BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF038P01

Length=568
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EUB56387.1|  Tubulin alpha-1C chain                                75.9    2e-12   Echinococcus granulosus
gb|ABD94137.1|  alpha tubulin                                         68.9    3e-12   Cathaya argyrophylla
gb|EPS68934.1|  alpha tubulin                                         68.6    4e-12   Genlisea aurea
ref|XP_002883197.1|  predicted protein                                71.6    5e-12   
ref|XP_010099392.1|  Tubulin alpha chain                              72.8    1e-11   
gb|AFW67745.1|  alpha tubulin4                                        68.9    1e-11   
gb|AAT77078.1|  alpha tubulin                                         70.1    1e-11   Oryza sativa Japonica Group [Japonica rice]
gb|AAV33983.1|  alpha tubulin                                         68.2    1e-11   Pinus taeda
gb|AAK51091.1|  alpha tubulin                                         68.2    1e-11   Coffea arabica [arabica coffee]
gb|ETE56023.1|  Tubulin alpha-1A chain                                68.2    1e-11   Ophiophagus hannah
ref|XP_007047652.1|  Tubulin alpha-2 chain                            72.4    2e-11   
emb|CDJ03953.1|  tubulin alpha chain                                  72.0    2e-11   
ref|XP_001786415.1|  predicted protein                                68.6    2e-11   
emb|CDS16437.1|  tubulin alpha chain                                  72.0    2e-11   Echinococcus granulosus
emb|CAA44864.1|  alpha-tubulin #4                                     66.2    2e-11   Zea mays [maize]
gb|ABF13307.1|  alpha-tubulin                                         68.2    2e-11   Phaseolus vulgaris [French bean]
emb|CAD32379.1|  tubulin alpha                                        68.2    2e-11   Oryza sativa Indica Group [Indian rice]
gb|AFV46219.1|  hypothetical protein                                  71.6    2e-11   Scutellaria baicalensis [Baikal skullcap]
ref|WP_039310890.1|  hypothetical protein                             71.6    2e-11   
sp|P33626.1|TBA4_MAIZE  RecName: Full=Tubulin alpha-4 chain; AltN...  66.6    3e-11   Zea mays [maize]
gb|ACU18775.1|  unknown                                               68.9    3e-11   Glycine max [soybeans]
ref|XP_003979912.1|  PREDICTED: tubulin alpha-1D chain-like           67.8    3e-11   
gb|EPQ14625.1|  Peripherin                                            72.0    3e-11   Myotis brandtii
gb|ABE66388.1|  alpha-tubulin                                         68.9    3e-11   Striga asiatica [witchweed]
gb|ACG47343.1|  hypothetical protein                                  65.9    3e-11   Zea mays [maize]
gb|EYU34086.1|  hypothetical protein MIMGU_mgv1a0196711mg             68.9    3e-11   Erythranthe guttata [common monkey flower]
tpg|DAA51110.1|  TPA: alpha-tubulin                                   69.3    3e-11   
gb|ACU24494.1|  unknown                                               68.6    3e-11   Glycine max [soybeans]
gb|AAT77076.1|  alpha tubulin                                         67.8    3e-11   Oryza sativa Japonica Group [Japonica rice]
dbj|BAE88902.1|  unnamed protein product                              66.6    3e-11   Macaca fascicularis [crab eating macaque]
gb|EPY73087.1|  hypothetical protein CB1_043508005                    66.2    4e-11   Camelus ferus
gb|AHJ80818.1|  Tua1                                                  69.7    4e-11   Eragrostis tef [tef]
ref|XP_004400552.1|  PREDICTED: tubulin alpha-3 chain-like            71.2    4e-11   Odobenus rosmarus divergens
ref|XP_010621916.1|  PREDICTED: tubulin alpha-1B chain isoform X2     71.2    4e-11   Fukomys damarensis [Damara mole rat]
ref|XP_009423750.1|  PREDICTED: tubulin alpha-1B chain isoform X2     71.2    4e-11   
ref|XP_004805868.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...  71.2    4e-11   
ref|XP_003793652.1|  PREDICTED: tubulin alpha-1C chain isoform 1      71.2    4e-11   
ref|XP_010726225.1|  PREDICTED: tubulin alpha chain-like              68.2    4e-11   Meleagris gallopavo [common turkey]
