLDVLASKLAEDTAHTIKAICIVHNET  590
            +LDVL +KL +DTAHTIKAI IVHNET
Sbjct  158  DLDVLEAKLRQDTAHTIKAIAIVHNET  184



>ref|XP_002444789.1| hypothetical protein SORBIDRAFT_07g028080 [Sorghum bicolor]
 gb|EES14284.1| hypothetical protein SORBIDRAFT_07g028080 [Sorghum bicolor]
Length=402

 Score =   266 bits (679),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = +3

Query  150  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  329
            DYV  PGRNHLFVPGPVNIPD VIRAM R NEDYRSPA+PALTK LLEDVK+IFKTT+GT
Sbjct  3    DYVYGPGRNHLFVPGPVNIPDPVIRAMNRQNEDYRSPAIPALTKVLLEDVKRIFKTTTGT  62

Query  330  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  509
            PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL F+VDVVES+WG GA
Sbjct  63   PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLGFDVDVVESDWGHGA  122

Query  510  NLDVLASKLAEDTAHTIKAICIVHNET  590
            +LD L  KL +DT HTIKA+ IVHNET
Sbjct  123  DLDALERKLRDDTLHTIKAVAIVHNET  149



>ref|XP_004491262.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cicer arietinum]
Length=401

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYV  PGR+HLFVPGP NIP+QVIRAM RNNE++R+PA+PALTK LL+DVKKIFKTTSG
Sbjct  1    MDYVYGPGRSHLFVPGPSNIPEQVIRAMNRNNENHRTPAIPALTKALLDDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
             PFLIP+TGTGAWESALTNTLSPGD+IVSFL+GQFSLLWI+QQ++LNF VDVVESEWGQ 
Sbjct  61   IPFLIPSTGTGAWESALTNTLSPGDQIVSFLMGQFSLLWIEQQKKLNFKVDVVESEWGQD  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A+LD L SKLA D +HTIKAICIVHNET
Sbjct  121  ADLDALESKLASDKSHTIKAICIVHNET  148



>ref|XP_003617296.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AET00255.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=401

 Score =   261 bits (667),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MD+   PGRNHLFVPGP NIP+ VIRAM RNNE++R+PA+  LTKTLL+DVKKIFKTTSG
Sbjct  1    MDFAYGPGRNHLFVPGPTNIPEHVIRAMNRNNENHRTPAITTLTKTLLDDVKKIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
             PFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWI+QQ+RLNF VDVVESEWGQG
Sbjct  61   IPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIEQQKRLNFKVDVVESEWGQG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A+LD L SKLA D  HTIKAICIVHNET
Sbjct  121  ADLDALESKLASDKTHTIKAICIVHNET  148



>gb|AGL09528.1| alanine-glyoxylate aminotransferase, partial [Saururus cernuus]
Length=279

 Score =   256 bits (654),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +3

Query  198  VNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESAL  377
            VNIP+ VIRAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESAL
Sbjct  1    VNIPEPVIRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSGTPFMIPTTGTGAWESAL  60

Query  378  TNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHT  557
            TNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQGANLD+LASKLA DTAHT
Sbjct  61   TNTLSPGDRIVSFLIGQFSLLWIDQQQRLGFNVDVVESEWGQGANLDILASKLAADTAHT  120

Query  558  IKAICIVHNET  590
            IKAICIVHNET
Sbjct  121  IKAICIVHNET  131



>gb|ABF70331.1| aminotransferase 1 [Cucumis sativus]
Length=386

 Score =   257 bits (657),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            GR +  VPGPVNIP+ V+RAM RNNEDYRSPAVPALTKTLLEDVKKIFK+T+GT FLIPT
Sbjct  1    GRGNSIVPGPVNIPEPVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKSTAGTTFLIPT  60

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  527
            TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES+WGQGANLDVL 
Sbjct  61   TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGQGANLDVLE  120

Query  528  SKLAEDTAHTIKAICIVHNET  590
            SKLA D   TIKAICIVHNET
Sbjct  121  SKLAADGGQTIKAICIVHNET  141



>tpg|DAA47863.1| TPA: hypothetical protein ZEAMMB73_595389 [Zea mays]
Length=368

 Score =   252 bits (644),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 129/148 (87%), Gaps = 1/148 (1%)
 Frame = +3

Query  150  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  329
            DYV  PGR HLFVPGPVNIPD VIRAM R NEDYRSPAVPALTK LLEDVKKIFKTT+GT
Sbjct  3    DYVYGPGRTHLFVPGPVNIPDPVIRAMNRQNEDYRSPAVPALTKVLLEDVKKIFKTTTGT  62

Query  330  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  509
            PF+IPTTGTGAWESALTNTLSPGDR+VSFLIGQFSLLWIDQQ+RL F+VD VESEWGQGA
Sbjct  63   PFMIPTTGTGAWESALTNTLSPGDRVVSFLIGQFSLLWIDQQRRLGFDVDAVESEWGQGA  122

Query  510  NLDVLASKLAEDT-AHTIKAICIVHNET  590
            +L  L  +L ED   H IKA+ IVHNET
Sbjct  123  DLAALERRLREDAPRHAIKAVAIVHNET  150



>ref|NP_001148339.1| LOC100281949 [Zea mays]
 ref|XP_008675752.1| PREDICTED: LOC100281949 isoform X1 [Zea mays]
 ref|XP_008675758.1| PREDICTED: LOC100281949 isoform X1 [Zea mays]
 gb|ACG30854.1| serine--glyoxylate aminotransferase [Zea mays]
 gb|ACN28633.1| unknown [Zea mays]
 tpg|DAA47859.1| TPA: Serine--glyoxylate aminotransferase isoform 1 [Zea mays]
 tpg|DAA47860.1| TPA: Serine--glyoxylate aminotransferase isoform 2 [Zea mays]
 tpg|DAA47861.1| TPA: Serine--glyoxylate aminotransferase isoform 3 [Zea mays]
 tpg|DAA47862.1| TPA: Serine--glyoxylate aminotransferase isoform 4 [Zea mays]
Length=403

 Score =   253 bits (646),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 129/148 (87%), Gaps = 1/148 (1%)
 Frame = +3

Query  150  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  329
            DYV  PGR HLFVPGPVNIPD VIRAM R NEDYRSPAVPALTK LLEDVKKIFKTT+GT
Sbjct  3    DYVYGPGRTHLFVPGPVNIPDPVIRAMNRQNEDYRSPAVPALTKVLLEDVKKIFKTTTGT  62

Query  330  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  509
            PF+IPTTGTGAWESALTNTLSPGDR+VSFLIGQFSLLWIDQQ+RL F+VD VESEWGQGA
Sbjct  63   PFMIPTTGTGAWESALTNTLSPGDRVVSFLIGQFSLLWIDQQRRLGFDVDAVESEWGQGA  122

Query  510  NLDVLASKLAEDT-AHTIKAICIVHNET  590
            +L  L  +L ED   H IKA+ IVHNET
Sbjct  123  DLAALERRLREDAPRHAIKAVAIVHNET  150



>gb|AGL09525.1| alanine-glyoxylate aminotransferase, partial [Manekia incurva]
Length=267

 Score =   234 bits (597),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/119 (95%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = +3

Query  234  RNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVS  413
            RNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSP DRIVS
Sbjct  2    RNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPCDRIVS  61

Query  414  FLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            FLIGQFSLLWIDQQQRL FNVDVVES+WGQGANLD+LASKLA DT HTIKAICIVHNET
Sbjct  62   FLIGQFSLLWIDQQQRLGFNVDVVESDWGQGANLDILASKLASDTTHTIKAICIVHNET  120



>gb|AGL09529.1| alanine-glyoxylate aminotransferase, partial [Thottea sp. JN-2013]
Length=252

 Score =   231 bits (589),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/119 (92%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +3

Query  234  RNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVS  413
            RNNEDYRSPAVP LTKTLLEDVKKIFKTT+GTPFLIPTTGTGAWESALTNTLSPGDRIVS
Sbjct  1    RNNEDYRSPAVPLLTKTLLEDVKKIFKTTAGTPFLIPTTGTGAWESALTNTLSPGDRIVS  60

Query  414  FLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            FLIGQFSLLWIDQQQRLNFNVDVVES+WG+GA+L+VLASKLA DT+HTIKAIC+VHNET
Sbjct  61   FLIGQFSLLWIDQQQRLNFNVDVVESDWGRGADLEVLASKLAADTSHTIKAICLVHNET  119



>gb|AGL09531.1| alanine-glyoxylate aminotransferase, partial [Zippelia begoniifolia]
Length=259

 Score =   230 bits (587),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 110/116 (95%), Positives = 114/116 (98%), Gaps = 0/116 (0%)
 Frame = +3

Query  243  EDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLI  422
            EDYRSPAVPALTKTLL+DVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLI
Sbjct  1    EDYRSPAVPALTKTLLQDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLI  60

Query  423  GQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            GQFSLLWIDQQQRL FNVDVVES+WGQGANLD+LASKLA DT+HTIKAICIVHNET
Sbjct  61   GQFSLLWIDQQQRLGFNVDVVESDWGQGANLDILASKLASDTSHTIKAICIVHNET  116



>ref|XP_008666464.1| PREDICTED: serine--glyoxylate aminotransferase-like [Zea mays]
Length=229

 Score =   227 bits (578),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 119/138 (86%), Gaps = 1/138 (1%)
 Frame = +3

Query  180  LFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTG  359
            +FVPGPVNIP  V RAM R NEDYRSPAVPALTK LLEDVKKIFKTT+GTPF+IPTTGTG
Sbjct  1    MFVPGPVNIPGPVNRAMNRQNEDYRSPAVPALTKVLLEDVKKIFKTTTGTPFMIPTTGTG  60

Query  360  AWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLA  539
             WESALTNTLSPGDR+VSFLIGQFSLLWIDQQ+RL F+VD VESEWGQGA+L  L  +L 
Sbjct  61   VWESALTNTLSPGDRVVSFLIGQFSLLWIDQQRRLGFDVDAVESEWGQGADLAALERRLR  120

Query  540  EDT-AHTIKAICIVHNET  590
            +D   H IKA+ IVHNET
Sbjct  121  DDAPRHAIKAVAIVHNET  138



>gb|ABR16109.1| unknown [Picea sitchensis]
Length=359

 Score =   230 bits (587),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MD    PGRN LFVPGPVNIP+ V++AM RNNEDYR+P VPALTK LL DV KIFK+T+G
Sbjct  1    MDPFYGPGRNQLFVPGPVNIPEPVLQAMNRNNEDYRAPPVPALTKKLLADVPKIFKSTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSP DRI+SF +GQFSLLWIDQ +RLNF+VDVV  EWG G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPRDRIISFEMGQFSLLWIDQMKRLNFDVDVVHCEWGTG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
             +L++L +KL  D  H +KAIC VHNET
Sbjct  121  VDLEILRTKLEADKEHKVKAICCVHNET  148



>gb|ACN39798.1| unknown [Picea sitchensis]
Length=401

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MD    PGRN LFVPGPVNIP+ V++AM RNNEDYR+P VPALTK LL DV KIFK+T+G
Sbjct  1    MDPFYGPGRNQLFVPGPVNIPEPVLQAMNRNNEDYRAPPVPALTKKLLADVPKIFKSTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSP DRI+SF +GQFSLLWIDQ +RLNF+VDVV  EWG G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPRDRIISFEMGQFSLLWIDQMKRLNFDVDVVHCEWGTG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
             +L++L +KL  D  H +KAIC VHNET
Sbjct  121  VDLEILRTKLEADKEHKVKAICCVHNET  148



