BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF039A14

Length=572
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009795542.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    252   2e-77   Nicotiana sylvestris
ref|XP_009588489.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    241   9e-77   Nicotiana tomentosiformis
ref|XP_006357659.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    244   1e-74   Solanum tuberosum [potatoes]
ref|XP_008342255.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    241   3e-73   
ref|XP_009361534.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    240   4e-73   Pyrus x bretschneideri [bai li]
ref|XP_008245622.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    232   5e-72   Prunus mume [ume]
ref|XP_004144553.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    237   5e-72   Cucumis sativus [cucumbers]
ref|XP_008462040.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    237   6e-72   Cucumis melo [Oriental melon]
gb|KDO50965.1|  hypothetical protein CISIN_1g010607mg                   233   7e-72   Citrus sinensis [apfelsine]
ref|XP_007215270.1|  hypothetical protein PRUPE_ppa004667mg             237   8e-72   Prunus persica
ref|XP_004305682.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    236   1e-71   Fragaria vesca subsp. vesca
gb|KDO50964.1|  hypothetical protein CISIN_1g010607mg                   233   3e-71   Citrus sinensis [apfelsine]
gb|KDP29954.1|  hypothetical protein JCGZ_18523                         235   3e-71   Jatropha curcas
gb|KDO50963.1|  hypothetical protein CISIN_1g010607mg                   233   4e-71   Citrus sinensis [apfelsine]
ref|XP_002320530.2|  hypothetical protein POPTR_0014s16720g             236   7e-71   
ref|XP_011100518.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    231   1e-70   
ref|XP_010252799.1|  PREDICTED: histone-lysine N-methyltransferas...    234   1e-70   Nelumbo nucifera [Indian lotus]
ref|XP_008229941.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    234   1e-70   Prunus mume [ume]
ref|XP_006447826.1|  hypothetical protein CICLE_v10014974mg             234   1e-70   Citrus clementina [clementine]
gb|KDO50961.1|  hypothetical protein CISIN_1g010607mg                   234   1e-70   Citrus sinensis [apfelsine]
ref|XP_011100517.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    233   2e-70   Sesamum indicum [beniseed]
emb|CBI28466.3|  unnamed protein product                                229   4e-69   Vitis vinifera
ref|XP_002267469.2|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    231   1e-68   Vitis vinifera
ref|XP_011008074.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    229   1e-68   Populus euphratica
gb|EYU42781.1|  hypothetical protein MIMGU_mgv1a004696mg                229   1e-68   Erythranthe guttata [common monkey flower]
ref|XP_002532210.1|  Ribulose-1,5 bisphosphate carboxylase/oxygen...    227   5e-68   Ricinus communis
ref|XP_010088354.1|  Ribulose-1,5 bisphosphate carboxylase/oxygen...    228   6e-68   
ref|XP_003542190.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    226   1e-67   Glycine max [soybeans]
ref|XP_004243586.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    221   1e-65   Solanum lycopersicum
gb|KHG30782.1|  Ribulose-1,5 bisphosphate carboxylase/oxygenase l...    220   2e-65   Gossypium arboreum [tree cotton]
ref|XP_004502116.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    218   1e-64   Cicer arietinum [garbanzo]
ref|XP_010048281.1|  PREDICTED: LOW QUALITY PROTEIN: ribulose-1,5...    218   1e-64   Eucalyptus grandis [rose gum]
gb|KJB10233.1|  hypothetical protein B456_001G190900                    218   1e-64   Gossypium raimondii
ref|XP_010689223.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    218   1e-64   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB10232.1|  hypothetical protein B456_001G190900                    218   5e-64   Gossypium raimondii
ref|XP_007049391.1|  Rubisco methyltransferase family protein iso...    216   1e-63   Theobroma cacao [chocolate]
ref|XP_003601528.1|  SET domain-containing protein                      213   1e-62   Medicago truncatula
ref|XP_006407809.1|  hypothetical protein EUTSA_v10020552mg             213   1e-62   Eutrema salsugineum [saltwater cress]
ref|XP_010486336.1|  PREDICTED: histone-lysine N-methyltransferas...    213   1e-62   Camelina sativa [gold-of-pleasure]
ref|XP_003605258.1|  SET domain-containing protein                      213   1e-62   
gb|KFK38228.1|  hypothetical protein AALP_AA3G085300                    213   2e-62   Arabis alpina [alpine rockcress]
ref|XP_007146016.1|  hypothetical protein PHAVU_006G005700g             212   2e-62   Phaseolus vulgaris [French bean]
ref|XP_006297498.1|  hypothetical protein CARUB_v10013517mg             212   3e-62   
ref|XP_010456598.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    212   4e-62   Camelina sativa [gold-of-pleasure]
ref|XP_002882542.1|  SET domain-containing protein                      211   1e-61   Arabidopsis lyrata subsp. lyrata
ref|XP_010464405.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    210   1e-61   Camelina sativa [gold-of-pleasure]
ref|NP_187424.1|  Rubisco methyltransferase family protein              209   2e-61   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61650.1|  putative ribulose-1,5-bisphosphate carboxylase/ox...    208   7e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010524627.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    206   4e-60   Tarenaya hassleriana [spider flower]
ref|XP_008802702.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    205   8e-60   Phoenix dactylifera
gb|AAC14296.1|  putative methyltransferase                              206   9e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008802701.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    205   1e-59   Phoenix dactylifera
ref|XP_010942853.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    202   2e-59   Elaeis guineensis
ref|XP_009124214.1|  PREDICTED: histone-lysine N-methyltransferas...    204   3e-59   Brassica rapa
ref|XP_010942854.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    202   3e-59   Elaeis guineensis
ref|XP_009391784.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    204   3e-59   
ref|XP_010942848.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    203   8e-59   
emb|CDY22127.1|  BnaC01g39740D                                          203   8e-59   Brassica napus [oilseed rape]
gb|KJB22702.1|  hypothetical protein B456_004G061300                    197   4e-58   Gossypium raimondii
ref|XP_006857756.1|  hypothetical protein AMTR_s00061p00196800          201   5e-58   Amborella trichopoda
gb|KJB22703.1|  hypothetical protein B456_004G061300                    198   4e-57   Gossypium raimondii
ref|XP_002454362.1|  hypothetical protein SORBIDRAFT_04g029430          198   5e-57   Sorghum bicolor [broomcorn]
ref|XP_004953752.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    197   9e-57   
gb|AFW63677.1|  hypothetical protein ZEAMMB73_839660                    192   1e-56   
ref|NP_001140387.1|  uncharacterized protein LOC100272441               194   2e-55   Zea mays [maize]
gb|KHG10408.1|  Ribulose-1,5 bisphosphate carboxylase/oxygenase l...    192   4e-55   Gossypium arboreum [tree cotton]
ref|XP_006649004.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    193   7e-55   
gb|ACG45124.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    192   8e-55   Zea mays [maize]
dbj|BAJ90575.1|  predicted protein                                      187   5e-53   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS68033.1|  Ribulose-1,5 bisphosphate carboxylase/oxygenase l...    187   7e-53   Triticum urartu
ref|XP_010236007.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    186   2e-52   Brachypodium distachyon [annual false brome]
gb|EEC73918.1|  hypothetical protein OsI_08761                          181   1e-50   Oryza sativa Indica Group [Indian rice]
ref|NP_001047982.1|  Os02g0725200                                       181   1e-50   
gb|EMT07134.1|  hypothetical protein F775_17280                         175   6e-48   
gb|KHN39942.1|  Ribulose-1,5 bisphosphate carboxylase/oxygenase l...    159   4e-43   Glycine soja [wild soybean]
ref|XP_008246184.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    150   3e-42   Prunus mume [ume]
ref|XP_002963244.1|  hypothetical protein SELMODRAFT_80789              138   5e-35   
ref|XP_001754252.1|  predicted protein                                  137   1e-34   
ref|XP_002974548.1|  hypothetical protein SELMODRAFT_101776             136   3e-34   
gb|KCW89043.1|  hypothetical protein EUGRSUZ_A01370                     133   3e-33   Eucalyptus grandis [rose gum]
gb|KCW89045.1|  hypothetical protein EUGRSUZ_A01370                     133   4e-33   Eucalyptus grandis [rose gum]
emb|CDY71476.1|  BnaCnng73100D                                        87.8    1e-18   Brassica napus [oilseed rape]
gb|KCW89046.1|  hypothetical protein EUGRSUZ_A01370                   87.0    7e-17   Eucalyptus grandis [rose gum]
ref|XP_010689224.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  87.0    8e-17   
ref|XP_005649983.1|  ResB-domain-containing protein                   79.0    2e-13   Coccomyxa subellipsoidea C-169
emb|CDX78685.1|  BnaA03g05970D                                        62.8    2e-09   
emb|CDY06579.1|  BnaC02g13030D                                        62.0    3e-09   
ref|XP_001419603.1|  predicted protein                                60.1    2e-07   Ostreococcus lucimarinus CCE9901
ref|XP_003081307.1|  putative methyltransferase (ISS)                 57.0    2e-06   
emb|CEF99133.1|  Rubisco LS methyltransferase, substrate-binding ...  57.0    2e-06   Ostreococcus tauri
ref|XP_002505573.1|  set domain protein                               56.2    3e-06   Micromonas commoda
ref|XP_002945653.1|  hypothetical protein VOLCADRAFT_120141           53.5    4e-06   Volvox carteri f. nagariensis
ref|XP_007510589.1|  predicted protein                                55.1    7e-06   Bathycoccus prasinos
ref|XP_008617921.1|  hypothetical protein SDRG_13603                  53.5    2e-05   Saprolegnia diclina VS20
ref|XP_005850299.1|  hypothetical protein CHLNCDRAFT_142047           52.4    6e-05   Chlorella variabilis
ref|XP_008607111.1|  hypothetical protein SDRG_03258                  52.0    7e-05   Saprolegnia diclina VS20
ref|XP_008179710.1|  PREDICTED: uncharacterized protein LOC103308320  51.2    1e-04   
ref|XP_008551338.1|  PREDICTED: SET domain-containing protein 4 i...  50.1    3e-04   
gb|KDO26770.1|  hypothetical protein SPRG_20573                       50.1    4e-04   Saprolegnia parasitica CBS 223.65
ref|WP_043409385.1|  hypothetical protein                             50.1    4e-04   
ref|XP_008551336.1|  PREDICTED: SET domain-containing protein 4 i...  49.7    4e-04   
gb|EJY74649.1|  SET domain containing protein                         50.1    4e-04   Oxytricha trifallax
ref|XP_008551335.1|  PREDICTED: SET domain-containing protein 4 i...  49.7    5e-04   
ref|XP_001774765.1|  predicted protein                                49.7    5e-04   
gb|ETL26697.1|  hypothetical protein L916_19665                       49.7    6e-04   Phytophthora parasitica
gb|ETK73260.1|  hypothetical protein L915_19780                       49.7    6e-04   Phytophthora parasitica
gb|ETP02735.1|  hypothetical protein F441_20218                       49.3    7e-04   Phytophthora parasitica CJ01A1
ref|XP_010203409.1|  PREDICTED: SET domain-containing protein 4       48.5    8e-04   Colius striatus



>ref|XP_009795542.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Nicotiana sylvestris]
Length=510

 Score =   252 bits (643),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 143/185 (77%), Gaps = 11/185 (6%)
 Frame = +2

Query  50   MPEASTIFQSTLLPPFSQS----RRALSSPICHTFFRRNPTSFTTI--RCSS-----VST  196
            M EAS I QS  LPPFS +    R  L     +TF RRN T+  TI  RCSS      +T
Sbjct  1    MAEASRILQSGFLPPFSHNSPSHRTTLHFNSSYTFHRRNSTTPNTINIRCSSSVSAAETT  60

Query  197  EAAKIQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEK  376
            +  K + VPWGCD DSL+NAS LQKWLSDSG+P QKM IQRVD+GERGLVALKNIRKGEK
Sbjct  61   KPTKAENVPWGCDIDSLENASTLQKWLSDSGLPDQKMGIQRVDVGERGLVALKNIRKGEK  120

Query  377  LLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALP  556
            LLFVPPSLVITADS+WS P+AG VLK+Y VPDWP +ATYLISEASL+KSSRWSNYISALP
Sbjct  121  LLFVPPSLVITADSKWSNPEAGAVLKQYNVPDWPFLATYLISEASLMKSSRWSNYISALP  180

Query  557  TQPYS  571
             QPYS
Sbjct  181  RQPYS  185



>ref|XP_009588489.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=217

 Score =   241 bits (614),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 137/185 (74%), Gaps = 11/185 (6%)
 Frame = +2

Query  50   MPEASTIFQSTLLPPFSQS----RRALSSPICHTFFRRNPTS--FTTIRCSS-----VST  196
            M EAS I QS  LP F  +    R  L     +TF RRN T+     IRCSS      +T
Sbjct  1    MAEASRILQSGFLPHFPHNSPSHRTTLHFNSSYTFHRRNNTTPNLINIRCSSSISAAETT  60

Query  197  EAAKIQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEK  376
            +  K +  PWGCD DSL+NAS LQKWLSDSG+P QKM IQRVD+GERGLVALKNIRKGEK
Sbjct  61   KPTKTENFPWGCDIDSLENASTLQKWLSDSGLPEQKMGIQRVDVGERGLVALKNIRKGEK  120

Query  377  LLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALP  556
            LLFVPPSLVITADS+WS P+ G VLK+Y VPDWP +ATYLISEASL+K SRWSNYISALP
Sbjct  121  LLFVPPSLVITADSKWSNPEVGAVLKQYNVPDWPFLATYLISEASLMKYSRWSNYISALP  180

Query  557  TQPYS  571
             QPYS
Sbjct  181  RQPYS  185



>ref|XP_006357659.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Solanum 
tuberosum]
Length=504

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 141/180 (78%), Gaps = 7/180 (4%)
 Frame = +2

Query  50   MPEASTIFQSTLLPPFSQSRRALSSPICHTF--FRRNPTSFTTIRCSSVSTEAA----KI  211
            M E S I QS LLPPFS     +++    ++  +RRN  + + IRCSS+ST  A    K 
Sbjct  1    MAEVSRILQSVLLPPFSNKLDGITNSHFSSYKLYRRNKLNIS-IRCSSISTTEATKSTKT  59

Query  212  QTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVP  391
            Q +PWGC+TDSL+NAS LQKWLS+SG+P QKM +QRVD+GERGLVA  NIRKGEKLLFVP
Sbjct  60   QNIPWGCETDSLENASNLQKWLSESGLPSQKMDLQRVDVGERGLVANNNIRKGEKLLFVP  119

Query  392  PSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  571
            PSLVITADS+WS  DAG VLK+Y VPDWP IATYLISEASL+KSSRWSNYISALP QPYS
Sbjct  120  PSLVITADSKWSNSDAGDVLKQYNVPDWPFIATYLISEASLMKSSRWSNYISALPRQPYS  179



>ref|XP_008342255.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Malus domestica]
 ref|XP_008353614.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Malus domestica]
 ref|XP_008362320.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Malus domestica]
Length=497

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 141/183 (77%), Gaps = 20/183 (11%)
 Frame = +2

Query  50   MPEASTIFQSTLLPPFSQSRRALSSPICHTF------FRRNPTSFTTIRCSSVSTEAAKI  211
            M EAS + Q+TLLP F    +       HTF      FRRNP     ++CS  +T+ AK 
Sbjct  1    MAEASRVLQTTLLPTFHPQHK------IHTFHSLPLNFRRNP-----VQCSVSTTDGAKA  49

Query  212  ---QTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLL  382
               Q +PWGCD DSL+NASALQKWL+DSG+PPQKMAI++V++GERGLVALKNIRKGEKLL
Sbjct  50   TVAQKIPWGCDIDSLENASALQKWLTDSGLPPQKMAIEKVEVGERGLVALKNIRKGEKLL  109