ref|XP_006433709.1|  hypothetical protein CICLE_v100015521mg          67.8    4e-11   
dbj|BAC56489.1|  similar to tubulin alpha 1                           65.9    4e-11   Bos taurus [bovine]
ref|NP_001275472.1|  alpha-tubulin-like protein                       68.9    4e-11   Solanum tuberosum [potatoes]
emb|CBI29424.3|  unnamed protein product                              69.3    5e-11   Vitis vinifera
ref|XP_008581337.1|  PREDICTED: tubulin alpha chain-like              66.6    5e-11   Galeopterus variegatus [Malayan flying lemur]
ref|XP_005391931.1|  PREDICTED: tubulin alpha-3E chain                67.0    5e-11   Chinchilla lanigera
gb|EPZ32931.1|  Tubulin domain-containing protein                     67.4    5e-11   Rozella allomycis CSF55
gb|ACN40426.1|  unknown                                               69.7    5e-11   Picea sitchensis
ref|XP_002609253.1|  hypothetical protein BRAFLDRAFT_86837            67.0    6e-11   Branchiostoma floridae
ref|XP_010751701.1|  PREDICTED: tubulin alpha-1C chain-like isofo...  70.9    6e-11   
ref|XP_002263822.2|  PREDICTED: tubulin alpha chain                   69.7    6e-11   
gb|KIH42923.1|  hypothetical protein ANCDUO_27086                     65.9    6e-11   Ancylostoma duodenale
gb|AAI59362.1|  Unknown (protein for MGC:185872)                      67.4    6e-11   Xenopus tropicalis [western clawed frog]
ref|XP_011302976.1|  PREDICTED: tubulin alpha-2 chain-like isofor...  70.5    6e-11   Fopius arisanus
emb|CDQ86411.1|  unnamed protein product                              67.0    6e-11   Oncorhynchus mykiss
ref|XP_006264720.1|  PREDICTED: tubulin alpha-1C chain                67.4    6e-11   
gb|EGI67764.1|  Tubulin alpha-1 chain                                 70.9    6e-11   Acromyrmex echinatior
ref|XP_005896455.1|  PREDICTED: tubulin alpha-1C chain-like           70.5    6e-11   Bos mutus
ref|XP_004007465.1|  PREDICTED: tubulin alpha-1C chain                70.9    6e-11   
gb|AAN33000.1|  alpha-tubulin 4                                       69.3    6e-11   Gossypium hirsutum [American cotton]
ref|XP_001178141.2|  PREDICTED: tubulin alpha-1C chain-like isofo...  70.9    6e-11   
emb|CBI25125.3|  unnamed protein product                              70.1    6e-11   Vitis vinifera
gb|ELK08399.1|  Protein LMBR1L                                        71.2    6e-11   Pteropus alecto
ref|XP_005195212.2|  PREDICTED: tubulin alpha-3 chain isoform X1      70.9    7e-11   
ref|XP_004854965.1|  PREDICTED: klotho-like                           71.2    7e-11   
ref|XP_005932718.1|  PREDICTED: tubulin alpha chain-like              67.0    7e-11   
ref|XP_003793694.1|  PREDICTED: tubulin alpha chain-like              67.0    7e-11   Otolemur garnettii
ref|XP_004019820.1|  PREDICTED: tubulin alpha chain-like              67.0    7e-11   
emb|CBI22190.3|  unnamed protein product                              70.1    7e-11   Vitis vinifera
emb|CAD32381.1|  tubulin alpha                                        64.7    7e-11   Oryza sativa Indica Group [Indian rice]
gb|EPY86205.1|  protein LMBR1L isoform 1                              70.9    7e-11   Camelus ferus
emb|CBI19330.3|  unnamed protein product                              70.1    7e-11   Vitis vinifera
ref|XP_793102.3|  PREDICTED: tubulin alpha-1C chain-like              70.5    7e-11   
ref|XP_006264718.1|  PREDICTED: tubulin alpha chain-like              67.4    7e-11   
ref|XP_005059562.1|  PREDICTED: tubulin alpha-2 chain-like            65.1    7e-11   
gb|EPY78320.1|  hypothetical protein CB1_001108068                    70.9    8e-11   Camelus ferus
dbj|GAA50791.1|  tubulin alpha                                        70.5    8e-11   Clonorchis sinensis [oriental liver fluke]
ref|XP_005466520.1|  PREDICTED: tubulin alpha chain-like              67.0    8e-11   
ref|XP_008236253.1|  PREDICTED: tubulin alpha chain isoform X2        70.1    8e-11   
gb|EGW08964.1|  Tubulin alpha-3 chain                                 65.5    8e-11   Cricetulus griseus [Chinese hamsters]
gb|KIH67265.1|  hypothetical protein ANCDUO_02401                     65.1    8e-11   Ancylostoma duodenale
