BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF038P10

Length=304
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ADB03784.1|  catalase                                                196   9e-58   Ipomoea batatas [batate]
gb|AAC84138.1|  catalase                                                186   2e-57   Cichorium intybus [radicchio]
gb|ADI58890.1|  catalase                                                184   1e-56   Vigna mungo [urad dal]
sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                          192   2e-56   Ipomoea batatas [batate]
emb|CBI29557.3|  unnamed protein product                                183   2e-56   Vitis vinifera
ref|XP_006382986.1|  hypothetical protein POPTR_0005s10340g             191   8e-56   
ref|NP_001237556.1|  catalase-1/2                                       190   2e-55   Glycine max [soybeans]
ref|XP_007160597.1|  hypothetical protein PHAVU_001G001000g             190   2e-55   Phaseolus vulgaris [French bean]
ref|NP_001235974.1|  catalase-3                                         189   2e-55   Glycine max [soybeans]
gb|KGN55500.1|  hypothetical protein Csa_4G658600                       187   2e-55   Cucumis sativus [cucumbers]
ref|XP_010242895.1|  PREDICTED: catalase isozyme 1-like isoform X2      188   3e-55   Nelumbo nucifera [Indian lotus]
gb|AHG98056.1|  catalase                                                184   3e-55   Plectranthus barbatus
ref|XP_006382987.1|  hypothetical protein POPTR_0005s10340g             188   3e-55   
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3               189   4e-55   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                      189   4e-55   Nicotiana tomentosiformis
ref|XP_008452957.1|  PREDICTED: catalase isozyme 1-like                 189   4e-55   Cucumis melo [Oriental melon]
gb|ABF93811.1|  Catalase-1, putative, expressed                         186   4e-55   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                      189   4e-55   Nicotiana sylvestris
ref|XP_004985840.1|  PREDICTED: catalase-1-like                         189   5e-55   Setaria italica
gb|AGI65617.1|  catalase                                                188   5e-55   Fragaria x ananassa
sp|P49315.1|CATA1_NICPL  RecName: Full=Catalase isozyme 1               189   5e-55   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_006382992.1|  hypothetical protein POPTR_0005s10340g             189   5e-55   
ref|XP_009794245.1|  PREDICTED: catalase isozyme 1                      189   5e-55   Nicotiana sylvestris
ref|XP_002306427.1|  hypothetical protein POPTR_0005s10340g             189   5e-55   Populus trichocarpa [western balsam poplar]
ref|XP_006828715.1|  hypothetical protein AMTR_s00001p00024160          189   6e-55   Amborella trichopoda
ref|XP_006382990.1|  hypothetical protein POPTR_0005s10340g             188   6e-55   
ref|XP_010242894.1|  PREDICTED: catalase isozyme 1-like isoform X1      189   6e-55   Nelumbo nucifera [Indian lotus]
gb|AAF61734.1|AF243519_1  catalase 4                                    189   6e-55   Helianthus annuus
gb|AAB62892.1|  catalase-1                                              189   6e-55   Nicotiana glutinosa
emb|CCP37650.1|  catalase-1                                             189   6e-55   Nicotiana tabacum [American tobacco]
gb|AFU48609.1|  catalase 1                                              189   6e-55   Nicotiana benthamiana
ref|XP_009597278.1|  PREDICTED: catalase isozyme 1                      189   6e-55   Nicotiana tomentosiformis
gb|ACL27272.1|  catalase                                                189   6e-55   Nicotiana benthamiana
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                      189   6e-55   
dbj|BAC79443.1|  catalase                                               189   6e-55   Acacia ampliceps
ref|XP_004300681.1|  PREDICTED: catalase isozyme 1                      188   7e-55   Fragaria vesca subsp. vesca
gb|AAB71764.1|  catalase 1                                              188   7e-55   Nicotiana tabacum [American tobacco]
gb|AET97564.1|  catalase                                                188   8e-55   Ziziphus jujuba [Chinese jujube]
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like                 188   8e-55   Eucalyptus grandis [rose gum]
tpg|DAA43177.1|  TPA: catalase2                                         188   8e-55   
sp|P17598.2|CATA1_GOSHI  RecName: Full=Catalase isozyme 1               188   8e-55   Gossypium hirsutum [American cotton]
ref|XP_007046520.1|  Catalase 2                                         188   8e-55   Theobroma cacao [chocolate]
gb|AAF61733.1|AF243518_1  catalase 3                                    188   9e-55   Helianthus annuus
emb|CAE82295.1|  catalase                                               188   9e-55   Homogyne alpina
ref|NP_001289779.1|  catalase isozyme 1                                 188   1e-54   Nelumbo nucifera [Indian lotus]
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3           188   1e-54   Sesamum indicum [beniseed]
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2           188   1e-54   
gb|KDP43757.1|  hypothetical protein JCGZ_22384                         188   1e-54   Jatropha curcas
gb|KJB14250.1|  hypothetical protein B456_002G115900                    188   1e-54   Gossypium raimondii
dbj|BAA34714.1|  catalase                                               188   1e-54   Oryza sativa [red rice]
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                      188   1e-54   Solanum lycopersicum
ref|NP_001048861.1|  Os03g0131200                                       188   1e-54   
gb|AAC19397.1|  leaf catalase                                           188   1e-54   Mesembryanthemum crystallinum
ref|XP_010530333.1|  PREDICTED: catalase-2                              188   1e-54   Tarenaya hassleriana [spider flower]
gb|AGE15298.2|  catalase 1                                              188   1e-54   Eriobotrya japonica [loquat]
gb|AGC65520.1|  catalase                                                188   1e-54   Eriobotrya japonica [loquat]
sp|O24339.1|CATA_SOLAP  RecName: Full=Catalase                          187   1e-54   Soldanella alpina
ref|XP_007018034.1|  Catalase 2                                         187   1e-54   
ref|XP_010692546.1|  PREDICTED: catalase                                187   1e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1              187   1e-54   
gb|ACJ71245.1|  catalase 2                                              185   1e-54   Vigna unguiculata
gb|ACJ71244.1|  catalase 2                                              185   1e-54   Vigna unguiculata
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2              187   1e-54   Cicer arietinum [garbanzo]
gb|AHB72694.1|  catalase                                                187   1e-54   Beta vulgaris subsp. maritima [sea beet]
gb|ABY21704.1|  catalase-1 precursor                                    187   2e-54   Panax ginseng [Asiatic ginseng]
gb|AAO17721.1|  catalase                                                187   2e-54   Hypericum perforatum
ref|XP_003558892.1|  PREDICTED: catalase-1                              187   2e-54   Brachypodium distachyon [annual false brome]
tpg|DAA43178.1|  TPA: catalase2                                         188   2e-54   
gb|AAX88799.1|  catalase                                                187   2e-54   Euphorbia characias
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                    187   2e-54   Arabis alpina [alpine rockcress]
ref|NP_001291326.1|  catalase isozyme 1                                 187   2e-54   Sesamum indicum [beniseed]
gb|AAK67359.2|AF390210_1  catalase                                      187   2e-54   Suaeda salsa
ref|XP_008348922.1|  PREDICTED: catalase isozyme 1-like                 186   2e-54   
gb|ADU56199.1|  catalase                                                187   2e-54   Hevea brasiliensis [jebe]
ref|XP_006342134.1|  PREDICTED: catalase isozyme 3-like                 187   2e-54   Solanum tuberosum [potatoes]
gb|KEH36313.1|  catalase heme-binding enzyme                            186   2e-54   Medicago truncatula
gb|KJB17473.1|  hypothetical protein B456_003G002800                    187   2e-54   Gossypium raimondii
gb|KHG25152.1|  Catalase isozyme 1                                      187   2e-54   Gossypium arboreum [tree cotton]
gb|KHG12976.1|  Catalase isozyme 2                                      187   2e-54   Gossypium arboreum [tree cotton]
gb|KJB17474.1|  hypothetical protein B456_003G002800                    186   2e-54   Gossypium raimondii
sp|P30567.1|CATA2_GOSHI  RecName: Full=Catalase isozyme 2               187   2e-54   Gossypium hirsutum [American cotton]
ref|XP_008382478.1|  PREDICTED: catalase isozyme 1-like                 186   3e-54   
gb|AAR84577.1|  catalase 1b                                             186   3e-54   Lotus japonicus
ref|XP_008373403.1|  PREDICTED: catalase isozyme 1                      187   3e-54   
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1               187   3e-54   Ricinus communis
ref|XP_010432341.1|  PREDICTED: catalase-2-like                         187   3e-54   Camelina sativa [gold-of-pleasure]
ref|XP_006649332.1|  PREDICTED: catalase-1-like                         187   3e-54   Oryza brachyantha
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                      187   3e-54   
sp|Q43206.1|CATA1_WHEAT  RecName: Full=Catalase-1                       187   3e-54   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010437527.1|  PREDICTED: catalase-2                              187   3e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010446982.1|  PREDICTED: catalase-2-like                         186   4e-54   Camelina sativa [gold-of-pleasure]
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                      186   4e-54   Prunus mume [ume]
gb|AAR84578.1|  catalase 1a                                             186   4e-54   Lotus japonicus
gb|AIA61608.1|  catalase                                                186   4e-54   Gynostemma pentaphyllum [jiaogulan]
gb|AAM97541.1|  catalase 2                                              186   4e-54   Capsicum annuum
gb|KEH36312.1|  catalase heme-binding enzyme                            186   4e-54   Medicago truncatula
gb|AIP93616.1|  CAT1                                                    186   4e-54   Bassia scoparia [burning bush]
emb|CDY31877.1|  BnaC07g15270D                                          186   5e-54   Brassica napus [oilseed rape]
ref|XP_009103333.1|  PREDICTED: catalase-1                              186   5e-54   Brassica rapa
emb|CDY01363.1|  BnaA07g11360D                                          186   5e-54   
ref|XP_010523643.1|  PREDICTED: catalase-2-like                         186   5e-54   Tarenaya hassleriana [spider flower]
ref|XP_002521709.1|  catalase, putative                                 186   5e-54   Ricinus communis
ref|NP_001240021.1|  catalase                                           186   5e-54   Glycine max [soybeans]
ref|NP_001237571.1|  catalase-4                                         186   5e-54   Glycine max [soybeans]
ref|XP_010536470.1|  PREDICTED: catalase-2-like                         186   5e-54   Tarenaya hassleriana [spider flower]
gb|ACH63223.1|  catalase                                                186   5e-54   Rheum australe [Himalayan rhubarb]
dbj|BAA05494.1|  catalase                                               186   6e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg             186   6e-54   Eutrema salsugineum [saltwater cress]
emb|CDX76313.1|  BnaA08g10870D                                          186   6e-54   
sp|P45739.1|CATA_HELAN  RecName: Full=Catalase                          186   6e-54   Helianthus annuus
gb|ADZ45555.1|  catalase                                                186   6e-54   Vigna radiata [mung bean]
emb|CDY17510.1|  BnaC03g65530D                                          186   6e-54   Brassica napus [oilseed rape]
emb|CDY52649.1|  BnaAnng11640D                                          185   6e-54   Brassica napus [oilseed rape]
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                          186   7e-54   Vigna radiata var. radiata [golden gram]
emb|CDP07287.1|  unnamed protein product                                186   7e-54   Coffea canephora [robusta coffee]
gb|ADZ45556.1|  catalase                                                186   7e-54   Vigna radiata [mung bean]
gb|ABK24453.1|  unknown                                                 186   7e-54   Picea sitchensis
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g             186   7e-54   Phaseolus vulgaris [French bean]
gb|AIZ77475.1|  catalase                                                186   8e-54   Triticum aestivum [Canadian hard winter wheat]
gb|AAK96854.1|  catalase                                                186   8e-54   Arabidopsis thaliana [mouse-ear cress]
sp|P25890.1|CATA_PEA  RecName: Full=Catalase                            186   8e-54   Pisum sativum [garden pea]
emb|CDX72514.1|  BnaC07g45360D                                          185   8e-54   
gb|AGV54297.1|  peroxisomal catalase                                    186   8e-54   Phaseolus vulgaris [French bean]
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg             186   8e-54   Prunus persica
ref|XP_010061175.1|  PREDICTED: catalase-like                           186   8e-54   Eucalyptus grandis [rose gum]
ref|XP_011022153.1|  PREDICTED: catalase-2-like isoform X2              186   8e-54   Populus euphratica
emb|CAD42908.1|  catalase                                               186   8e-54   Prunus persica
dbj|BAQ21275.1|  catalase                                               185   8e-54   Citrus tamurana
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                      186   8e-54   Populus euphratica
gb|ACJ11733.1|  catalase                                                186   8e-54   Gossypium hirsutum [American cotton]
ref|XP_002306976.2|  catalase family protein                            186   8e-54   
gb|KCW68093.1|  hypothetical protein EUGRSUZ_F01775                     183   9e-54   Eucalyptus grandis [rose gum]
ref|NP_001031791.1|  catalase 2                                         185   9e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010063132.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    186   9e-54   
ref|NP_195235.1|  catalase 2                                            186   9e-54   Arabidopsis thaliana [mouse-ear cress]
gb|KJB57963.1|  hypothetical protein B456_009G187600                    186   9e-54   Gossypium raimondii
dbj|BAJ90861.1|  predicted protein                                      186   9e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACA50528.1|  putative catalase 2                                     186   9e-54   Brassica napus [oilseed rape]
dbj|BAH19523.1|  AT4G35090                                              185   9e-54   Arabidopsis thaliana [mouse-ear cress]
gb|EMT05040.1|  Catalase-1                                              186   9e-54   
ref|XP_009108684.1|  PREDICTED: catalase-2-like isoform X3              185   1e-53   
gb|ACV92695.1|  catalase                                                185   1e-53   Brassica oleracea
gb|AIX10947.1|  putative catalase                                       185   1e-53   Gardenia jasminoides
ref|XP_002867092.1|  hypothetical protein ARALYDRAFT_491144             185   1e-53   
emb|CAA64220.1|  catalase                                               185   1e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like                 185   1e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006412154.1|  hypothetical protein EUTSA_v10024932mg             186   1e-53   Eutrema salsugineum [saltwater cress]
gb|AAD17935.1|  catalase                                                185   1e-53   Brassica juncea [brown mustard]
prf||1906388A  catalase                                                 185   1e-53
ref|XP_011022152.1|  PREDICTED: catalase-2-like isoform X1              186   1e-53   Populus euphratica
dbj|BAJ33995.1|  unnamed protein product                                185   1e-53   Eutrema halophilum
ref|XP_006412153.1|  hypothetical protein EUTSA_v10024932mg             185   1e-53   Eutrema salsugineum [saltwater cress]