>gb|ABK24112.1| unknown [Picea sitchensis]
Length=401

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MD    PGRN LFVPGPVNIP+ V+ AM RNNEDYR+P VPALTK LL DV KIFK+T+G
Sbjct  1    MDPFYGPGRNQLFVPGPVNIPEPVLHAMNRNNEDYRAPPVPALTKKLLADVPKIFKSTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPFL PTTGTGAWESALTNTLSP DRI+SF +GQFSLLWIDQ +RLNF+VDVV  EWG G
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPRDRIISFEMGQFSLLWIDQMKRLNFDVDVVHCEWGTG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
             +L++L +KL  D  H +KAIC VHNET
Sbjct  121  VDLEILRTKLEADKEHKVKAICCVHNET  148



>ref|XP_001783551.1| predicted protein [Physcomitrella patens]
 gb|EDQ51640.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   230 bits (587),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            M+Y  APGRNHLFVPGP N+P+ ++RAM R+NED+RSPA P L+K++++DVK+IF+T + 
Sbjct  1    MEYYPAPGRNHLFVPGPTNVPEPILRAMNRSNEDHRSPAFPKLSKSVIDDVKEIFRTKTA  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T F+ PTTGTGAWESALTNTLSPGD+I+SF +GQFSLLWIDQ QR NF+VDVV+ EWG G
Sbjct  61   TSFIFPTTGTGAWESALTNTLSPGDKIISFRLGQFSLLWIDQMQRYNFDVDVVDCEWGAG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
             +LDVL  KL  D +H++KA+C+VHNET
Sbjct  121  IDLDVLKQKLVSDRSHSVKAVCVVHNET  148



>tpg|DAA47874.1| TPA: hypothetical protein ZEAMMB73_131074 [Zea mays]
Length=290

 Score =   226 bits (577),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 119/138 (86%), Gaps = 1/138 (1%)
 Frame = +3

Query  180  LFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTG  359
            +FVPGPVNIP  V RAM R NEDYRSPAVPALTK LLEDVKKIFKTT+GTPF+IPTTGTG
Sbjct  1    MFVPGPVNIPGPVNRAMNRQNEDYRSPAVPALTKVLLEDVKKIFKTTTGTPFMIPTTGTG  60

Query  360  AWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLA  539
             WESALTNTLSPGDR+VSFLIGQFSLLWIDQQ+RL F+VD VESEWGQGA+L  L  +L 
Sbjct  61   VWESALTNTLSPGDRVVSFLIGQFSLLWIDQQRRLGFDVDAVESEWGQGADLAALERRLR  120

Query  540  EDTA-HTIKAICIVHNET  590
            +D   H IKA+ IVHNET
Sbjct  121  DDAPRHAIKAVAIVHNET  138



>ref|XP_001755667.1| predicted protein [Physcomitrella patens]
 gb|EDQ79340.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   229 bits (584),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            M+Y  APGRNHLFVPGP N+P+ ++RAM R+NED+RSPA P L+K++++DVK+IF+TT+ 
Sbjct  1    MEYYPAPGRNHLFVPGPTNVPEPILRAMNRSNEDHRSPAFPKLSKSVIDDVKQIFRTTTA  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T F+ PTTGTGAWESALTNTLSPGD+I+SF +GQFSLLWIDQ QR NF+VDVV+ EWG G
Sbjct  61   TSFIFPTTGTGAWESALTNTLSPGDKIISFRLGQFSLLWIDQMQRYNFDVDVVDCEWGTG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
             +LD L  KL  D +H++KA+C+VHNET
Sbjct  121  VDLDNLKQKLQSDWSHSVKAVCVVHNET  148



>ref|XP_002983655.1| hypothetical protein SELMODRAFT_228964 [Selaginella moellendorffii]
 gb|EFJ15151.1| hypothetical protein SELMODRAFT_228964 [Selaginella moellendorffii]
Length=401

 Score =   227 bits (578),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            M+Y  APGRNHLFVPGP N+P++VI+A +R NED+RSPA   L+K++L+ VK +FKT + 
Sbjct  1    MEYFPAPGRNHLFVPGPTNVPEKVIQAFSRGNEDHRSPAFATLSKSVLDGVKDLFKTKTA  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T F+ PTTGTGAWESALTNTLSPGD+IVSF +GQFSLLWIDQ QRL FNVDVV+ EWG G
Sbjct  61   TSFIFPTTGTGAWESALTNTLSPGDKIVSFRLGQFSLLWIDQMQRLKFNVDVVDCEWGAG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A+L++L +KLA D  H IKAICIVHNET
Sbjct  121  ADLNILNAKLAMDYNHEIKAICIVHNET  148



>ref|XP_002990557.1| hypothetical protein SELMODRAFT_448066 [Selaginella moellendorffii]
 gb|EFJ08434.1| hypothetical protein SELMODRAFT_448066 [Selaginella moellendorffii]
Length=401

 Score =   227 bits (578),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            M+Y  APGRNHLFVPGP N+P++VI+A +R NED+RSPA   L+K++L+ VK +FKT + 
Sbjct  1    MEYFPAPGRNHLFVPGPTNVPEKVIQAFSRGNEDHRSPAFATLSKSVLDGVKDLFKTKTA  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T F+ PTTGTGAWESALTNTLSPGD+IVSF +GQFSLLWIDQ QRL FNVDVV+ EWG G
Sbjct  61   TSFIFPTTGTGAWESALTNTLSPGDKIVSFRLGQFSLLWIDQMQRLKFNVDVVDCEWGAG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A+L++L +KLA D  H IKAICIVHNET
Sbjct  121  ADLNILNAKLAMDYNHEIKAICIVHNET  148



>emb|CBI24214.3| unnamed protein product [Vitis vinifera]
Length=374

 Score =   223 bits (569),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +3

Query  228  MTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRI  407
            M RNNEDYR+P +PALTK LLEDVKKIFKTT+GTPFLIPTTGTGAWESALTNTLSPGDR 
Sbjct  1    MNRNNEDYRAPPIPALTKDLLEDVKKIFKTTTGTPFLIPTTGTGAWESALTNTLSPGDRT  60

Query  408  VSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNE  587
            VSFLIGQFSLLWIDQQ+RL FNVDV+ESEWGQGANL++LA K+A D AHTIKA+CIVHNE
Sbjct  61   VSFLIGQFSLLWIDQQKRLRFNVDVIESEWGQGANLEILAEKIAADRAHTIKAVCIVHNE  120

Query  588  T  590
            T
Sbjct  121  T  121



>gb|ADO24297.1| aminotransferase [Valeriana jatamansi]
Length=116

 Score =   214 bits (546),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/116 (88%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MD   A GRNHLFVPGPVNIP+ V+RAM RNNEDYRSPA+PA+TKTLLEDVK+IFKTTSG
Sbjct  1    MDNFYAAGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAIPAMTKTLLEDVKQIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESE  494
            TPFL PTTGTGAWESALTNTLSPGDR+VSFLIGQFSLLWIDQQQRL FNVDVVESE
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRVVSFLIGQFSLLWIDQQQRLGFNVDVVESE  116



>gb|AEX09293.1| alanine glyoxylate aminotransferase [Peperomia rupiseda]
Length=358

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDRI+SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRIISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WGQGANL++LASKLA D AH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILASKLASDAAHSIKAICIVHNET  113



>gb|AEX09255.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   219 bits (557),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/113 (92%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPAVPALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAVPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WGQGANL++LASKLA D AHTIKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILASKLASDAAHTIKAICIVHNET  113



>gb|AEX09262.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=342

 Score =   218 bits (555),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WGQGANL++LASKLA D AHTIKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILASKLASDAAHTIKAICIVHNET  113



>gb|AEX09248.1| alanine glyoxylate aminotransferase [Peperomia questionis]
Length=360

 Score =   218 bits (556),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WGQGANL++LASKLA D AHTIKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILASKLASDAAHTIKAICIVHNET  113



>gb|AEX09252.1| alanine glyoxylate aminotransferase [Peperomia exclamationis]
Length=342

 Score =   217 bits (553),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPAVPALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAVPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WGQGANL++LASKLA D AH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILASKLASDAAHSIKAICIVHNET  113



>gb|AEX09288.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=335

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA DTAH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDTAHSIKAICIVHNET  113



>gb|AEX09287.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=331

 Score =   216 bits (551),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA DTAH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDTAHSIKAICIVHNET  113



>gb|AEX09282.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=332

 Score =   216 bits (551),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA DTAH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDTAHSIKAICIVHNET  113



>gb|AEX09251.1| alanine glyoxylate aminotransferase [Peperomia schizandra]
Length=331

 Score =   216 bits (551),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WGQGANL++LASKLA D AH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILASKLASDAAHSIKAICIVHNET  113



>gb|AEX09308.1| alanine glyoxylate aminotransferase [Peperomia polycephala]
Length=356

 Score =   217 bits (553),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WGQGANLD+L+SKLA D AH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLDILSSKLASDAAHSIKAICIVHNET  113



>gb|AEX09305.1| alanine glyoxylate aminotransferase [Peperomia pseudoverruculosa]
Length=362

 Score =   217 bits (553),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WGQGANL++LASKLA D AH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILASKLASDAAHSIKAICIVHNET  113



>gb|AEX09246.1| alanine glyoxylate aminotransferase [Peperomia elatior]
Length=335

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AHTIKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHTIKAICIVHNET  113



>gb|AEX09250.1| alanine glyoxylate aminotransferase [Peperomia schizandra]
Length=362

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WGQGANL++LASKLA D AH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILASKLASDAAHSIKAICIVHNET  113



>gb|ADG26437.1| putative aminotransferase [Valeriana jatamansi]
Length=116

 Score =   209 bits (531),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MD   A GRNH+FVPG VNIP+ V+RAM RNNEDYRSPA+PA+TKTLLEDVK+IFKTTSG
Sbjct  1    MDNFYAAGRNHMFVPGLVNIPEPVLRAMNRNNEDYRSPAIPAMTKTLLEDVKQIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESE  494
            TPFL PTTGTGAWESALTNTLSPGDR+VSFLIGQFSLLWIDQQQRL FNVDVVES+
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRVVSFLIGQFSLLWIDQQQRLGFNVDVVESK  116



>ref|XP_001763095.1| predicted protein [Physcomitrella patens]
 gb|EDQ71972.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            M+   APGRNHLFVPGP NIPD+V++AM RNNED+RSP  PAL K++LEDVK +F+T +G
Sbjct  1    MELFPAPGRNHLFVPGPTNIPDRVLQAMNRNNEDHRSPTFPALAKSVLEDVKLLFRTQTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+ P++GTGAWESALTNT+SPGDRI+   +GQF +LWI+   RL+FNVDV+E EWG+G
Sbjct  61   TPFIFPSSGTGAWESALTNTMSPGDRIIVPRMGQFCVLWINLMTRLHFNVDVIECEWGEG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
             +L++L  KL  D  H +KA+C+VHNET
Sbjct  121  IDLEILKQKLQSDHTHAVKAVCVVHNET  148



>gb|AEX09273.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA DTAH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDTAHSIKAICIVHNET  113



>gb|AEX09249.1| alanine glyoxylate aminotransferase [Peperomia aff. gracillima 
JN-2011]
Length=358

 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AHTIKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHTIKAICIVHNET  113



>gb|AEX09245.1| alanine glyoxylate aminotransferase [Peperomia putlaensis]
Length=349