Query  383  FVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQ  562
            FVPPSL ITADSEW+  +AG+VLK+ GVPDWP +ATYLISEAS ++SSRWSNYISALP Q
Sbjct  110  FVPPSLFITADSEWTCGEAGEVLKKNGVPDWPFLATYLISEASYLQSSRWSNYISALPRQ  169

Query  563  PYS  571
            PYS
Sbjct  170  PYS  172



>ref|XP_009361534.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Pyrus x bretschneideri]
Length=497

 Score =   240 bits (613),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 141/183 (77%), Gaps = 20/183 (11%)
 Frame = +2

Query  50   MPEASTIFQSTLLPPFSQSRRALSSPICHTF------FRRNPTSFTTIRCSSVSTEAAKI  211
            M EAS + Q+TLLP F    +       HTF      FRR+P     ++CS  +T+ AK 
Sbjct  1    MAEASRVLQTTLLPTFHPQHK------IHTFHSLPLNFRRHP-----VQCSVSTTDGAKA  49

Query  212  ---QTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLL  382
               Q +PWGCD DSL+NASALQKWL+DSG+PPQKMAIQ+V++GERGLVALKNIRKGEKLL
Sbjct  50   TVAQKIPWGCDIDSLENASALQKWLTDSGLPPQKMAIQKVEVGERGLVALKNIRKGEKLL  109

Query  383  FVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQ  562
            FVPPSL ITADSEW+  +AG+VLK+ GVPDWP +ATYLISEAS ++SSRWSNYISALP Q
Sbjct  110  FVPPSLFITADSEWTCGEAGEVLKKNGVPDWPFLATYLISEASYLQSSRWSNYISALPRQ  169

Query  563  PYS  571
            PYS
Sbjct  170  PYS  172



>ref|XP_008245622.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Prunus 
mume]
 ref|XP_008245623.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Prunus 
mume]
 ref|XP_008245624.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Prunus 
mume]
Length=308

 Score =   232 bits (591),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 141/177 (80%), Gaps = 8/177 (5%)
 Frame = +2

Query  50   MPEASTIFQSTLLPPFSQSRRALSSPICHTF---FRRNPTSFTTIRCSSVSTEAAKIQTV  220
            M EAS + Q+TL+P F    +   SPI  +    FRRNP   T    +S ST+A   Q +
Sbjct  1    MAEASRVLQTTLIPSFHPQHK---SPIFQSLPLNFRRNPIQCTV--STSNSTKATVPQKI  55

Query  221  PWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSL  400
            PWGC++DSL+NASALQKWL+DSG+PPQKMA+++V++GERGLVALKNIRKGEKLLFVPPSL
Sbjct  56   PWGCESDSLENASALQKWLTDSGLPPQKMALKKVEVGERGLVALKNIRKGEKLLFVPPSL  115

Query  401  VITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  571
             ITADSEW+  +AG+VLK+ GVPDWP +ATYLISEAS ++SSRWSNYISALP QPYS
Sbjct  116  FITADSEWTCGEAGKVLKQNGVPDWPFLATYLISEASSLESSRWSNYISALPRQPYS  172



>ref|XP_004144553.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004164054.1| PREDICTED: LOW QUALITY PROTEIN: ribulose-1,5 bisphosphate carboxylase/oxygenase 
large subunit N-methyltransferase, chloroplastic-like 
[Cucumis sativus]
 gb|KGN43400.1| hypothetical protein Csa_7G031610 [Cucumis sativus]
Length=497

 Score =   237 bits (605),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 142/177 (80%), Gaps = 8/177 (5%)
 Frame = +2

Query  50   MPEASTIFQSTLLPPFSQSRRALSSPICHTFFRRNPTSFTTIRCSSVSTEAAKIQT---V  220
            M EAS +F S+LLP F   +  LS+      FRR+     +I CS  +T+ A++     +
Sbjct  1    MAEASRVFNSSLLPNFRPLQNTLSTKPHTATFRRH-----SINCSVSTTDGARVAATGPI  55

Query  221  PWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSL  400
            PWGC+ DSL+NASALQKWLS+SG+P QKM+IQRV++GERGLVALKN+RKGEKLLFVPPSL
Sbjct  56   PWGCEIDSLENASALQKWLSESGLPDQKMSIQRVNVGERGLVALKNVRKGEKLLFVPPSL  115

Query  401  VITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  571
            VI+A+SEWS P+AG+VLKR  VPDWPLIATYLISEASL+KSSRW+NYISALP QPYS
Sbjct  116  VISAESEWSCPEAGEVLKRNSVPDWPLIATYLISEASLMKSSRWNNYISALPRQPYS  172



>ref|XP_008462040.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Cucumis melo]
Length=497

 Score =   237 bits (605),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 141/177 (80%), Gaps = 8/177 (5%)
 Frame = +2

Query  50   MPEASTIFQSTLLPPFSQSRRALSSPICHTFFRRNPTSFTTIRCSSVSTEAAKIQT---V  220
            M EAS +F S+L+P F   +   S+      FRR+     +I CS  +T+ A++     +
Sbjct  1    MAEASRVFNSSLVPNFRPLQYTHSTKPHAATFRRH-----SINCSVSTTDTARVAATGPI  55

Query  221  PWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSL  400
            PWGCD DSL+NASALQKWLS+SG+P QKM+IQRVD+GERGLVALKN+RKGEKLLFVPPSL
Sbjct  56   PWGCDIDSLENASALQKWLSESGLPDQKMSIQRVDVGERGLVALKNVRKGEKLLFVPPSL  115

Query  401  VITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  571
            VI+A+SEWS P+AG+VLKR  VPDWPLIATYLISEASL+KSSRWSNYISALP QPYS
Sbjct  116  VISAESEWSCPEAGEVLKRNSVPDWPLIATYLISEASLMKSSRWSNYISALPRQPYS  172



>gb|KDO50965.1| hypothetical protein CISIN_1g010607mg [Citrus sinensis]
Length=359

 Score =   233 bits (594),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 138/181 (76%), Gaps = 7/181 (4%)
 Frame = +2

Query  50   MPEASTIFQSTLLPPFSQSRRALSSPICHTFFRRNPTSFTTIRCS-SVSTEAAKIQT---  217
            M EAS  F + LLP FS   +A S      F R+       + CS S + +A++ +T   
Sbjct  1    MAEASRTFHTILLPSFSHLHKAQSPAGFTDFPRKRCGHRIVVHCSVSTTNDASRTKTTVT  60

Query  218  ---VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFV  388
               +PWGC+ DSL+NAS LQKWLSDSG+PPQKMAIQ+VD+GERGLVALKNIRKGEKLLFV
Sbjct  61   QNMIPWGCEIDSLENASTLQKWLSDSGLPPQKMAIQKVDVGERGLVALKNIRKGEKLLFV  120

Query  389  PPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPY  568
            PPSLVITADS+WS P+AG+VLK+  VPDWPL+ATYLISEAS  KSSRWSNYISALP QPY
Sbjct  121  PPSLVITADSKWSCPEAGEVLKQCSVPDWPLLATYLISEASFEKSSRWSNYISALPRQPY  180

Query  569  S  571
            S
Sbjct  181  S  181



>ref|XP_007215270.1| hypothetical protein PRUPE_ppa004667mg [Prunus persica]
 gb|EMJ16469.1| hypothetical protein PRUPE_ppa004667mg [Prunus persica]
Length=497

 Score =   237 bits (604),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 141/177 (80%), Gaps = 8/177 (5%)
 Frame = +2

Query  50   MPEASTIFQSTLLPPFSQSRRALSSPICHTF---FRRNPTSFTTIRCSSVSTEAAKIQTV  220
            M EAS + Q+TL+P F    R   SPI  +    FRRNP   T    +S ST+A   Q +
Sbjct  1    MAEASRVLQTTLIPSFHPQHR---SPIFQSLPLNFRRNPIQCTV--STSNSTKATVPQKI  55

Query  221  PWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSL  400
            PWGC++DSL+NASALQKWL+DSG+PPQKMA+Q+V++GERGLVALKNIRKGEKLLFVPPSL
Sbjct  56   PWGCESDSLENASALQKWLTDSGLPPQKMALQKVEVGERGLVALKNIRKGEKLLFVPPSL  115

Query  401  VITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  571
             ITADSEW+  +AG+VLK+ GVPDWP +ATYLISEAS ++SSRWSNYISALP QPYS
Sbjct  116  FITADSEWTCGEAGKVLKQNGVPDWPFLATYLISEASSLESSRWSNYISALPRQPYS  172



>ref|XP_004305682.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Fragaria vesca 
subsp. vesca]
Length=498

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 137/180 (76%), Gaps = 13/180 (7%)
 Frame = +2

Query  50   MPEASTIFQSTLLPPFSQSRRALSSPICHTF------FRRNPTSFTTIRCSSVSTEAAKI  211
            M E S I QSTL+P F       S P  HTF      F+R+P    +I  +  +T+A   
Sbjct  1    MAEVSRILQSTLIPSFH------SHPKTHTFQSHPPSFKRHPVQ-CSISTTESTTKATVS  53

Query  212  QTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVP  391
            Q +PWGCD DSL+NASALQKWL+DSG+PPQKM IQ+VD+GERGLVALKNIRKGEKLLFVP
Sbjct  54   QNIPWGCDIDSLENASALQKWLTDSGLPPQKMGIQKVDVGERGLVALKNIRKGEKLLFVP  113

Query  392  PSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  571
            PSL ITADSEW+  +AG+V+K+  VPDWPL+ATYLISEAS +KSSRWSNYI ALP QPYS
Sbjct  114  PSLFITADSEWTCREAGKVMKKNSVPDWPLLATYLISEASYLKSSRWSNYIDALPRQPYS  173



>gb|KDO50964.1| hypothetical protein CISIN_1g010607mg [Citrus sinensis]
Length=397

 Score =   233 bits (593),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 138/181 (76%), Gaps = 7/181 (4%)
 Frame = +2

Query  50   MPEASTIFQSTLLPPFSQSRRALSSPICHTFFRRNPTSFTTIRCS-SVSTEAAKIQT---  217
            M EAS  F + LLP FS   +A S      F R+       + CS S + +A++ +T   
Sbjct  1    MAEASRTFHTILLPSFSHLHKAQSPAGFTDFPRKRCGHRIVVHCSVSTTNDASRTKTTVT  60

Query  218  ---VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFV  388
               +PWGC+ DSL+NAS LQKWLSDSG+PPQKMAIQ+VD+GERGLVALKNIRKGEKLLFV
Sbjct  61   QNMIPWGCEIDSLENASTLQKWLSDSGLPPQKMAIQKVDVGERGLVALKNIRKGEKLLFV  120

Query  389  PPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPY  568
            PPSLVITADS+WS P+AG+VLK+  VPDWPL+ATYLISEAS  KSSRWSNYISALP QPY
Sbjct  121  PPSLVITADSKWSCPEAGEVLKQCSVPDWPLLATYLISEASFEKSSRWSNYISALPRQPY  180

Query  569  S  571
            S
Sbjct  181  S  181



>gb|KDP29954.1| hypothetical protein JCGZ_18523 [Jatropha curcas]
Length=502

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 141/184 (77%), Gaps = 17/184 (9%)
 Frame = +2

Query  50   MPEASTIFQSTLLPPFS--QSRRALSSP--ICHTFFRRNPTSFTTIRCSSVSTEAA----  205
            M +AS +FQ TL P FS     R LS+   I H         + TIRCS  ++++A    
Sbjct  1    MAKASRVFQPTLFPTFSTLHKPRTLSNAPTIIHK-------KYPTIRCSVSTSDSAIREA  53

Query  206  --KIQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKL  379
                Q VPWGCD DSL+NA+ALQKWLSDSG+PPQKMAI++V++GERGLVALKNIRKGEKL
Sbjct  54   TSATQKVPWGCDIDSLENAAALQKWLSDSGLPPQKMAIEKVEVGERGLVALKNIRKGEKL  113

Query  380  LFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPT  559
            LFVPP LVITADSEWS P+AG+VLK+Y VPDWP +ATYLISEASL +SSRWSNYISALP 
Sbjct  114  LFVPPPLVITADSEWSCPEAGEVLKQYSVPDWPFLATYLISEASLNQSSRWSNYISALPR  173

Query  560  QPYS  571
            QPYS
Sbjct  174  QPYS  177



>gb|KDO50963.1| hypothetical protein CISIN_1g010607mg [Citrus sinensis]
Length=442

 Score =   233 bits (595),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 138/181 (76%), Gaps = 7/181 (4%)
 Frame = +2

Query  50   MPEASTIFQSTLLPPFSQSRRALSSPICHTFFRRNPTSFTTIRCS-SVSTEAAKIQT---  217
            M EAS  F + LLP FS   +A S      F R+       + CS S + +A++ +T   
Sbjct  1    MAEASRTFHTILLPSFSHLHKAQSPAGFTDFPRKRCGHRIVVHCSVSTTNDASRTKTTVT  60

Query  218  ---VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFV  388
               +PWGC+ DSL+NAS LQKWLSDSG+PPQKMAIQ+VD+GERGLVALKNIRKGEKLLFV
Sbjct  61   QNMIPWGCEIDSLENASTLQKWLSDSGLPPQKMAIQKVDVGERGLVALKNIRKGEKLLFV  120

Query  389  PPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPY  568
            PPSLVITADS+WS P+AG+VLK+  VPDWPL+ATYLISEAS  KSSRWSNYISALP QPY
Sbjct  121  PPSLVITADSKWSCPEAGEVLKQCSVPDWPLLATYLISEASFEKSSRWSNYISALPRQPY  180

Query  569  S  571
            S
Sbjct  181  S  181



>ref|XP_002320530.2| hypothetical protein POPTR_0014s16720g [Populus trichocarpa]
 gb|EEE98845.2| hypothetical protein POPTR_0014s16720g [Populus trichocarpa]
Length=561

 Score =   236 bits (602),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 146/199 (73%), Gaps = 17/199 (9%)
 Frame = +2

Query  17   CLLASLPRS-------SAMPEA-STIFQSTLLPPF-----SQSRRALSSPICHTFFRRNP  157
            C L+S+ RS       + M EA   I  +T LP       +  + + S P  H   +R+P
Sbjct  41   CFLSSVSRSVQWCTLCTDMAEACRIILNTTFLPSLHSLHKTHKKVSYSQPFLH---KRHP  97

Query  158  TSFTTIRCSSVSTEAAKI-QTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGE  334
                +I  SS +  AAK+ +TVPWGCD DSL+NA ALQKWLSDSG+PPQKMAIQ+V++GE
Sbjct  98   AIQCSISTSSDTKAAAKVSETVPWGCDIDSLENAEALQKWLSDSGLPPQKMAIQKVEVGE  157

Query  335  RGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASL  514
            RGLVALKNIRKGE LLFVPPSLVI ADSEWS P+AG+VLK+Y VPDWPL+ATYLISEAS 
Sbjct  158  RGLVALKNIRKGEMLLFVPPSLVIAADSEWSCPEAGEVLKKYSVPDWPLLATYLISEASF  217

Query  515  IKSSRWSNYISALPTQPYS  571
             KSSRWSNYISALP QPYS
Sbjct  218  EKSSRWSNYISALPRQPYS  236



>ref|XP_011100518.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X2 [Sesamum 
indicum]
Length=403

 Score =   231 bits (590),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 137/183 (75%), Gaps = 9/183 (5%)
 Frame = +2

Query  50   MPEASTIFQSTLLPPFSQ--SRRALSSPICHTF---FRRNPTSFTTIRCS----SVSTEA  202
            M EAS I Q+TL+  FSQ  S+  L +   H       +    F  IRCS    S   E+
Sbjct  1    MAEASRILQTTLISTFSQNPSQYTLKAHSHHYIPPSTSKRSNLFHRIRCSVSTASTGGES  60

Query  203  AKIQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLL  382
            A   T+PWGCD +SL+NASALQ+WLS  G+PPQKMAIQRVD+GERGLVALKNIRKGEKLL
Sbjct  61   ATGTTIPWGCDVESLENASALQEWLSKCGLPPQKMAIQRVDVGERGLVALKNIRKGEKLL  120