gb|AAB86582.2|  catalase                                                185   1e-53   Raphanus sativus
gb|AFD29285.1|  catalase                                                185   1e-53   Vicia faba [broad bean]
dbj|BAH37035.1|  catalase 1                                             185   1e-53   Pisum sativum [garden pea]
gb|AHF21552.1|  catalase                                                185   1e-53   Hylocereus undatus [dragon fruit]
sp|P48350.1|CATA1_CUCPE  RecName: Full=Catalase isozyme 1               185   1e-53   Cucurbita pepo
gb|AAD17933.1|  catalase                                                185   1e-53   Brassica juncea [brown mustard]
ref|XP_008812256.1|  PREDICTED: catalase isozyme B                      185   1e-53   Phoenix dactylifera
ref|XP_010094556.1|  Catalase isozyme 1                                 185   1e-53   Morus notabilis
gb|AAF71742.1|AF248491_1  catalase                                      185   1e-53   Raphanus sativus
gb|AJE26131.1|  catalase                                                185   1e-53   Salix matsudana [tortured willow]
gb|KFK30147.1|  catalase                                                185   1e-53   Arabis alpina [alpine rockcress]
ref|XP_009138342.1|  PREDICTED: catalase-2                              185   1e-53   Brassica rapa
gb|EYU36566.1|  hypothetical protein MIMGU_mgv1a005245mg                185   1e-53   Erythranthe guttata [common monkey flower]
gb|AAD17936.1|  catalase                                                185   1e-53   Brassica juncea [brown mustard]
gb|AAR14052.2|  catalase                                                185   1e-53   Solanum tuberosum [potatoes]
ref|XP_009108683.1|  PREDICTED: catalase-2-like isoform X2              185   1e-53   
gb|AIS20825.1|  CAT                                                     185   1e-53   Pyrus x bretschneideri [bai li]
gb|AFN81243.1|  catalase 1                                              185   1e-53   Brassica rapa subsp. pekinensis [bai cai]
gb|KGN55499.1|  hypothetical protein Csa_4G658590                       185   1e-53   Cucumis sativus [cucumbers]
gb|KCW70315.1|  hypothetical protein EUGRSUZ_F03557                     185   1e-53   Eucalyptus grandis [rose gum]
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                      185   2e-53   Cucumis melo [Oriental melon]
ref|XP_009108682.1|  PREDICTED: catalase-2-like isoform X1              185   2e-53   Brassica rapa
gb|AFU90823.1|  catalase                                                184   2e-53   Populus x beijingensis
ref|XP_009106100.1|  PREDICTED: catalase-2                              185   2e-53   Brassica rapa
gb|ADC95629.1|  catalase                                                185   2e-53   Bruguiera gymnorhiza [Burma mangrove]
gb|AAM97542.1|  catalase 3                                              185   2e-53   Capsicum annuum
gb|AII23739.1|  catalase                                                184   2e-53   Zostera marina
dbj|BAJ88747.1|  predicted protein                                      186   2e-53   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAC19398.1|  root catalase                                           185   2e-53   Mesembryanthemum crystallinum
ref|XP_011396830.1|  Catalase isozyme 2                                 185   2e-53   Auxenochlorella protothecoides
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313             184   2e-53   
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like                 184   2e-53   Vitis vinifera
ref|NP_001268098.1|  catalase                                           184   2e-53   Vitis vinifera
ref|NP_001234186.1|  catalase isozyme 2                                 184   2e-53   
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171             184   2e-53   Selaginella moellendorffii
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like                 184   2e-53   Populus euphratica
ref|XP_006340832.1|  PREDICTED: catalase isozyme 2                      184   2e-53   Solanum tuberosum [potatoes]
emb|CAG23920.1|  catalase                                               184   2e-53   Festuca arundinacea [tall fescue]
dbj|BAA34205.1|  catalase                                               184   2e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002301920.1|  catalase family protein                            184   2e-53   Populus trichocarpa [western balsam poplar]
emb|CAI43948.1|  catalase                                               184   2e-53   Populus deltoides
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4      184   3e-53   Citrus sinensis [apfelsine]
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg             184   3e-53   Citrus clementina [clementine]
gb|ABB51561.1|  truncated catalase 2                                    183   3e-53   Avicennia marina
gb|EPS69543.1|  catalase                                                184   3e-53   Genlisea aurea
ref|XP_011022275.1|  PREDICTED: catalase-like                           184   3e-53   Populus euphratica
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2      184   3e-53   Eucalyptus grandis [rose gum]
gb|AFU90822.1|  catalase                                                184   3e-53   Populus tomentosa [Chinese white poplar]
gb|ACB11496.1|  catalase                                                184   3e-53   Pinus sylvestris [Scotch pine]
prf||2104177A  catalase                                                 184   3e-53
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1      184   3e-53   
ref|XP_006828714.1|  hypothetical protein AMTR_s00001p00022550          184   3e-53   Amborella trichopoda
gb|AAP80622.1|AF475100_1  catalase isozyme                              178   3e-53   Triticum aestivum [Canadian hard winter wheat]
gb|KCW68095.1|  hypothetical protein EUGRSUZ_F01777                     186   3e-53   Eucalyptus grandis [rose gum]
sp|Q9AXH0.1|CATA_AVIMR  RecName: Full=Catalase                          184   3e-53   Avicennia marina
gb|AAF19965.1|AF207906_1  catalase 1                                    184   4e-53   Zantedeschia aethiopica [arum-lily]
emb|CDP01803.1|  unnamed protein product                                184   4e-53   Coffea canephora [robusta coffee]
emb|CDX69111.1|  BnaC01g03420D                                          183   4e-53   
gb|ACL35349.1|  catalase                                                184   4e-53   Picea glauca
ref|XP_010061173.1|  PREDICTED: catalase isozyme 2-like isoform X1      184   5e-53   
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg             183   5e-53   Prunus persica
emb|CAD42909.1|  catalase                                               183   5e-53   Prunus persica
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like                 183   6e-53   Prunus mume [ume]
gb|ABV55108.1|  catalase 2                                              183   6e-53   Musa acuminata AAA Group [Cavendish banana]
gb|AFR53082.1|  CAT                                                     183   6e-53   Anthurium andraeanum [flamingo-lily]
ref|XP_009398521.1|  PREDICTED: catalase isozyme A                      183   6e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006283612.1|  hypothetical protein CARUB_v10004668mg             183   6e-53   Capsella rubella
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                      183   6e-53   Elaeis guineensis
ref|XP_010477308.1|  PREDICTED: catalase-1                              183   6e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010459749.1|  PREDICTED: catalase-1-like                         183   6e-53   Camelina sativa [gold-of-pleasure]
gb|AAD50974.1|AF170272_1  catalase CAT1                                 183   6e-53   Manihot esculenta [manioc]
ref|XP_008789355.1|  PREDICTED: catalase isozyme 1-like                 183   7e-53   Phoenix dactylifera
gb|ABM47415.1|  catalase                                                183   7e-53   Prunus avium [gean]
ref|XP_008778560.1|  PREDICTED: catalase isozyme 2-like                 183   7e-53   Phoenix dactylifera
gb|EYU30275.1|  hypothetical protein MIMGU_mgv1a005250mg                183   7e-53   Erythranthe guttata [common monkey flower]
emb|CAA45564.1|  catalase                                               183   7e-53   Arabidopsis thaliana [mouse-ear cress]
gb|AHF27433.1|  catalase                                                183   7e-53   Cucurbita maxima [Boston marrow]
gb|AIU99487.1|  catalase                                                183   9e-53   Saccharum hybrid cultivar ROC22
ref|XP_010663966.1|  PREDICTED: catalase isozyme 1                      183   9e-53   Vitis vinifera
ref|XP_008802866.1|  PREDICTED: catalase isozyme 1                      183   9e-53   Phoenix dactylifera
ref|XP_010941422.1|  PREDICTED: catalase isozyme B                      183   1e-52   Elaeis guineensis
gb|ABB88582.1|  catalase                                                182   1e-52   Ulva fasciata
ref|XP_001752315.1|  predicted protein                                  182   1e-52   
gb|ACJ76836.3|  catalase                                                182   1e-52   Dimocarpus longan [longan]
gb|AAG43363.1|AF151368_1  catalase                                      182   1e-52   Hevea brasiliensis [jebe]
gb|AAF61732.1|AF243517_1  catalase 2                                    182   1e-52   Helianthus annuus
ref|XP_004145541.1|  PREDICTED: catalase isozyme 1-like                 187   1e-52   
ref|XP_008791900.1|  PREDICTED: catalase isozyme 2                      182   1e-52   Phoenix dactylifera
ref|NP_001058635.1|  Os06g0727200                                       182   1e-52   
sp|A2YH64.2|CATA2_ORYSI  RecName: Full=Catalase isozyme B; Short=...    182   1e-52   Oryza sativa Indica Group [Indian rice]
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like                 182   1e-52   Oryza brachyantha
gb|AHF27430.1|  catalase                                                182   1e-52   Cucurbita moschata [ayote]
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                      182   1e-52   Cucumis melo [Oriental melon]
gb|ACL81498.1|  catalase                                                182   1e-52   Ginkgo biloba [ginkgo]
ref|XP_002437631.1|  hypothetical protein SORBIDRAFT_10g030840          182   1e-52   
ref|XP_003563243.1|  PREDICTED: catalase isozyme 1                      182   1e-52   Brachypodium distachyon [annual false brome]
ref|XP_002510677.1|  catalase, putative                                 187   1e-52   
ref|XP_009392261.1|  PREDICTED: catalase isozyme A-like isoform X2      182   2e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001784759.1|  predicted protein                                  182   2e-52   
ref|XP_009400996.1|  PREDICTED: catalase isozyme 2                      182   2e-52   Musa acuminata subsp. malaccensis [pisang utan]
gb|AHF27432.1|  catalase                                                181   2e-52   Cucurbita maxima [Boston marrow]
ref|XP_010692544.1|  PREDICTED: catalase-like                           182   2e-52   Beta vulgaris subsp. vulgaris [field beet]
sp|P18122.1|CATA1_MAIZE  RecName: Full=Catalase isozyme 1               182   2e-52   Zea mays [maize]
gb|AIU99480.1|  catalase                                                182   2e-52   Saccharum spontaneum [fodder cane]
gb|AIU99488.1|  catalase                                                182   2e-52   Saccharum hybrid cultivar ROC22
ref|XP_009773579.1|  PREDICTED: catalase isozyme 3-like                 182   2e-52   Nicotiana sylvestris
gb|AIM43584.1|  catalase                                                182   2e-52   Saccharum hybrid cultivar Yacheng05-179
ref|NP_001105415.1|  catalase isozyme 1                                 182   2e-52   
ref|NP_001241808.1|  catalase isozyme B                                 182   2e-52   Zea mays [maize]
emb|CAA42720.1|  catalase-1                                             182   2e-52   Zea mays [maize]
gb|AIU99486.1|  catalase                                                182   2e-52   Saccharum spontaneum [fodder cane]
ref|XP_009392260.1|  PREDICTED: catalase isozyme A-like isoform X1      182   2e-52   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIU99484.1|  catalase                                                182   2e-52   Saccharum arundinaceum
ref|XP_009600533.1|  PREDICTED: catalase isozyme 3-like                 182   2e-52   Nicotiana tomentosiformis
ref|XP_002961779.1|  hypothetical protein SELMODRAFT_140901             181   3e-52   
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2               181   3e-52   Ricinus communis
gb|ABK41476.1|  catalase                                                181   4e-52   Haematococcus lacustris
ref|XP_004144240.1|  PREDICTED: catalase isozyme 3-like                 181   5e-52   
dbj|BAA34204.1|  catalase                                               181   5e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010934843.1|  PREDICTED: catalase isozyme 2                      181   5e-52   
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3               181   6e-52   Cucurbita pepo
ref|XP_010907090.1|  PREDICTED: catalase isozyme 1-like                 181   6e-52   Elaeis guineensis
ref|XP_004158284.1|  PREDICTED: catalase isozyme 3-like                 181   7e-52   
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like                 181   7e-52   
gb|AIU99481.1|  catalase                                                180   8e-52   Saccharum spontaneum [fodder cane]
ref|XP_010534184.1|  PREDICTED: catalase isozyme 3-like                 180   8e-52   Tarenaya hassleriana [spider flower]
prf||1803522A  catalase                                                 180   9e-52
sp|P12365.3|CATA2_MAIZE  RecName: Full=Catalase isozyme 2               180   9e-52   
ref|XP_010498497.1|  PREDICTED: catalase-1-like                         180   9e-52   
gb|AIU99479.1|  catalase                                                180   1e-51   
gb|AIU99482.1|  catalase                                                180   1e-51   
gb|AHF27429.1|  catalase                                                179   1e-51   
gb|AAC17731.1|  catalase 1                                              180   1e-51   
gb|AEB22071.1|  catalase 2                                              171   1e-51   
ref|NP_564121.1|  catalase 1                                            180   1e-51   
sp|P55313.1|CATA2_WHEAT  RecName: Full=Catalase                         180   1e-51   
gb|AEQ30070.1|  catalase                                                179   1e-51   
gb|AAY59707.1|  catalase                                                179   2e-51   
gb|ADU56198.1|  catalase                                                179   2e-51   
sp|P55307.1|CATA1_HORVU  RecName: Full=Catalase isozyme 1               179   2e-51   
ref|XP_010536468.1|  PREDICTED: catalase-3-like                         179   2e-51   
gb|ADN94253.1|  catalase                                                179   3e-51   
gb|KDO85095.1|  hypothetical protein CISIN_1g044386mg                   181   3e-51   
gb|ADM96039.1|  catalase                                                179   3e-51   
gb|AAG61140.2|AF332973_1  catalase 2                                    178   4e-51   
gb|AIU99483.1|  catalase                                                178   4e-51   
gb|AHA50082.1|  catalase                                                178   4e-51   
ref|NP_001105310.1|  catalase isozyme 2                                 178   5e-51   
gb|AGT16054.1|  catalase                                                178   5e-51   
gb|AGT16188.1|  catalase                                                178   5e-51   
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2               178   5e-51   
gb|AHZ13843.1|  catalase                                                178   5e-51   
gb|AGT16310.1|  catalase                                                178   6e-51   
ref|XP_001779509.1|  predicted protein                                  178   6e-51   
gb|AGT16203.1|  catalase                                                178   6e-51   
sp|P18123.2|CATA3_MAIZE  RecName: Full=Catalase isozyme 3               178   6e-51   
gb|AAB07026.1|  catalase 1                                              178   7e-51   
gb|AFW66787.1|  catalase3                                               178   7e-51   