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AHTIKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHTIKAICIVHNET  113



>gb|AEX09263.1| alanine glyoxylate aminotransferase [Peperomia putlaensis]
Length=358

 Score =   216 bits (549),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPAVPALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAVPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNET  113



>gb|AEX09266.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=350

 Score =   215 bits (548),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WGQGANL++L+SKLA D AH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILSSKLASDAAHSIKAICIVHNET  113



>gb|AEX09244.1| alanine glyoxylate aminotransferase [Peperomia basiradicans]
Length=332

 Score =   215 bits (547),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNET  113



>gb|AEX09268.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=359

 Score =   216 bits (549),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WGQGANL++L+SKLA D AH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILSSKLASDAAHSIKAICIVHNET  113



>gb|AEX09283.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=349

 Score =   215 bits (548),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WGQGANL++L+SKLA D AH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILSSKLASDAAHSIKAICIVHNET  113



>gb|AEX09300.1| alanine glyoxylate aminotransferase [Peperomia parvifolia]
Length=362

 Score =   216 bits (549),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPAVPALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAVPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNET  113



>gb|AEX09310.1| alanine glyoxylate aminotransferase [Peperomia wernerrauhii]
Length=331

 Score =   214 bits (546),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNET  113



>gb|AEX09274.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=358

 Score =   216 bits (549),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WGQGANL++L+SKLA D AH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILSSKLASDAAHSIKAICIVHNET  113



>gb|AEX09302.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=343

 Score =   215 bits (547),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WGQGANL++L+SKLA D AH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILSSKLASDAAHSIKAICIVHNET  113



>gb|AEX09306.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=362

 Score =   216 bits (549),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WGQGANL++L+SKLA D AH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILSSKLASDAAHSIKAICIVHNET  113



>gb|AEX09301.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=358

 Score =   215 bits (548),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WGQGANL++L+SKLA D AH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILSSKLASDAAHSIKAICIVHNET  113



>gb|AEX09286.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=358

 Score =   215 bits (548),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNET  113



>gb|AEX09277.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=351

 Score =   215 bits (547),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNET  113



>gb|AEX09295.1| alanine glyoxylate aminotransferase [Peperomia pugnicaudex]
Length=356

 Score =   215 bits (548),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNET  113



>gb|AEX09275.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=362

 Score =   215 bits (548),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNET  113



>gb|AEX09257.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
 gb|AEX09278.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
 gb|AEX09279.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=362

 Score =   215 bits (548),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNET  113



>gb|AEX09311.1| alanine glyoxylate aminotransferase [Peperomia andina]
Length=362

 Score =   215 bits (548),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNET  113



>gb|AEX09270.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
 gb|AEX09296.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
 gb|AEX09297.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
Length=362

 Score =   215 bits (548),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNET  113



>gb|AEX09253.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   215 bits (548),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNET  113



>gb|AEX09298.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   215 bits (547),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNET  113



>gb|AEX09260.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=326

 Score =   214 bits (544),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDXAHXIKAICIVHNET  113



>gb|EMT09291.1| Serine--glyoxylate aminotransferase [Aegilops tauschii]
Length=290

 Score =   213 bits (541),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY+N PGRNHLFVPGPVNIPDQVIRAM+R NEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYMNGPGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFN  473
            TPFL PTTGTGAWESALTNTLSPGDRIVSF +GQFSLLWIDQQQRL F+
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLGFS  109



>gb|AEX09309.1| alanine glyoxylate aminotransferase [Peperomia wernerrauhii]
Length=335

 Score =   214 bits (544),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WG GANL++L+SKLA D AH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILSSKLASDAAHSIKAICIVHNET  113



>gb|AEX09256.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPAVPALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAVPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AHTIKAICIVH ET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDVAHTIKAICIVHXET  113



>gb|AEX09258.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPAVPAL KTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAVPALAKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNET  113



>gb|AEX09304.1| alanine glyoxylate aminotransferase [Peperomia chutanka]
Length=358

 Score =   214 bits (544),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQ+RL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNET
Sbjct  61   SLLWIDQQERLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNET  113



>gb|AEX09292.1| alanine glyoxylate aminotransferase [Peperomia klopfensteinii]
Length=330

 Score =   213 bits (541),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTT GTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTXGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNET  113



>gb|AEX09299.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   213 bits (543),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSG PF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGAPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNET  113



>gb|AEX09254.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   213 bits (542),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPAVPALTKTLLEDVKKIFKTTSGT F+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAVPALTKTLLEDVKKIFKTTSGTSFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WGQGANL++LASKLA + AH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGQGANLEILASKLASNAAHSIKAICIVHNET  113



>gb|AEX09242.1| alanine glyoxylate aminotransferase [Peperomia aff. pinoi JN-2011]
Length=335

 Score =   212 bits (540),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQ RL FNVDVVES+WG GANL+++ASKLA D AH+IKAICIVHNET
Sbjct  61   SLLWIDQQTRLGFNVDVVESDWGLGANLEIMASKLASDAAHSIKAICIVHNET  113



>gb|AEX09294.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=345

 Score =   211 bits (536),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D A +IKA+CIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAXSIKAVCIVHNET  113



>gb|AEX09276.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=362

 Score =   211 bits (536),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTT G PF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTPGIPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNET  113



>gb|AEX09267.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=362

 Score =   210 bits (534),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +3

Query  252  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  431
            RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1    RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  432  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            SLLWIDQQQRL  +VDVVES+WG GANL++L+SKLA D AH+IKAICIVHNET
Sbjct  61   SLLWIDQQQRLGLDVDVVESDWGHGANLEILSSKLASDAAHSIKAICIVHNET  113



>ref|XP_002969615.1| hypothetical protein SELMODRAFT_267279 [Selaginella moellendorffii]
 gb|EFJ29703.1| hypothetical protein SELMODRAFT_267279 [Selaginella moellendorffii]
Length=401

 Score =   207 bits (528),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 113/148 (76%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY  APGRNHLFVPGP NIP +V++A+ R NED+RSPA P  ++ LL DV +IF T SG
Sbjct  1    MDYFMAPGRNHLFVPGPSNIPQKVMQALNRGNEDHRSPAFPVFSRQLLADVTRIFSTQSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+IPTTGTG WE A  NTLS GDR+++F+ GQFS LW  Q Q+L+F+VD V+ +WG G
Sbjct  61   TPFIIPTTGTGGWECAAVNTLSTGDRVLTFVFGQFSHLWSQQLQKLHFDVDAVQCQWGGG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
             +L VL SKL  D  H IKA+C+VHNET
Sbjct  121  VDLGVLDSKLRADEEHRIKAVCVVHNET  148



>ref|XP_002970880.1| hypothetical protein SELMODRAFT_147375 [Selaginella moellendorffii]
 gb|EFJ28206.1| hypothetical protein SELMODRAFT_147375 [Selaginella moellendorffii]
Length=401

 Score =   207 bits (527),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 113/148 (76%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDY  APGRNHLFVPGP NIP +V++A+ R NED+RSPA P  ++ LL DV +IF T SG
Sbjct  1    MDYFMAPGRNHLFVPGPSNIPQKVMQALNRGNEDHRSPAFPVFSRQLLADVTRIFSTQSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            TPF+IPTTGTG WE A  NTLS GDR+++F+ GQFS LW  Q Q+L+F+VD V+ +WG G
Sbjct  61   TPFIIPTTGTGGWECAAVNTLSTGDRVLTFVFGQFSHLWSQQLQKLHFDVDAVQCQWGGG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
             +L VL SKL  D  H IKA+C+VHNET
Sbjct  121  VDLGVLDSKLRADEEHRIKAVCVVHNET  148



>gb|EYU35937.1| hypothetical protein MIMGU_mgv1a026291mg, partial [Erythranthe 
guttata]
Length=359

 Score =   202 bits (514),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 97/106 (92%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = +3

Query  273  LTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQ  452
            LTK LLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQ
Sbjct  1    LTKNLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQ  60

Query  453  QQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            QQRL FNVDVVES+WG GA+LD LASK+AEDTAHTIKA+CIVHNET
Sbjct  61   QQRLKFNVDVVESDWGAGADLDALASKIAEDTAHTIKAVCIVHNET  106



>gb|AEX09303.1| alanine glyoxylate aminotransferase [Peperomia ayacuchoana]
Length=351

 Score =   196 bits (499),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = +3

Query  285  LLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL  464
            LLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL
Sbjct  1    LLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRL  60

Query  465  NFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
             FNVDVVES+WGQGANL++LASKLA D AH+IKAICIVHNET
Sbjct  61   GFNVDVVESDWGQGANLEILASKLASDAAHSIKAICIVHNET  102



>gb|AEX09259.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=351

 Score =   196 bits (498),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = +3

Query  285  LLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL  464
            LLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL
Sbjct  1    LLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRL  60

Query  465  NFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
             FNVDVVES+WG GANL++LASKLA D AHTIKAICIVHNET
Sbjct  61   GFNVDVVESDWGHGANLEILASKLASDVAHTIKAICIVHNET  102



>gb|AEX09307.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
Length=351

 Score =   194 bits (494),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = +3

Query  285  LLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL  464
            LLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL
Sbjct  1    LLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRL  60

Query  465  NFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
             FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNET
Sbjct  61   GFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNET  102



>gb|AEX09291.1| alanine glyoxylate aminotransferase [Peperomia jalcaensis]
Length=323

 Score =   193 bits (490),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +3

Query  288  LEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLN  467
            LEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL 
Sbjct  1    LEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLG  60

Query  468  FNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNET
Sbjct  61   FNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNET  101



>gb|AEX09284.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=338

 Score =   193 bits (491),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +3

Query  288  LEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLN  467
            LEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL 
Sbjct  1    LEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLG  60

Query  468  FNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            FNVDVVES+WGQGANL++L+SKLA D AH+IKAICIVHNET
Sbjct  61   FNVDVVESDWGQGANLEILSSKLASDAAHSIKAICIVHNET  101



>gb|AEX09272.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=338

 Score =   192 bits (489),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +3

Query  288  LEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLN  467
            LEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL 
Sbjct  1    LEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLG  60

Query  468  FNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNET
Sbjct  61   FNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNET  101



>gb|AEX09265.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=353

 Score =   193 bits (490),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +3

Query  279  KTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQ  458
            KTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGD  +SFLIGQFSLLWIDQQQ
Sbjct  1    KTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDXTISFLIGQFSLLWIDQQQ  60

Query  459  RLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            RL F VDVVES+WG GANL++LASKLA D AH+IKAICIVHNET
Sbjct  61   RLGFXVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNET  104



>gb|AEX09264.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=334

 Score =   191 bits (484),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/102 (87%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +3

Query  285  LLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL  464
            LLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL
Sbjct  1    LLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRL  60

Query  465  NFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
             FNVDVVES+WG GANL++LAS LA D  H+IKAICIVHNET
Sbjct  61   GFNVDVVESDWGHGANLEILASXLASDAGHSIKAICIVHNET  102



>gb|ACN36238.1| unknown [Zea mays]
Length=328

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 100/120 (83%), Gaps = 7/120 (6%)
 Frame = +3

Query  150  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  329
            DYV  PGR HLFVPGPVNIPD VIRAM R NEDYRSPAVPALTK LLEDVKKIFKTT+GT
Sbjct  3    DYVYGPGRTHLFVPGPVNIPDPVIRAMNRQNEDYRSPAVPALTKVLLEDVKKIFKTTTGT  62