ref|XP_003392163.2|  PREDICTED: tubulin alpha chain, testis-speci...  67.4    8e-11   Amphimedon queenslandica
ref|XP_004704287.1|  PREDICTED: tubulin alpha chain-like              66.6    8e-11   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_007107598.1|  PREDICTED: tubulin alpha-1A chain                67.0    8e-11   
gb|ERE85967.1|  tubulin alpha-1C chain-like protein                   65.9    8e-11   Cricetulus griseus [Chinese hamsters]
ref|XP_004085980.2|  PREDICTED: tubulin alpha-1D chain-like           66.6    8e-11   
ref|XP_003976815.1|  PREDICTED: tubulin alpha-1 chain-like            67.4    8e-11   
gb|EHJ68371.1|  Moesin                                                70.9    8e-11   
gb|AFW67749.1|  alpha tubulin4                                        68.9    8e-11   
emb|CDQ84911.1|  unnamed protein product                              70.9    8e-11   Oncorhynchus mykiss
ref|XP_008216843.1|  PREDICTED: tubulin alpha-1C chain-like           67.4    9e-11   Nasonia vitripennis
emb|CAJ26346.1|  alpha-tubulin                                        67.4    9e-11   Platynereis dumerilii
gb|ADN07531.1|  tubulin, alpha-like 3, 5 prime                        65.5    9e-11   Microtus ochrogaster [prairie voles]
ref|XP_009916549.1|  PREDICTED: tubulin alpha-1C chain-like           67.4    9e-11   Haliaeetus albicilla
gb|EPQ18458.1|  Tubulin alpha-1D chain                                70.1    9e-11   Myotis brandtii
ref|XP_008455056.1|  PREDICTED: tubulin alpha-4 chain isoform X2      69.7    9e-11   
ref|XP_005906298.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...  67.4    9e-11   Bos mutus
gb|ERE81184.1|  tubulin alpha-1C chain                                67.4    9e-11   Cricetulus griseus [Chinese hamsters]
ref|XP_008969760.1|  PREDICTED: tubulin alpha chain-like              67.4    9e-11   
ref|XP_009124557.1|  PREDICTED: tubulin alpha-6 chain-like isofor...  69.7    9e-11   Brassica rapa
gb|AAC97930.1|  alpha tubulin                                         67.0    9e-11   Notothenia coriiceps [yellowbelly rockcod]
gb|EFO61055.1|  Alpha-tubulin                                         67.4    9e-11   Giardia lamblia P15
ref|XP_004644630.1|  PREDICTED: tubulin alpha-3 chain-like            67.4    1e-10   
ref|XP_006056311.1|  PREDICTED: tubulin alpha-1B chain-like           67.8    1e-10   
gb|AAX21196.1|  putative alpha-tubulin                                67.4    1e-10   Solanum betaceum [tamarillo]
gb|KHG14074.1|  Tubulin alpha-2 chain                                 69.7    1e-10   Gossypium arboreum [tree cotton]
ref|XP_010466127.1|  PREDICTED: tubulin alpha-2 chain-like isofor...  69.7    1e-10   
gb|EDM01432.1|  rCG30111, isoform CRA_b                               65.9    1e-10   Rattus norvegicus [brown rat]
gb|AAW30622.1|  unknown                                               67.4    1e-10   Sus scrofa [pigs]
ref|XP_008294350.1|  PREDICTED: tubulin alpha chain                   67.4    1e-10   Stegastes partitus
ref|XP_009702189.1|  PREDICTED: tubulin alpha-1C chain-like           67.4    1e-10   Cariama cristata
ref|XP_006482577.1|  PREDICTED: tubulin alpha-2 chain-like isofor...  69.7    1e-10   Citrus sinensis [apfelsine]
gb|AAW30623.1|  unknown                                               67.4    1e-10   Sus scrofa [pigs]
gb|ABQ59634.1|  alpha-tubulin 5                                       69.7    1e-10   Populus tremuloides
ref|XP_003804211.2|  PREDICTED: tubulin alpha-3E chain                66.6    1e-10   Pan paniscus [bonobo]
ref|XP_005350997.1|  PREDICTED: tubulin alpha chain-like              66.6    1e-10   
ref|XP_002587654.1|  hypothetical protein BRAFLDRAFT_96496            66.2    1e-10   Branchiostoma floridae
ref|XP_002962630.1|  hypothetical protein SELMODRAFT_230143           69.7    1e-10   
dbj|BAG60120.1|  unnamed protein product                              67.0    1e-10   Homo sapiens [man]
ref|NP_849388.1|  tubulin alpha-6 chain                               69.7    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002401565.1|  alpha tubulin, putative                          70.1    1e-10   
ref|XP_002275973.1|  PREDICTED: tubulin alpha chain                   69.7    1e-10   Vitis vinifera