ref|XP_005645077.1|  catalase                                           178   7e-51   
gb|AGT15888.1|  catalase                                                177   8e-51   
gb|AFW66788.1|  catalase3                                               178   8e-51   
gb|AJF34884.1|  catalase                                                177   8e-51   
ref|XP_006646781.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    178   8e-51   
emb|CDP07288.1|  unnamed protein product                                177   8e-51   
gb|EMS61345.1|  Catalase isozyme 1                                      179   8e-51   
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2               177   1e-50   
ref|XP_006416379.1|  hypothetical protein EUTSA_v10007795mg             175   1e-50   
gb|AIU99485.1|  catalase                                                177   2e-50   
gb|AFW66785.1|  catalase3 isoform 1                                     179   2e-50   
gb|ACJ22771.1|  catalase 1                                              177   2e-50   
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1    176   2e-50   
pir||S40265  catalase (EC 1.11.1.6) - eggplant                          176   4e-50
ref|NP_973873.1|  catalase 3                                            174   4e-50   
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...    176   4e-50   
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                      176   4e-50   
pir||CSRZ  catalase (EC 1.11.1.6) catA - rice                           176   4e-50
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                      176   4e-50   
ref|NP_001045673.1|  Os02g0115700                                       176   4e-50   
gb|AAD30291.2|AF139538_1  catalase 2                                    176   5e-50   
gb|AAC48918.1|  salicylic acid binding catalase                         176   5e-50   
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                          176   5e-50   
dbj|BAH20307.1|  AT1G20620                                              175   5e-50   
gb|ABN71233.2|  catalase                                                176   5e-50   
gb|AAD30292.1|AF139539_1  catalase 3                                    176   5e-50   
emb|CDY29518.1|  BnaA06g14520D                                          176   5e-50   
emb|CDY31490.1|  BnaC05g15990D                                          176   5e-50   
ref|XP_003573241.1|  PREDICTED: catalase isozyme 2                      176   5e-50   
ref|XP_009149540.1|  PREDICTED: catalase-1                              175   6e-50   
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg             175   6e-50   
emb|CDY31488.1|  BnaC05g15970D                                          176   6e-50   
emb|CDY29519.1|  BnaA06g14510D                                          175   6e-50   
gb|EAZ21490.1|  hypothetical protein OsJ_05114                          176   6e-50   
emb|CDY33636.1|  BnaC08g19360D                                          175   6e-50   
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                    175   6e-50   
ref|XP_009103334.1|  PREDICTED: catalase-3-like                         175   6e-50   
gb|AAF79625.1|AC027665_26  F5M15.5                                      180   6e-50   
ref|XP_009110221.1|  PREDICTED: catalase-3                              175   6e-50   
ref|XP_002453177.1|  hypothetical protein SORBIDRAFT_04g001130          175   6e-50   
ref|NP_564120.1|  catalase 3                                            175   6e-50   
emb|CDY31878.1|  BnaC07g15280D                                          175   6e-50   
gb|AAM65021.1|  unknown                                                 175   6e-50   
ref|NP_001031073.1|  catalase 3                                         175   7e-50   
gb|ABR16304.1|  unknown                                                 175   7e-50   
ref|XP_006435362.1|  hypothetical protein CICLE_v10000948mg             174   7e-50   
ref|XP_001696763.1|  catalase/peroxidase                                175   7e-50   
sp|P55308.1|CATA2_HORVU  RecName: Full=Catalase isozyme 2               175   8e-50   
dbj|BAJ92414.1|  predicted protein                                      175   8e-50   
dbj|BAH56915.1|  AT1G20620                                              175   8e-50   
emb|CAH61266.1|  catalase                                               175   8e-50   
gb|ADY02963.1|  catalase                                                175   8e-50   
gb|EMS51034.1|  Catalase isozyme 2                                      175   9e-50   
gb|AAB70006.1|  catalase                                                175   9e-50   
ref|XP_004952158.1|  PREDICTED: catalase isozyme 3-like isoform X2      175   9e-50   
ref|XP_009149539.1|  PREDICTED: catalase-3                              176   1e-49   
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1                174   1e-49   
gb|ADQ28492.1|  catalase                                                175   1e-49   
gb|AAL38024.1|AF443179_1  catalase                                      168   1e-49   
gb|ABK24543.1|  unknown                                                 174   1e-49   
gb|AIR77003.1|  catalase                                                170   1e-49   
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg             174   1e-49   
emb|CDY01364.1|  BnaA07g11370D                                          176   1e-49   
ref|XP_004952157.1|  PREDICTED: catalase isozyme 3-like isoform X1      174   1e-49   
ref|XP_010498496.1|  PREDICTED: catalase-3                              174   1e-49   
ref|XP_002950455.1|  catalase                                           174   2e-49   
ref|XP_002890395.1|  F5M15.5                                            178   2e-49   
gb|EMT06167.1|  Catalase isozyme 2                                      176   2e-49   
gb|ADR01107.1|  catalase 3                                              171   2e-49   
gb|ABK24449.1|  unknown                                                 174   2e-49   
ref|XP_005847557.1|  hypothetical protein CHLNCDRAFT_57817              173   4e-49   
emb|CAA43814.1|  catalase                                               172   7e-49   
gb|AAC49807.1|  catalase 3                                              172   8e-49   
emb|CAA85470.1|  catalase                                               172   1e-48   
gb|KDD77132.1|  catalase                                                172   1e-48   
ref|NP_001274863.1|  catalase isozyme 1                                 172   1e-48   
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2               172   1e-48   
emb|CAA73663.1|  catalase                                               172   1e-48   
ref|NP_001234827.1|  catalase isozyme 1                                 172   1e-48   
dbj|BAF91369.1|  catalase                                               171   2e-48   
gb|ACJ71242.1|  catalase 1                                              165   3e-48   
gb|ABC01913.1|  catalase isozyme 1-like protein                         171   3e-48   
gb|ADU56189.1|  catalase 1                                              161   5e-48   
gb|AAR97905.1|  catalase                                                170   7e-48   
gb|ABB72796.1|  catalase isozyme 1-like protein                         167   8e-47   
emb|CDY40645.1|  BnaA03g53180D                                          167   8e-47   
gb|AAD37788.1|AF149283_1  catalase 1                                    164   3e-46   
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1               165   3e-46   
ref|XP_011074090.1|  PREDICTED: catalase isoform X1                     163   3e-45   
gb|AII80275.1|  catalase                                                159   4e-45   
ref|XP_006306503.1|  hypothetical protein CARUB_v10012491mg             154   1e-44   
emb|CAB16750.1|  catalase                                               156   2e-44   
gb|AAA33441.1|  catalase isozyme 3 (EC 1.11.1.6)                        159   5e-44   
gb|AEG89525.1|  catalase                                                156   5e-44   
ref|NP_001105416.1|  catalase isozyme 3                                 159   6e-44   
ref|XP_005708279.1|  catalase                                           155   2e-42   
gb|ACJ71243.1|  catalase 2                                              148   5e-42   
sp|P55310.1|CATA_SECCE  RecName: Full=Catalase                          151   4e-41   
gb|AEA86312.1|  catalase isozyme                                        144   5e-41   
ref|XP_005536240.1|  catalase                                           150   1e-40   
gb|AIC75339.1|  CAT                                                     138   8e-40   
gb|ACY30463.1|  catalase                                                145   9e-40   
emb|CAC37634.1|  catalase 1                                             143   4e-39   
emb|CAB56850.1|  catalase                                               143   2e-38   
gb|AAO12509.1|  catalase                                                137   4e-38   
gb|AEQ94083.1|  putative catalase                                       140   5e-38   
emb|CAP74531.1|  putative Td650 protein                                 138   8e-38   
gb|KFH72187.1|  catalase                                                142   1e-37   
emb|CDP01802.1|  unnamed protein product                                141   2e-37   
ref|WP_036667842.1|  catalase                                           140   5e-37   
ref|WP_024632816.1|  MULTISPECIES: catalase                             140   6e-37   
ref|WP_034700019.1|  catalase                                           140   6e-37   
ref|WP_002978792.1|  catalase                                           140   6e-37   
gb|AAN78323.1|  catalase1                                               134   7e-37   
ref|WP_038335781.1|  catalase                                           139   9e-37   
gb|ABY74514.1|  catalase                                                134   9e-37   
ref|WP_018669668.1|  catalase                                           139   1e-36   
ref|WP_019973735.1|  catalase                                           139   1e-36   
gb|KFK81701.1|  catalase family protein                                 134   1e-36   
ref|WP_038700758.1|  catalase                                           139   2e-36   
gb|KJF46757.1|  catalase                                                138   2e-36   
ref|WP_024719958.1|  MULTISPECIES: catalase                             138   2e-36   
ref|WP_003211348.1|  catalase                                           138   2e-36   
ref|WP_041091807.1|  catalase                                           138   2e-36   
ref|WP_035703421.1|  catalase                                           138   2e-36   
gb|AHI58962.1|  catalase KatX2                                          138   2e-36   
ref|WP_012009409.1|  catalase                                           138   2e-36   
ref|WP_008359888.1|  catalase                                           138   2e-36   
ref|WP_040574212.1|  catalase                                           138   2e-36   
ref|WP_034321610.1|  catalase                                           138   2e-36   
ref|WP_008348997.1|  MULTISPECIES: catalase                             138   2e-36   
ref|WP_034663722.1|  catalase                                           138   2e-36   
ref|WP_024426596.1|  catalase                                           138   3e-36   
ref|WP_034282264.1|  catalase                                           138   3e-36   
ref|WP_036612802.1|  catalase                                           138   3e-36   
ref|WP_039169268.1|  catalase                                           138   3e-36   
ref|WP_035405433.1|  catalase                                           138   3e-36   
ref|WP_039177466.1|  catalase                                           138   3e-36   
ref|WP_041089594.1|  catalase                                           138   3e-36   
gb|EJF09706.1|  catalase                                                138   3e-36   
ref|WP_007497088.1|  catalase                                           138   3e-36   
ref|WP_044333630.1|  catalase                                           138   3e-36   
ref|WP_041109904.1|  catalase                                           138   3e-36   
ref|WP_024425295.1|  MULTISPECIES: catalase                             138   3e-36   
ref|WP_016090862.1|  catalase                                           131   4e-36   
ref|WP_028783654.1|  catalase                                           137   4e-36   
ref|WP_017674668.1|  catalase                                           137   5e-36   
ref|WP_002162341.1|  catalase                                           137   6e-36   
ref|WP_044481181.1|  catalase                                           137   7e-36   
ref|WP_038987770.1|  catalase                                           137   7e-36   
gb|AIM05077.1|  catalase                                                131   8e-36   
ref|WP_042124255.1|  catalase                                           137   8e-36   
ref|WP_020618147.1|  catalase                                           137   8e-36   
dbj|GAE06714.1|  catalase                                               133   8e-36   
ref|WP_003470096.1|  catalase                                           137   9e-36   
ref|WP_006256937.1|  MULTISPECIES: catalase                             137   9e-36   
ref|WP_006266515.1|  catalase                                           137   1e-35   
ref|WP_006263075.1|  catalase                                           137   1e-35   
ref|WP_041889734.1|  catalase                                           137   1e-35   
ref|WP_044186614.1|  catalase                                           137   1e-35   
ref|WP_042184995.1|  catalase                                           136   1e-35   
ref|WP_031412803.1|  catalase                                           136   1e-35   
ref|WP_040058190.1|  catalase                                           136   2e-35   
ref|WP_019393152.1|  catalase                                           136   2e-35   
ref|WP_036686886.1|  MULTISPECIES: catalase                             135   2e-35   
ref|WP_039073350.1|  catalase                                           135   2e-35   
ref|WP_040949987.1|  catalase                                           135   2e-35   
ref|WP_028396461.1|  catalase                                           135   2e-35   
ref|WP_017691823.1|  catalase                                           135   3e-35   
ref|WP_028402967.1|  catalase                                           135   3e-35   
ref|WP_016103618.1|  catalase                                           135   3e-35   
ref|WP_002130360.1|  catalase                                           135   3e-35   
ref|WP_024740569.1|  catalase                                           135   3e-35   
ref|WP_018932076.1|  catalase                                           135   3e-35   
ref|WP_001069198.1|  catalase                                           135   3e-35   
ref|WP_022586116.1|  catalase                                           135   3e-35   
dbj|GAN06759.1|  catalase                                               135   3e-35   
ref|WP_002114641.1|  catalase                                           135   4e-35   
ref|WP_003342200.1|  catalase                                           135   4e-35   
emb|CEI86636.1|  Putative Catalase                                      135   4e-35   
emb|CEG67568.1|  Putative Catalase                                      135   4e-35   
ref|WP_003334168.1|  catalase                                           135   4e-35   
ref|WP_026069024.1|  catalase                                           135   4e-35   
ref|WP_014271793.1|  catalase                                           135   4e-35   
ref|XP_005642928.1|  catalase                                           135   4e-35   
ref|WP_025852190.1|  catalase                                           135   4e-35   
ref|WP_025909238.1|  catalase                                           135   4e-35   
ref|WP_043932219.1|  catalase                                           135   4e-35   
ref|WP_001069181.1|  MULTISPECIES: catalase                             134   5e-35   
ref|WP_007202104.1|  catalase                                           134   6e-35   