Query  383  FVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQ  562
            FVPPSL ITADSEWS  +AG+VLK+Y VPDWPL+ATYLISEA L+ SSRWSNYISALP Q
Sbjct  121  FVPPSLFITADSEWSCREAGEVLKQYNVPDWPLLATYLISEAGLMNSSRWSNYISALPRQ  180

Query  563  PYS  571
            PYS
Sbjct  181  PYS  183



>ref|XP_010252799.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Nelumbo 
nucifera]
Length=502

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 143/185 (77%), Gaps = 19/185 (10%)
 Frame = +2

Query  50   MPEASTIFQSTLLPPFSQ----SRRALSSPICHTFFRRNPTSFTTIRCS--SVSTEAAKI  211
            M EAST   +TL+P FSQ    SRR  + P       RN     +IRCS  + S ++ + 
Sbjct  1    MAEASTSLYTTLIPHFSQNPSPSRRTSALPTARD---RN-----SIRCSISATSNDSTRA  52

Query  212  -----QTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEK  376
                 Q +PWGCD DSL+NASALQKWLS+SG+PPQKMAI++VDIGERGLVALKNIRKGEK
Sbjct  53   LVSVSQKIPWGCDVDSLENASALQKWLSESGLPPQKMAIEKVDIGERGLVALKNIRKGEK  112

Query  377  LLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALP  556
            LLF+PPSLVITADSEWS P+ G+VLKR  VPDWPL+ATYLISEAS++KSSRWSNYISALP
Sbjct  113  LLFIPPSLVITADSEWSCPEVGEVLKRNFVPDWPLLATYLISEASIMKSSRWSNYISALP  172

Query  557  TQPYS  571
             QPYS
Sbjct  173  RQPYS  177



>ref|XP_008229941.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Prunus mume]
Length=497

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 141/177 (80%), Gaps = 8/177 (5%)
 Frame = +2

Query  50   MPEASTIFQSTLLPPFSQSRRALSSPICHTF---FRRNPTSFTTIRCSSVSTEAAKIQTV  220
            M EAS + Q+TL+P F    +   SPI  +    FRRNP   T    +S ST+A   Q +
Sbjct  1    MAEASRVLQTTLIPSFHPQHK---SPIFQSLPLNFRRNPIQCTV--STSNSTKATVPQKI  55

Query  221  PWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSL  400
            PWGC++DSL+NASALQKWL+DSG+PPQKMA+++V++GERGLVALKNIRKGEKLLFVPPSL
Sbjct  56   PWGCESDSLENASALQKWLTDSGLPPQKMALKKVEVGERGLVALKNIRKGEKLLFVPPSL  115

Query  401  VITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  571
             ITADSEW+  +AG+VLK+ GVPDWP +ATYLISEAS ++SSRWSNYISALP QPYS
Sbjct  116  FITADSEWTCGEAGKVLKQNGVPDWPFLATYLISEASSLESSRWSNYISALPRQPYS  172



>ref|XP_006447826.1| hypothetical protein CICLE_v10014974mg [Citrus clementina]
 ref|XP_006469428.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Citrus 
sinensis]
 gb|ESR61066.1| hypothetical protein CICLE_v10014974mg [Citrus clementina]
Length=506

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 138/181 (76%), Gaps = 7/181 (4%)
 Frame = +2

Query  50   MPEASTIFQSTLLPPFSQSRRALSSPICHTFFRRNPTSFTTIRCS-SVSTEAAKIQT---  217
            M EAS  F + LLP FS   +A S      F R+       + CS S + +A++ +T   
Sbjct  1    MAEASRTFHTILLPSFSHLHKAQSPAGFTAFPRKRCGHRIVVHCSVSTTNDASRTKTTVT  60

Query  218  ---VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFV  388
               +PWGC+ DSL+NAS LQKWLSDSG+PPQKMAIQ+VD+GERGLVALKNIRKGEKLLFV
Sbjct  61   QNMIPWGCEIDSLENASTLQKWLSDSGLPPQKMAIQKVDVGERGLVALKNIRKGEKLLFV  120

Query  389  PPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPY  568
            PPSLVITADS+WS P+AG+VLK+  VPDWPL+ATYLISEAS  KSSRWSNYISALP QPY
Sbjct  121  PPSLVITADSKWSCPEAGEVLKQCSVPDWPLLATYLISEASFEKSSRWSNYISALPRQPY  180

Query  569  S  571
            S
Sbjct  181  S  181



>gb|KDO50961.1| hypothetical protein CISIN_1g010607mg [Citrus sinensis]
Length=506

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 138/181 (76%), Gaps = 7/181 (4%)
 Frame = +2

Query  50   MPEASTIFQSTLLPPFSQSRRALSSPICHTFFRRNPTSFTTIRCS-SVSTEAAKIQT---  217
            M EAS  F + LLP FS   +A S      F R+       + CS S + +A++ +T   
Sbjct  1    MAEASRTFHTILLPSFSHLHKAQSPAGFTDFPRKRCGHRIVVHCSVSTTNDASRTKTTVT  60

Query  218  ---VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFV  388
               +PWGC+ DSL+NAS LQKWLSDSG+PPQKMAIQ+VD+GERGLVALKNIRKGEKLLFV
Sbjct  61   QNMIPWGCEIDSLENASTLQKWLSDSGLPPQKMAIQKVDVGERGLVALKNIRKGEKLLFV  120

Query  389  PPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPY  568
            PPSLVITADS+WS P+AG+VLK+  VPDWPL+ATYLISEAS  KSSRWSNYISALP QPY
Sbjct  121  PPSLVITADSKWSCPEAGEVLKQCSVPDWPLLATYLISEASFEKSSRWSNYISALPRQPY  180

Query  569  S  571
            S
Sbjct  181  S  181



>ref|XP_011100517.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X1 [Sesamum 
indicum]
Length=508

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 137/183 (75%), Gaps = 9/183 (5%)
 Frame = +2

Query  50   MPEASTIFQSTLLPPFSQ--SRRALSSPICHTF---FRRNPTSFTTIRCS----SVSTEA  202
            M EAS I Q+TL+  FSQ  S+  L +   H       +    F  IRCS    S   E+
Sbjct  1    MAEASRILQTTLISTFSQNPSQYTLKAHSHHYIPPSTSKRSNLFHRIRCSVSTASTGGES  60

Query  203  AKIQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLL  382
            A   T+PWGCD +SL+NASALQ+WLS  G+PPQKMAIQRVD+GERGLVALKNIRKGEKLL
Sbjct  61   ATGTTIPWGCDVESLENASALQEWLSKCGLPPQKMAIQRVDVGERGLVALKNIRKGEKLL  120

Query  383  FVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQ  562
            FVPPSL ITADSEWS  +AG+VLK+Y VPDWPL+ATYLISEA L+ SSRWSNYISALP Q
Sbjct  121  FVPPSLFITADSEWSCREAGEVLKQYNVPDWPLLATYLISEAGLMNSSRWSNYISALPRQ  180

Query  563  PYS  571
            PYS
Sbjct  181  PYS  183



>emb|CBI28466.3| unnamed protein product [Vitis vinifera]
Length=497

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 139/181 (77%), Gaps = 16/181 (9%)
 Frame = +2

Query  50   MPEASTIFQSTL---LPP-FSQSRRALSSPICHTFFRRNPTSFTTIRCSSVSTEAAKI--  211
            M EA  +F + L   LPP FSQ+    S PI     RR+P     IRCS  +T+ AK   
Sbjct  1    MAEACRMFHTALTLTLPPSFSQTPSRHSQPIP----RRHP-----IRCSISTTDTAKTSV  51

Query  212  -QTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFV  388
             Q +PWGC+ DSL+NA+ LQKWLSDSG+PPQKM I+RV++GERGLVALKNIRKGEKLLFV
Sbjct  52   TQKIPWGCEVDSLENAALLQKWLSDSGLPPQKMGIERVEVGERGLVALKNIRKGEKLLFV  111

Query  389  PPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPY  568
            PPSLVITADSEWS  +AG+VLKR  VPDWPL+ATYLI EAS ++SSRWSNYISALP QPY
Sbjct  112  PPSLVITADSEWSCTEAGEVLKRNSVPDWPLLATYLIGEASFMQSSRWSNYISALPRQPY  171

Query  569  S  571
            S
Sbjct  172  S  172



>ref|XP_002267469.2| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Vitis vinifera]
Length=577

 Score =   231 bits (588),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 141/183 (77%), Gaps = 16/183 (9%)
 Frame = +2

Query  44   SAMPEASTIFQSTL---LPP-FSQSRRALSSPICHTFFRRNPTSFTTIRCSSVSTEAAKI  211
            ++M EA  +F + L   LPP FSQ+    S PI     RR+P     IRCS  +T+ AK 
Sbjct  79   ASMAEACRMFHTALTLTLPPSFSQTPSRHSQPIP----RRHP-----IRCSISTTDTAKT  129

Query  212  ---QTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLL  382
               Q +PWGC+ DSL+NA+ LQKWLSDSG+PPQKM I+RV++GERGLVALKNIRKGEKLL
Sbjct  130  SVTQKIPWGCEVDSLENAALLQKWLSDSGLPPQKMGIERVEVGERGLVALKNIRKGEKLL  189

Query  383  FVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQ  562
            FVPPSLVITADSEWS  +AG+VLKR  VPDWPL+ATYLI EAS ++SSRWSNYISALP Q
Sbjct  190  FVPPSLVITADSEWSCTEAGEVLKRNSVPDWPLLATYLIGEASFMQSSRWSNYISALPRQ  249

Query  563  PYS  571
            PYS
Sbjct  250  PYS  252



>ref|XP_011008074.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Populus euphratica]
Length=503

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 136/178 (76%), Gaps = 4/178 (2%)
 Frame = +2

Query  50   MPEASTIFQSTLLPPFSQSRRALSSPI-CHTFF--RRNPTSFTTIRCSSVSTEAAKI-QT  217
            M EA  I  +T   P   S       + C   F  +R+P    +I  SS +  AAK+ +T
Sbjct  1    MAEACRIILNTTFRPSLHSLHKTQKKVSCSQPFLPKRHPAIQCSISTSSDTKAAAKVSET  60

Query  218  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  397
            VPWGCD DSL+NA ALQKWLSDSG+PPQKMAIQ+V++GERGLVALKNIRKGE LLFVPPS
Sbjct  61   VPWGCDIDSLENAEALQKWLSDSGLPPQKMAIQKVEVGERGLVALKNIRKGEMLLFVPPS  120

Query  398  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  571
            LVI+ADSEWS P+AG+VLK+Y VPDWPL+ATYLISEAS  KSSRWSNYISALP QPYS
Sbjct  121  LVISADSEWSCPEAGEVLKQYSVPDWPLLATYLISEASFEKSSRWSNYISALPRQPYS  178



>gb|EYU42781.1| hypothetical protein MIMGU_mgv1a004696mg [Erythranthe guttata]
Length=514

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 139/185 (75%), Gaps = 11/185 (6%)
 Frame = +2

Query  50   MPEASTIFQSTLLPPFSQSRRALSSPICHTFFRRNP------TSFTTIRCS--SVSTEAA  205
            M EAS I Q+TL+  FSQ+ ++  +   H+  R  P      + F  IRCS  + S    
Sbjct  1    MAEASRILQTTLVHTFSQNPKSQITLRAHSNRRSFPPISKSSSLFRPIRCSVTTASGGGG  60

Query  206  KIQT---VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEK  376
            +I T   VPWGC+TDS +NASALQKWLS+SG+PPQKMAIQRV++GERGLVALKNIRKGE 
Sbjct  61   EIATQIGVPWGCETDSAENASALQKWLSESGLPPQKMAIQRVEVGERGLVALKNIRKGEN  120

Query  377  LLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALP  556
            LLFVPPSL ITADSEWS  +AG+V+KRY VPDWP +ATYLISEA L  SSRWSNYISALP
Sbjct  121  LLFVPPSLFITADSEWSNREAGEVMKRYNVPDWPFLATYLISEAGLKSSSRWSNYISALP  180

Query  557  TQPYS  571
             QPYS
Sbjct  181  RQPYS  185



>ref|XP_002532210.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit 
N-methyltransferase, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF30179.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit 
N-methyltransferase, chloroplast precursor, putative [Ricinus 
communis]
Length=508

 Score =   227 bits (579),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 138/187 (74%), Gaps = 17/187 (9%)
 Frame = +2

Query  50   MPEASTIFQSTLLPPFSQSRRALSSP--ICHTFFRRNPTSFTTIRC--SSVST-------  196
            M EAS IFQ+TLLP FS    +L  P  + H         + TI C  SSVST       
Sbjct  1    MAEASRIFQTTLLPTFS----SLQKPRLVSHHPPNLAHKKYQTIHCLSSSVSTSDDITTA  56

Query  197  --EAAKIQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKG  370
                   Q VPWGCD DS DNA+ALQ+WLS++G+P QKMAI +V++GERGLVALKNIRKG
Sbjct  57   KAATTVTQMVPWGCDIDSSDNAAALQRWLSNNGLPDQKMAIDKVEVGERGLVALKNIRKG  116

Query  371  EKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISA  550
            EKLLFVPPSLVITADSEWS P+AG+VLK+Y VPDWPL+A YLISEA+L KSS+WSNYISA
Sbjct  117  EKLLFVPPSLVITADSEWSCPEAGEVLKQYSVPDWPLLAIYLISEANLQKSSKWSNYISA  176

Query  551  LPTQPYS  571
            LP QPYS
Sbjct  177  LPRQPYS  183



>ref|XP_010088354.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit 
N-methyltransferase [Morus notabilis]
 gb|EXB34472.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit 
N-methyltransferase [Morus notabilis]
Length=527

 Score =   228 bits (580),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 141/181 (78%), Gaps = 11/181 (6%)
 Frame = +2

Query  50   MPEASTIFQSTLL---PPFSQSRRALSSPICHTFFRRNPTSFTTIRCSSVSTEAAKI---  211
            M EAS I Q++L+    PF ++      P+    FRRNPT    I+CS  ++E  K    
Sbjct  1    MAEASGILQTSLISNFHPFHKTHLPQLHPVLS--FRRNPT--IPIQCSVSTSETTKTTTT  56

Query  212  -QTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFV  388
               +PWGCD DSL+NASALQKWLS SG+PPQKMAI+RVD+GERGLVALKNIRKGEKLLFV
Sbjct  57   QNAIPWGCDIDSLENASALQKWLSQSGLPPQKMAIERVDVGERGLVALKNIRKGEKLLFV  116

Query  389  PPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPY  568
            PPSLVI+ADSEWS  +AG+V+K+  VPDWPL+ATYLISEASL++SSRWSNYISALP QPY
Sbjct  117  PPSLVISADSEWSCEEAGEVMKKNSVPDWPLLATYLISEASLMESSRWSNYISALPRQPY  176

Query  569  S  571
            S
Sbjct  177  S  177



>ref|XP_003542190.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Glycine max]
Length=499

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 136/176 (77%), Gaps = 6/176 (3%)
 Frame = +2

Query  47   AMPEASTI-FQSTLLPPFSQSRRALSSPICHTFFRRNPTSFTTIRCSSVSTEAAKIQTVP  223
            AM EAS I   STLLP F+       + + H     + +    ++CS  +  AA+   V 
Sbjct  4    AMAEASRITLHSTLLPFFTPK-----THVGHRHLSLSSSRKHQVQCSVSAGAAAQTNPVA  58

Query  224  WGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLV  403
            WGC+ DSL+N+SALQ+WLS+SG+PPQKM I+RV++GERGLVALKNIRKGEKLLFVPPSLV
Sbjct  59   WGCEIDSLENSSALQRWLSESGLPPQKMGIERVEVGERGLVALKNIRKGEKLLFVPPSLV  118