ref|XP_010291103.1|  PREDICTED: tubulin alpha-8 chain                 66.2    1e-10   Phaethon lepturus
ref|XP_006578253.1|  PREDICTED: tubulin alpha-4 chain isoform X2      69.7    1e-10   
ref|XP_008294349.1|  PREDICTED: tubulin alpha chain-like              66.6    1e-10   Stegastes partitus
gb|AGG37287.1|  alpha-tubulin 5                                       69.7    1e-10   Salix arbutifolia
sp|Q6VAG1.1|TBA1_GOSHI  RecName: Full=Tubulin alpha-1 chain; AltN...  69.7    1e-10   Gossypium hirsutum [American cotton]
ref|XP_002989731.1|  hypothetical protein SELMODRAFT_130285           69.7    1e-10   Selaginella moellendorffii
ref|XP_002989721.1|  hypothetical protein SELMODRAFT_235864           69.7    1e-10   
gb|AEM36066.1|  alpha tubulin                                         65.5    1e-10   Mytilus edulis [blue mussel]
ref|XP_007541192.1|  PREDICTED: tubulin alpha chain-like              67.0    1e-10   
ref|XP_002981542.1|  hypothetical protein SELMODRAFT_178975           69.7    1e-10   Selaginella moellendorffii
gb|KHG20487.1|  Tubulin alpha chain                                   69.7    1e-10   Gossypium arboreum [tree cotton]
gb|ABK92552.1|  unknown                                               69.7    1e-10   Populus trichocarpa [western balsam poplar]
ref|XP_005801996.1|  PREDICTED: tubulin alpha-1B chain-like           67.8    1e-10   
ref|XP_005466564.1|  PREDICTED: tubulin alpha chain-like              66.2    1e-10   
gb|ABQ59633.1|  alpha-tubulin 3                                       69.7    1e-10   Populus tremuloides
ref|XP_007199840.1|  hypothetical protein PRUPE_ppa005633mg           69.7    1e-10   Prunus persica
ref|XP_010664458.1|  PREDICTED: tubulin alpha-4 chain                 69.7    1e-10   Vitis vinifera
ref|XP_006422747.1|  hypothetical protein CICLE_v10028426mg           69.7    1e-10   Citrus clementina [clementine]
emb|CAN62392.1|  hypothetical protein VITISV_016172                   69.3    1e-10   Vitis vinifera
gb|KJB29387.1|  hypothetical protein B456_005G097800                  69.7    1e-10   Gossypium raimondii
ref|XP_010104543.1|  Tubulin alpha chain                              69.7    1e-10   
ref|XP_008341563.1|  PREDICTED: tubulin alpha-2 chain-like            69.7    1e-10   
ref|XP_002510010.1|  tubulin alpha chain, putative                    69.7    1e-10   Ricinus communis
gb|ABX57816.1|  alpha tubulin                                         69.7    1e-10   Picea wilsonii
gb|AAV92352.1|  alpha tubulin 1                                       69.7    1e-10   Pseudotsuga menziesii var. menziesii
ref|XP_002466535.1|  hypothetical protein SORBIDRAFT_01g009570        69.7    1e-10   
gb|EJD75589.1|  hypothetical protein LOAG_17302                       64.3    1e-10   Loa loa
gb|KDP32140.1|  hypothetical protein JCGZ_12601                       69.3    1e-10   Jatropha curcas
ref|XP_002522104.1|  tubulin alpha chain, putative                    69.3    1e-10   Ricinus communis
ref|XP_003635553.2|  PREDICTED: tubulin alpha chain-like              69.3    1e-10   Vitis vinifera
dbj|BAP59012.1|  alpha tubulin                                        69.3    1e-10   Taxus cuspidata [ichii]
dbj|BAJ06364.1|  alpha-tubulin                                        69.3    1e-10   Alopecurus aequalis
ref|XP_007018369.1|  Tubulin alpha-2 chain                            69.3    1e-10   Theobroma cacao [chocolate]
gb|AGG37285.1|  alpha-tubulin 3                                       69.3    1e-10   Salix arbutifolia
gb|ABO47737.1|  alpha-tubulin                                         69.3    1e-10   Gossypium hirsutum [American cotton]
ref|NP_001289660.1|  tubulin alpha chain-like                         69.3    1e-10   Eucalyptus grandis [rose gum]
ref|XP_003558668.1|  PREDICTED: tubulin alpha-2 chain-like            69.3    1e-10   Brachypodium distachyon [annual false brome]
ref|XP_006486879.1|  PREDICTED: tubulin alpha chain-like isoform X2   69.3    1e-10   
ref|XP_003522731.1|  PREDICTED: tubulin alpha-4 chain isoform X1      69.3    1e-10   Glycine max [soybeans]