Query  330  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQR---LNFNVDVVESEWG  500
            PF+IPTTGTGAWESALTNTLSPGDR+VSFLIGQFSLL +D       L+F +D    EWG
Sbjct  63   PFMIPTTGTGAWESALTNTLSPGDRVVSFLIGQFSLLLVDGVSSICALDFRMD----EWG  118



>gb|AEX09285.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=350

 Score =   188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +3

Query  288  LEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLN  467
            LEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL 
Sbjct  1    LEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLG  60

Query  468  FNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            F VDVVES+WG GANL++LASKLA D  H+IKAICIVHNET
Sbjct  61   FIVDVVESDWGHGANLEILASKLASDAGHSIKAICIVHNET  101



>ref|XP_005709273.1| serine--glyoxylate transaminase [Galdieria sulphuraria]
 gb|EME32753.1| serine--glyoxylate transaminase [Galdieria sulphuraria]
Length=400

 Score =   186 bits (471),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 109/141 (77%), Gaps = 0/141 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            G+N L VPGP N+PD+V+RAM RN+ED+RSP  PAL KT+LE++K +F TT G  F+ P 
Sbjct  5    GKNFLMVPGPTNVPDRVLRAMHRNSEDHRSPDFPALAKTVLENIKWVFGTTKGRSFIFPA  64

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  527
            +GTGAWE+ALTNTL+ GD+++S   GQFS LWID  QRL   V +++ +WG+G  +D+L+
Sbjct  65   SGTGAWEAALTNTLNKGDKVISVRFGQFSHLWIDMMQRLGLEVTILDVDWGEGIPIDILS  124

Query  528  SKLAEDTAHTIKAICIVHNET  590
            S +A+DT H  +A+C+VHNET
Sbjct  125  SYIAQDTRHEYQAVCVVHNET  145



>gb|AEX09271.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=332

 Score =   184 bits (466),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +3

Query  303  KIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDV  482
            KIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDV
Sbjct  1    KIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDV  60

Query  483  VESEWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            VES+WGQGANL++L+SKLA D AH+IKAICIVHNET
Sbjct  61   VESDWGQGANLEILSSKLASDAAHSIKAICIVHNET  96



>gb|AEX09261.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=327

 Score =   180 bits (456),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +3

Query  312  KTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES  491
            KTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES
Sbjct  1    KTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVES  60

Query  492  EWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            +WGQGANL++LASKLA D AHTIKAICIVHNET
Sbjct  61   DWGQGANLEILASKLASDAAHTIKAICIVHNET  93



>gb|AEX09247.1| alanine glyoxylate aminotransferase [Peperomia cavispicata]
Length=342

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +3

Query  312  KTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES  491
            KTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES
Sbjct  1    KTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVES  60

Query  492  EWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            +WGQGANL++LASKLA D AHTIKAICIVHNET
Sbjct  61   DWGQGANLEILASKLASDAAHTIKAICIVHNET  93



>ref|XP_005648727.1| serine glyoxylate aminotransferase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24183.1| serine glyoxylate aminotransferase [Coccomyxa subellipsoidea 
C-169]
Length=434

 Score =   181 bits (459),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 102/142 (72%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGRNHL VPGPVNI +QV+RAM R ++++R P  P   + +LED K IFKTT GTPF+ P
Sbjct  41   PGRNHLAVPGPVNIHEQVMRAMDRPSQNHRDPWFPPFFQQILEDTKYIFKTTEGTPFIFP  100

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  524
             TGTG WE ALTNTLSPGD++V+F  GQFS LWID  QRL  +V VVE EWG GA+   L
Sbjct  101  GTGTGGWEVALTNTLSPGDKVVTFRYGQFSHLWIDMMQRLGLDVQVVEVEWGGGADEAKL  160

Query  525  ASKLAEDTAHTIKAICIVHNET  590
               L  DT   IKA+ +VHNET
Sbjct  161  EQILKADTDKKIKAVAVVHNET  182



>ref|WP_017485211.1| serine--glyoxylate aminotransferase [Methylobacterium sp. MB200]
Length=402

 Score =   180 bits (456),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 102/148 (69%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            M     PGRNHLFVPGP NIPD+V+RAM   +ED+RS   P+LTK L ED KK+F +T G
Sbjct  1    MAATRRPGRNHLFVPGPTNIPDRVMRAMMVQSEDHRSVDFPSLTKPLFEDTKKVFGSTEG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T FL P +GTG WESALTNTL+ GD++++   GQFS LWID  QRL  +V V E EWG G
Sbjct  61   TIFLFPASGTGIWESALTNTLARGDKVLTARYGQFSHLWIDMAQRLGLDVIVQEEEWGTG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A  D +   L  D  H IKA+ +VHNET
Sbjct  121  AKADKIEEALRADKDHQIKAVMVVHNET  148



>gb|AEX09281.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=330

 Score =   177 bits (448),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +3

Query  312  KTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES  491
            KTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES
Sbjct  1    KTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVES  60

Query  492  EWGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            +WG GANL++LASKLA D AH+IKAICIVHNET
Sbjct  61   DWGHGANLEILASKLASDAAHSIKAICIVHNET  93



>ref|WP_015950680.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 gb|ACK82978.1| aminotransferase class V [Methylobacterium extorquens CM4]
Length=402

 Score =   177 bits (450),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 102/148 (69%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            M     PGRNHLFVPGP NIPD+V+RAM   +ED+RS   P+LTK L ED KK+F +T G
Sbjct  1    MAATRRPGRNHLFVPGPTNIPDRVMRAMMVQSEDHRSVDFPSLTKPLFEDTKKVFGSTEG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T FL P +GTG WESAL+NTL+ GD++V+   GQFS LWID  QRL  +V V E EWG G
Sbjct  61   TIFLFPASGTGIWESALSNTLARGDKVVAARFGQFSHLWIDMAQRLGLDVVVQEEEWGTG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A  + +   L  D  H IKA+ +VHNET
Sbjct  121  AKPEKIEEALRADKNHEIKAVMVVHNET  148



>dbj|BAQ46928.1| serine--glyoxylate aminotransferase [Methylobacterium aquaticum]
Length=396

 Score =   177 bits (449),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 102/142 (72%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGRN LFVPGP NIPD+V RAM   +ED+RS A P LT  L E+ KKIFK+  G  FL P
Sbjct  7    PGRNFLFVPGPTNIPDRVQRAMIVPSEDHRSSAFPELTLPLFEETKKIFKSREGQIFLFP  66

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  524
             TGTGAWE+ALTNTLSPGDR+++   GQFS LWID  +R+  +V+V E EWG+GA+ D +
Sbjct  67   ATGTGAWEAALTNTLSPGDRVLAPRYGQFSTLWIDLARRVGLDVEVQEEEWGKGADPDRI  126

Query  525  ASKLAEDTAHTIKAICIVHNET  590
               L  D  H IKA+ +VHNET
Sbjct  127  EEALRADREHRIKAVLVVHNET  148



>gb|AEX09269.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=328

 Score =   176 bits (445),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 81/92 (88%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +3

Query  315  TTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESE  494
            TTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES+
Sbjct  1    TTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVESD  60

Query  495  WGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            WGQGANL++L+SKLA D AH+IKAICIVHNET
Sbjct  61   WGQGANLEILSSKLASDAAHSIKAICIVHNET  92



>gb|AEX09290.1| alanine glyoxylate aminotransferase [Peperomia dolabella]
Length=311

 Score =   175 bits (443),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 81/92 (88%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +3

Query  315  TTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESE  494
            TTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES+
Sbjct  1    TTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVESD  60

Query  495  WGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            WG GANL++LASKLA D AH+IKAICIVHNET
Sbjct  61   WGHGANLEILASKLASDAAHSIKAICIVHNET  92



>gb|AEX09243.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=301

 Score =   174 bits (442),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +3

Query  321  SGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWG  500
            SGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES+WG
Sbjct  1    SGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVESDWG  60

Query  501  QGANLDVLASKLAEDTAHTIKAICIVHNET  590
            QGANL++LASKLA D AHTIKAICIVHNET
Sbjct  61   QGANLEILASKLASDAAHTIKAICIVHNET  90



>ref|WP_012453656.1| serine--glyoxylate aminotransferase [Methylobacterium populi]
 gb|ACB79910.1| aminotransferase class V [Methylobacterium populi BJ001]
Length=402

 Score =   177 bits (449),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 102/148 (69%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            M     PGRNHLFVPGP NIPD+V+RAM   +ED+RS   P+LTK L ED KK+F +T G
Sbjct  1    MAATRRPGRNHLFVPGPTNIPDRVMRAMMVQSEDHRSVDFPSLTKPLFEDTKKVFGSTEG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T FL P +GTG WESALTNTL+ GD++++   GQFS LWID  QRL  +V V E EWG G
Sbjct  61   TIFLFPASGTGIWESALTNTLARGDKVLTSRYGQFSHLWIDMAQRLGLDVIVQEEEWGTG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A  + +   L  D  H IKA+ +VHNET
Sbjct  121  AKPEKIEEALRADKNHEIKAVMVVHNET  148



>ref|WP_020188076.1| hypothetical protein [Methylopila sp. 73B]
Length=402

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PG+N LFVPGP N+P++V+RAM  + ED+RSP  P LTK L E +KK+FKT  G  F+ P
Sbjct  5    PGKNFLFVPGPTNVPERVLRAMVVSQEDHRSPIFPELTKPLYEGLKKVFKTKDGQVFIFP  64

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  524
            ++GTG WE+ALTNTL+PGD++++   GQFS LW D  QRL  +V + E EWG GA+ + +
Sbjct  65   SSGTGGWEAALTNTLAPGDKVLTARFGQFSHLWTDMAQRLGLDVQIQEEEWGTGAHEEKI  124

Query  525  ASKLAEDTAHTIKAICIVHNET  590
               L  DTAH IKA+ +VHNET
Sbjct  125  EEALVADTAHEIKAVMVVHNET  146



>ref|WP_003597639.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 sp|P55819.2|SGAA_METEA RecName: Full=Serine--glyoxylate aminotransferase; Short=SGAT 
[Methylobacterium extorquens AM1]
 gb|ACS39570.1| serine-glyoxylate aminotransferase (SGAT) [Methylobacterium extorquens 
AM1]
 emb|CAX24121.1| serine-glyoxylate aminotransferase (SGAT) [Methylobacterium extorquens 
DM4]
 gb|EHP94104.1| Serine--glyoxylate transaminase [Methylobacterium extorquens 
DSM 13060]
Length=402

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 102/148 (69%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            M     PGRNHLFVPGP NIPD+V+RAM   +ED+RS   P+LTK L ED KK+F +T G
Sbjct  1    MAATRRPGRNHLFVPGPTNIPDRVMRAMMVQSEDHRSVDFPSLTKPLFEDTKKVFGSTEG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T FL P +GTG WESAL+NTL+ GD++++   GQFS LWID  QRL  +V V E EWG G
Sbjct  61   TIFLFPASGTGIWESALSNTLARGDKVLAARFGQFSHLWIDMAQRLGLDVVVQEEEWGTG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A  + +   L  D  H IKA+ +VHNET
Sbjct  121  AKPEKIEEALRADKNHEIKAVMVVHNET  148



>ref|WP_012253362.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 gb|ABY30194.1| Serine--glyoxylate transaminase [Methylobacterium extorquens 
PA1]
Length=402