>gb|ADB03784.1| catalase [Ipomoea batatas]
Length=492

 Score =   196 bits (498),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 94/100 (94%), Positives = 96/100 (96%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EKI NFTRERIP RVVHARGATAKGFFEVT DITHLTCADFLRAPGVQTPLIVRFS
Sbjct  45   YHLIEKIQNFTRERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPETIRDPRGFAVKMYTREGN+DLVGNNFP FF
Sbjct  105  TVIHERGSPETIRDPRGFAVKMYTREGNWDLVGNNFPVFF  144



>gb|AAC84138.1| catalase [Cichorium intybus]
Length=182

 Score =   186 bits (473),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EK+ NFTRERIP R+VHARGA+AKGFFEVT DITHLTCADFLRAPGVQTP IVRFS
Sbjct  45   YHLIEKLANFTRERIPERIVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPTIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPETIRDPRGFA K YTREGNFD+VGNNFP FF
Sbjct  105  TVIHERGSPETIRDPRGFATKFYTREGNFDIVGNNFPVFF  144



>gb|ADI58890.1| catalase [Vigna mungo]
Length=163

 Score =   184 bits (466),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT D++HLTCADFLRAPGVQTP+IVRFS
Sbjct  4    YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFS  63

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNN P FF
Sbjct  64   TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNLPVFF  103



>sp|P07145.1|CATA_IPOBA RecName: Full=Catalase [Ipomoea batatas]
 emb|CAA29063.1| unnamed protein product [Ipomoea batatas]
Length=492

 Score =   192 bits (489),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/100 (93%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEKI NFTRERIP RVVHARGA+AKGFFEVT DITHLTCADFLRAPGVQTPLIVRFS
Sbjct  45   YHLVEKIQNFTRERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPETIRDPRGFAVKMYTR GN+DLVGNNFP FF
Sbjct  105  TVIHERGSPETIRDPRGFAVKMYTRGGNWDLVGNNFPVFF  144



>emb|CBI29557.3| unnamed protein product [Vitis vinifera]
 emb|CBI37654.3| unnamed protein product [Vitis vinifera]
Length=160

 Score =   183 bits (464),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT D++ LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFQRERIPERVVHARGASAKGFFEVTHDVSDLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPETIRDPRGFAVK YTREGNFD+VGNNFP FF
Sbjct  105  TVIHERGSPETIRDPRGFAVKFYTREGNFDMVGNNFPVFF  144



>ref|XP_006382986.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60783.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=519

 Score =   191 bits (486),  Expect = 8e-56, Method: Composition-based stats.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|NP_001237556.1| catalase-1/2 [Glycine max]
 sp|P29756.1|CATA1_SOYBN RecName: Full=Catalase-1/2 [Glycine max]
 emb|CAA78056.1| catalase [Glycine max]
 gb|AAB88169.1| catalase [Glycine max]
 gb|AAB88170.1| catalase [Glycine max]
 gb|KHN48523.1| Catalase-1/2 [Glycine soja]
Length=492

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/100 (90%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTPLIVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_007160597.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
Length=492

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/100 (90%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTPLIVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|NP_001235974.1| catalase-3 [Glycine max]
 sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 [Glycine max]
 gb|AAB88171.1| catalase [Glycine max]
 gb|KHN12602.1| Catalase-3 [Glycine soja]
Length=492

 Score =   189 bits (481),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/100 (90%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTPLIVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|KGN55500.1| hypothetical protein Csa_4G658600 [Cucumis sativus]
Length=405

 Score =   187 bits (476),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DITHLTCADFLRAPG QTP+IVRFS
Sbjct  44   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGTQTPVIVRFS  103

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  104  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  143



>ref|XP_010242895.1| PREDICTED: catalase isozyme 1-like isoform X2 [Nelumbo nucifera]
Length=433

 Score =   188 bits (478),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/100 (90%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEKI NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKIANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|AHG98056.1| catalase, partial [Plectranthus barbatus]
Length=299

 Score =   184 bits (468),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+ LTCADFLRAPGVQTP+IVRFS
Sbjct  7    YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFS  66

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  67   TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  106



>ref|XP_006382987.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382988.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382989.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60784.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60785.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60786.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=434

 Score =   188 bits (477),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   189 bits (480),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/100 (90%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DITHLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score =   189 bits (480),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/100 (90%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DITHLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_008452957.1| PREDICTED: catalase isozyme 1-like [Cucumis melo]
Length=492

 Score =   189 bits (480),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/100 (90%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DITHLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|ABF93811.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
Length=382

 Score =   186 bits (473),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DITHLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFA+K YTREGN+DLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAIKFYTREGNWDLVGNNFPVFF  144



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score =   189 bits (480),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/100 (90%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DITHLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_004985840.1| PREDICTED: catalase-1-like [Setaria italica]
Length=492

 Score =   189 bits (479),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/100 (90%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DITHLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPETIRDPRGFAVK YTREGN+DLVGNNFP FF
Sbjct  105  TVIHERGSPETIRDPRGFAVKFYTREGNWDLVGNNFPVFF  144



>gb|AGI65617.1| catalase, partial [Fragaria x ananassa]
Length=467

 Score =   188 bits (478),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  38   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  97

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  98   TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  137



>sp|P49315.1|CATA1_NICPL RecName: Full=Catalase isozyme 1, partial [Nicotiana plumbaginifolia]
 emb|CAA85424.1| catalase [Nicotiana plumbaginifolia]
Length=485

 Score =   189 bits (479),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RER+P RVVHARGA+AKGFFEVT DITHLTCADFLRAPGVQTP+IVRFS
Sbjct  38   YHLVEKLANFDRERVPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFS  97

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  98   TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  137



>ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60789.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=490

 Score =   189 bits (479),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  43   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFS  102

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  103  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  142



>ref|XP_009794245.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   189 bits (479),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RER+P RVVHARGA+AKGFFEVT DITHLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERVPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382993.1| catalase family protein [Populus trichocarpa]
 emb|CAI43950.1| catalase [Populus deltoides]
 gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60790.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   189 bits (479),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_006828715.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
 gb|ERM96131.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
Length=492

 Score =   189 bits (479),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTPLIVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFD+VGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFF  144



>ref|XP_006382990.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382991.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60787.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60788.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=455

 Score =   188 bits (477),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_010242894.1| PREDICTED: catalase isozyme 1-like isoform X1 [Nelumbo nucifera]
Length=492

 Score =   189 bits (479),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 90/100 (90%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEKI NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKIANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|AAF61734.1|AF243519_1 catalase 4 [Helianthus annuus]
Length=492