Query  404  ITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  571
            IT DSEWS P+AG+VLKR  VPDWPL+ATYLISEASL++SSRWSNYISALP QPYS
Sbjct  119  ITPDSEWSCPEAGEVLKRNSVPDWPLLATYLISEASLMESSRWSNYISALPRQPYS  174



>ref|XP_004243586.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Solanum lycopersicum]
Length=501

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 134/178 (75%), Gaps = 6/178 (3%)
 Frame = +2

Query  50   MPEASTIFQSTLLPPFSQSRRALSSPICHTFFRRNPTSFTTIRCSSVST----EAAKIQT  217
            M E + I Q  LLPPF       ++   H    R      +IRCSS+ST    ++ K Q 
Sbjct  1    MAEVTKILQPVLLPPFFHKLDGTTN--SHFRLCRRNRRNISIRCSSISTTETNKSTKTQN  58

Query  218  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  397
            +PWGC+TDS++NAS LQKWL++SG+P QK+ +QRV++GERGLVA  NIRKGE+LLFVPPS
Sbjct  59   IPWGCETDSIENASNLQKWLTESGLPAQKLDLQRVNVGERGLVANNNIRKGERLLFVPPS  118

Query  398  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  571
            LVITADS+WS  DAG VLK+Y VPDWP IATYLISEASL+KSSRWSNYISALP QPYS
Sbjct  119  LVITADSKWSNSDAGDVLKQYNVPDWPFIATYLISEASLMKSSRWSNYISALPRQPYS  176



>gb|KHG30782.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit 
N-methyltransferase, chloroplastic [Gossypium arboreum]
Length=504

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 134/185 (72%), Gaps = 17/185 (9%)
 Frame = +2

Query  50   MPEASTIFQSTLLPPFSQSRRALSSPI--CHTF----FRRNPTSFTTIRCSSVSTEAAK-  208
            M EAS IF STL P  S     LS P    H +     ++ P     ++CS  ++E    
Sbjct  1    MAEASRIFHSTLFPTLSLQ---LSKPCYNSHVYPSLSLKKAPR---PVQCSVSTSETKST  54

Query  209  ----IQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEK  376
                 Q VPWGCD DSL+NA ALQKWLSDSG+PPQKMAI +V +GERGLVALKN+RKGEK
Sbjct  55   SSNATQEVPWGCDIDSLENAEALQKWLSDSGLPPQKMAIDKVAVGERGLVALKNVRKGEK  114

Query  377  LLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALP  556
            LLFVPPSL ITADSEWS P+AGQVLK+Y VPDWPL+ATYLISEAS  KSSRW NYISALP
Sbjct  115  LLFVPPSLFITADSEWSSPEAGQVLKQYSVPDWPLLATYLISEASAQKSSRWCNYISALP  174

Query  557  TQPYS  571
             QPYS
Sbjct  175  RQPYS  179



>ref|XP_004502116.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Cicer arietinum]
Length=503

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 140/182 (77%), Gaps = 12/182 (7%)
 Frame = +2

Query  50   MPEAS-TIFQST--LLPPFS-----QSRRALSSPICHTFFRRNPTSFTTIRCSSVSTEAA  205
            M EAS  +F +T  L+P F+     ++   LS P   T  RR+   F+ +  +   T AA
Sbjct  1    MVEASGMMFTNTTNLIPAFTPTTFHRTYLGLSQP---TLSRRHHIHFS-VSATQSQTSAA  56

Query  206  KIQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLF  385
             ++T+PWGC+ DSL+N+S+LQ WLSDSG+P QKMAI +VD+GERGLVALKNIRKGEKLLF
Sbjct  57   LVETIPWGCENDSLENSSSLQTWLSDSGLPFQKMAIDKVDVGERGLVALKNIRKGEKLLF  116

Query  386  VPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQP  565
            VPPSLVIT DSEWS P+AG+VLKR  VPDWPL+ATYLISEASL+KSSRW +YISALP QP
Sbjct  117  VPPSLVITPDSEWSCPEAGEVLKRNSVPDWPLLATYLISEASLMKSSRWCSYISALPRQP  176

Query  566  YS  571
            YS
Sbjct  177  YS  178



>ref|XP_010048281.1| PREDICTED: LOW QUALITY PROTEIN: ribulose-1,5 bisphosphate carboxylase/oxygenase 
large subunit N-methyltransferase, chloroplastic 
[Eucalyptus grandis]
Length=506

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 133/179 (74%), Gaps = 10/179 (6%)
 Frame = +2

Query  59   ASTIFQSTLLPPFSQSRRALSSPICHTFFRRNPT-----SFTTIRCS---SVSTEAAKIQ  214
            AS IF ++LLPPFS  RR    P     F   P+     + + + CS   + +  +   +
Sbjct  5    ASRIFHASLLPPFSPLRRGPHKP--RPRFPPGPSLLPPATASKVVCSVPAAAARASEARR  62

Query  215  TVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPP  394
             +PWGCD DSL+NASALQ WLSDSG+PPQKMAIQRVD+GERG VALKN+RKGEKLLFVPP
Sbjct  63   MIPWGCDVDSLENASALQGWLSDSGLPPQKMAIQRVDVGERGXVALKNVRKGEKLLFVPP  122

Query  395  SLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  571
             LVITADSEW   +AG+VLK+  VPDWPL+A YLISEASL+ SSRWSNYISALP QPYS
Sbjct  123  PLVITADSEWGCAEAGEVLKKNSVPDWPLLAIYLISEASLMGSSRWSNYISALPRQPYS  181



>gb|KJB10233.1| hypothetical protein B456_001G190900 [Gossypium raimondii]
Length=483

 Score =   218 bits (554),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 135/186 (73%), Gaps = 17/186 (9%)
 Frame = +2

Query  47   AMPEASTIFQSTLLPPFSQSRRALSSPI--CHTF----FRRNPTSFTTIRCSSVSTEAAK  208
            AM EAS IF STL+P  S     LS P    H +     ++ P     ++CS  ++E   
Sbjct  54   AMAEASRIFHSTLIPTLSLQ---LSKPCYNSHVYPSLSLKKAPR---PVQCSVSTSETKS  107

Query  209  -----IQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGE  373
                  Q VPWGCD DSL+NA ALQKWLS+SG+PPQKMAI +V +GERGLVALKNIRKGE
Sbjct  108  TSSNATQEVPWGCDIDSLENAEALQKWLSNSGLPPQKMAIDKVAVGERGLVALKNIRKGE  167

Query  374  KLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISAL  553
            KLLFVPPSL ITADSEWS P+AG VLK+Y VPDWPL+ATYLISEAS  KSSRW NYISAL
Sbjct  168  KLLFVPPSLFITADSEWSSPEAGLVLKQYSVPDWPLLATYLISEASAQKSSRWCNYISAL  227

Query  554  PTQPYS  571
            P QPYS
Sbjct  228  PRQPYS  233



>ref|XP_010689223.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=500

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 134/178 (75%), Gaps = 7/178 (4%)
 Frame = +2

Query  50   MPEAST-IFQSTLLPP-FSQSRRALSSPICHTFFRRNPTSFTTIRCS--SVSTEAAKIQT  217
            M EAST IF+STLLP  FSQ+      P    F  +   S + IRCS  +  T    +  
Sbjct  1    MAEASTVIFRSTLLPSMFSQNHHL---PYSKHFRTKTLNSPSQIRCSISTSDTPFTAVGR  57

Query  218  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  397
            +PWGC+ DS++NA ALQKWLS SG+PPQKM I++VD+GERGLVA  NIRKGEKLLFVPPS
Sbjct  58   IPWGCEVDSVENAEALQKWLSGSGLPPQKMRIEKVDVGERGLVANNNIRKGEKLLFVPPS  117

Query  398  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  571
            LVI+ADS WS P+AG+VLKR  VPDWPL+ATYLISEAS + SSRWSNYISALP QPYS
Sbjct  118  LVISADSVWSCPEAGKVLKRNSVPDWPLLATYLISEASQMSSSRWSNYISALPRQPYS  175



>gb|KJB10232.1| hypothetical protein B456_001G190900 [Gossypium raimondii]
Length=558

 Score =   218 bits (554),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 135/186 (73%), Gaps = 17/186 (9%)
 Frame = +2

Query  47   AMPEASTIFQSTLLPPFSQSRRALSSPI--CHTF----FRRNPTSFTTIRCSSVSTEAAK  208
            AM EAS IF STL+P  S     LS P    H +     ++ P     ++CS  ++E   
Sbjct  54   AMAEASRIFHSTLIPTLSLQ---LSKPCYNSHVYPSLSLKKAPRP---VQCSVSTSETKS  107

Query  209  -----IQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGE  373
                  Q VPWGCD DSL+NA ALQKWLS+SG+PPQKMAI +V +GERGLVALKNIRKGE
Sbjct  108  TSSNATQEVPWGCDIDSLENAEALQKWLSNSGLPPQKMAIDKVAVGERGLVALKNIRKGE  167

Query  374  KLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISAL  553
            KLLFVPPSL ITADSEWS P+AG VLK+Y VPDWPL+ATYLISEAS  KSSRW NYISAL
Sbjct  168  KLLFVPPSLFITADSEWSSPEAGLVLKQYSVPDWPLLATYLISEASAQKSSRWCNYISAL  227

Query  554  PTQPYS  571
            P QPYS
Sbjct  228  PRQPYS  233



>ref|XP_007049391.1| Rubisco methyltransferase family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007049392.1| Rubisco methyltransferase family protein isoform 1 [Theobroma 
cacao]
 gb|EOX93548.1| Rubisco methyltransferase family protein isoform 1 [Theobroma 
cacao]
 gb|EOX93549.1| Rubisco methyltransferase family protein isoform 1 [Theobroma 
cacao]
Length=506

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 138/184 (75%), Gaps = 13/184 (7%)
 Frame = +2

Query  50   MPEASTIFQSTLLPPFS-QSRRALSSPICHTF----FRRNPTSFTTIRCSSVSTEAAKI-  211
            M EAS IF +TLLP FS Q    L     HTF    F++  +    ++CS  ++E     
Sbjct  1    MAEASRIFHATLLPTFSPQLHHKLRHSHSHTFPSLSFKKERS---VVQCSVSTSETRTTS  57

Query  212  ----QTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKL  379
                Q VPWGCD DSL+NA  LQKWLSDSG+PPQKMAI +VDIGERGLVALKNIRKGEKL
Sbjct  58   SNTTQEVPWGCDIDSLENAEDLQKWLSDSGLPPQKMAIDKVDIGERGLVALKNIRKGEKL  117

Query  380  LFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPT  559
            LFVPPSL ITADSEWS P+AGQVLK+Y VPDWPLIATYLISEAS  KSSRWSNYISALP 
Sbjct  118  LFVPPSLFITADSEWSSPEAGQVLKQYSVPDWPLIATYLISEASSSKSSRWSNYISALPR  177

Query  560  QPYS  571
            QPYS
Sbjct  178  QPYS  181



>ref|XP_003601528.1| SET domain-containing protein [Medicago truncatula]
 gb|AES71779.1| rubisco methyltransferase family protein [Medicago truncatula]
 gb|AFK38105.1| unknown [Medicago truncatula]
Length=497

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 134/180 (74%), Gaps = 13/180 (7%)
 Frame = +2

Query  44   SAMPEASTIFQ----STLLPPFSQSRRALSSPICHTFFRRNPTSFTTIRCSSVSTEAAKI  211
            + M EA  +F     +TL+P F+Q+   +         RRN   FT      +S  ++ I
Sbjct  2    TTMVEALGMFMFTNTTTLIPAFNQT---IHKTTHLGLSRRNHAHFT------LSATSSLI  52

Query  212  QTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVP  391
            +T+PWGC+ DS++N+S+LQKWLS SG+P QKM+I +VD+GERGLVAL NIRKGEKLLFVP
Sbjct  53   ETIPWGCENDSIENSSSLQKWLSQSGLPSQKMSIDKVDVGERGLVALNNIRKGEKLLFVP  112

Query  392  PSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  571
            P LVIT DSEWS P+AG+VLK+  VPDWPL+ATYLISEASL+KSSRW +YISALP QPYS
Sbjct  113  PQLVITPDSEWSCPEAGEVLKKNSVPDWPLLATYLISEASLMKSSRWFSYISALPRQPYS  172



>ref|XP_006407809.1| hypothetical protein EUTSA_v10020552mg [Eutrema salsugineum]
 gb|ESQ49262.1| hypothetical protein EUTSA_v10020552mg [Eutrema salsugineum]
Length=506

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/182 (60%), Positives = 136/182 (75%), Gaps = 10/182 (5%)
 Frame = +2

Query  50   MPEASTIFQSTLLPPFSQSRRALSSPICHTF-----FRRNPTSFTTIRCSSVSTEAAKIQ  214
            M ++S++ QSTLLP FS   +  +     +       R  P  + ++  S+  T    ++
Sbjct  1    MAKSSSVLQSTLLPAFSPLHKLRNQNFTLSLPPLPVSRCRPGIYCSV--SAGETTRRSVE  58

Query  215  TVP---WGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLF  385
              P   WGC+ DS++NA++LQKWLSDSG+PPQKMAI RVDIGERGLVA +N+RKGEKLLF
Sbjct  59   EAPDISWGCEIDSVENATSLQKWLSDSGLPPQKMAIDRVDIGERGLVASQNLRKGEKLLF  118

Query  386  VPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQP  565
            VPPSLVI+ADSEW+ P+AG+V+KRY VPDWPL+ATYLISEASL KSSRW NYISALP QP
Sbjct  119  VPPSLVISADSEWTNPEAGEVMKRYDVPDWPLLATYLISEASLQKSSRWFNYISALPRQP  178

Query  566  YS  571
            YS
Sbjct  179  YS  180



>ref|XP_010486336.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Camelina 
sativa]
Length=507

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 136/184 (74%), Gaps = 14/184 (8%)
 Frame = +2

Query  50   MPEASTIFQSTLLPPFSQSRRALSSPICHTF-----FRRNPTSFTTIRCSSVSTEAAK--  208
            M +AS++ QSTLLP +S   +  +     +F      R  P     I CS  + E  +  
Sbjct  1    MAKASSVLQSTLLPAYSPLHKLRNQSFILSFPPLPVSRCRPG----IHCSVSAGETTRRS  56

Query  209  IQTVP---WGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKL  379
            ++  P   WGC+ DSL+NA++LQ WLS+SG+PPQKMAI RVDIGERGLVA +N+RKGEKL
Sbjct  57   VEEAPDISWGCEIDSLENATSLQNWLSESGLPPQKMAIDRVDIGERGLVASQNLRKGEKL  116

Query  380  LFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPT  559
            LFVPPSLVI+ADSEW+ P+AG+V+KRY VPDWPL+ATYLISEASL K+SRW NYISALP 
Sbjct  117  LFVPPSLVISADSEWTNPEAGEVMKRYDVPDWPLLATYLISEASLQKNSRWFNYISALPR  176

Query  560  QPYS  571
            QPYS
Sbjct  177  QPYS  180



>ref|XP_003605258.1| SET domain-containing protein [Medicago truncatula]
Length=494

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 132/178 (74%), Gaps = 13/178 (7%)
 Frame = +2

Query  50   MPEASTIFQ----STLLPPFSQSRRALSSPICHTFFRRNPTSFTTIRCSSVSTEAAKIQT  217
            M EA  +F     +TL+P F+Q+   +         RRN   FT    SS+      I+T
Sbjct  1    MVEALGMFMFTNTTTLIPAFNQT---IHKTTHLGLSRRNHAHFTLSATSSL------IET  51

Query  218  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  397
            +PWGC+ DS++N+S+LQKWLS SG+P QKM+I +VD+GERGLVAL NIRKGEKLLFVPP 
Sbjct  52   IPWGCENDSIENSSSLQKWLSQSGLPSQKMSIDKVDVGERGLVALNNIRKGEKLLFVPPQ  111