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 102/148 (69%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            M     PGRNHLFVPGP NIPD+V+RAM   +ED+RS   P+LTK L ED KK+F +T G
Sbjct  1    MAATRRPGRNHLFVPGPTNIPDRVMRAMMVQSEDHRSVDFPSLTKPLFEDTKKVFGSTEG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T FL P +GTG WESAL+NTL+ GD++++   GQFS LWID  QRL  +V V E EWG G
Sbjct  61   TIFLFPASGTGIWESALSNTLARGDKVLAARFGQFSHLWIDMAQRLGLDVVVQEEEWGTG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A  + +   L  D  H IKA+ +VHNET
Sbjct  121  AKPEKIEEALRADKNHEIKAVMVVHNET  148



>ref|WP_041930245.1| serine--glyoxylate aminotransferase, partial [Methylibium petroleiphilum]
Length=395

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 102/141 (72%), Gaps = 0/141 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            GRN LFVPGP N+P++V RAM  + ED+RS   P LTK++LED+K +FKTT+GTP + P 
Sbjct  3    GRNFLFVPGPTNVPERVQRAMVVSMEDHRSSKFPDLTKSVLEDLKAVFKTTTGTPIIFPA  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  527
            TGTG WE+ALTNTLSPGD +++   GQFS LWID   RL F V+ VE EWG+G  ++  A
Sbjct  63   TGTGGWEAALTNTLSPGDLVLASRFGQFSHLWIDMITRLGFQVETVECEWGEGVPVEKYA  122

Query  528  SKLAEDTAHTIKAICIVHNET  590
              LA+D  H IKA+   HNET
Sbjct  123  EILAKDKGHKIKAVIATHNET  143



>ref|WP_026610206.1| serine--glyoxylate aminotransferase [Methylocaldum szegediense]
Length=394

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 100/142 (70%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGR HL+VPGP NIPD ++ AM    ED+R P  P L + LLED+KKIF+T SG  F+ P
Sbjct  2    PGRTHLYVPGPTNIPDSILSAMHVPMEDHRRPDFPELIQPLLEDLKKIFQTKSGQCFIFP  61

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  524
             TGT  WE ALTNTLSPGD+++++  GQFS LWID  +RL F+V+  E  WG+G  LD L
Sbjct  62   ATGTAGWEIALTNTLSPGDKVLAYRFGQFSHLWIDMARRLGFDVEYEEVPWGEGVPLDRL  121

Query  525  ASKLAEDTAHTIKAICIVHNET  590
             ++L  DT H IKA+ I HNET
Sbjct  122  EARLKADTKHEIKALLICHNET  143



>gb|ABM96214.1| serine-glyoxylate aminotransferase [Methylibium petroleiphilum 
PM1]
Length=415

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 102/141 (72%), Gaps = 0/141 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            GRN LFVPGP N+P++V RAM  + ED+RS   P LTK++LED+K +FKTT+GTP + P 
Sbjct  3    GRNFLFVPGPTNVPERVQRAMVVSMEDHRSSKFPDLTKSVLEDLKAVFKTTTGTPIIFPA  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  527
            TGTG WE+ALTNTLSPGD +++   GQFS LWID   RL F V+ VE EWG+G  ++  A
Sbjct  63   TGTGGWEAALTNTLSPGDLVLASRFGQFSHLWIDMITRLGFQVETVECEWGEGVPVEKYA  122

Query  528  SKLAEDTAHTIKAICIVHNET  590
              LA+D  H IKA+   HNET
Sbjct  123  EILAKDKGHKIKAVIATHNET  143



>ref|WP_010960683.1| serine--glyoxylate aminotransferase [Methylococcus capsulatus]
 gb|AAU92322.1| serine--glyoxylate aminotransferase [Methylococcus capsulatus 
str. Bath]
Length=395

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 100/142 (70%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGRNHL+VPGP NIPD V+ AM    ED+R P  PAL   LLE++KK+F+T +G  F+ P
Sbjct  2    PGRNHLYVPGPTNIPDAVLSAMHVPMEDHRRPDFPALVTPLLENLKKVFRTEAGQCFIFP  61

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  524
             TGT  WE AL+NTLSPGD+++S+  GQFS LWID  +RL   V+  E  WGQG  LD L
Sbjct  62   ATGTAGWEIALSNTLSPGDKVLSYRFGQFSHLWIDLARRLGLEVEYEEVPWGQGVPLDRL  121

Query  525  ASKLAEDTAHTIKAICIVHNET  590
             ++L  DTAH IKA+ I HNET
Sbjct  122  EARLKADTAHEIKAVLICHNET  143



>ref|WP_026362994.1| serine--glyoxylate aminotransferase [Methylopila sp. M107]
Length=402

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PG+N LFVPGP N+P++V+RAM  + ED+RSP  P LTK L E +KK++KTT G  F+ P
Sbjct  5    PGKNFLFVPGPTNVPERVLRAMVVSQEDHRSPIFPELTKPLYEGLKKVYKTTEGQVFIFP  64

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  524
            ++GTG WE+AL NTL+PGD++++   GQFS LW D  QRL  +V ++E EWG GA+ + +
Sbjct  65   SSGTGGWEAALANTLAPGDKVLNSRFGQFSHLWTDMAQRLGLDVQILEEEWGTGAHEEKI  124

Query  525  ASKLAEDTAHTIKAICIVHNET  590
               L  D AH IKA+ +VHNET
Sbjct  125  EEALVADKAHEIKAVMVVHNET  146



>gb|AEX09280.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=330

 Score =   174 bits (440),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/92 (87%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +3

Query  315  TTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESE  494
            T SGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES+
Sbjct  1    TXSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVESD  60

Query  495  WGQGANLDVLASKLAEDTAHTIKAICIVHNET  590
            WGQGANL++L+SKLA D AH+IKAICIVHNET
Sbjct  61   WGQGANLEILSSKLASDAAHSIKAICIVHNET  92



>ref|WP_014149643.1| serine--glyoxylate aminotransferase [Methylomicrobium alcaliphilum]
 ref|YP_004918468.1| serine-glyoxylate aminotransferase [Methylomicrobium alcaliphilum 
20Z]
 emb|CCE24883.1| Serine-glyoxylate aminotransferase [Methylomicrobium alcaliphilum 
20Z]
Length=387

 Score =   175 bits (443),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 100/141 (71%), Gaps = 0/141 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            GRNHL+VPGP NIPD+V+ AM   +ED+RSP  P L K LLED+KK+FKT +G  F+ P 
Sbjct  3    GRNHLYVPGPTNIPDEVLSAMHVPSEDHRSPIFPELFKPLLEDLKKVFKTETGHSFIFPA  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  527
            TGT  WE ALTNTLSPGD+++ +  GQFS LW    +RL+F V V+E  WG+G  LD L 
Sbjct  63   TGTAGWEIALTNTLSPGDKVLIYRFGQFSHLWAAMAKRLDFEVIVIERPWGEGIPLDDLE  122

Query  528  SKLAEDTAHTIKAICIVHNET  590
            ++L ED  H IKAI   HNET
Sbjct  123  ARLKEDGKHEIKAILATHNET  143



>gb|ADO24296.1| aminotransferase [Valeriana jatamansi]
Length=91

 Score =   166 bits (419),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 78/91 (86%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MD   A GRNHLFVPGPVNIP+ V+RAM RNNEDYRSPA+PA+TKTLLEDVK+IFKTTSG
Sbjct  1    MDNFYAAGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAIPAMTKTLLEDVKQIFKTTSG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFL  419
            TPFL PTTGTGAWESALTNTLSPGDR+VSFL
Sbjct  61   TPFLFPTTGTGAWESALTNTLSPGDRVVSFL  91



>ref|WP_027156802.1| serine--glyoxylate aminotransferase [Methylobacter luteus]
Length=388

 Score =   174 bits (442),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 101/141 (72%), Gaps = 0/141 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            GRNHL++PGP N+P +V+ AM  N ED+RSP  P L K LL+D+KK+FKT +G  F+ P 
Sbjct  3    GRNHLYIPGPTNVPSEVLNAMHVNMEDHRSPIFPKLLKPLLQDLKKVFKTETGQAFIFPA  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  527
            TGT  WE ALTNTL+PGD+++ +  GQFS LW +  +RL FNV++ +  WG+G  LD L 
Sbjct  63   TGTAGWEIALTNTLNPGDKVLIYRFGQFSHLWAEMAKRLGFNVEIHQETWGKGIPLDKLE  122

Query  528  SKLAEDTAHTIKAICIVHNET  590
            ++L EDT H IKA+   HNET
Sbjct  123  ARLKEDTKHEIKAVLATHNET  143



>ref|WP_017840623.1| serine--glyoxylate aminotransferase [Methylomicrobium buryatense]
Length=387

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 99/141 (70%), Gaps = 0/141 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            GRNHL+VPGP NIPD+V+ AM   +ED+RSP  P L K LLED+KK+FKT +G  F+ P 
Sbjct  3    GRNHLYVPGPTNIPDEVLSAMHVPSEDHRSPIFPELFKPLLEDLKKVFKTETGHSFIFPA  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  527
            TGT  WE ALTNTLSPGD+++ +  GQFS LW    +RL F V V+E  WG+G  LD L 
Sbjct  63   TGTAGWEIALTNTLSPGDKVLIYRFGQFSHLWAAMAKRLGFEVIVIERPWGEGIPLDDLE  122

Query  528  SKLAEDTAHTIKAICIVHNET  590
            ++L ED  H IKAI   HNET
Sbjct  123  ARLKEDGQHEIKAILATHNET  143



>ref|XP_003615391.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES98349.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=343

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 100/148 (68%), Gaps = 33/148 (22%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MD+   PGRNHLFVPG              NNE++R+PA+ ALTKTLL+DVKKIFKTTS 
Sbjct  1    MDFAYGPGRNHLFVPG--------------NNENHRTPAITALTKTLLDDVKKIFKTTSR  46

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
             PFLIPTT                   V FLIGQFSLLWI+QQ+ LNF +DVVESEWGQG
Sbjct  47   IPFLIPTT-------------------VYFLIGQFSLLWIEQQKCLNFKIDVVESEWGQG  87

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
             +LD L SKLA D  HTIKAICIVHNET
Sbjct  88   VDLDALESKLASDKTHTIKAICIVHNET  115



>ref|WP_036230592.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylibium]
 gb|EWS54025.1| Soluble hydrogenase 42 kDa subunit [Methylibium sp. T29]
 gb|EWS61014.1| Soluble hydrogenase 42 kDa subunit [Methylibium sp. T29-B]
Length=415

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 102/141 (72%), Gaps = 0/141 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            GRN LFVPGP N+P++V RAM  + ED+RS   P LTK++LED+K +FKTT+GTP + P 
Sbjct  3    GRNFLFVPGPTNVPERVQRAMVVSMEDHRSSKFPDLTKSVLEDLKAVFKTTNGTPIIFPA  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  527
            TGTG WE+ALTNTLSPGD +++   GQFS LWID   RL F V+ VE EWG+G  ++  A
Sbjct  63   TGTGGWEAALTNTLSPGDLVLASRFGQFSHLWIDMITRLGFQVETVECEWGEGVPVEKYA  122

Query  528  SKLAEDTAHTIKAICIVHNET  590
              L++D  H IKA+   HNET
Sbjct  123  EILSKDKGHRIKAVIATHNET  143



>ref|WP_018238561.1| serine--glyoxylate aminotransferase [Ensifer sp. BR816]
Length=396

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 99/142 (70%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PG NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK   G  F+ P
Sbjct  2    PGYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRYPELTLPLFADVKKVFKNQDGRVFIYP  61