 Score =   189 bits (479),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EK+ NFTRERIP R+VHARGA+AKGFFEVT DITHLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLIEKLANFTRERIPERIVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPETIRDPRGFA K YTREGNFD+VGNNFP FF
Sbjct  105  TVIHERGSPETIRDPRGFATKFYTREGNFDIVGNNFPVFF  144



>gb|AAB62892.1| catalase-1 [Nicotiana glutinosa]
Length=492

 Score =   189 bits (479),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RER+P RVVHARGA+AKGFFEVT DITHLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERVPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>emb|CCP37650.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   189 bits (479),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RER+P RVVHARGA+AKGFFEVT DITHLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERVPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana]
Length=491

 Score =   189 bits (479),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RER+P RVVHARGA+AKGFFEVT DITHLTCADFLRAPGVQTP+IVRFS
Sbjct  44   YHLVEKLANFDRERVPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFS  103

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  104  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  143



>ref|XP_009597278.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
 emb|CCP37651.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   189 bits (479),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RER+P RVVHARGA+AKGFFEVT DITHLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERVPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|ACL27272.1| catalase [Nicotiana benthamiana]
Length=492

 Score =   189 bits (479),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RER+P RVVHARGA+AKGFFEVT DITHLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERVPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   189 bits (479),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPXFF  144



>dbj|BAC79443.1| catalase [Acacia ampliceps]
Length=492

 Score =   189 bits (479),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 91/100 (91%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEKI NFTRER P RVVHARGA+AKGFFEVT DITHLTCADFLR PGVQTP+IVRFS
Sbjct  45   YHLVEKIANFTRERTPERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPETIRDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETIRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_004300681.1| PREDICTED: catalase isozyme 1 [Fragaria vesca subsp. vesca]
Length=492

 Score =   188 bits (478),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|AAB71764.1| catalase 1 [Nicotiana tabacum]
Length=492

 Score =   188 bits (478),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RER+P RVVHARGA+AKGFFEVT DITHLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERVPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score =   188 bits (478),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_010061172.1| PREDICTED: catalase isozyme 3-like [Eucalyptus grandis]
 gb|KCW68094.1| hypothetical protein EUGRSUZ_F01776 [Eucalyptus grandis]
Length=492

 Score =   188 bits (478),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLIEKLANFERERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>tpg|DAA43177.1| TPA: catalase2 [Zea mays]
Length=493

 Score =   188 bits (478),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DITHLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGN+DLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNWDLVGNNFPVFF  144



>sp|P17598.2|CATA1_GOSHI RecName: Full=Catalase isozyme 1 [Gossypium hirsutum]
 emb|CAA36380.1| unnamed protein product [Gossypium hirsutum]
Length=492

 Score =   188 bits (478),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_007046520.1| Catalase 2 [Theobroma cacao]
 gb|EOX90677.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   188 bits (478),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|AAF61733.1|AF243518_1 catalase 3 [Helianthus annuus]
Length=492

 Score =   188 bits (478),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EK+ NFTRERIP R+VHARGA+AKGFFEVT DITHLTCADFLRAPGVQTP IVRFS
Sbjct  45   YHLIEKLANFTRERIPERIVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPTIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPETIRDPRGFA K YTREGNFD+VGNNFP FF
Sbjct  105  TVIHERGSPETIRDPRGFATKFYTREGNFDIVGNNFPVFF  144



>emb|CAE82295.1| catalase [Homogyne alpina]
Length=492

 Score =   188 bits (477),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EK+ NFTRERIP R+VHARGA+AKGFFEVT DITHLTCADFLRAPGVQTP IVRFS
Sbjct  45   YHLIEKLANFTRERIPERIVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPTIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPETIRDPRGFA K YTREGNFD+VGNNFP FF
Sbjct  105  TVIHERGSPETIRDPRGFATKFYTREGNFDIVGNNFPVFF  144



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|KDP43757.1| hypothetical protein JCGZ_22384 [Jatropha curcas]
Length=492

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|KJB14250.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=492

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>dbj|BAA34714.1| catalase [Oryza sativa]
Length=492

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DITHLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFA+K YTREGN+DLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAIKFYTREGNWDLVGNNFPVFF  144



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EKI NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLLEKIANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|NP_001048861.1| Os03g0131200 [Oryza sativa Japonica Group]
 gb|ABF93810.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10775.1| Os03g0131200 [Oryza sativa Japonica Group]
 dbj|BAG88238.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89941.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74449.1| hypothetical protein OsI_09857 [Oryza sativa Indica Group]
 gb|EEE58275.1| hypothetical protein OsJ_09293 [Oryza sativa Japonica Group]
Length=492

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DITHLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFA+K YTREGN+DLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAIKFYTREGNWDLVGNNFPVFF  144



>gb|AAC19397.1| leaf catalase [Mesembryanthemum crystallinum]
Length=492

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT D++HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPETIRDPRGFAVK YTREGNFD+VGNNFP FF
Sbjct  105  TVIHERGSPETIRDPRGFAVKFYTREGNFDMVGNNFPVFF  144



>ref|XP_010530333.1| PREDICTED: catalase-2 [Tarenaya hassleriana]
Length=492

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|AGE15298.2| catalase 1 [Eriobotrya japonica]
Length=492

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EK+ NF RERIP RVVHARGA+AKGFFEVT DI+HL+CADFLRAPGVQTP+IVRFS
Sbjct  45   YHLIEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPETIRDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETIRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|AGC65520.1| catalase [Eriobotrya japonica]
 gb|AGC65522.1| catalase [Eriobotrya japonica]
 gb|AGC65523.1| catalase [Eriobotrya japonica]
 gb|AGC65524.1| catalase [Eriobotrya japonica]
 gb|AGE15297.2| catalase 2 [Eriobotrya japonica]
Length=492

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EK+ NF RERIP RVVHARGA+AKGFFEVT DI+HL+CADFLRAPGVQTP+IVRFS
Sbjct  45   YHLIEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPETIRDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETIRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>sp|O24339.1|CATA_SOLAP RecName: Full=Catalase [Soldanella alpina]
 emb|CAB16749.1| catalase [Soldanella alpina]
Length=492

 Score =   187 bits (476),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   187 bits (476),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_010692546.1| PREDICTED: catalase [Beta vulgaris subsp. vulgaris]
Length=492

 Score =   187 bits (476),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADF+RAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFMRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_004500876.1| PREDICTED: catalase-4-like isoform X1 [Cicer arietinum]
Length=493

 Score =   187 bits (476),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT D++HLTCADFLRAPGVQTP+IVRFS
Sbjct  46   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFS  105

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  106  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  145



>gb|ACJ71245.1| catalase 2, partial [Vigna unguiculata]
Length=394

 Score =   185 bits (470),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT D++HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNN P FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNLPVFF  144



>gb|ACJ71244.1| catalase 2, partial [Vigna unguiculata]
Length=394

 Score =   185 bits (470),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT D++HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNN P FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNLPVFF  144



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score =   187 bits (476),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT D++HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|AHB72694.1| catalase [Beta vulgaris subsp. maritima]
Length=492

 Score =   187 bits (476),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADF+RAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFMRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|ABY21704.1| catalase-1 precursor [Panax ginseng]
Length=492

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/100 (90%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            Y LVEKI NF RERIP RVVHARGA+AKGFFEVT DITHLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YQLVEKIANFDRERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|AAO17721.1| catalase [Hypericum perforatum]
Length=492

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HL+CADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_003558892.1| PREDICTED: catalase-1 [Brachypodium distachyon]
Length=492

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEKI NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKIANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFA+K YTREGN+DLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAIKFYTREGNWDLVGNNFPVFF  144



>tpg|DAA43178.1| TPA: catalase2 [Zea mays]
Length=531

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DITHLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGN+DLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNWDLVGNNFPVFF  144



>gb|AAX88799.1| catalase [Euphorbia characias]
Length=493

 Score =   187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFF+VT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFQVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|KFK44176.1| hypothetical protein AALP_AA1G224400 [Arabis alpina]
Length=492

 Score =   187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EKI NF RERIP RVVHARGA+AKGFFEVT DITHLTCADFLR PGVQTP+IVRFS
Sbjct  45   YHLLEKIANFDRERIPERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|NP_001291326.1| catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score =   187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HL+CADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|AAK67359.2|AF390210_1 catalase [Suaeda salsa]
Length=492

 Score =   187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT D++HLTCADFLR+PGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRSPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPETIRDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETIRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_008348922.1| PREDICTED: catalase isozyme 1-like [Malus domestica]
Length=445

 Score =   186 bits (473),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HL+CADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPETIRDPRGFAVK YTREGN+DLVGNNFP FF
Sbjct  105  TVIHERGSPETIRDPRGFAVKFYTREGNWDLVGNNFPVFF  144



>gb|ADU56199.1| catalase [Hevea brasiliensis]
Length=492

 Score =   187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA++KGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASSKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_006342134.1| PREDICTED: catalase isozyme 3-like [Solanum tuberosum]
Length=492

 Score =   187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLLEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|KEH36313.1| catalase heme-binding enzyme [Medicago truncatula]
Length=430

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+  F RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLAQFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|KJB17473.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=492

 Score =   187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+ LTCADFLRAPGVQTPLIVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|KHG25152.1| Catalase isozyme 1 [Gossypium arboreum]
Length=492

 Score =   187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+I+RFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVILRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|KHG12976.1| Catalase isozyme 2 [Gossypium arboreum]
Length=492

 Score =   187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+ LTCADFLRAPGVQTPLIVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|KJB17474.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=451

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+ LTCADFLRAPGVQTPLIVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 [Gossypium hirsutum]
 emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum]
Length=492

 Score =   187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+ LTCADFLRAPGVQTPLIVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_008382478.1| PREDICTED: catalase isozyme 1-like [Malus domestica]
Length=453

 Score =   186 bits (472),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HL+CADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPETIRDPRGFAVK YTREGN+DLVGNNFP FF
Sbjct  105  TVIHERGSPETIRDPRGFAVKFYTREGNWDLVGNNFPVFF  144



>gb|AAR84577.1| catalase 1b [Lotus japonicus]
 gb|AAR84579.1| catalase 1b [Lotus japonicus]
Length=449

 Score =   186 bits (472),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT D++HLTCADFLRAPGVQTP+I+RFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIILRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_008373403.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   187 bits (474),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HL+CADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>sp|Q01297.2|CATA1_RICCO RecName: Full=Catalase isozyme 1 [Ricinus communis]
 gb|AAB31537.1| catalase 1 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04697.1| catalase CAT1 [Ricinus communis]
Length=492

 Score =   187 bits (474),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EK+ NF RERIP RVVHARGA+AKGFFEVT D++HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLIEKLANFDRERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_010432341.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   187 bits (474),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTPLIVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_006649332.1| PREDICTED: catalase-1-like [Oryza brachyantha]
Length=492

 Score =   187 bits (474),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFA+K YTREGN+DLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAIKFYTREGNWDLVGNNFPVFF  144



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   187 bits (474),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HL CADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLXCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPXFF  144



>sp|Q43206.1|CATA1_WHEAT RecName: Full=Catalase-1 [Triticum aestivum]
 dbj|BAA13068.1| catalase [Triticum aestivum]
 gb|ADF83496.1| catalase [Triticum aestivum]
Length=492

 Score =   187 bits (474),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEKI +F RERIP RVVHARGATAKGFFEVT D++HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKIADFDRERIPERVVHARGATAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFA+K YTREGN+DLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAIKFYTREGNWDLVGNNFPVFF  144



>ref|XP_010437527.1| PREDICTED: catalase-2 [Camelina sativa]
Length=492

 Score =   187 bits (474),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTPLIVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_010446982.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   186 bits (473),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTPLIVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score =   186 bits (473),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEKI NF RERIP RVVHARGA+AKGFFEVT DI+ LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKIANFDRERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score =   186 bits (473),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT D++HLTCADFLRAPGVQTP+I+RFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIILRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score =   186 bits (473),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DIT+LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDITNLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|AAM97541.1| catalase 2, partial [Capsicum annuum]
Length=484

 Score =   186 bits (472),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERI  RVVHARGA+AKGFFEVT DITHLTCADFLRAPGVQTP+IVRFS
Sbjct  37   YHLVEKLANFDRERIAERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFS  96