Query  398  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  571
            LVIT DSEWS P+AG+VLK+  VPDWPL+ATYLISEASL+KSSRW +YISALP QPYS
Sbjct  112  LVITPDSEWSCPEAGEVLKKNSVPDWPLLATYLISEASLMKSSRWFSYISALPRQPYS  169



>gb|KFK38228.1| hypothetical protein AALP_AA3G085300 [Arabis alpina]
Length=506

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 135/188 (72%), Gaps = 22/188 (12%)
 Frame = +2

Query  50   MPEASTIFQSTLLPPFSQSRRALSSPICHTFFRRNPTSF---------TTIRCSSVSTEA  202
            M +AS++ QSTLLPPFS        P+    F+ +  S            I CS  + E 
Sbjct  1    MAKASSVLQSTLLPPFS--------PLPKLRFQTSTVSLPPSPPFRCRQGIHCSVSAGET  52

Query  203  AK--IQTVP---WGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRK  367
             +  ++  P   WGC+ DSL+NA++LQ WLSDSG+PPQKM+I +VDIGERGLVA +N+RK
Sbjct  53   TRRSVEEAPDISWGCEIDSLENATSLQNWLSDSGLPPQKMSIDKVDIGERGLVASQNLRK  112

Query  368  GEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYIS  547
            GEKLLFVPPSLVI+ADS W+ P+AG+V+KRY VPDWPL+ATYLISEAS  KSSRW NYIS
Sbjct  113  GEKLLFVPPSLVISADSGWTNPEAGEVMKRYDVPDWPLLATYLISEASFQKSSRWYNYIS  172

Query  548  ALPTQPYS  571
            ALP QPYS
Sbjct  173  ALPRQPYS  180



>ref|XP_007146016.1| hypothetical protein PHAVU_006G005700g [Phaseolus vulgaris]
 gb|ESW18010.1| hypothetical protein PHAVU_006G005700g [Phaseolus vulgaris]
Length=492

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 132/175 (75%), Gaps = 9/175 (5%)
 Frame = +2

Query  50   MPEASTI-FQSTLLPPFSQSRRALSSPICHTFFRRNPTSFTTIRCSSVSTEAAKIQTVPW  226
            M EAST+ F STLLP F         P+  T  R+       +RCS VS  A     V W
Sbjct  1    MAEASTVTFFSTLLPSFRPHAHVSHRPL--TLPRK-----LQVRCS-VSAGATPQNAVAW  52

Query  227  GCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVI  406
            GC+ +SL++ASALQ+WLS SG+PPQKM I RV++GERGLVALK+IRKGEKLLFVPPSLVI
Sbjct  53   GCEIESLESASALQRWLSKSGLPPQKMGIDRVEVGERGLVALKSIRKGEKLLFVPPSLVI  112

Query  407  TADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  571
            T +SEWS P+ G+VLKR  VPDWPL+ATYLISEASL++SSRWSNYISALP QPYS
Sbjct  113  TPNSEWSHPETGEVLKRNSVPDWPLLATYLISEASLMESSRWSNYISALPRQPYS  167



>ref|XP_006297498.1| hypothetical protein CARUB_v10013517mg [Capsella rubella]
 gb|EOA30396.1| hypothetical protein CARUB_v10013517mg [Capsella rubella]
Length=498

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 136/184 (74%), Gaps = 14/184 (8%)
 Frame = +2

Query  50   MPEASTIFQSTLLPPFSQSRRALSSPICHTF-----FRRNPTSFTTIRCSSVSTEAAK--  208
            M +AS++ QSTLLP +S   +  +     +F      R  P     I CS  + E  +  
Sbjct  1    MAKASSVLQSTLLPAYSPLYKLRNQSFTLSFPPLPVSRCRPG----IHCSVSAGETTRRS  56

Query  209  IQTVP---WGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKL  379
            ++  P   WGC+ DSL+NA++LQ WLSDSG+PPQKM+I RVDIGERGLVA +N+RKGEKL
Sbjct  57   VEEAPDISWGCEIDSLENATSLQNWLSDSGLPPQKMSIDRVDIGERGLVASQNLRKGEKL  116

Query  380  LFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPT  559
            LFVPPSLVI+ADSEW+ P+AG+V+KRY VPDWPL+ATYLISEASL K+SRW NYISALP 
Sbjct  117  LFVPPSLVISADSEWTNPEAGEVMKRYDVPDWPLLATYLISEASLQKNSRWFNYISALPR  176

Query  560  QPYS  571
            QPYS
Sbjct  177  QPYS  180



>ref|XP_010456598.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Camelina 
sativa]
Length=507

 Score =   212 bits (539),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 136/184 (74%), Gaps = 14/184 (8%)
 Frame = +2

Query  50   MPEASTIFQSTLLPPFSQSRRALSSPICHTF-----FRRNPTSFTTIRCSSVSTEAAK--  208
            M +AS++ QSTLLP +S   +  +     +F      R  P     I CS  + E  +  
Sbjct  1    MAKASSVLQSTLLPAYSPLLKLRNQSFILSFPPLPVSRCRPG----IHCSVSAGETTRRS  56

Query  209  IQTVP---WGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKL  379
            ++  P   WGC+ DSL+NA++LQ WLS+SG+PPQKMAI RVDIGERGLVA +N+RKGEKL
Sbjct  57   VEDAPDISWGCEIDSLENATSLQNWLSESGLPPQKMAIDRVDIGERGLVASQNLRKGEKL  116

Query  380  LFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPT  559
            LFVPPSLVI+ADSEW+ P+AG+V+KRY VPDWPL+ATYLISEASL K+SRW NYISALP 
Sbjct  117  LFVPPSLVISADSEWTNPEAGEVMKRYDVPDWPLLATYLISEASLQKNSRWFNYISALPR  176

Query  560  QPYS  571
            QPYS
Sbjct  177  QPYS  180



>ref|XP_002882542.1| SET domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58801.1| SET domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=504

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 129/174 (74%), Gaps = 6/174 (3%)
 Frame = +2

Query  68   IFQSTLLPPFSQSRRALSSPICHTF-----FRRNPTSFTTIRCSSVSTEAAKIQ-TVPWG  229
            + QSTLLP +S   +  +     +F      R  P    ++     +T + +    + WG
Sbjct  6    VLQSTLLPAYSPLHKLRNQNFTLSFPPLPVSRCRPGIHCSVSAGETTTRSVEEAPEISWG  65

Query  230  CDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVIT  409
            C+ DSL+NA++LQ WLSDSG+PPQKMAI RVDIGERGLVA +N+RKGEKLLFVPPSLVI+
Sbjct  66   CEIDSLENATSLQNWLSDSGLPPQKMAIDRVDIGERGLVASQNLRKGEKLLFVPPSLVIS  125

Query  410  ADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  571
            ADSEW+ P+AG+V+KRY VPDWPL+ATYLISEASL KSSRW NYISALP QPYS
Sbjct  126  ADSEWTNPEAGEVMKRYDVPDWPLLATYLISEASLQKSSRWYNYISALPRQPYS  179



>ref|XP_010464405.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Camelina 
sativa]
Length=507

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 135/184 (73%), Gaps = 14/184 (8%)
 Frame = +2

Query  50   MPEASTIFQSTLLPPFSQSRRALSSPICHTF-----FRRNPTSFTTIRCSSVSTEAAK--  208
            M +AS++ QSTLLP +S   +  +     +F      R  P     I CS  + E  +  
Sbjct  1    MAKASSVLQSTLLPAYSPLHKLRNQSSILSFPPLPVSRCRPG----IHCSVSAGETTRRS  56

Query  209  IQTVP---WGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKL  379
            ++  P   WGC+ DSL+NA++LQ WLS+SG+PPQKMAI RVDIGERGLVA +N+RKGEKL
Sbjct  57   VEEAPDISWGCEIDSLENATSLQNWLSESGLPPQKMAIDRVDIGERGLVASQNLRKGEKL  116

Query  380  LFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPT  559
            LFVPPSLVI+ADSEW+ P+AG+V+KRY VPDWPL+ATYLISEAS  K+SRW NYISALP 
Sbjct  117  LFVPPSLVISADSEWTNPEAGEVMKRYDVPDWPLLATYLISEASFQKNSRWFNYISALPR  176

Query  560  QPYS  571
            QPYS
Sbjct  177  QPYS  180



>ref|NP_187424.1| Rubisco methyltransferase family protein [Arabidopsis thaliana]
 gb|AAF13085.1|AC009176_12 putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase I [Arabidopsis thaliana]
 gb|AAF21177.1|AC013483_1 putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase I [Arabidopsis thaliana]
 gb|AAK76599.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase I [Arabidopsis thaliana]
 gb|AAL85066.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase I [Arabidopsis thaliana]
 gb|AEE74585.1| Rubisco methyltransferase family protein [Arabidopsis thaliana]
Length=504

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 132/178 (74%), Gaps = 14/178 (8%)
 Frame = +2

Query  68   IFQSTLLPPFSQSRRALSSPICHTFFRRNPTSFTT----IRCSSVSTEAAKIQT------  217
            + QSTLLP +S   +  +  I  +F   +P   +     I CS VS     IQ+      
Sbjct  6    LLQSTLLPAYSPLHKLRNQNITLSF---SPLPLSRCRPGIHCS-VSAGETTIQSMEEAPK  61

Query  218  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  397
            + WGC+ DSL+NA++LQ WLSDSG+PPQKMAI RVDIGERGLVA +N+RKGEKLLFVPPS
Sbjct  62   ISWGCEIDSLENATSLQNWLSDSGLPPQKMAIDRVDIGERGLVASQNLRKGEKLLFVPPS  121

Query  398  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  571
            LVI+ADSEW+  +AG+V+KRY VPDWPL+ATYLISEASL KSSRW NYISALP QPYS
Sbjct  122  LVISADSEWTNAEAGEVMKRYDVPDWPLLATYLISEASLQKSSRWFNYISALPRQPYS  179



>gb|AAM61650.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase I [Arabidopsis thaliana]
Length=504

 Score =   208 bits (530),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 132/178 (74%), Gaps = 14/178 (8%)
 Frame = +2

Query  68   IFQSTLLPPFSQSRRALSSPICHTFFRRNPTSFTT----IRCSSVSTEAAKIQT------  217
            + QSTLLP +S   +  +  I  +F   +P   +     I CS VS     IQ+      
Sbjct  6    LLQSTLLPAYSPLHKLRNQNITLSF---SPLPLSRCRPGIHCS-VSAGETTIQSMEEAPK  61

Query  218  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  397
            + WGC+ DSL+NA++LQ WLSDSG+PPQKMAI RVDIGERGLVA +N+RKGEKLLFVPPS
Sbjct  62   ISWGCEIDSLENATSLQNWLSDSGLPPQKMAIDRVDIGERGLVASQNLRKGEKLLFVPPS  121

Query  398  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  571
            LVI+ADSEW+  +AG+V+KRY VPDWPL+ATYLISEA+L KSSRW NYISALP QPYS
Sbjct  122  LVISADSEWTNAEAGEVMKRYDVPDWPLLATYLISEANLQKSSRWFNYISALPRQPYS  179



>ref|XP_010524627.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Tarenaya hassleriana]
Length=508

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 131/188 (70%), Gaps = 19/188 (10%)
 Frame = +2

Query  50   MPEASTIFQSTLLP---PFSQSRR----ALSSPICHTFFRRNPTSFTTIRCSSVSTEAAK  208
            M EAS + QS L P   PF +  R     LS P      RR       + CS  + EA +
Sbjct  1    MAEASIVLQSALFPTLSPFHKLHRDQHSTLSFPSPAVARRRQ-----VVHCSVSAGEAMR  55

Query  209  IQTVP-------WGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRK  367
              +V        WGC+ DS++NA++LQ+WLSDSG+PPQKMAI +V IGERGLVA KNIRK
Sbjct  56   RASVEEDSPEISWGCEVDSVENATSLQRWLSDSGLPPQKMAIDKVSIGERGLVASKNIRK  115

Query  368  GEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYIS  547
            GEKLLFVPPSLVIT+DS+WS P+AG+++KRY VPDWPL+ATYLISEASL   S W NYIS
Sbjct  116  GEKLLFVPPSLVITSDSKWSKPEAGELMKRYDVPDWPLLATYLISEASLGNDSVWYNYIS  175

Query  548  ALPTQPYS  571
            ALP QPYS
Sbjct  176  ALPRQPYS  183



>ref|XP_008802702.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X2 [Phoenix 
dactylifera]
Length=483

 Score =   205 bits (522),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  218  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  397
            +PWGC+ +SL++ASALQ+WLS+SG+PPQKMAIQRVD+GERGLVALKNIRKGEKLLFVPPS
Sbjct  59   IPWGCEIESLESASALQQWLSESGLPPQKMAIQRVDVGERGLVALKNIRKGEKLLFVPPS  118

Query  398  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  571
            LVITADS+WS P+ G V++R  VPDWPL+ATYLISEASL+ SSRW +YISALP QPYS
Sbjct  119  LVITADSDWSCPEVGNVMRRNSVPDWPLLATYLISEASLLNSSRWCSYISALPRQPYS  176



>gb|AAC14296.1| putative methyltransferase [Arabidopsis thaliana]
Length=504

 Score =   206 bits (523),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 129/177 (73%), Gaps = 12/177 (7%)
 Frame = +2

Query  68   IFQSTLLPPFSQSRRALSSPICHTFFRRNPTSFTTIR---CSSVSTEAAKIQT------V  220
            + QSTLLP +S   +  +  I  +F   +P   +  R     SVS     IQ+      +
Sbjct  6    LLQSTLLPAYSPLHKLRNQNITLSF---SPLPLSRCRPGIHCSVSAGETTIQSMEEAPKI  62

Query  221  PWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSL  400
             WGC+ DSL+NA++LQ WLSDSG+PPQKMAI RVDIGERGLVA +N+RKGEKLLFV PSL
Sbjct  63   SWGCEIDSLENATSLQNWLSDSGLPPQKMAIDRVDIGERGLVASQNLRKGEKLLFVSPSL  122

Query  401  VITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  571
            VI ADSEW+  +AG+V+KRY VPDWPL+ATYLISEASL KSSRW NYISALP QPYS
Sbjct  123  VICADSEWTNAEAGEVMKRYDVPDWPLLATYLISEASLQKSSRWFNYISALPRQPYS  179



>ref|XP_008802701.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X1 [Phoenix 
dactylifera]
Length=501

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  218  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  397
            +PWGC+ +SL++ASALQ+WLS+SG+PPQKMAIQRVD+GERGLVALKNIRKGEKLLFVPPS
Sbjct  59   IPWGCEIESLESASALQQWLSESGLPPQKMAIQRVDVGERGLVALKNIRKGEKLLFVPPS  118

Query  398  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  571
            LVITADS+WS P+ G V++R  VPDWPL+ATYLISEASL+ SSRW +YISALP QPYS
Sbjct  119  LVITADSDWSCPEVGNVMRRNSVPDWPLLATYLISEASLLNSSRWCSYISALPRQPYS  176



>ref|XP_010942853.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X2 [Elaeis 
guineensis]
Length=434

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  218  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  397
            +PWGC+ +SL++ASALQ+WLS+SG+PPQKMAIQRVD+GERGLVALKNIRKGEKLLFVPPS
Sbjct  59   IPWGCEIESLESASALQQWLSESGLPPQKMAIQRVDVGERGLVALKNIRKGEKLLFVPPS  118

Query  398  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  571
            LVITADS+WS  +AG V++R  VPDWPL+ATYLISEASL+ SSRW +YISALP QPYS
Sbjct  119  LVITADSDWSCLEAGNVMRRNSVPDWPLLATYLISEASLMNSSRWCSYISALPRQPYS  176



>ref|XP_009124214.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Brassica 
rapa]
Length=507

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 132/184 (72%), Gaps = 13/184 (7%)
 Frame = +2