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  524
            ++GTGAWE+A+TN LSPGDR++    GQFS LW+D  +RL F VD ++ EWG G  +++ 
Sbjct  62   SSGTGAWEAAMTNVLSPGDRLLMSRFGQFSHLWVDMAERLGFEVDCLDREWGTGVPVELY  121

Query  525  ASKLAEDTAHTIKAICIVHNET  590
            A +LA D AH IKA+ + HNET
Sbjct  122  AERLAADKAHEIKAVFVTHNET  143



>ref|WP_014762956.1| serine--glyoxylate aminotransferase [Sinorhizobium fredii]
 gb|AFL50786.1| serine--glyoxylate aminotransferase SgaA [Sinorhizobium fredii 
USDA 257]
Length=396

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 99/141 (70%), Gaps = 0/141 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK  SG  F+ P+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRYPELTLPLFADVKKVFKNHSGRVFIYPS  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  527
            +GTGAWE+A+TN LSPGDR++    GQFS LW+D  +RL F VD ++ EWG G  +++ A
Sbjct  63   SGTGAWEAAMTNVLSPGDRVLMSRFGQFSHLWVDMAERLRFEVDCIDREWGTGVPVELYA  122

Query  528  SKLAEDTAHTIKAICIVHNET  590
             +LA D AH IKA+ + HNET
Sbjct  123  ERLAADKAHKIKAVFVTHNET  143



>gb|AEX09289.1| alanine glyoxylate aminotransferase [Peperomia gigantea]
Length=312

 Score =   171 bits (434),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +3

Query  324  GTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQ  503
            GTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES+WGQ
Sbjct  1    GTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVESDWGQ  60

Query  504  GANLDVLASKLAEDTAHTIKAICIVHNET  590
            GANL++LASKLA D AH+IKAICIVHNET
Sbjct  61   GANLEILASKLASDAAHSIKAICIVHNET  89



>ref|WP_026597137.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 77]
Length=402

 Score =   172 bits (436),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 100/148 (68%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            M     PGRNHLFVPGP NIPD+V RAM   +ED+RS   PALTK L E+ K +F +T G
Sbjct  1    MAATRRPGRNHLFVPGPTNIPDRVQRAMIVPSEDHRSVDFPALTKPLFEETKAVFGSTEG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T FL P +GTG WE+ALTNTL  GD++++   GQFS LWID  QRL  NV V E EWG G
Sbjct  61   TIFLFPASGTGIWEAALTNTLHRGDKVLTSRFGQFSHLWIDMAQRLGLNVIVQEEEWGTG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A+ + +   L  DT H IKA+  VHNET
Sbjct  121  ASPERIEEALRADTNHEIKAVMTVHNET  148



>ref|WP_027147316.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylobacter]
Length=388

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 101/141 (72%), Gaps = 0/141 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            GRNHL++PGP N+P +V+ AM  N ED+RSP  P L K LL+D+KK+FKT +G  F+ P 
Sbjct  3    GRNHLYIPGPTNVPSEVLNAMHVNMEDHRSPIFPKLLKPLLQDLKKVFKTETGQAFVFPA  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  527
            TGT  WE ALTNTL+PGD+++ +  GQFS LW +  +RL F+V++ +  WG+G  LD L 
Sbjct  63   TGTAGWEIALTNTLNPGDKVLIYRFGQFSHLWAEMAKRLGFDVEIHQEAWGKGIPLDKLE  122

Query  528  SKLAEDTAHTIKAICIVHNET  590
            ++L ED+ H IKA+   HNET
Sbjct  123  ARLKEDSQHEIKAVLATHNET  143



>ref|WP_037416404.1| serine--glyoxylate aminotransferase [Sinorhizobium sp. CCBAU 
05631]
Length=396

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 99/141 (70%), Gaps = 0/141 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  D+K++FK  SG  F+ P+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRYPELTLPLFADIKRVFKNQSGRVFIYPS  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  527
            +GTGAWE+A+TN L PGDR++    GQFS LW+D  +RL F VD ++ EWG G  +++ A
Sbjct  63   SGTGAWEAAMTNVLYPGDRVLMSRFGQFSHLWVDMAERLGFEVDCLDREWGTGVPVELYA  122

Query  528  SKLAEDTAHTIKAICIVHNET  590
             +LA D AHTIKA+ + HNET
Sbjct  123  DRLAADKAHTIKAVFVTHNET  143



>ref|WP_026622911.1| serine--glyoxylate aminotransferase [Ensifer sp. WSM1721]
Length=396

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 99/141 (70%), Gaps = 0/141 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK  +G  F+ P+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPQYPELTLPLFADVKKVFKNRNGRVFIYPS  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  527
            +GTGAWE+A+TN LSPGDR++    GQFS LW+D  +RL F VD ++ EWG G  +++ A
Sbjct  63   SGTGAWEAAMTNVLSPGDRVLMSRFGQFSHLWVDMAERLGFEVDCLDMEWGTGVPVELYA  122

Query  528  SKLAEDTAHTIKAICIVHNET  590
             +LA D AH IKA+ + HNET
Sbjct  123  ERLAADKAHRIKAVFVTHNET  143



>ref|WP_036253086.1| serine--glyoxylate aminotransferase [Methylobacter sp. BBA5.1]
Length=388

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 101/141 (72%), Gaps = 0/141 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            GRNHL++PGP N+P +V+ AM  N ED+RSP  P L K LL+D+KK+FKT +G  F+ P 
Sbjct  3    GRNHLYIPGPTNVPSEVLNAMHVNMEDHRSPIFPKLLKPLLQDLKKVFKTETGQAFVFPA  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  527
            TGT  WE ALTNTL+PGD+++ +  GQFS LW +  +RL F+V++ +  WG+G  LD L 
Sbjct  63   TGTAGWEIALTNTLNPGDKVLIYRFGQFSHLWAEMAKRLGFDVEIHQETWGKGIPLDKLE  122

Query  528  SKLAEDTAHTIKAICIVHNET  590
            ++L ED+ H IKA+   HNET
Sbjct  123  ARLKEDSQHEIKAVLATHNET  143



>ref|WP_018410273.1| serine--glyoxylate aminotransferase [Methyloversatilis sp. NVD]
Length=396

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 95/141 (67%), Gaps = 0/141 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            GRNHLFVPGP N+PD+V+RAM    ED+RSP  P LTK++L D+KK+FKTT GT    P 
Sbjct  6    GRNHLFVPGPTNVPDRVLRAMVVAQEDHRSPKFPELTKSVLADLKKVFKTTEGTILTFPA  65

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  527
            +GTG WE+ALTNTLSPGD+++    GQFS LW D  QRL F V +++ EWG G   D   
Sbjct  66   SGTGMWEAALTNTLSPGDKVLCSRFGQFSHLWADMAQRLGFEVQILDVEWGTGVPYDQYE  125

Query  528  SKLAEDTAHTIKAICIVHNET  590
              L  D  H IKA+    NET
Sbjct  126  EVLRADKEHKIKAVLACQNET  146



>ref|WP_034858116.1| serine--glyoxylate aminotransferase [Ensifer sojae]
Length=396

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 100/141 (71%), Gaps = 0/141 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK  +G  F+ P+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRYPELTLPLFADVKKVFKNENGRVFIYPS  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  527
            +GTGAWE+A+TN LSPGDR++    GQFS LW+D  +RL F VD ++ EWG G  +++ A
Sbjct  63   SGTGAWEAAMTNVLSPGDRVLMSRFGQFSHLWVDMAERLGFEVDCLDMEWGTGVPVELYA  122

Query  528  SKLAEDTAHTIKAICIVHNET  590
             +L+ D AH+IKA+ + HNET
Sbjct  123  ERLSADKAHSIKAVFVTHNET  143



>ref|WP_003535479.1| serine--glyoxylate aminotransferase [Sinorhizobium meliloti]
 gb|EHK74228.1| serine--glyoxylate aminotransferase [Sinorhizobium meliloti CCNWSX0020]
Length=396

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 98/141 (70%), Gaps = 0/141 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKKIFK  +G  F+ P+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRYPELTLPLFSDVKKIFKNQNGRVFIYPS  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  527
            +GTGAWE+A+TN LSPGDR++    GQFS LW+D   RL F VD ++ EWG G  +++ A
Sbjct  63   SGTGAWEAAMTNVLSPGDRVLMSRFGQFSHLWVDMAARLGFEVDCIDREWGTGVPVELYA  122

Query  528  SKLAEDTAHTIKAICIVHNET  590
             +L+ D AH IKA+ + HNET
Sbjct  123  ERLSADKAHKIKAVFVTHNET  143



>ref|WP_026175686.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 88A]
Length=402

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 97/148 (66%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            M     PGRNHLFVPGP NIPD+V RAM   +ED+RS   P LTK L E+ K +F +T G
Sbjct  1    MAATRRPGRNHLFVPGPTNIPDRVQRAMIVPSEDHRSVDFPTLTKPLFEETKAVFGSTEG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T FL P +GTG WESALTNTL  GD +++   GQFS LWID  QRL  NV V E EWG G
Sbjct  61   TIFLFPASGTGIWESALTNTLHRGDTVLTSRFGQFSHLWIDMAQRLGLNVIVQEEEWGTG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            AN   +   L  DT H IKA+  VHNET
Sbjct  121  ANPQRIEEALRADTNHEIKAVMTVHNET  148



>ref|WP_027172630.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 10]
Length=402

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 97/148 (66%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            M     PGRNHLFVPGP NIPD+V RAM   +ED+RS   P LTK L E+ K +F +T G
Sbjct  1    MAATRRPGRNHLFVPGPTNIPDRVQRAMIVPSEDHRSVDFPTLTKPLFEETKAVFGSTEG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T FL P +GTG WESALTNTL  GD +++   GQFS LWID  QRL  NV V E EWG G
Sbjct  61   TIFLFPASGTGIWESALTNTLHRGDTVLTSRFGQFSHLWIDMAQRLGLNVIVQEEEWGTG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            AN   +   L  DT H IKA+  VHNET
Sbjct  121  ANPQRIEEALRADTNHEIKAVMTVHNET  148



>ref|WP_007559580.1| serine--glyoxylate aminotransferase [Methylobacterium sp. GXF4]
 gb|EIZ86366.1| class V aminotransferase [Methylobacterium sp. GXF4]
Length=402

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 101/148 (68%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            M     PGRNHLF+PGP NIPD+V+RAM   +ED+RSP  P L K LL+D K +F +T+G
Sbjct  1    MAATRRPGRNHLFIPGPTNIPDRVLRAMHVPSEDHRSPGFPELVKPLLQDAKIVFGSTAG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T  L P++GTG WESAL+NTL  GD++++   GQFS LW+D  QRL  +V V E EWG G
Sbjct  61   TVILFPSSGTGIWESALSNTLCRGDKVLTSRYGQFSHLWVDMAQRLGLDVIVQEEEWGTG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A+   +   L  D  H IKA+ +VHNET
Sbjct  121  ADPQKIEEALRADKDHAIKAVMVVHNET  148



>ref|WP_014329402.1| serine--glyoxylate aminotransferase [Sinorhizobium fredii]
 emb|CCE96968.1| serine-glyoxylate aminotransferase-related [Sinorhizobium fredii 
HH103]
Length=396

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 99/141 (70%), Gaps = 0/141 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK  +G  F+ P+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRFPELTLPLFADVKKVFKNRNGRVFIYPS  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  527
            +GTGAWE+A+TN LSPGD+++    GQFS LW+D  +RL F VD ++ EWG G  +++ A
Sbjct  63   SGTGAWEAAMTNVLSPGDKVLMSRFGQFSHLWVDMAERLGFEVDCLDREWGTGVPVELYA  122