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  97   TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  136



>gb|KEH36312.1| catalase heme-binding enzyme [Medicago truncatula]
Length=492

 Score =   186 bits (473),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+  F RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLAQFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|AIP93616.1| CAT1 [Bassia scoparia]
Length=492

 Score =   186 bits (473),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFE T DI+HLTCADFLR+PGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFETTHDISHLTCADFLRSPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPETIRDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETIRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>emb|CDY31877.1| BnaC07g15270D [Brassica napus]
Length=492

 Score =   186 bits (473),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EK+ NF RERIP RVVHARGA+AKGFFEVT DITHLTCADFLR PGVQTP+IVRFS
Sbjct  45   YHLLEKLANFDRERIPERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_009103333.1| PREDICTED: catalase-1 [Brassica rapa]
Length=492

 Score =   186 bits (472),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EK+ NF RERIP RVVHARGA+AKGFFEVT DITHLTCADFLR PGVQTP+IVRFS
Sbjct  45   YHLLEKLANFDRERIPERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>emb|CDY01363.1| BnaA07g11360D [Brassica napus]
Length=492

 Score =   186 bits (472),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EK+ NF RERIP RVVHARGA+AKGFFEVT DITHLTCADFLR PGVQTP+IVRFS
Sbjct  45   YHLLEKLANFDRERIPERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_010523643.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   186 bits (472),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLR PGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRGPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_002521709.1| catalase, putative [Ricinus communis]
 gb|EEF40696.1| catalase, putative [Ricinus communis]
Length=492

 Score =   186 bits (472),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT +I+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHNISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score =   186 bits (472),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNN P FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNLPVFF  144



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score =   186 bits (472),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNN P FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNLPVFF  144



>ref|XP_010536470.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   186 bits (472),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EK+ NF RERIP RVVHARGA+AKGFFEVT DITHLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLLEKLANFDRERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHER SPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERASPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|ACH63223.1| catalase [Rheum australe]
Length=492

 Score =   186 bits (472),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEKI NF RERIP RVVHARGA+AK FFEVT D++HLTCADFLRAPGVQTPLIVRFS
Sbjct  45   YHLVEKIVNFDRERIPERVVHARGASAKVFFEVTHDVSHLTCADFLRAPGVQTPLIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>dbj|BAA05494.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   186 bits (472),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EK+  F RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLIEKLAQFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TV+HERGSPET+RDPRGFAVK YTREGNFDLVGNN PGFF
Sbjct  105  TVVHERGSPETLRDPRGFAVKFYTREGNFDLVGNNMPGFF  144



>ref|XP_006416378.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
 gb|ESQ34731.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
Length=492

 Score =   186 bits (472),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EKI NF RERIP RVVHARGA+AKGFFEVT DITHLTCADFLR PGVQTP+I RFS
Sbjct  45   YHLLEKIANFDRERIPERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIARFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>emb|CDX76313.1| BnaA08g10870D [Brassica napus]
Length=477

 Score =   186 bits (471),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  42   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  101

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  102  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  141



>sp|P45739.1|CATA_HELAN RecName: Full=Catalase [Helianthus annuus]
 gb|AAA69866.1| catalase [Helianthus annuus]
Length=492

 Score =   186 bits (472),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DIT LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDITALTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score =   186 bits (472),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT D++HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNN P FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNLPVFF  144



>emb|CDY17510.1| BnaC03g65530D [Brassica napus]
Length=477

 Score =   186 bits (471),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  42   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  101

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  102  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  141



>emb|CDY52649.1| BnaAnng11640D [Brassica napus]
Length=449

 Score =   185 bits (469),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTPLIVRFS
Sbjct  82   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFS  141

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNN P FF
Sbjct  142  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNIPVFF  181



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score =   186 bits (471),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT D++HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNN P FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNLPVFF  144



>emb|CDP07287.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   186 bits (471),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score =   186 bits (471),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT D++HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNN P FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNLPVFF  144



>gb|ABK24453.1| unknown [Picea sitchensis]
Length=492

 Score =   186 bits (471),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEKI  F RER+P RVVHARGA+AKGFFEVT DI+HLTCAD LRAPGVQTPLIVRFS
Sbjct  45   YHLVEKIAQFDRERVPERVVHARGASAKGFFEVTHDISHLTCADLLRAPGVQTPLIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score =   186 bits (471),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT D++HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNN P FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNLPVFF  144



>gb|AIZ77475.1| catalase, partial [Triticum aestivum]
Length=490

 Score =   186 bits (471),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEKI +F RERIP RVVHARGA+AKGFFEVT D++HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKIADFDRERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFA+K YTREGN+DLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAIKFYTREGNWDLVGNNFPVFF  144



>gb|AAK96854.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   186 bits (471),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>sp|P25890.1|CATA_PEA RecName: Full=Catalase [Pisum sativum]
 emb|CAA42736.1| catalase [Pisum sativum]
Length=494

 Score =   186 bits (471),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+  F RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLAQFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGN+DLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNYDLVGNNFPVFF  144



>emb|CDX72514.1| BnaC07g45360D [Brassica napus]
Length=480

 Score =   185 bits (470),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|AGV54297.1| peroxisomal catalase [Phaseolus vulgaris]
Length=492

 Score =   186 bits (471),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT D++HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNN P FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNLPVFF  144



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score =   186 bits (471),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+ LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_010061175.1| PREDICTED: catalase-like [Eucalyptus grandis]
Length=492

 Score =   186 bits (471),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EKI NF RERIP RVVHARGA+AKGFFEVT DI+ LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLLEKIANFDRERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_011022153.1| PREDICTED: catalase-2-like isoform X2 [Populus euphratica]
Length=492

 Score =   186 bits (471),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHE GSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHELGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score =   186 bits (471),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+ LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>dbj|BAQ21275.1| catalase [Citrus tamurana]
Length=476

 Score =   185 bits (470),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  29   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  88

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  89   TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  128



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score =   186 bits (471),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEKI NF RERIP RVVHARGA+AKGFFEVT DI++L+CADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKIANFDRERIPERVVHARGASAKGFFEVTHDISNLSCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|ACJ11733.1| catalase [Gossypium hirsutum]
Length=492

 Score =   186 bits (471),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+H+TCADFLRAPGVQTP+I+RFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHVTCADFLRAPGVQTPVILRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score =   186 bits (471),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEKI NF RERIP RVVHARGA+AKGFFEVT DI++L+CADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKIANFDRERIPERVVHARGASAKGFFEVTHDISNLSCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|KCW68093.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=399

 Score =   183 bits (465),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLLEKLANFERERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVG NFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGINFPVFF  144



>ref|NP_001031791.1| catalase 2 [Arabidopsis thaliana]
 gb|AEE86463.1| catalase 2 [Arabidopsis thaliana]
Length=474

 Score =   185 bits (470),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_010063132.1| PREDICTED: LOW QUALITY PROTEIN: catalase isozyme 1-like [Eucalyptus 
grandis]
Length=490

 Score =   186 bits (471),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+ LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|NP_195235.1| catalase 2 [Arabidopsis thaliana]
 sp|P25819.3|CATA2_ARATH RecName: Full=Catalase-2 [Arabidopsis thaliana]
 emb|CAA17773.1| catalase [Arabidopsis thaliana]
 emb|CAB80226.1| catalase [Arabidopsis thaliana]
 gb|AAL66998.1| putative catalase [Arabidopsis thaliana]
 gb|AAM44902.1| putative catalase [Arabidopsis thaliana]
 gb|AEE86462.1| catalase 2 [Arabidopsis thaliana]
Length=492

 Score =   186 bits (471),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|KJB57963.1| hypothetical protein B456_009G187600 [Gossypium raimondii]
Length=492

 Score =   186 bits (471),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+ LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>dbj|BAJ90861.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86892.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   186 bits (471),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEKI +F RERIP RVVHARGA+AKGFFEVT D++HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKIADFDRERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFA+K YTREGN+DLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAIKFYTREGNWDLVGNNFPVFF  144



>gb|ACA50528.1| putative catalase 2 [Brassica napus]
Length=492

 Score =   186 bits (471),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKSYTREGNFDLVGNNFPVFF  144



>dbj|BAH19523.1| AT4G35090 [Arabidopsis thaliana]
Length=474

 Score =   185 bits (470),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|EMT05040.1| Catalase-1 [Aegilops tauschii]
Length=526

 Score =   186 bits (472),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEKI +F RERIP RVVHARGA+AKGFFEVT D++HLTCADFLRAPGVQTP+IVRFS
Sbjct  79   YHLVEKIADFDRERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFS  138

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFA+K YTREGN+DLVGNNFP FF
Sbjct  139  TVIHERGSPETLRDPRGFAIKFYTREGNWDLVGNNFPVFF  178



>ref|XP_009108684.1| PREDICTED: catalase-2-like isoform X3 [Brassica rapa]
Length=474

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|ACV92695.1| catalase [Brassica oleracea]
Length=492

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|AIX10947.1| putative catalase [Gardenia jasminoides]
Length=492

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ N+TRERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANWTRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGN+DLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNYDLVGNNFPVFF  144



>ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>emb|CAA64220.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+  F RERIP RVVHARGA+AKGFFEVT D++HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLAQFDRERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_006412154.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53607.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=518

 Score =   186 bits (472),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|AAD17935.1| catalase [Brassica juncea]
Length=492

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>prf||1906388A catalase
Length=492

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_011022152.1| PREDICTED: catalase-2-like isoform X1 [Populus euphratica]
Length=511

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  64   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFS  123

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHE GSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  124  TVIHELGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  163



>dbj|BAJ33995.1| unnamed protein product [Thellungiella halophila]
Length=492

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=492

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|AAB86582.2| catalase [Raphanus sativus]
Length=491

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  44   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  103

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  104  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  143



>gb|AFD29285.1| catalase [Vicia faba]
Length=494

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+  F RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLAQFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGN+DLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNYDLVGNNFPVFF  144



>dbj|BAH37035.1| catalase 1 [Pisum sativum]
Length=494

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+  F RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLAQFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGN+DLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNYDLVGNNFPVFF  144



>gb|AHF21552.1| catalase [Hylocereus undatus]
Length=492

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EKI NF RERIP R+VHARGA+AKGFFEVT D++HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLIEKITNFHRERIPERIVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPETIRDPRGFA K YTREGNFD+VGNNFP FF
Sbjct  105  TVIHERGSPETIRDPRGFATKFYTREGNFDIVGNNFPVFF  144



>sp|P48350.1|CATA1_CUCPE RecName: Full=Catalase isozyme 1 [Cucurbita pepo]
 dbj|BAA09506.1| catalase [Cucurbita pepo]
Length=492

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DIT+L+CADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDITNLSCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|AAD17933.1| catalase [Brassica juncea]
Length=496

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_008812256.1| PREDICTED: catalase isozyme B [Phoenix dactylifera]
Length=478

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EK+  F RERIP RVVHARGA+AKGFFEVT D++HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLIEKLAQFDRERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|AAF71742.1|AF248491_1 catalase [Raphanus sativus]
Length=492

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|AJE26131.1| catalase [Salix matsudana]
Length=492

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEKI NF RERIP RVVHARGA+AKGFFEVT DI+ LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKIANFDRERIPERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|KFK30147.1| catalase [Arabis alpina]
Length=492

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_009138342.1| PREDICTED: catalase-2 [Brassica rapa]
 gb|AAD17934.1| catalase [Brassica juncea]
Length=492

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|EYU36566.1| hypothetical protein MIMGU_mgv1a005245mg [Erythranthe guttata]
Length=492

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|AAD17936.1| catalase [Brassica juncea]
Length=492

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|AAR14052.2| catalase [Solanum tuberosum]
Length=475

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERI  RVVHARGA+AKGFFEVT DI HLTCADFLRAPGVQTP+IVRFS
Sbjct  28   YHLVEKLANFDRERIAERVVHARGASAKGFFEVTHDIAHLTCADFLRAPGVQTPVIVRFS  87

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  88   TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  127



>ref|XP_009108683.1| PREDICTED: catalase-2-like isoform X2 [Brassica rapa]
Length=496

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|AIS20825.1| CAT [Pyrus x bretschneideri]
Length=492

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HL+CADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHE GSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHEHGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|AFN81243.1| catalase 1 [Brassica rapa subsp. pekinensis]
Length=492