Query  50   MPEASTIFQSTLLPPFS-----QSRRALSSPICHTFFRRNPTSFTTIRCSSVSTEAAK--  208
            M +AS   QSTLLP  S     +S+    S       R  P    TI CS  + E  K  
Sbjct  1    MAKASNFLQSTLLPSSSPLRNLRSQPLPLSFPPLPSSRHRPI---TIHCSVSAGETTKRS  57

Query  209  IQTVP---WGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKL  379
            ++  P   WGC+ DS++NA++LQ+WLSDSG+PPQKMAI +VDIGERGLVA +++RKGEKL
Sbjct  58   LEEAPDISWGCEIDSVENATSLQRWLSDSGLPPQKMAIDKVDIGERGLVASQSLRKGEKL  117

Query  380  LFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPT  559
            LFVPPSLVI+ADS W+  +AG+V+KRY VPDWPL+ATYLISEASL K SRW NYISALP 
Sbjct  118  LFVPPSLVISADSVWTNGEAGEVMKRYDVPDWPLLATYLISEASLQKGSRWFNYISALPR  177

Query  560  QPYS  571
            QPYS
Sbjct  178  QPYS  181



>ref|XP_010942854.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X3 [Elaeis 
guineensis]
Length=434

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  218  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  397
            +PWGC+ +SL++ASALQ+WLS+SG+PPQKMAIQRVD+GERGLVALKNIRKGEKLLFVPPS
Sbjct  59   IPWGCEIESLESASALQQWLSESGLPPQKMAIQRVDVGERGLVALKNIRKGEKLLFVPPS  118

Query  398  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  571
            LVITADS+WS  +AG V++R  VPDWPL+ATYLISEASL+ SSRW +YISALP QPYS
Sbjct  119  LVITADSDWSCLEAGNVMRRNSVPDWPLLATYLISEASLMNSSRWCSYISALPRQPYS  176



>ref|XP_009391784.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=502

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 115/138 (83%), Gaps = 5/138 (4%)
 Frame = +2

Query  173  IRCSSVSTE-----AAKIQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGER  337
            IRCS  +T       ++ + +PWGC+ +SL++ASALQ+WLS SG+PPQK+ IQRVD+GER
Sbjct  39   IRCSVSATSSNALTGSEARVIPWGCEIESLESASALQRWLSASGLPPQKLEIQRVDVGER  98

Query  338  GLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLI  517
            GLVAL NIRKGEKLLFVPPSLVITADSEWS P+ G VLK+  VPDWPL+ATYL+SEASL+
Sbjct  99   GLVALNNIRKGEKLLFVPPSLVITADSEWSCPEVGNVLKKNSVPDWPLLATYLLSEASLM  158

Query  518  KSSRWSNYISALPTQPYS  571
             SSRW+ YISALP QPYS
Sbjct  159  SSSRWNRYISALPRQPYS  176



>ref|XP_010942848.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X1 [Elaeis 
guineensis]
 ref|XP_010942849.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X1 [Elaeis 
guineensis]
 ref|XP_010942850.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X1 [Elaeis 
guineensis]
 ref|XP_010942851.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X1 [Elaeis 
guineensis]
 ref|XP_010942852.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X1 [Elaeis 
guineensis]
Length=501

 Score =   203 bits (516),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  218  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  397
            +PWGC+ +SL++ASALQ+WLS+SG+PPQKMAIQRVD+GERGLVALKNIRKGEKLLFVPPS
Sbjct  59   IPWGCEIESLESASALQQWLSESGLPPQKMAIQRVDVGERGLVALKNIRKGEKLLFVPPS  118

Query  398  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  571
            LVITADS+WS  +AG V++R  VPDWPL+ATYLISEASL+ SSRW +YISALP QPYS
Sbjct  119  LVITADSDWSCLEAGNVMRRNSVPDWPLLATYLISEASLMNSSRWCSYISALPRQPYS  176



>emb|CDY22127.1| BnaC01g39740D [Brassica napus]
Length=507

 Score =   203 bits (516),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 131/184 (71%), Gaps = 13/184 (7%)
 Frame = +2

Query  50   MPEASTIFQSTLLPPFS-----QSRRALSSPICHTFFRRNPTSFTTIRCSSVSTEAAK--  208
            M +AS   QSTLLP  S     +S+    S       R  P    TI CS  + E  K  
Sbjct  1    MAKASNFLQSTLLPSSSPLRNLRSQPLPLSFPPLPSSRHRPI---TIHCSVSAGETTKRS  57

Query  209  IQTVP---WGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKL  379
            ++  P   WGC+ DS++NA++LQ+WLSDSG+PPQKMAI +VDIGERGLVA +++RKGEKL
Sbjct  58   LEEAPDISWGCEIDSVENATSLQRWLSDSGLPPQKMAIDKVDIGERGLVASQSLRKGEKL  117

Query  380  LFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPT  559
            LFVPPSLVI+ADS W+  +AG+V+KRY VPDWPL+ATYLISEAS  K SRW NYISALP 
Sbjct  118  LFVPPSLVISADSVWTNGEAGEVMKRYDVPDWPLLATYLISEASFQKGSRWFNYISALPR  177

Query  560  QPYS  571
            QPYS
Sbjct  178  QPYS  181



>gb|KJB22702.1| hypothetical protein B456_004G061300 [Gossypium raimondii]
Length=344

 Score =   197 bits (501),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 130/185 (70%), Gaps = 20/185 (11%)
 Frame = +2

Query  50   MPEASTIFQSTL--LPPFSQSRRALSSPICH---TFFRRNPTSFTTIRCSSVSTEAAKIQ  214
            M EAS  F +TL  LP FS        P  H   ++   +P S    R  SV    ++ +
Sbjct  1    MAEASRTFHATLFSLPTFS--------PRLHFKLSYSHSHP-SLHLKRARSVQRSISETK  51

Query  215  T------VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEK  376
            T      +PWGCD DSL+NA ALQKWLSDSG+PPQK+ I +V++G+RGLVALK I +GEK
Sbjct  52   TMSSDTTLPWGCDIDSLENAEALQKWLSDSGLPPQKVGINKVEMGKRGLVALKKINRGEK  111

Query  377  LLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALP  556
            LLFVPPSL+IT+DS+WS P+ G VLK++ V D PL+ATYLISEA+L KSSRWSNYIS+LP
Sbjct  112  LLFVPPSLLITSDSDWSSPEVGHVLKQHNVADLPLLATYLISEANLQKSSRWSNYISSLP  171

Query  557  TQPYS  571
             QPYS
Sbjct  172  RQPYS  176



>ref|XP_006857756.1| hypothetical protein AMTR_s00061p00196800 [Amborella trichopoda]
 gb|ERN19223.1| hypothetical protein AMTR_s00061p00196800 [Amborella trichopoda]
Length=541

 Score =   201 bits (512),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +2

Query  197  EAAKIQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEK  376
            E  ++  V WGCD DS +NAS L++WLS++G+PPQKMAI+RV++GERGLVALKNIRKGEK
Sbjct  90   EREEVGAVRWGCDIDSSENASYLKRWLSENGLPPQKMAIERVEVGERGLVALKNIRKGEK  149

Query  377  LLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALP  556
            LLFVPPSLVI A+SEWS P+ G VLKR  VPDWPL+ATYLISEASL++SSRW+ YISALP
Sbjct  150  LLFVPPSLVIDANSEWSCPEVGNVLKRNSVPDWPLLATYLISEASLMESSRWNEYISALP  209

Query  557  TQPYS  571
             QPYS
Sbjct  210  RQPYS  214



>gb|KJB22703.1| hypothetical protein B456_004G061300 [Gossypium raimondii]
Length=489

 Score =   198 bits (503),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 130/185 (70%), Gaps = 20/185 (11%)
 Frame = +2

Query  50   MPEASTIFQSTL--LPPFSQSRRALSSPICH---TFFRRNPTSFTTIRCSSVSTEAAKIQ  214
            M EAS  F +TL  LP FS        P  H   ++   +P S    R  SV    ++ +
Sbjct  1    MAEASRTFHATLFSLPTFS--------PRLHFKLSYSHSHP-SLHLKRARSVQRSISETK  51

Query  215  T------VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEK  376
            T      +PWGCD DSL+NA ALQKWLSDSG+PPQK+ I +V++G+RGLVALK I +GEK
Sbjct  52   TMSSDTTLPWGCDIDSLENAEALQKWLSDSGLPPQKVGINKVEMGKRGLVALKKINRGEK  111

Query  377  LLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALP  556
            LLFVPPSL+IT+DS+WS P+ G VLK++ V D PL+ATYLISEA+L KSSRWSNYIS+LP
Sbjct  112  LLFVPPSLLITSDSDWSSPEVGHVLKQHNVADLPLLATYLISEANLQKSSRWSNYISSLP  171

Query  557  TQPYS  571
             QPYS
Sbjct  172  RQPYS  176



>ref|XP_002454362.1| hypothetical protein SORBIDRAFT_04g029430 [Sorghum bicolor]
 gb|EES07338.1| hypothetical protein SORBIDRAFT_04g029430 [Sorghum bicolor]
Length=499

 Score =   198 bits (503),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +2

Query  218  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  397
            VPWGC+ +SL++A++L++WL DSG+P Q++AIQRVDIGERGLVALKNIRKGEKLLFVPPS
Sbjct  57   VPWGCEIESLESAASLERWLIDSGLPEQRLAIQRVDIGERGLVALKNIRKGEKLLFVPPS  116

Query  398  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  571
            LVITADSEW  P+ G+V+KR  VPDWPLIATYLISEASL  SSRWS+YI+ALP QPYS
Sbjct  117  LVITADSEWGRPEVGEVMKRNSVPDWPLIATYLISEASLEGSSRWSSYIAALPRQPYS  174



>ref|XP_004953752.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like isoform 
X1 [Setaria italica]
 ref|XP_004953753.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like isoform 
X2 [Setaria italica]
 ref|XP_004953754.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like isoform 
X3 [Setaria italica]
Length=503

 Score =   197 bits (502),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = +2

Query  209  IQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFV  388
            +  VPWGC+ +SL++A++L++WL DSG+P Q++AIQRVD+GERGLVALKNIRKGEKLLFV
Sbjct  58   VAGVPWGCEIESLESAASLERWLIDSGLPEQRLAIQRVDVGERGLVALKNIRKGEKLLFV  117

Query  389  PPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPY  568
            PPSLVITADSEWS P+ G V+K+  VPDWPLIATYLISEASL  SS+WSNYI+ALP QPY
Sbjct  118  PPSLVITADSEWSRPEVGDVMKKNAVPDWPLIATYLISEASLEGSSKWSNYIAALPRQPY  177

Query  569  S  571
            S
Sbjct  178  S  178



>gb|AFW63677.1| hypothetical protein ZEAMMB73_839660 [Zea mays]
 gb|AFW63678.1| hypothetical protein ZEAMMB73_839660 [Zea mays]
Length=306

 Score =   192 bits (488),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +2

Query  218  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  397
            VPWGC+ +SL++A++L++WL DSG+P Q++AIQRVDIGERGLVALKNIRKGEKLLFVPPS
Sbjct  61   VPWGCEIESLESAASLERWLIDSGLPEQRLAIQRVDIGERGLVALKNIRKGEKLLFVPPS  120

Query  398  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  571
            LVITADSEW  P+ G V+KR  VPDWPLIATYLISEASL  SSRW +YI+ALP QPYS
Sbjct  121  LVITADSEWGRPEVGDVMKRNSVPDWPLIATYLISEASLEGSSRWISYIAALPRQPYS  178



>ref|NP_001140387.1| uncharacterized protein LOC100272441 [Zea mays]
 gb|ACF83720.1| unknown [Zea mays]
 gb|AFW63676.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
N-methyltransferase I [Zea mays]
Length=503

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +2

Query  218  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  397
            VPWGC+ +SL++A++L++WL DSG+P Q++AIQRVDIGERGLVALKNIRKGEKLLFVPPS
Sbjct  61   VPWGCEIESLESAASLERWLIDSGLPEQRLAIQRVDIGERGLVALKNIRKGEKLLFVPPS  120

Query  398  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  571
            LVITADSEW  P+ G V+KR  VPDWPLIATYLISEASL  SSRW +YI+ALP QPYS
Sbjct  121  LVITADSEWGRPEVGDVMKRNSVPDWPLIATYLISEASLEGSSRWISYIAALPRQPYS  178



>gb|KHG10408.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit 
N-methyltransferase, chloroplastic [Gossypium arboreum]
Length=451

 Score =   192 bits (488),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 129/182 (71%), Gaps = 14/182 (8%)
 Frame = +2

Query  50   MPEASTIFQSTL--LPPFS-----QSRRALSSPICHTFFRRN-PTSFTTIRCSSVSTEAA  205
            M EAS  F +TL  LP FS     +   + S P  H    R+   S +  +  S++T   
Sbjct  1    MAEASRTFHATLFSLPTFSPRFHFKLSYSHSHPSLHLKRARSVQRSISETKTMSLNT---  57

Query  206  KIQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLF  385
               T+PWGCD DSL+NA ALQ WLSDSG+PPQK+ I +V++G+RGLVALK I +GEK+LF
Sbjct  58   ---TLPWGCDIDSLENAEALQNWLSDSGLPPQKVGINKVEMGKRGLVALKKINRGEKILF  114

Query  386  VPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQP  565
            VPPSL+IT+DS+WS P AG VLK+  V D PL+ATYLISEA+L KSSRWSNYIS+LP +P
Sbjct  115  VPPSLLITSDSDWSSPVAGHVLKQQNVADLPLLATYLISEANLQKSSRWSNYISSLPREP  174

Query  566  YS  571
            YS
Sbjct  175  YS  176



>ref|XP_006649004.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Oryza brachyantha]
Length=551

 Score =   193 bits (491),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +2

Query  218  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  397
            VPWGC+ +SL++A++L++WL+ SG+P Q++AIQRVD+GERGLVALKNIRKGEKLLFVPP 
Sbjct  109  VPWGCEIESLESAASLERWLTASGLPEQRLAIQRVDVGERGLVALKNIRKGEKLLFVPPP  168

Query  398  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  571
            LVI+ADSEW  P+ G V+KR  VPDWPL+ATYLISEASL  SSRWSNYI+ALP QPYS
Sbjct  169  LVISADSEWGCPEVGNVMKRNSVPDWPLLATYLISEASLESSSRWSNYIAALPRQPYS  226



>gb|ACG45124.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
N-methyltransferase I [Zea mays]
Length=503

 Score =   192 bits (488),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +2

Query  218  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  397
            VPWGC+ +SL++A++L++WL DSG+P Q++AIQRVDIGERGLVALKNIRKGE LLFVPPS
Sbjct  61   VPWGCEIESLESAASLERWLIDSGLPEQRLAIQRVDIGERGLVALKNIRKGENLLFVPPS  120

Query  398  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  571
            LVITADSEW  P+ G V+KR  VPDWPLIATYLISEASL  SSRW +YI+ALP QPYS
Sbjct  121  LVITADSEWGRPEVGDVMKRNSVPDWPLIATYLISEASLEGSSRWISYIAALPRQPYS  178



>dbj|BAJ90575.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=507

 Score =   187 bits (476),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +2

Query  209  IQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFV  388
            +  VPWGC+ +SL++A++L++WL+ SG+P Q++A+++VDIGERGLVALKN+R GEKLLFV
Sbjct  61   VSGVPWGCEIESLESAASLERWLTASGLPEQRLALEKVDIGERGLVALKNVRNGEKLLFV  120

Query  389  PPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPY  568
            PP+LVITADSEW+  + G V+KRY VPDWPL+ATYLISEASL  SSRWS+YI ALP QPY
Sbjct  121  PPTLVITADSEWTNREVGDVMKRYSVPDWPLLATYLISEASLEGSSRWSSYIDALPRQPY  180

Query  569  S  571
            S
Sbjct  181  S  181



>gb|EMS68033.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit 
N-methyltransferase, chloroplastic [Triticum urartu]
Length=509