Query  528  SKLAEDTAHTIKAICIVHNET  590
             +LA D AH IKA+ + HNET
Sbjct  123  ERLAADKAHKIKAVFVTHNET  143



>ref|WP_006890572.1| serine--glyoxylate aminotransferase [Methylobacter tundripaludum]
 gb|EGW22602.1| Serine--glyoxylate transaminase [Methylobacter tundripaludum 
SV96]
Length=388

 Score =   170 bits (430),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 101/141 (72%), Gaps = 0/141 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            GRNHL++PGP N+P++++ AM  N ED+RSP  P L   LL+D+KKIFKT +G  F+ P 
Sbjct  3    GRNHLYIPGPTNVPNEILNAMHVNMEDHRSPVFPKLLTPLLQDLKKIFKTETGQAFIFPA  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  527
            TGT  WE ALTNTL+PGD+++ +  GQFS LW +  +RL F+V++ +  WG+G  LD + 
Sbjct  63   TGTAGWEVALTNTLNPGDKVLIYRFGQFSHLWAEMAKRLGFDVEIHQEVWGKGIPLDRME  122

Query  528  SKLAEDTAHTIKAICIVHNET  590
            ++L EDT H IKA+   HNET
Sbjct  123  ARLKEDTNHEIKAVLATHNET  143



>ref|WP_031437003.1| serine--glyoxylate aminotransferase [Methylobacter tundripaludum]
Length=388

 Score =   170 bits (430),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 101/141 (72%), Gaps = 0/141 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            GRNHL++PGP N+P++++ AM  N ED+RSP  P L   LL+D+KKIFKT +G  F+ P 
Sbjct  3    GRNHLYIPGPTNVPNEILNAMHVNMEDHRSPVFPKLLTPLLQDLKKIFKTETGQAFIFPA  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  527
            TGT  WE ALTNTL+PGD+++ +  GQFS LW +  +RL F+V++ +  WG+G  LD + 
Sbjct  63   TGTAGWEVALTNTLNPGDKVLIYRFGQFSHLWAEMAKRLGFDVEIHQEVWGKGIPLDRME  122

Query  528  SKLAEDTAHTIKAICIVHNET  590
            ++L EDT H IKA+   HNET
Sbjct  123  ARLKEDTNHEIKAVLATHNET  143



>ref|WP_028223486.1| serine--glyoxylate aminotransferase [Burkholderia oxyphila]
Length=421

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 99/142 (70%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGRN L VPGP NIPD V+RAM  + ED+RS   P L   +L D+K+++KTTSG PF+ P
Sbjct  10   PGRNILAVPGPTNIPDAVLRAMVVSMEDHRSTRFPELANGVLSDLKRLYKTTSGQPFIFP  69

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  524
            ++GTGAWE+ALTNTLSPGDR++    GQFS LW D  QRL F V++VE +WG+G  ++ +
Sbjct  70   SSGTGAWEAALTNTLSPGDRVLVARFGQFSHLWADMAQRLGFEVEIVEVDWGEGVPVERI  129

Query  525  ASKLAEDTAHTIKAICIVHNET  590
               L  D  H IK I   HNET
Sbjct  130  EEVLKADKKHQIKGILACHNET  151



>ref|WP_031434945.1| serine--glyoxylate aminotransferase [Methylomarinum vadi]
Length=388

 Score =   169 bits (429),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 98/141 (70%), Gaps = 0/141 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            GRNHLF+PGP N P +V+ AM    ED+RSP  P L K +LED+KK+F+T +G  F+ P 
Sbjct  3    GRNHLFIPGPTNTPHEVLSAMHVPMEDHRSPDFPKLLKPVLEDLKKVFRTETGQAFIFPA  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  527
            TGT  WE ALTNTLSPGD+++ +  GQFS LW+D  +RL  +V+  E EWG+G  LD L 
Sbjct  63   TGTAGWEIALTNTLSPGDKVLIYRFGQFSHLWMDMAKRLGLDVEFHEVEWGKGIPLDALE  122

Query  528  SKLAEDTAHTIKAICIVHNET  590
            ++L ED  H IKA+   HNET
Sbjct  123  TRLKEDGNHEIKAVLATHNET  143



>ref|WP_028755163.1| serine--glyoxylate aminotransferase [Rhizobium leucaenae]
Length=396

 Score =   169 bits (429),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 98/141 (70%), Gaps = 0/141 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK  +G  F+ P+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRYPELTLPLFADVKKVFKNHNGRVFIYPS  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  527
            +GTGAWE+A+TN LSPGDR++    GQFS LW+D  +RL F VD ++ EWG G  +++ A
Sbjct  63   SGTGAWEAAMTNVLSPGDRVLMSRFGQFSHLWVDMAERLGFEVDCLDMEWGTGVPVELYA  122

Query  528  SKLAEDTAHTIKAICIVHNET  590
             +L  D AH IKA+ + HNET
Sbjct  123  ERLVADKAHKIKAVFVTHNET  143



>ref|WP_027999163.1| serine--glyoxylate aminotransferase [Sinorhizobium arboris]
Length=396

 Score =   169 bits (429),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 98/141 (70%), Gaps = 0/141 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK  +G  F+ P+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRFPELTLPLFADVKKVFKNRNGRVFIYPS  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  527
            +GTGAWE+A+TN LSPGD+++    GQFS LW+D  +RL F VD ++ EWG G  +D+ A
Sbjct  63   SGTGAWEAAMTNVLSPGDKVLMSRFGQFSHLWVDMAERLGFEVDCLDMEWGTGVPVDLYA  122

Query  528  SKLAEDTAHTIKAICIVHNET  590
             +LA D  H IKA+ + HNET
Sbjct  123  ERLAADETHQIKAVFVTHNET  143



>ref|WP_040961132.1| serine--glyoxylate aminotransferase [Sinorhizobium fredii]
Length=396

 Score =   169 bits (429),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 98/141 (70%), Gaps = 0/141 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK  +G  F+ P+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRYPELTLPLFADVKKVFKNRNGRVFIYPS  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  527
            +GTGAWE+A+TN LSPGD+++    GQFS LW+D  +RL F VD ++ EWG G  + + A
Sbjct  63   SGTGAWEAAMTNVLSPGDKVLMSRFGQFSHLWVDMAERLGFEVDCLDREWGTGVPVKLYA  122

Query  528  SKLAEDTAHTIKAICIVHNET  590
             +LA D AH IKA+ + HNET
Sbjct  123  ERLAADKAHKIKAVFVTHNET  143



>ref|WP_040580464.1| serine--glyoxylate aminotransferase [Methyloferula stellata]
Length=404

 Score =   169 bits (429),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 102/142 (72%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGR+ LFVPGP N+PD+++RAM    ED+R+P  P LTK +LED+KKIFKTT+G  F+ P
Sbjct  10   PGRHFLFVPGPTNVPDRILRAMHVPMEDHRNPTFPDLTKPILEDLKKIFKTTTGQCFVYP  69

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  524
            +TGTG WE+ALTNTLSPGD+++    GQFS LW D  QR+  +V V++ EWG G + + +
Sbjct  70   STGTGGWEAALTNTLSPGDKVIVSRYGQFSALWTDLAQRIGLDVQVIDEEWGTGTHPEHI  129

Query  525  ASKLAEDTAHTIKAICIVHNET  590
             + L  D  H IK + +V NET
Sbjct  130  HAILEADKEHKIKGVLVVQNET  151



>ref|WP_018329867.1| serine--glyoxylate aminotransferase [Rhizobium giardinii]
Length=396

 Score =   169 bits (428),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 99/142 (70%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PG NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  D++++FK  +G  F+ P
Sbjct  2    PGYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRFPELTLPLFADLRRVFKNQNGRVFIYP  61

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  524
            ++GTGAWE+A+TN LSPGD ++    GQFS LW+D  +RL F VD ++ EWG G  +++ 
Sbjct  62   SSGTGAWEAAMTNVLSPGDHVLMSRFGQFSHLWVDMAERLGFKVDCIDMEWGTGVPVELY  121

Query  525  ASKLAEDTAHTIKAICIVHNET  590
            A +L  D AHTIKA+ + HNET
Sbjct  122  AERLTGDKAHTIKAVFVTHNET  143



>ref|WP_012320605.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylobacterium]
 gb|ACB25646.1| aminotransferase class V [Methylobacterium radiotolerans JCM 
2831]
 gb|KIU30995.1| serine--glyoxylate aminotransferase [Methylobacterium radiotolerans]
 dbj|GAN47418.1| class V aminotransferase [Methylobacterium sp. ME121]
Length=402

 Score =   169 bits (429),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 102/148 (69%), Gaps = 0/148 (0%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            M     PGRNHLF+PGP NIP++V+RAM   +ED+RSP+ P L K LL+D K +F +T+G
Sbjct  1    MAATRRPGRNHLFIPGPTNIPERVLRAMHVPSEDHRSPSFPELVKPLLQDSKMVFGSTNG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
            T  L P++GTG WESAL+NTL  GD++++   GQFS LW+D  QRL  +V V E EWG G
Sbjct  61   TVILFPSSGTGIWESALSNTLCRGDKVLTARYGQFSHLWVDMAQRLGLDVIVQEEEWGAG  120

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            A+   +   L  D  H IKA+ +VHNET
Sbjct  121  ADPQKIEEALRADKDHAIKAVMVVHNET  148



>ref|WP_015933415.1| serine--glyoxylate aminotransferase [Methylobacterium nodulans]
 gb|ACL61852.1| aminotransferase class V [Methylobacterium nodulans ORS 2060]
Length=417

 Score =   169 bits (429),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 101/142 (71%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGRN LFVPGP N+P++V RAM    ED+RS + P LT  L E++KK+FK+  G  F+ P
Sbjct  7    PGRNFLFVPGPTNVPERVQRAMIVPMEDHRSSSFPDLTLPLFENMKKVFKSKDGQVFIFP  66

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  524
            ++GTGAWE+ALTNTLSPGDR+++   GQFS LWID  QR+  +V + + EWG GAN D +
Sbjct  67   SSGTGAWEAALTNTLSPGDRVLASRFGQFSTLWIDLAQRVGLDVVIQDEEWGTGANPDRI  126

Query  525  ASKLAEDTAHTIKAICIVHNET  590
               L  D  H IKA+ IVHNET
Sbjct  127  EEALRADRDHRIKAVLIVHNET  148



>ref|WP_026616975.1| serine--glyoxylate aminotransferase [Ensifer sp. TW10]
Length=396

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 99/141 (70%), Gaps = 0/141 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DV+K+FK  +G  F+ P+
Sbjct  3    GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRFPELTLPLFADVRKVFKNQNGRVFIYPS  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  527
            +GTGAWE+A+TN LSPGDR++    GQFS LW+D  +RL F VD ++ EWG G  +++ A
Sbjct  63   SGTGAWEAAMTNVLSPGDRVLMSRFGQFSHLWVDMAERLGFEVDCLDMEWGTGVPVELYA  122

Query  528  SKLAEDTAHTIKAICIVHNET  590
             +LA D AH I+A+ + HNET
Sbjct  123  ERLAADKAHEIQAVFVTHNET  143



>ref|WP_026608295.1| serine--glyoxylate aminotransferase [Methylocapsa acidiphila]
Length=412