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DIT+L+CADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDITNLSCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|KCW70315.1| hypothetical protein EUGRSUZ_F03557 [Eucalyptus grandis]
Length=479

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+ LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_009108682.1| PREDICTED: catalase-2-like isoform X1 [Brassica rapa]
Length=514

 Score =   185 bits (470),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|AFU90823.1| catalase, partial [Populus x beijingensis]
Length=446

 Score =   184 bits (466),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+ LTCADFLRAPGVQTP+IVRFS
Sbjct  44   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFS  103

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  104  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  143



>ref|XP_009106100.1| PREDICTED: catalase-2 [Brassica rapa]
Length=492

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTPLIVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNN P FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNIPVFF  144



>gb|ADC95629.1| catalase [Bruguiera gymnorhiza]
Length=492

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|AAM97542.1| catalase 3 [Capsicum annuum]
Length=492

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EK+ NF RERIP RVVHARGA+AKGFFEVT DIT LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLLEKLANFDRERIPERVVHARGASAKGFFEVTHDITRLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|AII23739.1| catalase [Zostera marina]
Length=477

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EKI  F RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAP VQTP+IVRFS
Sbjct  45   YHLIEKIAQFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPAVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>dbj|BAJ88747.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=533

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEKI +F RERIP RVVHARGA+AKGFFEVT D++HLTCADFLRAPGVQTP+IVRFS
Sbjct  86   YHLVEKIADFDRERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFS  145

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFA+K YTREGN+DLVGNNFP FF
Sbjct  146  TVIHERGSPETLRDPRGFAIKFYTREGNWDLVGNNFPVFF  185



>gb|AAC19398.1| root catalase [Mesembryanthemum crystallinum]
Length=493

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EKI ++ RERIP RVVHARGA+AKGFFEVT DITHLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLLEKIASWDRERIPERVVHARGASAKGFFEVTNDITHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFA+K YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETMRDPRGFALKFYTREGNFDLVGNNFPVFF  144



>ref|XP_011396830.1| Catalase isozyme 2 [Auxenochlorella protothecoides]
 gb|KFM23952.1| Catalase isozyme 2 [Auxenochlorella protothecoides]
Length=493

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA AKGFFEVT DI+HLTCADFLRAPGVQTP+I RFS
Sbjct  45   YHLVEKLSNFDRERIPERVVHARGAVAKGFFEVTHDISHLTCADFLRAPGVQTPIIARFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TV+HERGSPET+RDPRGFAVK YTREGNFD+VGNNFP FF
Sbjct  105  TVVHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFF  144



>ref|XP_002963086.1| hypothetical protein SELMODRAFT_438313 [Selaginella moellendorffii]
 gb|EFJ36549.1| hypothetical protein SELMODRAFT_438313 [Selaginella moellendorffii]
Length=484

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+  F RERIP RVVHARGA+AKGFFEVT D++HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLAQFDRERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFD+VGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFF  144



>ref|XP_003631925.1| PREDICTED: catalase isozyme 1-like [Vitis vinifera]
Length=492

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT D++ LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFQRERIPERVVHARGASAKGFFEVTHDVSDLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPETIRDPRGFAVK YTREGNFD+VGNNFP FF
Sbjct  105  TVIHERGSPETIRDPRGFAVKFYTREGNFDMVGNNFPVFF  144



>ref|NP_001268098.1| catalase [Vitis vinifera]
 gb|AAL83720.1|AF236127_1 catalase [Vitis vinifera]
Length=492

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT D++ LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFQRERIPERVVHARGASAKGFFEVTHDVSDLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPETIRDPRGFAVK YTREGNFD+VGNNFP FF
Sbjct  105  TVIHERGSPETIRDPRGFAVKFYTREGNFDMVGNNFPVFF  144



>ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum]
 sp|Q9XHH3.1|CATA2_SOLLC RecName: Full=Catalase isozyme 2 [Solanum lycopersicum]
 gb|AAD41256.1| catalase 2 [Solanum lycopersicum]
Length=492

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERI  RVVHARGA+AKGFFEVT DI HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIAERVVHARGASAKGFFEVTHDIAHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_002980247.1| hypothetical protein SELMODRAFT_178171 [Selaginella moellendorffii]
 gb|EFJ18507.1| hypothetical protein SELMODRAFT_178171 [Selaginella moellendorffii]
Length=492

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+  F RERIP RVVHARGA+AKGFFEVT D++HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLAQFDRERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFD+VGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFF  144



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+ LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERI  RVVHARGA+AKGFFEVT DI HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIAERVVHARGASAKGFFEVTHDIAHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>emb|CAG23920.1| catalase [Festuca arundinacea]
Length=492

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEKI +F RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKIADFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFA+K YTREGN+DL GNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAIKFYTREGNWDLAGNNFPVFF  144



>dbj|BAA34205.1| catalase [Oryza sativa Japonica Group]
 gb|AAQ19030.1| catalase [Oryza sativa]
Length=492

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DITHLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPR FA+K YTREGN+DLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRVFAIKFYTREGNWDLVGNNFPVFF  144



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+ LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+ LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score =   184 bits (467),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT D+++LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDVSNLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score =   184 bits (467),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT D+++LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDVSNLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|ABB51561.1| truncated catalase 2 [Avicennia marina]
Length=424

 Score =   183 bits (464),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            Y L++K+ +FTRERIP RVVHARGATAKGFFEVT D++HLTCADFLRAPGVQTPLIVRFS
Sbjct  45   YQLIDKLAHFTRERIPERVVHARGATAKGFFEVTHDVSHLTCADFLRAPGVQTPLIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFD+VGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDIVGNNFPVFF  144



>gb|EPS69543.1| catalase [Genlisea aurea]
Length=492

 Score =   184 bits (467),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLT ADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLTSADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_011022275.1| PREDICTED: catalase-like [Populus euphratica]
Length=476

 Score =   184 bits (467),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGV+TP+IVRFS
Sbjct  29   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVKTPVIVRFS  88

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHE GSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  89   TVIHELGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  128



>ref|XP_010061174.1| PREDICTED: catalase isozyme 3-like isoform X2 [Eucalyptus grandis]
 gb|KCW68092.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=492

 Score =   184 bits (467),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLLEKLANFERERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVG NFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGINFPVFF  144



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score =   184 bits (467),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+ LTCADFLRAPGVQTP+IVRFS
Sbjct  44   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFS  103

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  104  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  143



>gb|ACB11496.1| catalase [Pinus sylvestris]
Length=492

 Score =   184 bits (467),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEKI  F RER+P RVVHARGA+AKGFFEVT DI+HLTCADFLRA GVQTPLIVRFS
Sbjct  45   YHLVEKIAQFDRERVPERVVHARGASAKGFFEVTHDISHLTCADFLRAAGVQTPLIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>prf||2104177A catalase
Length=492

 Score =   184 bits (467),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DIT LTCADFLRAPGVQTP+IVR S
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDITALTCADFLRAPGVQTPVIVRLS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_006473791.1| PREDICTED: catalase isozyme 1-like isoform X1 [Citrus sinensis]
 ref|XP_006473792.1| PREDICTED: catalase isozyme 1-like isoform X2 [Citrus sinensis]
 ref|XP_006473793.1| PREDICTED: catalase isozyme 1-like isoform X3 [Citrus sinensis]
Length=512

 Score =   184 bits (468),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT D+++LTCADFLRAPGVQTP+IVRFS
Sbjct  65   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDVSNLTCADFLRAPGVQTPVIVRFS  124

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  125  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  164



>ref|XP_006828714.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
 gb|ERM96130.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
Length=492

 Score =   184 bits (467),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EK+ +FTRER P R+VHARGA+AKGFFEVT DI+HLTCAD LRAPGVQTPLIVRFS
Sbjct  45   YHLIEKLAHFTRERTPERIVHARGASAKGFFEVTHDISHLTCADLLRAPGVQTPLIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPETIRDPRGFAVK YTREGN+DLVGNNFP FF
Sbjct  105  TVIHERGSPETIRDPRGFAVKFYTREGNWDLVGNNFPVFF  144



>gb|AAP80622.1|AF475100_1 catalase isozyme, partial [Triticum aestivum]
Length=268

 Score =   178 bits (452),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EK+  F RERIP RVVHARGA+AKGFFEVT D++ LTCADFLRAPGVQTP+IVRFS
Sbjct  59   YHLIEKLAQFDRERIPERVVHARGASAKGFFEVTHDVSQLTCADFLRAPGVQTPVIVRFS  118

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TV+HERGSPET+RDPRGFAVK YTREGNFDLVGNN P FF
Sbjct  119  TVVHERGSPETLRDPRGFAVKFYTREGNFDLVGNNMPVFF  158



>gb|KCW68095.1| hypothetical protein EUGRSUZ_F01777 [Eucalyptus grandis]
Length=584

 Score =   186 bits (471),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EKI NF RERIP RVVHARGA+AKGFFEVT DI+ LTCADFLRAPGVQTP+IVRFS
Sbjct  137  YHLLEKIANFDRERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFS  196

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  197  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  236



>sp|Q9AXH0.1|CATA_AVIMR RecName: Full=Catalase [Avicennia marina]
 gb|AAK06839.1|AF328861_1 catalase [Avicennia marina]
 gb|AAP13538.1| catalase [Avicennia marina]
Length=492

 Score =   184 bits (467),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            Y L++K+ +FTRERIP RVVHARGATAKGFFEVT D++HLTCADFLRAPGVQTPLIVRFS
Sbjct  45   YQLIDKLAHFTRERIPERVVHARGATAKGFFEVTHDVSHLTCADFLRAPGVQTPLIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFD+VGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDIVGNNFPVFF  144



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score =   184 bits (466),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EK+  F RERIP RVVHARGA+AKGFFEVT D++HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLLEKLAQFDRERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>emb|CDP01803.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   184 bits (466),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI+ LTCADFLR PGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISQLTCADFLRTPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>emb|CDX69111.1| BnaC01g03420D [Brassica napus]
Length=480

 Score =   183 bits (465),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK+YT EGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKLYTGEGNFDLVGNNFPVFF  144



>gb|ACL35349.1| catalase [Picea glauca]
Length=492

 Score =   184 bits (466),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEKI  F RER+P RVVHARGA+AKGFFEVT DI+HLTCAD LRAPGVQTPLIVRFS
Sbjct  45   YHLVEKIAQFDRERVPERVVHARGASAKGFFEVTHDISHLTCADLLRAPGVQTPLIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETPRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_010061173.1| PREDICTED: catalase isozyme 2-like isoform X1 [Eucalyptus grandis]
Length=496

 Score =   184 bits (466),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EK+ NF RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLLEKLANFERERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVG NFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGINFPVFF  144



>ref|XP_007210576.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
 gb|EMJ11775.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
Length=492

 Score =   183 bits (465),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+  F RERIP RVVHARGA+AKGFFEVT DI+ LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLATFDRERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>emb|CAD42909.1| catalase [Prunus persica]
Length=492

 Score =   183 bits (465),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+  F RERIP RVVHARGA+AKGFFEVT DI+ LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLATFDRERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_008237989.1| PREDICTED: catalase isozyme 1-like [Prunus mume]
Length=492

 Score =   183 bits (465),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+  F RERIP RVVHARGA+AKGFFEVT DI+ LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLATFDRERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|ABV55108.1| catalase 2 [Musa acuminata AAA Group]
Length=492

 Score =   183 bits (465),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEKI +F RERIP RVVHARGA+AKGFFE T D+THLTCADFLRAPGVQTP+I+RFS
Sbjct  45   YHLVEKIAHFARERIPERVVHARGASAKGFFECTHDVTHLTCADFLRAPGVQTPIILRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPETIRDPRGFAVK YTREGN+DL+GNNFP FF
Sbjct  105  TVIHERGSPETIRDPRGFAVKFYTREGNWDLLGNNFPVFF  144



>gb|AFR53082.1| CAT [Anthurium andraeanum]
Length=492

 Score =   183 bits (465),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EK+ +F RERIP RVVHARGA+AKGFFE T D+THLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLIEKVAHFARERIPERVVHARGASAKGFFECTHDVTHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPETIRDPRGFAVK YTREGN+DL+GNNFP FF
Sbjct  105  TVIHERGSPETIRDPRGFAVKFYTREGNWDLLGNNFPVFF  144