ref|XP_011457777.1|  PREDICTED: tubulin alpha chain                   69.3    1e-10   Fragaria vesca subsp. vesca
ref|XP_009335354.1|  PREDICTED: tubulin alpha chain                   69.3    1e-10   Pyrus x bretschneideri [bai li]
ref|XP_008379344.1|  PREDICTED: tubulin alpha-2 chain                 69.3    1e-10   Malus domestica [apple tree]
gb|ACN40181.1|  unknown                                               69.3    1e-10   Picea sitchensis
gb|AAO73546.1|  alpha-tubulin                                         69.3    1e-10   Ceratopteris richardii
sp|Q6VAG0.1|TBA2_GOSHI  RecName: Full=Tubulin alpha-2 chain; AltN...  69.3    1e-10   Gossypium hirsutum [American cotton]
ref|XP_002283198.1|  PREDICTED: tubulin alpha chain                   69.3    1e-10   Vitis vinifera
gb|AGE09583.1|  TUA1-like protein                                     69.3    1e-10   Eucalyptus cladocalyx
emb|CDY25017.1|  BnaC02g39910D                                        69.3    1e-10   Brassica napus [oilseed rape]
ref|XP_011002356.1|  PREDICTED: tubulin alpha chain-like              69.3    1e-10   Populus euphratica
ref|XP_009402887.1|  PREDICTED: tubulin alpha chain                   69.3    1e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002313194.1|  hypothetical protein POPTR_0009s08850g           69.3    1e-10   Populus trichocarpa [western balsam poplar]
ref|XP_002298794.2|  TUBULIN ALPHA CHAIN family protein               69.3    1e-10   Populus trichocarpa [western balsam poplar]
ref|XP_003608582.1|  Tubulin alpha-5 chain                            69.3    1e-10   Medicago truncatula
ref|XP_001764722.1|  predicted protein                                69.3    1e-10   
ref|XP_006581474.1|  PREDICTED: tubulin alpha-4 chain-like isofor...  69.3    1e-10   
gb|KDP44552.1|  hypothetical protein JCGZ_16385                       69.3    1e-10   Jatropha curcas
gb|ACJ60905.1|  alpha tubulin                                         69.3    1e-10   Betula pendula [white birch]
sp|P33629.1|TBA_PRUDU  RecName: Full=Tubulin alpha chain              69.3    1e-10   Prunus dulcis [sweet almond]
gb|ABO47739.1|  alpha-tubulin                                         69.3    1e-10   Gossypium hirsutum [American cotton]
ref|XP_010245599.1|  PREDICTED: tubulin alpha chain-like              69.3    1e-10   Nelumbo nucifera [Indian lotus]
ref|XP_010266793.1|  PREDICTED: tubulin alpha chain                   69.3    1e-10   Nelumbo nucifera [Indian lotus]
ref|XP_006404742.1|  hypothetical protein EUTSA_v10000161mg           69.3    1e-10   Eutrema salsugineum [saltwater cress]
gb|KDO49533.1|  hypothetical protein CISIN_1g013062mg                 69.3    1e-10   Citrus sinensis [apfelsine]
ref|XP_010774362.1|  PREDICTED: tubulin alpha-1D chain-like           65.5    1e-10   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_004136930.1|  PREDICTED: tubulin alpha-4 chain-like            69.3    1e-10   Cucumis sativus [cucumbers]
ref|XP_010300646.1|  PREDICTED: tubulin alpha-2 chain-like            66.2    1e-10   Balearica regulorum gibbericeps
emb|CDY66630.1|  BnaCnng51680D                                        69.3    1e-10   Brassica napus [oilseed rape]
ref|XP_009388502.1|  PREDICTED: tubulin alpha-2 chain isoform X1      69.3    1e-10   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP41548.1|  hypothetical protein JCGZ_15955                       69.3    1e-10   Jatropha curcas
ref|XP_002301128.1|  hypothetical protein POPTR_0002s11250g           69.3    1e-10   Populus trichocarpa [western balsam poplar]
ref|XP_007137281.1|  hypothetical protein PHAVU_009G114100g           69.3    1e-10   Phaseolus vulgaris [French bean]
gb|ABV55999.1|  alpha-tubulin 7                                       69.3    1e-10   Populus tremuloides
gb|ABD92937.1|  alpha tubulin-4A                                      69.3    1e-10   Triticum aestivum [Canadian hard winter wheat]
gb|ABD92936.1|  alpha tubulin-4D                                      69.3    1e-10   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004299843.1|  PREDICTED: tubulin alpha chain-like              69.3    1e-10   Fragaria vesca subsp. vesca
tpg|DAA51109.1|  TPA: alpha tubulin                                   69.3    1e-10   