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 101/142 (71%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGR+ LFVPGP N+PD+V RAM    ED+RS   P LT  L ED+KK+FK+  G  F+ P
Sbjct  2    PGRHFLFVPGPTNVPDRVQRAMLVAMEDHRSSKFPELTLPLFEDLKKVFKSVDGQVFIFP  61

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  524
            ++GTGAWE++L+NTLSPGD++++   GQFS LWID  QRL  +V V+E EWG G   + +
Sbjct  62   SSGTGAWEASLSNTLSPGDKVLASRFGQFSHLWIDLAQRLGLDVQVLEEEWGTGVKPEKI  121

Query  525  ASKLAEDTAHTIKAICIVHNET  590
             + L ED +H IKA+  VHNET
Sbjct  122  EAILREDKSHQIKAVLAVHNET  143



>ref|WP_035937801.1| serine--glyoxylate aminotransferase [Burkholderia glathei]
 gb|KDR42451.1| serine--glyoxylate aminotransferase [Burkholderia glathei]
 emb|CDY78627.1| Serine--glyoxylate aminotransferase [Burkholderia glathei]
Length=419

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 98/142 (69%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGRN L VPGP NIPDQV+R+M  + ED+RS   P L   +L D+K ++KTT+G PF+ P
Sbjct  10   PGRNFLAVPGPTNIPDQVLRSMVVSMEDHRSSKFPELANGVLSDLKALYKTTTGQPFIFP  69

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  524
            ++GTGAWE+ALTNTLSPGD++V    GQFS LW D   RL F V +V+ EWG+G  ++ +
Sbjct  70   SSGTGAWEAALTNTLSPGDKVVVARFGQFSHLWADMAHRLGFEVQIVDVEWGEGVPVERI  129

Query  525  ASKLAEDTAHTIKAICIVHNET  590
               L  D  HTIK I   HNET
Sbjct  130  EEILRADKQHTIKGILACHNET  151



>ref|XP_001702107.1| serine glyoxylate aminotransferase [Chlamydomonas reinhardtii]
 gb|EDO97196.1| serine glyoxylate aminotransferase [Chlamydomonas reinhardtii]
Length=437

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 97/142 (68%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGRNHLFVPGPVNI ++V+RAM    +++R P      K  LED K ++ T + TPF+ P
Sbjct  39   PGRNHLFVPGPVNIHERVLRAMHVPGQNHRDPWFAEFYKECLEDTKHMYGTKAATPFIFP  98

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  524
             TGTG WE+AL NTLSPGD+++ F  G FS LWID  QRL  +V VV+  WG+GA+   L
Sbjct  99   GTGTGGWEAALCNTLSPGDKVICFRYGLFSHLWIDMMQRLGLDVTVVDRPWGEGADEGAL  158

Query  525  ASKLAEDTAHTIKAICIVHNET  590
               L +DT   IKA+C+VHNET
Sbjct  159  EELLRKDTGKKIKAVCVVHNET  180



>ref|WP_005371842.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylomicrobium]
 gb|EIC29744.1| serine-pyruvate aminotransferase/archaeal aspartate aminotransferase 
[Methylomicrobium album BG8]
Length=388

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 99/141 (70%), Gaps = 0/141 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            GRNHL++PGP N+P +V+ AM    ED+RSP  PA+ K LLED+KK+F+T  G  F+ P 
Sbjct  3    GRNHLYIPGPTNVPHEVLSAMHAPMEDHRSPKFPAIFKPLLEDMKKVFRTEKGQCFIFPA  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  527
            TGT  WE ALTNTL+PGD+++ +  GQFS LW +  +RL F+V++ +  WG+G  LD L 
Sbjct  63   TGTAGWEIALTNTLNPGDKVIIYRFGQFSHLWAEMAKRLGFDVEIHQETWGKGIPLDKLE  122

Query  528  SKLAEDTAHTIKAICIVHNET  590
            ++L ED  H IKA+   HNET
Sbjct  123  ARLKEDKNHEIKAVLATHNET  143



>ref|XP_003617694.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AET00653.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=350

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 99/148 (67%), Gaps = 31/148 (21%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MD+   P RNHLFVPG  NIP+ VI   T             LTKTLL+DVKKIFKT  G
Sbjct  1    MDFAYGPERNHLFVPGSTNIPEHVIPITT-------------LTKTLLDDVKKIFKTVYG  47

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  506
              FLIPTTG    ESALTNT+SPG R +SFLIGQFSLLWI+QQ+RLNF VDVVESEWGQG
Sbjct  48   ISFLIPTTGI---ESALTNTMSPGYRTISFLIGQFSLLWIEQQKRLNFKVDVVESEWGQG  104

Query  507  ANLDVLASKLAEDTAHTIKAICIVHNET  590
            ANL+               AICIVHNET
Sbjct  105  ANLE---------------AICIVHNET  117



>ref|WP_012709136.1| serine--glyoxylate aminotransferase [Sinorhizobium fredii]
 ref|YP_002827132.1| serine--glyoxylate aminotransferase [Sinorhizobium fredii NGR234]
 gb|ACP26379.1| serine--glyoxylate aminotransferase [Sinorhizobium fredii NGR234]
Length=395

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 97/141 (69%), Gaps = 0/141 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            G NHLF+PGP NIP+Q+ +AM    ED RSP  P LT  L  DVKK+FK  +G  F+ P+
Sbjct  3    GYNHLFIPGPTNIPEQIRQAMNLPMEDMRSPRYPELTLPLFADVKKVFKNRNGRVFIYPS  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  527
            +GTGAWE+A+TN LSPGDR++    GQFS LW+D  +RL   VD ++ EWG G  +D+  
Sbjct  63   SGTGAWEAAMTNVLSPGDRVLMSRFGQFSHLWVDMAERLGLEVDCLDREWGTGVPVDLYT  122

Query  528  SKLAEDTAHTIKAICIVHNET  590
             +LA D AH IKA+ + HNET
Sbjct  123  ERLAADKAHRIKAVFVTHNET  143



>ref|XP_001702106.1| serine glyoxylate aminotransferase [Chlamydomonas reinhardtii]
 gb|EDO97195.1| serine glyoxylate aminotransferase [Chlamydomonas reinhardtii]
Length=448

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 97/142 (68%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGRNHLFVPGPVNI ++V+RAM    +++R P      K  LED K ++ T + TPF+ P
Sbjct  50   PGRNHLFVPGPVNIHERVLRAMHVPGQNHRDPWFAEFYKECLEDTKHMYGTKAATPFIFP  109

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  524
             TGTG WE+AL NTLSPGD+++ F  G FS LWID  QRL  +V VV+  WG+GA+   L
Sbjct  110  GTGTGGWEAALCNTLSPGDKVICFRYGLFSHLWIDMMQRLGLDVTVVDRPWGEGADEGAL  169

Query  525  ASKLAEDTAHTIKAICIVHNET  590
               L +DT   IKA+C+VHNET
Sbjct  170  EELLRKDTGKKIKAVCVVHNET  191



>ref|WP_037131645.1| serine--glyoxylate aminotransferase [Rhizobium sp. CF097]
Length=396

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 99/142 (70%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PG +HLF+PGP NIP+QV +AM    ED RS   P LT  L  DVKK+FK  +G  F+ P
Sbjct  2    PGYSHLFIPGPTNIPEQVRQAMNLPMEDMRSSRYPELTLPLFADVKKVFKNQNGRVFIYP  61

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  524
            ++GTGAWE+A+TN LSPGDR++    GQFS LW+D  +RL F VD ++ EWG G  +++ 
Sbjct  62   SSGTGAWEAAMTNVLSPGDRVLMSRFGQFSHLWVDMAERLGFVVDCLDREWGTGVPVELY  121

Query  525  ASKLAEDTAHTIKAICIVHNET  590
            A +LA D AH IKA+ + HNET
Sbjct  122  AERLAADKAHEIKAVFVTHNET  143



>ref|WP_037384071.1| serine--glyoxylate aminotransferase [Ensifer americanum]
 gb|KEC78847.1| serine-glyoxylate aminotransferase [Sinorhizobium americanum 
CCGM7]
Length=395

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 99/141 (70%), Gaps = 0/141 (0%)
 Frame = +3

Query  168  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  347
            G NHLF+PGP NIP++V +AM    ED RSP  P LT  L  D+K++FK  +G  F+ P+
Sbjct  3    GYNHLFIPGPTNIPERVRQAMNLPMEDMRSPRYPELTLPLFADIKQVFKNKTGRVFIYPS  62

Query  348  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  527
            +GTGAWE+A+TN LSPGDR++    GQFS LW+D  +RL F VD ++ EWG G  +++ A
Sbjct  63   SGTGAWEAAMTNVLSPGDRVLMSRFGQFSHLWVDMAERLGFEVDCLDREWGTGVPVELYA  122

Query  528  SKLAEDTAHTIKAICIVHNET  590
             +LA D AH IKA+ + HNET
Sbjct  123  ERLAADEAHEIKAVFVTHNET  143



>ref|WP_012590731.1| serine--glyoxylate aminotransferase [Methylocella silvestris]
 gb|ACK50661.1| aminotransferase class V [Methylocella silvestris BL2]
Length=396

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 97/142 (68%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGR+ LFVPGP N+P++V RAM    ED+RSP  P LT  L +D+KKI+KT  G  FL P
Sbjct  2    PGRHFLFVPGPTNVPERVARAMVVPMEDHRSPKFPELTLPLFQDLKKIYKTKDGQVFLFP  61

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  524
            ++GTGAWESA  NTLSPGD+++    GQFS LWID  QR+ F+V ++E EWG G   + +
Sbjct  62   SSGTGAWESAFNNTLSPGDKVLMSRFGQFSHLWIDMAQRMGFDVQILEEEWGTGVKPEKI  121

Query  525  ASKLAEDTAHTIKAICIVHNET  590
               L  D +H IKA+   HNET
Sbjct  122  EEILRADKSHQIKAVTATHNET  143



>gb|ACJ84853.1| unknown [Medicago truncatula]
Length=91

 Score =   159 bits (402),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/91 (86%), Positives = 83/91 (91%), Gaps = 1/91 (1%)
 Frame = +3

Query  147  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  326
            MDYVN PGRNHLFVPGPVNIPDQVIRAM+RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1    MDYVNGPGRNHLFVPGPVNIPDQVIRAMSRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  327  TPFLIPTTGTGAWESALTNTLSPGDRIVSFL  419
            TPFLIPTTGTGAWESALT  +    RIV +L
Sbjct  61   TPFLIPTTGTGAWESALTKHIVTW-RIVLYL  90



>ref|WP_035994918.1| serine--glyoxylate aminotransferase [Burkholderia caribensis]
 gb|ETY83415.1| Serine--glyoxylate aminotransferase [Burkholderia caribensis 
MBA4]
Length=422

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 99/142 (70%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  344
            PGRN L VPGP N+PD V RAM  + ED+RS   P LT  LL D+KKI++T  G PF+ P
Sbjct  10   PGRNILAVPGPTNVPDAVQRAMVVSMEDHRSTKFPELTHGLLSDLKKIYRTAEGQPFIFP  69

Query  345  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  524
            ++GTGAWE+ALTNTLSPGDR++    GQFS LW D  QRL F+V++++ +WG+G  ++ +
Sbjct  70   SSGTGAWEAALTNTLSPGDRVLVPRFGQFSHLWADMAQRLGFDVEILDVDWGEGVPVERI  129

Query  525  ASKLAEDTAHTIKAICIVHNET  590
               L  D  HTIK I   HNET
Sbjct  130  GEILKADRQHTIKGILACHNET  151



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 764930893160