 Score =   187 bits (475),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +2

Query  209  IQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFV  388
            +  VPWGC+ +SL++A++L++WL+ SG+P Q++A+++VDIGERGLVALKN+R GEKLLFV
Sbjct  60   VAGVPWGCEIESLESAASLERWLTASGLPEQRLALEKVDIGERGLVALKNVRNGEKLLFV  119

Query  389  PPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPY  568
            PP+LVITADSEWS  + G V+KRY VPDWPL+ATYLISEASL  SS+WS+YI ALP QPY
Sbjct  120  PPTLVITADSEWSNREVGDVMKRYSVPDWPLLATYLISEASLEGSSKWSSYIDALPRQPY  179

Query  569  S  571
            S
Sbjct  180  S  180



>ref|XP_010236007.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Brachypodium 
distachyon]
Length=506

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  215  TVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPP  394
            +VPWGC+ +SL++A++L++WL+ SG+P Q+MA+QRVD+GERGLVAL N+R GEKLLFVPP
Sbjct  62   SVPWGCEIESLESAASLERWLTASGLPEQRMALQRVDVGERGLVALTNVRNGEKLLFVPP  121

Query  395  SLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  571
            SLVI+ADSEWS  + G V+K Y VPDWPL+ATYLISEASL  SSRWS+YI ALP QPYS
Sbjct  122  SLVISADSEWSNREVGDVMKSYSVPDWPLLATYLISEASLEGSSRWSSYIDALPRQPYS  180



>gb|EEC73918.1| hypothetical protein OsI_08761 [Oryza sativa Indica Group]
Length=502

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +2

Query  218  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  397
            VPWGC+ +SL++A +L++WL+DSG+P Q++ IQRVD+GERGLVALKNIRKGEKLLFVPPS
Sbjct  60   VPWGCEIESLESAVSLERWLTDSGLPEQRLGIQRVDVGERGLVALKNIRKGEKLLFVPPS  119

Query  398  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  571
            LVITADSEW  P+ G VLKR  VPDWPLIATYLISEASL  SSRWS+YI+ALP QPYS
Sbjct  120  LVITADSEWGCPEVGNVLKRNSVPDWPLIATYLISEASLESSSRWSSYIAALPRQPYS  177



>ref|NP_001047982.1| Os02g0725200 [Oryza sativa Japonica Group]
 dbj|BAD12920.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase [Oryza sativa Japonica Group]
 dbj|BAD13045.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase [Oryza sativa Japonica Group]
 dbj|BAF09896.1| Os02g0725200 [Oryza sativa Japonica Group]
 dbj|BAG96165.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57721.1| hypothetical protein OsJ_08208 [Oryza sativa Japonica Group]
Length=502

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +2

Query  218  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  397
            VPWGC+ +SL++A +L++WL+DSG+P Q++ IQRVD+GERGLVALKNIRKGEKLLFVPPS
Sbjct  60   VPWGCEIESLESAVSLERWLTDSGLPEQRLGIQRVDVGERGLVALKNIRKGEKLLFVPPS  119

Query  398  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  571
            LVITADSEW  P+ G VLKR  VPDWPLIATYLISEASL  SSRWS+YI+ALP QPYS
Sbjct  120  LVITADSEWGCPEVGNVLKRNSVPDWPLIATYLISEASLESSSRWSSYIAALPRQPYS  177



>gb|EMT07134.1| hypothetical protein F775_17280 [Aegilops tauschii]
Length=579

 Score =   175 bits (444),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 105/137 (77%), Gaps = 16/137 (12%)
 Frame = +2

Query  209  IQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFV  388
            +  VPWGC+ +SL++A++L++WL+ SG+P Q++A+++VDIGERGLVALKN+R GEKLLFV
Sbjct  62   VAGVPWGCEIESLESAASLERWLTASGLPEQRLALEKVDIGERGLVALKNVRNGEKLLFV  121

Query  389  PPSLVITADS----------------EWSVPDAGQVLKRYGVPDWPLIATYLISEASLIK  520
            PP+LVITADS                EWS  + G V+KRY VP WPL+ATYLISEASL  
Sbjct  122  PPTLVITADSVEMIIQSVSPVTTPLMEWSNREVGDVMKRYSVPAWPLLATYLISEASLEG  181

Query  521  SSRWSNYISALPTQPYS  571
            SSRWS+YI ALP QPYS
Sbjct  182  SSRWSSYIDALPRQPYS  198



>gb|KHN39942.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit 
N-methyltransferase, chloroplastic [Glycine soja]
Length=409

 Score =   159 bits (403),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/89 (84%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +2

Query  305  MAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLI  484
            M I+RV++GERGLVALKNIRKGEKLLFVPPSLVIT DSEWS P+AG+VLKR  VPDWPL+
Sbjct  1    MGIERVEVGERGLVALKNIRKGEKLLFVPPSLVITPDSEWSCPEAGEVLKRNSVPDWPLL  60

Query  485  ATYLISEASLIKSSRWSNYISALPTQPYS  571
            ATYLISEASL++SSRWSNYISALP QPYS
Sbjct  61   ATYLISEASLMESSRWSNYISALPRQPYS  89



>ref|XP_008246184.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like, partial 
[Prunus mume]
Length=147

 Score =   150 bits (378),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  305  MAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLI  484
            MA+++V++GERGLVALKNIRKGEKLLFVPPSL ITADSEW+  +AG+VLK+ GVPDWP +
Sbjct  1    MALKKVEVGERGLVALKNIRKGEKLLFVPPSLFITADSEWTCGEAGKVLKQNGVPDWPFL  60

Query  485  ATYLISEASLIKSSRWSNYISALPTQPYS  571
            ATYLISEAS ++SSRWSNYISALP QPYS
Sbjct  61   ATYLISEASSLESSRWSNYISALPRQPYS  89



>ref|XP_002963244.1| hypothetical protein SELMODRAFT_80789 [Selaginella moellendorffii]
 gb|EFJ35115.1| hypothetical protein SELMODRAFT_80789 [Selaginella moellendorffii]
Length=467

 Score =   138 bits (348),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 93/126 (74%), Gaps = 2/126 (2%)
 Frame = +2

Query  200  AAKIQTVPWGCDTDS--LDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGE  373
            A +  +VPWGCDTDS  LD+  ALQ+WLS +G+P QK+ ++ V  G RGLV+ + + KG+
Sbjct  18   ACRASSVPWGCDTDSSALDSGIALQQWLSQAGLPIQKVELKNVGAGGRGLVSKRMLYKGD  77

Query  374  KLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISAL  553
            +LLF+P +L IT +SEW+  +AG+V++   +P+WP +A YLISEASL KSS W  YI+AL
Sbjct  78   RLLFLPATLAITTESEWACAEAGKVIRAKDLPEWPFLACYLISEASLGKSSPWYPYIAAL  137

Query  554  PTQPYS  571
            P +P S
Sbjct  138  PRRPGS  143



>ref|XP_001754252.1| predicted protein [Physcomitrella patens]
 gb|EDQ80702.1| predicted protein, partial [Physcomitrella patens]
Length=431

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 83/118 (70%), Gaps = 0/118 (0%)
 Frame = +2

Query  218  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  397
            V WGCD  S++  S LQ WL   G+  QK+ + RVD G RGLVA +++R+GE+LLFVP  
Sbjct  1    VNWGCDPQSIEKGSLLQDWLMKEGLAKQKLVLDRVDSGGRGLVATQSLRQGERLLFVPSG  60

Query  398  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  571
            L+ITADSEW   + G+++K  G+P+WP++A +LISEAS  +SSRW  Y + LP  P S
Sbjct  61   LLITADSEWGCAETGRIIKEAGLPEWPMLAIFLISEASREESSRWFPYFATLPKTPSS  118



>ref|XP_002974548.1| hypothetical protein SELMODRAFT_101776 [Selaginella moellendorffii]
 gb|EFJ24068.1| hypothetical protein SELMODRAFT_101776 [Selaginella moellendorffii]
Length=467

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 93/126 (74%), Gaps = 2/126 (2%)
 Frame = +2

Query  200  AAKIQTVPWGCDTDS--LDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGE  373
            A +  +VPWGCDTDS  L++  ALQ+WLS +G+P QK+ ++ V  G RGLV+ + + KG+
Sbjct  18   ACRASSVPWGCDTDSSALNSGIALQQWLSQAGLPIQKVELKNVGAGGRGLVSKRMLYKGD  77

Query  374  KLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISAL  553
            +LLF+P +L IT +SEW+  +AG+V++   +P+WP +A YLISEASL KSS W  YI+AL
Sbjct  78   RLLFLPATLAITTESEWACAEAGKVIRAKDLPEWPFLACYLISEASLGKSSPWYPYIAAL  137

Query  554  PTQPYS  571
            P +P S
Sbjct  138  PRRPGS  143



>gb|KCW89043.1| hypothetical protein EUGRSUZ_A01370 [Eucalyptus grandis]
 gb|KCW89044.1| hypothetical protein EUGRSUZ_A01370 [Eucalyptus grandis]
Length=439

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  338  GLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLI  517
            GLVALKN+RKGEKLLFVPP LVITADSEW   +AG+VLK+  VPDWPL+A YLISEASL+
Sbjct  37   GLVALKNVRKGEKLLFVPPPLVITADSEWGCAEAGEVLKKNSVPDWPLLAIYLISEASLM  96

Query  518  KSSRWSNYISALPTQPYS  571
             SSRWSNYISALP QPYS
Sbjct  97   GSSRWSNYISALPRQPYS  114



>gb|KCW89045.1| hypothetical protein EUGRSUZ_A01370 [Eucalyptus grandis]
Length=464

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  338  GLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLI  517
            GLVALKN+RKGEKLLFVPP LVITADSEW   +AG+VLK+  VPDWPL+A YLISEASL+
Sbjct  37   GLVALKNVRKGEKLLFVPPPLVITADSEWGCAEAGEVLKKNSVPDWPLLAIYLISEASLM  96

Query  518  KSSRWSNYISALPTQPYS  571
             SSRWSNYISALP QPYS
Sbjct  97   GSSRWSNYISALPRQPYS  114



>emb|CDY71476.1| BnaCnng73100D [Brassica napus]
Length=124

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 58/93 (62%), Gaps = 17/93 (18%)
 Frame = +2

Query  251  NASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITADSEWSV  430
             AS  +KWLS                 ERGLVA +N+RKGEKLLFVPPSLVI ADS  S 
Sbjct  21   QASHRRKWLSTE------------STSERGLVASQNLRKGEKLLFVPPSLVIRADSVSSK  68

Query  431  P-----DAGQVLKRYGVPDWPLIATYLISEASL  514
                  +A +V+KRY VPDWPL+ATYLISE  L
Sbjct  69   ACGPNGEAREVMKRYDVPDWPLLATYLISEGKL  101



>gb|KCW89046.1| hypothetical protein EUGRSUZ_A01370 [Eucalyptus grandis]
Length=381

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  413  DSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  571
            D EW   +AG+VLK+  VPDWPL+A YLISEASL+ SSRWSNYISALP QPYS
Sbjct  4    DQEWGCAEAGEVLKKNSVPDWPLLAIYLISEASLMGSSRWSNYISALPRQPYS  56



>ref|XP_010689224.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=413

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  422  WSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  571
            WS P+AG+VLKR  VPDWPL+ATYLISEAS + SSRWSNYISALP QPYS
Sbjct  39   WSCPEAGKVLKRNSVPDWPLLATYLISEASQMSSSRWSNYISALPRQPYS  88



>ref|XP_005649983.1| ResB-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE25439.1| ResB-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=889

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 60/104 (58%), Gaps = 2/104 (2%)
 Frame = +2

Query  257  SALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITADSEWSVPD  436
             +L+ WL+  G+PPQK+AI       RGLVA + +RK EKLL VP  L++TAD       
Sbjct  32   GSLEDWLTHRGLPPQKVAISHEIPEGRGLVATRRVRKHEKLLNVPAQLLLTADVALQHSA  91

Query  437  AGQVLKRYGVPDWPLIATYLISEASLIKSSR--WSNYISALPTQ  562
             G +L+  GVP W ++AT+L       +  +  W  Y+ ALP+Q
Sbjct  92   YGGLLESCGVPAWSVLATFLAETRRQPEGDKNVWGQYVDALPSQ  135



>emb|CDX78685.1| BnaA03g05970D [Brassica napus]
Length=133

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  218  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGL  343
            + WGC+ DS++NA++LQ+WL++SG PP+KMA+  VDI ER L
Sbjct  7    ISWGCNIDSVENATSLQRWLTNSGFPPKKMAVDSVDIREREL  48



>emb|CDY06579.1| BnaC02g13030D [Brassica napus]
Length=129

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  218  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGER  337
            + WGC+ DS++NA++LQ+WL++SG PP+KMA+  VDI ER
Sbjct  7    ISWGCNIDSVENATSLQRWLTNSGFPPKKMAVDSVDIRER  46



>ref|XP_001419603.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97896.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=524

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 77/142 (54%), Gaps = 13/142 (9%)
 Frame = +2

Query  158  TSFTTIRCSSVSTEAAKIQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGE-  334
            T+ T  R  S   + A+I   P G  + +    + L +WL    +P QKMA++ V++ E 
Sbjct  55   TTSTRGRAESARYDDAEI---PRGVGSAT---KAELARWLEGRRLPGQKMALE-VNLAEG  107

Query  335  RGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASL  514
            RGLVA + I++GE LL VP + +IT   E ++ +A    K   + +W ++AT+L  +A  
Sbjct  108  RGLVATEEIKRGEALLGVPRTTLITV--ERAIAEAKLGPKHAELQEWSVLATFLAQQALA  165

Query  515  IKS---SRWSNYISALPTQPYS  571
            ++S     +  YI ALP +  S
Sbjct  166  LESGTAGTFGEYIRALPRRTGS  187



>ref|XP_003081307.1| putative methyltransferase (ISS) [Ostreococcus tauri]
Length=505

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 66/121 (55%), Gaps = 8/121 (7%)
 Frame = +2

Query  218  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  397
            +P G  + + ++   L +WL+ +G+  QKM ++      RGLVA + I++GE LL V  S
Sbjct  55   IPRGVGSATRED---LTRWLASNGLRAQKMTLESNLAEGRGLVATEEIKRGEALLGVDAS  111

Query  398  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSR---WSNYISALPTQPY  568
             +IT   E ++ +A    +   + +W ++AT+L  +A  ++S     +  YI ALP +  
Sbjct  112  CLITV--ERAIAEAKLGPRHAELQEWSVLATFLAQQAMALESGNAGTFGEYIRALPRRTG  169

Query  569  S  571
            S
Sbjct  170  S  170



>emb|CEF99133.1| Rubisco LS methyltransferase, substrate-binding domain [Ostreococcus 
tauri]
Length=531

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 66/121 (55%), Gaps = 8/121 (7%)
 Frame = +2

Query  218  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  397
            +P G  + + ++   L +WL+ +G+  QKM ++      RGLVA + I++GE LL V  S
Sbjct  81   IPRGVGSATRED---LTRWLASNGLRAQKMTLESNLAEGRGLVATEEIKRGEALLGVDAS  137

Query  398  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSR---WSNYISALPTQPY  568
             +IT   E ++ +A    +   + +W ++AT+L  +A  ++S     +  YI ALP +  
Sbjct  138  CLITV--ERAIAEAKLGPRHAELQEWSVLATFLAQQAMALESGNAGTFGEYIRALPRRTG  195

Query  569  S  571
            S
Sbjct  196  S  196



>ref|XP_002505573.1| set domain protein [Micromonas sp. RCC299]
 gb|ACO66831.1| set domain protein [Micromonas sp. RCC299]
Length=509

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/143 (31%), Positives = 70/143 (49%), Gaps = 15/143 (10%)
 Frame = +2

Query  146  RRNPTSFTTIRCSSVSTEAAKIQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVD  325
            RR P   +  R  +V+ +A+         D+ +  +  AL  WL   G+   K++   VD
Sbjct  30   RRAPPPLSQRRPRAVAVDAS--------VDSRTQADFDALWAWLGSEGVDVSKVSPALVD  81