gb|KHN08201.1|  Tubulin alpha chain                                   69.3    1e-10   Glycine soja [wild soybean]
ref|XP_004599399.1|  PREDICTED: tubulin alpha-1B chain                67.4    1e-10   Ochotona princeps [southern American pika]
ref|XP_011030289.1|  PREDICTED: tubulin alpha-4 chain                 69.3    1e-10   Populus euphratica
ref|XP_010943272.1|  PREDICTED: tubulin alpha chain-like              69.3    1e-10   Elaeis guineensis
ref|XP_009779180.1|  PREDICTED: tubulin alpha-3 chain-like            69.3    1e-10   Nicotiana sylvestris
gb|AAB84298.1|  tubulin                                               69.3    1e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_010093625.1|  Tubulin alpha chain                              69.3    1e-10   Morus notabilis
gb|AGG37283.1|  alpha-tubulin 1                                       69.3    1e-10   Salix arbutifolia
dbj|BAC24800.1|  alpha tubulin                                        69.3    1e-10   Physcomitrella patens
ref|XP_009407690.1|  PREDICTED: tubulin alpha chain-like              69.3    1e-10   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIJ27191.1|  alpha-tubulin 1a                                      67.8    1e-10   Mytilus galloprovincialis
ref|XP_008804464.1|  PREDICTED: tubulin alpha chain-like              69.3    1e-10   Phoenix dactylifera
ref|XP_006431130.1|  hypothetical protein CICLE_v10011709mg           69.3    1e-10   Citrus clementina [clementine]
ref|XP_004304311.1|  PREDICTED: tubulin alpha-2 chain-like            69.3    1e-10   Fragaria vesca subsp. vesca
ref|XP_004150268.1|  PREDICTED: tubulin alpha chain-like              69.3    1e-10   Cucumis sativus [cucumbers]
ref|XP_011014531.1|  PREDICTED: tubulin alpha-4 chain-like            69.3    1e-10   Populus euphratica
ref|XP_011008936.1|  PREDICTED: tubulin alpha chain                   69.3    1e-10   Populus euphratica
ref|XP_010507910.1|  PREDICTED: tubulin alpha-2 chain-like            69.3    1e-10   Camelina sativa [gold-of-pleasure]
ref|XP_007156677.1|  hypothetical protein PHAVU_002G007900g           69.3    1e-10   Phaseolus vulgaris [French bean]
ref|XP_004501073.1|  PREDICTED: tubulin alpha chain-like              69.3    1e-10   Cicer arietinum [garbanzo]
ref|XP_004288297.1|  PREDICTED: tubulin alpha-3 chain                 69.3    1e-10   Fragaria vesca subsp. vesca
ref|XP_003603670.1|  Tubulin alpha-7 chain                            69.3    1e-10   Medicago truncatula
emb|CAA62917.1|  alfa-tubulin                                         69.3    1e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010096739.1|  Tubulin alpha chain                              69.3    1e-10   
ref|XP_010526692.1|  PREDICTED: tubulin alpha chain-like              69.3    1e-10   Tarenaya hassleriana [spider flower]
ref|XP_010555432.1|  PREDICTED: tubulin alpha chain-like              69.3    1e-10   Tarenaya hassleriana [spider flower]
ref|XP_010531321.1|  PREDICTED: tubulin alpha chain isoform X1        69.3    1e-10   Tarenaya hassleriana [spider flower]
ref|XP_009335355.1|  PREDICTED: tubulin alpha chain-like              69.3    1e-10   Pyrus x bretschneideri [bai li]
gb|AID52921.1|  tubulin alpha chain                                   69.3    1e-10   Carthamus tinctorius
gb|AGG37289.1|  alpha-tubulin 7                                       69.3    1e-10   Salix arbutifolia
ref|XP_007908291.1|  PREDICTED: tubulin alpha chain-like              69.3    1e-10   Callorhinchus milii [Australian ghost shark]
ref|XP_008787760.1|  PREDICTED: tubulin alpha chain-like              69.3    1e-10   Phoenix dactylifera
ref|XP_008787237.1|  PREDICTED: tubulin alpha chain                   69.3    1e-10   Phoenix dactylifera
ref|XP_002964078.1|  hypothetical protein SELMODRAFT_405729           69.3    1e-10   Selaginella moellendorffii
ref|XP_001770881.1|  predicted protein                                69.3    1e-10   
gb|ABK92520.1|  unknown                                               69.3    1e-10   Populus trichocarpa [western balsam poplar]
ref|XP_010065856.1|  PREDICTED: tubulin alpha chain                   69.3    1e-10   Eucalyptus grandis [rose gum]