>ref|XP_009398521.1| PREDICTED: catalase isozyme A [Musa acuminata subsp. malaccensis]
Length=492

 Score =   183 bits (465),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEKI +F RERIP RVVHARGA+AKGFFE T D+THLTCADFLRAPGVQTP+I+RFS
Sbjct  45   YHLVEKIAHFARERIPERVVHARGASAKGFFECTHDVTHLTCADFLRAPGVQTPIILRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPETIRDPRGFAVK YTREGN+DL+GNNFP FF
Sbjct  105  TVIHERGSPETIRDPRGFAVKFYTREGNWDLLGNNFPVFF  144



>ref|XP_006283612.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
 gb|EOA16510.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
Length=492

 Score =   183 bits (465),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNN P FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNMPVFF  144



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score =   183 bits (465),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YH++EK+  F RERIP RVVHARGA+AKGFFEVT D++HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHVIEKLAQFDRERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_010477308.1| PREDICTED: catalase-1 [Camelina sativa]
Length=492

 Score =   183 bits (465),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EK+ NF RERIP RVVHARGA+AKGFFEVT DI+ LTCADFLR PGVQTP+IVRFS
Sbjct  45   YHLLEKLANFDRERIPERVVHARGASAKGFFEVTHDISQLTCADFLRGPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_010459749.1| PREDICTED: catalase-1-like [Camelina sativa]
Length=492

 Score =   183 bits (465),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EK+ NF RERIP RVVHARGA+AKGFFEVT DI+ LTCADFLR PGVQTP+IVRFS
Sbjct  45   YHLLEKLANFDRERIPERVVHARGASAKGFFEVTHDISQLTCADFLRGPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|AAD50974.1|AF170272_1 catalase CAT1 [Manihot esculenta]
Length=492

 Score =   183 bits (465),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YH++EK+ NFTRERIP RVVHARG +AKGFFEVT D++HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHMIEKLANFTRERIPERVVHARGMSAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFA K YTREGNFD+VGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFATKFYTREGNFDIVGNNFPVFF  144



>ref|XP_008789355.1| PREDICTED: catalase isozyme 1-like [Phoenix dactylifera]
Length=492

 Score =   183 bits (465),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YH++EK+  F RERIP RVVHARGA+AKGFFEVT D++HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHVIEKLAQFDRERIPERVVHARGASAKGFFEVTNDVSHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|ABM47415.1| catalase [Prunus avium]
Length=492

 Score =   183 bits (465),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+  F RERIP RVVHARGA+AKGFFEVT DI+ LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLATFDRERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_008778560.1| PREDICTED: catalase isozyme 2-like [Phoenix dactylifera]
Length=482

 Score =   183 bits (464),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EKI +F RERIP RVVHARGA+AKGFFE T D+THLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLIEKIAHFARERIPERVVHARGASAKGFFECTHDVTHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPETIRDPRGFAVK YTREGN+DL+GNNFP FF
Sbjct  105  TVIHERGSPETIRDPRGFAVKFYTREGNWDLLGNNFPVFF  144



>gb|EYU30275.1| hypothetical protein MIMGU_mgv1a005250mg [Erythranthe guttata]
Length=492

 Score =   183 bits (464),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLR PGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRGPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPE+IRDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPESIRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>emb|CAA45564.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   183 bits (464),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIH RGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHARGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|AHF27433.1| catalase [Cucurbita maxima]
Length=492

 Score =   183 bits (464),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            Y L+EKI  FTRERIP RVVHARGA+AKGFFEVT DI++LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YQLIEKIATFTRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|AIU99487.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   183 bits (464),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EK+  F RERIP RVVHARGA+AKGFFEVT D++HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLIEKLAQFDRERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TV+HERGSPET+RDPRGFAVK+YTREGNFDLVGNN P FF
Sbjct  105  TVVHERGSPETLRDPRGFAVKLYTREGNFDLVGNNMPVFF  144



>ref|XP_010663966.1| PREDICTED: catalase isozyme 1 [Vitis vinifera]
 emb|CBI40714.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   183 bits (464),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFE T DI++LTCADFLRAPGVQTP+I+RFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFETTHDISNLTCADFLRAPGVQTPVILRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_008802866.1| PREDICTED: catalase isozyme 1 [Phoenix dactylifera]
Length=492

 Score =   183 bits (464),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YH++EK+  F RERIP RVVHARGA+AKGFFEVT D++HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHVIEKLAQFDRERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_010941422.1| PREDICTED: catalase isozyme B [Elaeis guineensis]
Length=492

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YH++EK+  F RERIP RVVHARGA+AKGFFEVT D++HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHVIEKLAQFDRERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|ABB88582.1| catalase [Ulva fasciata]
Length=492

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA AKGFFEVT DI+HLTCADFLRAPGVQTP+ VRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGAAAKGFFEVTHDISHLTCADFLRAPGVQTPVAVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPETIRDPRGFAVK YTREGN+D+VGNN P FF
Sbjct  105  TVIHERGSPETIRDPRGFAVKFYTREGNYDMVGNNMPVFF  144



>ref|XP_001752315.1| predicted protein [Physcomitrella patens]
 gb|EDQ83048.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+  F RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLAQFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFD+VGNN P FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNIPVFF  144



>gb|ACJ76836.3| catalase [Dimocarpus longan]
Length=492

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ +F RER P RVVHARGA+AKGFFEVT D++HLTCADFLRAPGVQTP+I+RFS
Sbjct  45   YHLVEKLAHFARERTPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIILRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|AAG43363.1|AF151368_1 catalase [Hevea brasiliensis]
Length=492

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EK+ NF RERIP RVVHARGA+AKGFFEVT +++ LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLLEKLANFDRERIPERVVHARGASAKGFFEVTHNVSQLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPETIRDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETIRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|AAF61732.1|AF243517_1 catalase 2 [Helianthus annuus]
Length=492

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YH VEK+ NF RERIP RVVHARGA+AKGFFEVT DI+ LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHFVEKLANFDRERIPERVVHARGASAKGFFEVTHDISALTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_004145541.1| PREDICTED: catalase isozyme 1-like [Cucumis sativus]
 ref|XP_004157075.1| PREDICTED: catalase isozyme 1-like [Cucumis sativus]
Length=973

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DITHLTCADFLRAPG QTP+IVRFS
Sbjct  526  YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGTQTPVIVRFS  585

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  586  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  625


 Score =   185 bits (469),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHLVEK+ NF RERIP RVVHARGA+AKGFFEVT DIT+L+CADFLRAPGVQTP+IVRFS
Sbjct  45   YHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDITNLSCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_008791900.1| PREDICTED: catalase isozyme 2 [Phoenix dactylifera]
Length=492

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EKI +F RERIP RVVHARGA+AKGFFE T D+THLTCADFLRAPGVQTP+I+RFS
Sbjct  45   YHLIEKIAHFARERIPERVVHARGASAKGFFECTHDVTHLTCADFLRAPGVQTPIILRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPETIRDPRGFAVK YTREGN+DL+GNNFP FF
Sbjct  105  TVIHERGSPETIRDPRGFAVKFYTREGNWDLLGNNFPVFF  144



>ref|NP_001058635.1| Os06g0727200 [Oryza sativa Japonica Group]
 sp|Q0D9C4.1|CATA2_ORYSJ RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Japonica 
Group]
 dbj|BAD61813.1| catalase [Oryza sativa Japonica Group]
 dbj|BAF20549.1| Os06g0727200 [Oryza sativa Japonica Group]
 gb|EAZ38347.1| hypothetical protein OsJ_22721 [Oryza sativa Japonica Group]
 dbj|BAG91437.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94401.1| unnamed protein product [Oryza sativa Japonica Group]
Length=492

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EK+  F RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLIEKLAQFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TV+HERGSPET+RDPRGFAVK YTREGNFDLVGNN P FF
Sbjct  105  TVVHERGSPETLRDPRGFAVKFYTREGNFDLVGNNMPVFF  144



>sp|A2YH64.2|CATA2_ORYSI RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Indica 
Group]
 gb|EEC81340.1| hypothetical protein OsI_24526 [Oryza sativa Indica Group]
Length=492

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EK+  F RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLIEKLAQFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TV+HERGSPET+RDPRGFAVK YTREGNFDLVGNN P FF
Sbjct  105  TVVHERGSPETLRDPRGFAVKFYTREGNFDLVGNNMPVFF  144



>ref|XP_006656514.1| PREDICTED: catalase isozyme B-like [Oryza brachyantha]
Length=492

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EK+  F RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLIEKLAQFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TV+HERGSPET+RDPRGFAVK YTREGNFDLVGNN P FF
Sbjct  105  TVVHERGSPETLRDPRGFAVKFYTREGNFDLVGNNMPVFF  144



>gb|AHF27430.1| catalase [Cucurbita moschata]
Length=492

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            Y L+EKI  FTRERIP RVVHARGA+AKGFFEVT DI+ LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YQLIEKIATFTRERIPERVVHARGASAKGFFEVTHDISDLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>ref|XP_008464839.1| PREDICTED: catalase isozyme 3 [Cucumis melo]
 gb|ADN33988.1| catalase [Cucumis melo subsp. melo]
Length=492

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            Y L+EKI  FTRERIP RVVHARGA+AKGFFEVT DI+ LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YQLIEKIATFTRERIPERVVHARGASAKGFFEVTHDISDLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  144



>gb|ACL81498.1| catalase [Ginkgo biloba]
Length=492

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EK+  FTRERIP RVVHARGA+AKGFFEVT D++HLTCADFLR+PGVQTPLIVRFS
Sbjct  45   YHLIEKLSVFTRERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRSPGVQTPLIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFD+VGNN P FF
Sbjct  105  TVIHERGSPETLRDPRGFAVKFYTREGNFDIVGNNIPVFF  144



>ref|XP_002437631.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
 gb|EER88998.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
Length=492

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EK+  F RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLIEKLAQFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TV+HERGSPET+RDPRGFAVK YTREGNFDLVGNN P FF
Sbjct  105  TVVHERGSPETLRDPRGFAVKFYTREGNFDLVGNNMPVFF  144



>ref|XP_003563243.1| PREDICTED: catalase isozyme 1 [Brachypodium distachyon]
Length=492

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EK+  F RERIP RVVHARGA+AKGFFEVT DI+HLTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHLIEKLAQFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TV+HERGSPET+RDPRGFAVK YTREGNFDLVGNN P FF
Sbjct  105  TVVHERGSPETLRDPRGFAVKFYTREGNFDLVGNNMPVFF  144



>ref|XP_002510677.1| catalase, putative [Ricinus communis]
 gb|EEF52864.1| catalase, putative [Ricinus communis]
Length=974

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EK+ NF RERIP RVVHARGA+AKGFFEVT D++HLTCADFLRAPGVQTP+IVRFS
Sbjct  527  YHLIEKLANFDRERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFS  586

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFAVK YTREGNFDLVGNNFP FF
Sbjct  587  TVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF  626


 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YH++EK+ NFTRERIP RVVHARG +AKGFFEVT D+T LTCADFLRAPGVQTP+IVRFS
Sbjct  45   YHMIEKLANFTRERIPERVVHARGMSAKGFFEVTHDVTDLTCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPET+RDPRGFA K YTREGNFD+VGNNFP FF
Sbjct  105  TVIHERGSPETLRDPRGFATKFYTREGNFDIVGNNFPVFF  144



>ref|XP_009392261.1| PREDICTED: catalase isozyme A-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=492

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  3    YHLVEKIXNFTRERIPXRVVHARGATAKGFFEVTRDITHLTCADFLRAPGVQTPLIVRFS  182
            YHL+EK+ +F RERIP RVVHARGA+AKGFFE T D+THL+CADFLRAPGVQTP+IVRFS
Sbjct  45   YHLIEKVAHFARERIPERVVHARGASAKGFFECTHDVTHLSCADFLRAPGVQTPVIVRFS  104

Query  183  TVIHERGSPETIRDPRGFAVKMYTREGNFDLVGNNFPGFF  302
            TVIHERGSPETIRDPRGFAVK YTREGN+DL+GNNFP FF
Sbjct  105  TVIHERGSPETIRDPRGFAVKFYTREGNWDLLGNNFPVFF  144



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562775562090