Query  326  I--GERG--LVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATY  493
               G RG  LVA ++I  G+ +L +P SL +T D+  + P         G   W  +A  
Sbjct  82   AAPGGRGWGLVAAEDIGGGDAVLAIPRSLWMTVDTALASPIGAHCGDEAG---WIAVALQ  138

Query  494  LISEASLIKSSRWSNYISALPTQ  562
            L+ E S+ + SRW+ Y++ALP Q
Sbjct  139  LLHERSIGEKSRWAAYVNALPAQ  161



>ref|XP_002945653.1| hypothetical protein VOLCADRAFT_120141 [Volvox carteri f. nagariensis]
 gb|EFJ52648.1| hypothetical protein VOLCADRAFT_120141 [Volvox carteri f. nagariensis]
Length=163

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/132 (26%), Positives = 67/132 (51%), Gaps = 13/132 (10%)
 Frame = +2

Query  197  EAAKIQTVPWGCDTDSLDNASA----------LQKWLSDSG--MPPQKMAIQRVDIGERG  340
            +  +++ +  GC  ++L  AS           L+ W+ +    +P Q   +QR D G   
Sbjct  20   DVKRVRALDGGCQEEALAEASGSGAADPRAARLKAWVLEHSKTLPTQLTPVQRSD-GSYS  78

Query  341  LVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIK  520
            LVA + +R+G+ L+ VP  L+++ D+  +    G+ ++  G+ +W  +  +L+ E +L  
Sbjct  79   LVADEPVRRGQILVRVPRRLLMSQDTARASEACGRTVREAGLNEWQSLILHLLCERALGS  138

Query  521  SSRWSNYISALP  556
             S W+ Y+  LP
Sbjct  139  RSFWAPYLDTLP  150



>ref|XP_007510589.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18122.1| predicted protein [Bathycoccus prasinos]
Length=543

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 58/117 (50%), Gaps = 14/117 (12%)
 Frame = +2

Query  230  CDTDSLDNASALQKWLSD-SGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVI  406
            C  D LD       WL+D   +P QKM ++      RGLVA ++I++GEK+L +P   +I
Sbjct  86   CSKDELD------AWLADIMKLPEQKMKLEYFKEEGRGLVATESIKRGEKVLEIPQEAII  139

Query  407  TADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSS-------RWSNYISALP  556
            T +         +  K   + +W ++AT+L   A  + +        R++ Y+ ALP
Sbjct  140  TVEVALKESLLREKKKLAELQEWSILATFLAETAQNLSTEDNSSNKYRFATYVKALP  196



>ref|XP_008617921.1| hypothetical protein SDRG_13603 [Saprolegnia diclina VS20]
 gb|EQC28729.1| hypothetical protein SDRG_13603 [Saprolegnia diclina VS20]
Length=400

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 54/106 (51%), Gaps = 3/106 (3%)
 Frame = +2

Query  248  DNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITADSEWS  427
            D+ +   +WL++ G     +AI R   G RG+VA +++   E  + +P +L+I+  S   
Sbjct  4    DDEARFLRWLTEHGAKIDALAITRDLDGGRGVVATRDLAPNEIAMSIPEALMISEASVKL  63

Query  428  VPDAGQVLKRYG---VPDWPLIATYLISEASLIKSSRWSNYISALP  556
             PD G +  R+      D PL+AT++     L   S +  Y+S LP
Sbjct  64   DPDLGPIFARHSDLFARDDPLLATFVAHHMHLGHHSFYYPYLSTLP  109



>ref|XP_005850299.1| hypothetical protein CHLNCDRAFT_142047 [Chlorella variabilis]
 gb|EFN58197.1| hypothetical protein CHLNCDRAFT_142047 [Chlorella variabilis]
Length=485

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 51/100 (51%), Gaps = 0/100 (0%)
 Frame = +2

Query  263  LQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAG  442
            L+ WL + G+PP K+A        RGLVA + I KGE LL +P  LV+T  +        
Sbjct  61   LKAWLIERGLPPPKLAAAATPGSGRGLVAAQPIGKGESLLSIPQQLVLTPAAALEQSCLR  120

Query  443  QVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQ  562
             +L+   +P W ++A +L  + +   +  W  Y+  LP +
Sbjct  121  PLLEEQPLPAWSVLALWLAEQRAAGSAGGWWPYVRLLPER  160



>ref|XP_008607111.1| hypothetical protein SDRG_03258 [Saprolegnia diclina VS20]
 gb|EQC39050.1| hypothetical protein SDRG_03258 [Saprolegnia diclina VS20]
Length=401

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 51/99 (52%), Gaps = 3/99 (3%)
 Frame = +2

Query  269  KWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQV  448
            +WL++ G     +AI R   G RG+VA +++   E  + +P +L+I+  S    PD G +
Sbjct  12   RWLTERGAKIDALAITRDLDGGRGVVATRDLAPNEVAMSIPEALMISEASVKLDPDLGPI  71

Query  449  LKRYG---VPDWPLIATYLISEASLIKSSRWSNYISALP  556
              R+      D PL+AT++     L   S +  Y+S LP
Sbjct  72   FARHSDLFARDDPLLATFVAHHMHLGHHSFYYPYLSTLP  110



>ref|XP_008179710.1| PREDICTED: uncharacterized protein LOC103308320 [Acyrthosiphon 
pisum]
Length=301

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 47/102 (46%), Gaps = 5/102 (5%)
 Frame = +2

Query  260  ALQKWLSDSGMPPQKMAI--QRVDIGERGLVALKNIRKGEKLLFVPPSLVITADSEWSVP  433
            +L  W+   G  P    +     D G RGL+A +NI  G+ L  VP  LVIT DS    P
Sbjct  89   SLTTWMKSHGWKPTCRLVPASFADTG-RGLMAAQNIDAGQPLAIVPGCLVITVDSVSMSP  147

Query  434  DAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPT  559
                    Y      ++ATYL+ E      S W NYI +LPT
Sbjct  148  FGKHFTTVYKTQQ--VLATYLMFERHKGSESFWHNYIVSLPT  187



>ref|XP_008551338.1| PREDICTED: SET domain-containing protein 4 isoform X3 [Microplitis 
demolitor]
Length=416

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/108 (27%), Positives = 50/108 (46%), Gaps = 1/108 (1%)
 Frame = +2

Query  239  DSLDNASALQKWLSDSG-MPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITAD  415
            + L     L+ W+   G  P   M      +  RGL+ L+NI     L+ +P  L+IT  
Sbjct  30   EDLSTIEQLESWMKSVGWTPSTNMKPTIFPVTHRGLITLENISPDTPLVKIPKELLITPS  89

Query  416  SEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPT  559
              W+       +++ G     ++AT+L+ E  L  +S W +Y+ +LP 
Sbjct  90   VAWNSNVKSIFIEKNGYTGHSVLATFLLYEKHLGTTSTWKHYLDSLPN  137



>gb|KDO26770.1| hypothetical protein SPRG_20573 [Saprolegnia parasitica CBS 223.65]
Length=403

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 52/100 (52%), Gaps = 3/100 (3%)
 Frame = +2

Query  269  KWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQV  448
            +WL+++G     +AI     G RG+VA +++   E  + +P +L+I+  S    PD G +
Sbjct  11   RWLTENGAKIDALAITHDLDGGRGVVATRDLAPNEVAMSIPEALMISEASVKLDPDLGPI  70

Query  449  LKRYG---VPDWPLIATYLISEASLIKSSRWSNYISALPT  559
              R+      D PL+AT++     L   S +  Y+S LPT
Sbjct  71   FARHSDLFARDDPLLATFVAHHMDLGPHSFYYPYLSMLPT  110



>ref|WP_043409385.1| hypothetical protein [Cystobacter violaceus]
 gb|KFA88255.1| hypothetical protein Q664_42470 [Cystobacter violaceus Cb vi76]
Length=457

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 55/108 (51%), Gaps = 4/108 (4%)
 Frame = +2

Query  239  DSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITADS  418
            DS    + L +WL D G    K+ I R   GER ++A  +I  GE +L VP   +IT + 
Sbjct  21   DSDQKLATLLRWLEDGGARLPKLHIARQQNGERSVLARADIAAGEAVLQVPRGHLITLEV  80

Query  419  EWSVPDAGQVLKRYGVPDWPLI--ATYLISEASLIKSSRWSNYISALP  556
              S  D G++++ +  PD   I  A++L+ E  L   S W  Y+  LP
Sbjct  81   AKS-SDIGRLIQSHVNPDNEEIYLASFLLQE-KLRPDSFWKPYVDTLP  126



>ref|XP_008551336.1| PREDICTED: SET domain-containing protein 4 isoform X2 [Microplitis 
demolitor]
 ref|XP_008551337.1| PREDICTED: SET domain-containing protein 4 isoform X2 [Microplitis 
demolitor]
Length=429

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/108 (27%), Positives = 50/108 (46%), Gaps = 1/108 (1%)
 Frame = +2

Query  239  DSLDNASALQKWLSDSG-MPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITAD  415
            + L     L+ W+   G  P   M      +  RGL+ L+NI     L+ +P  L+IT  
Sbjct  20   EDLSTIEQLESWMKSVGWTPSTNMKPTIFPVTHRGLITLENISPDTPLVKIPKELLITPS  79

Query  416  SEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPT  559
              W+       +++ G     ++AT+L+ E  L  +S W +Y+ +LP 
Sbjct  80   VAWNSNVKSIFIEKNGYTGHSVLATFLLYEKHLGTTSTWKHYLDSLPN  127



>gb|EJY74649.1| SET domain containing protein [Oxytricha trifallax]
Length=2165

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 32/104 (31%), Positives = 52/104 (50%), Gaps = 8/104 (8%)
 Frame = +2

Query  263  LQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAG  442
            L KWL   G   +K+ I+      RG+ A ++I+KGE +L+VP   +IT +   + P  G
Sbjct  150  LLKWLEQGGSHFEKLKIRYYTADYRGVHAARDIKKGEIILYVPKHQIITLEMAMTSP-VG  208

Query  443  QVLKRYGV------PDWPLIATYLISEASLIKSSRWSNYISALP  556
            + +   G+      P    ++TY++ E      S+W  YI  LP
Sbjct  209  KKMYEKGLRQRLISPKHSFLSTYIMQEKRK-PESQWQIYIDILP  251



>ref|XP_008551335.1| PREDICTED: SET domain-containing protein 4 isoform X1 [Microplitis 
demolitor]
Length=439

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/108 (27%), Positives = 50/108 (46%), Gaps = 1/108 (1%)
 Frame = +2

Query  239  DSLDNASALQKWLSDSG-MPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITAD  415
            + L     L+ W+   G  P   M      +  RGL+ L+NI     L+ +P  L+IT  
Sbjct  30   EDLSTIEQLESWMKSVGWTPSTNMKPTIFPVTHRGLITLENISPDTPLVKIPKELLITPS  89

Query  416  SEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPT  559
              W+       +++ G     ++AT+L+ E  L  +S W +Y+ +LP 
Sbjct  90   VAWNSNVKSIFIEKNGYTGHSVLATFLLYEKHLGTTSTWKHYLDSLPN  137



>ref|XP_001774765.1| predicted protein [Physcomitrella patens]
 gb|EDQ60436.1| predicted protein [Physcomitrella patens]
Length=523

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 49/184 (27%), Positives = 80/184 (43%), Gaps = 18/184 (10%)
 Frame = +2

Query  35   PRSSAMPEASTIFQSTLLPP-FSQSRRALSSPICHTFFRRNPTSFTTIRCSSVSTEAAKI  211
            PRSSA+   +  F   L PP F   + A+SS    +  R N  +    +        +K 
Sbjct  26   PRSSAVRYTTLGFVGNLCPPRFGTQKVAVSSEKRGSRCR-NTLTTDVYKQDENDLAQSKK  84

Query  212  QTVPWGCDTDSLDNASALQKWLSDSGMPPQK--MAIQRVDIGERG-----LVALKNIRKG  370
            Q    G D         L++W+ + G+P  K  +A  +   G++G     +VA ++++ G
Sbjct  85   QEHESGID---------LKQWMEEQGLPECKVSLAEHQPSEGDKGKPIHYVVASEDLQPG  135

Query  371  EKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISA  550
            E  L +P SLV+T +         ++L    + +   +A YL+ E    K S W  YI  
Sbjct  136  ELALTIPKSLVVTLERVLGDETIAELLTTNKLSELACLALYLMYEKKQGKESYWYPYIRE  195

Query  551  LPTQ  562
            L  Q
Sbjct  196  LDRQ  199



>gb|ETL26697.1| hypothetical protein L916_19665 [Phytophthora parasitica]
Length=918

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 31/109 (28%), Positives = 58/109 (53%), Gaps = 5/109 (5%)
 Frame = +2

Query  248  DNASALQKWLSDSG-MPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITAD---  415
            +  S    W   +G      +AI+      +G+VAL+++++ ++LLFVP S++I  D   
Sbjct  66   EKISTFLNWFQTAGGNVSSNIAIKMFPEMGKGMVALQSVKENDELLFVPTSIIICYDTVA  125

Query  416  SEWSV-PDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPT  559
            +EWS  P   + L +       L+  +L+ E +  ++SRW+ Y+  LP+
Sbjct  126  TEWSSHPKLKKNLVKLENDQEELLTAFLVWERAKGQASRWAPYLQLLPS  174



>gb|ETK73260.1| hypothetical protein L915_19780 [Phytophthora parasitica]
Length=918

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 26/79 (33%), Positives = 49/79 (62%), Gaps = 4/79 (5%)
 Frame = +2

Query  335  RGLVALKNIRKGEKLLFVPPSLVITAD---SEWSV-PDAGQVLKRYGVPDWPLIATYLIS  502
            +G+VAL+++++ ++LLFVP S++I  D   +EWS  P   + L +       L+  +L+ 
Sbjct  96   KGMVALQSVKENDELLFVPTSIIICYDTVATEWSSHPKLKKNLVKLENDQEELLTAFLVW  155

Query  503  EASLIKSSRWSNYISALPT  559
            E +  ++SRW+ Y+  LP+
Sbjct  156  ERAKGQASRWAPYLQLLPS  174



>gb|ETP02735.1| hypothetical protein F441_20218 [Phytophthora parasitica CJ01A1]
Length=918

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 31/109 (28%), Positives = 58/109 (53%), Gaps = 5/109 (5%)
 Frame = +2

Query  248  DNASALQKWLSDSG-MPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITAD---  415
            +  S    W   +G      +AI+      +G+VAL+++++ ++LLFVP S++I  D   
Sbjct  66   EKISTFLNWFQTAGGNVSSNIAIKMFPEMGKGIVALQSVKENDELLFVPTSIIICYDTVA  125

Query  416  SEWSV-PDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPT  559
            +EWS  P   + L +       L+  +L+ E +  ++SRW+ Y+  LP+
Sbjct  126  TEWSSHPKLKKNLVKLENDQEELLTAFLVWERAKGQASRWAPYLQLLPS  174



>ref|XP_010203409.1| PREDICTED: SET domain-containing protein 4 [Colius striatus]
Length=244

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 57/119 (48%), Gaps = 3/119 (3%)
 Frame = +2

Query  206  KIQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLF  385
            ++Q   +G +         L+KWL D G     +      +  RGL+  K ++ G+ ++ 
Sbjct  16   QLQNFMYGVNCSHKLEYVKLKKWLKDRGFQDSNLRPAEFWVTGRGLMTTKALQAGDLIIS  75

Query  386  VPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIA--TYLISEASLIKSSRWSNYISALP  556
            +P   ++T  +  S    G+ + R+  P  PL+A  T+LI+E    ++S W  Y+  LP
Sbjct  76   LPEKCLVTTGTVLS-SCLGEYIMRWKPPVSPLVALCTFLIAERHAGENSLWKPYLDVLP  133



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 669314531515