ref|NP_171974.1|  tubulin alpha-4 chain                               69.3    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007042689.1|  Tubulin alpha-2 chain                            69.3    1e-10   Theobroma cacao [chocolate]
ref|XP_007215369.1|  hypothetical protein PRUPE_ppa005626mg           69.3    1e-10   Prunus persica
sp|Q6VAF9.1|TBA4_GOSHI  RecName: Full=Tubulin alpha-4 chain; AltN...  69.3    1e-10   Gossypium hirsutum [American cotton]
gb|AAL16174.1|AF428406_1  AT4g14960/dl3520c                           69.3    1e-10   Arabidopsis thaliana [mouse-ear cress]
gb|AHJ80822.1|  Tua1                                                  69.3    1e-10   Eragrostis tef [tef]
ref|XP_002517492.1|  tubulin alpha chain, putative                    69.3    1e-10   Ricinus communis
dbj|BAE99023.1|  tubulin alpha-2/alpha-4 chain                        69.3    1e-10   Arabidopsis thaliana [mouse-ear cress]
gb|EDL10694.1|  mCG13302, isoform CRA_b                               65.5    1e-10   Mus musculus [mouse]
gb|AFW67748.1|  alpha tubulin4                                        68.9    1e-10   
ref|XP_010939312.1|  PREDICTED: tubulin alpha chain-like              69.3    1e-10   Elaeis guineensis
ref|XP_010936237.1|  PREDICTED: tubulin alpha chain-like              69.3    1e-10   Elaeis guineensis
ref|XP_009618479.1|  PREDICTED: tubulin alpha-3 chain-like            69.3    1e-10   Nicotiana tomentosiformis
gb|AAO23139.1|  alpha tubulin                                         69.3    1e-10   Populus tremuloides
ref|NP_001067613.1|  Os11g0247300                                     69.3    1e-10   
ref|XP_007032501.1|  Tubulin alpha-2 chain                            69.3    1e-10   
ref|XP_006307493.1|  hypothetical protein CARUB_v10009117mg           69.3    1e-10   Capsella rubella
dbj|BAB19779.1|  alpha tubulin                                        69.3    1e-10   Nicotiana tabacum [American tobacco]
emb|CAD13176.1|  alpha-tubulin                                        69.3    1e-10   Nicotiana tabacum [American tobacco]
gb|KDO81348.1|  hypothetical protein CISIN_1g013037mg                 69.3    1e-10   Citrus sinensis [apfelsine]
ref|XP_002324047.2|  hypothetical protein POPTR_0017s11740g           69.3    1e-10   
ref|XP_002110664.1|  alpha tubulin                                    67.8    1e-10   Trichoplax adhaerens
ref|XP_009147859.1|  PREDICTED: tubulin alpha-6 chain                 69.3    1e-10   Brassica rapa
gb|ABP65320.1|  alpha tubulin                                         69.3    1e-10   Capsicum annuum
ref|XP_010531322.1|  PREDICTED: tubulin alpha-4 chain isoform X2      69.3    1e-10   Tarenaya hassleriana [spider flower]
ref|XP_009409992.1|  PREDICTED: tubulin alpha chain-like              69.3    1e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010500555.1|  PREDICTED: tubulin alpha-6 chain isoform X1      69.3    1e-10   Camelina sativa [gold-of-pleasure]
ref|XP_009124556.1|  PREDICTED: tubulin alpha-2 chain-like isofor...  69.3    1e-10   Brassica rapa
gb|ABB02631.1|  unknown                                               69.3    1e-10   Solanum tuberosum [potatoes]
ref|NP_001291325.1|  tubulin alpha chain-like                         69.3    1e-10   Sesamum indicum [beniseed]
sp|P46259.1|TBA1_PEA  RecName: Full=Tubulin alpha-1 chain             69.3    1e-10   Pisum sativum [garden pea]
ref|XP_005801995.1|  PREDICTED: tubulin alpha-1A chain-like           67.4    1e-10   
ref|XP_010557535.1|  PREDICTED: tubulin alpha-2 chain-like isofor...  69.3    1e-10   Tarenaya hassleriana [spider flower]
ref|XP_010461854.1|  PREDICTED: tubulin alpha-6 chain-like            69.3    1e-10   Camelina sativa [gold-of-pleasure]
ref|XP_009790136.1|  PREDICTED: tubulin alpha chain                   69.3    1e-10   Nicotiana sylvestris
ref|XP_009620798.1|  PREDICTED: tubulin alpha chain                   69.3    1e-10   Nicotiana tomentosiformis
ref|XP_006356798.1|  PREDICTED: tubulin alpha chain-like              69.3    1e-10   Solanum tuberosum [potatoes]
ref|NP_193232.1|  tubulin alpha-6 chain                               69.3    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002972670.1|  hypothetical protein SELMODRAFT_231979           69.3    1e-10   Selaginella moellendorffii
gb|KDO78780.1|  hypothetical protein CISIN_1g037616mg                 68.9    1e-10   Citrus sinensis [apfelsine]
ref|XP_006601463.1|  PREDICTED: tubulin alpha-3 chain-like            69.3    1e-10   
dbj|BAE01779.1|  unnamed protein product                              67.4    1e-10   Macaca fascicularis [crab eating macaque]
ref|XP_010680774.1|  PREDICTED: tubulin alpha-2 chain                 69.3    1e-10   Beta vulgaris subsp. vulgaris [field beet]
gb|AIK29207.1|  putative alpha-tubulin                                67.8    1e-10   Cynoglossus semilaevis [half-smooth tongue sole]
gb|ESU39295.1|  Tubulin alpha chain                                   69.7    1e-10   Giardia intestinalis
gb|AIX10773.1|  alpha tubulin                                         69.3    1e-10   Panax notoginseng [san-qi]
ref|XP_008455054.1|  PREDICTED: tubulin alpha-4 chain isoform X1      69.3    1e-10   
gb|AHJ80815.1|  Tua1                                                  69.3    1e-10   
ref|NP_001167663.1|  tubulin alpha-3 chain                            69.3    1e-10   
sp|O22347.1|TBA1_ELEIN  RecName: Full=Tubulin alpha-1 chain; AltN...  69.3    1e-10   
sp|Q9ZRR5.1|TBA3_HORVU  RecName: Full=Tubulin alpha-3 chain           69.3    1e-10   
gb|AFC88832.1|  putative tubulin alpha-3 chain                        69.3    1e-10   
ref|XP_008440460.1|  PREDICTED: tubulin alpha chain-like isoform X2   69.3    1e-10   
gb|AHJ80817.1|  Tua1                                                  69.3    1e-10   
dbj|BAJ06362.1|  alpha-tubulin                                        69.3    1e-10   
ref|XP_006662856.1|  PREDICTED: tubulin alpha-3 chain-like            69.3    1e-10   
ref|XP_006650518.1|  PREDICTED: tubulin alpha-1 chain-like            69.3    1e-10   
ref|XP_003560377.1|  PREDICTED: tubulin alpha-1 chain                 69.3    1e-10   
gb|ABG78593.1|  alpha-tubulin                                         69.3    1e-10   
ref|XP_004981922.1|  PREDICTED: tubulin alpha-1 chain-like            69.3    1e-10   
gb|AAG49533.3|  alpha tubulin                                         67.8    1e-10   
ref|XP_008665337.1|  PREDICTED: tubulin alpha-1 chain-like            69.3    1e-10   
ref|XP_004244533.1|  PREDICTED: tubulin alpha-3 chain-like            69.3    1e-10   
ref|XP_008665339.1|  PREDICTED: tubulin alpha-2 chain                 69.3    1e-10   
emb|CDP02221.1|  unnamed protein product                              69.3    1e-10   
gb|ELK27771.1|  Tubulin alpha-1B chain                                67.8    1e-10   
ref|XP_011098608.1|  PREDICTED: tubulin alpha chain                   69.3    1e-10   
ref|XP_006362511.1|  PREDICTED: tubulin alpha-1 chain-like            69.3    1e-10   
ref|XP_004238046.1|  PREDICTED: tubulin alpha chain                   69.3    1e-10   
ref|NP_001051132.1|  Os03g0726100                                     69.3    1e-10   
sp|Q96460.1|TBA2_HORVU  RecName: Full=Tubulin alpha-2 chain           69.3    1e-10   
gb|ABD92930.1|  alpha tubulin-2A                                      69.3    1e-10   
ref|XP_009605705.1|  PREDICTED: tubulin alpha-2 chain-like            69.3    1e-10   
emb|CAA62916.1|  alpha-tubulin                                        69.3    1e-10   
gb|ENN78723.1|  hypothetical protein YQE_04815                        67.0    1e-10   
ref|XP_009107245.1|  PREDICTED: tubulin alpha-2 chain isoform X2      69.3    1e-10   
gb|AHJ80823.1|  Tua1                                                  69.3    1e-10   
ref|XP_009969560.1|  PREDICTED: tubulin alpha-1A chain-like           67.8    1e-10   
emb|CDY29334.1|  BnaA05g16010D                                        69.3    1e-10   
ref|XP_004981594.1|  PREDICTED: tubulin alpha-3 chain-like            69.3    1e-10   
ref|XP_003524707.1|  PREDICTED: tubulin alpha-3 chain-like isofor...  69.3    1e-10   
emb|CAE52514.1|  alpha tubulin                                        69.3    1e-10   
sp|Q9ZRB7.1|TBA_WHEAT  RecName: Full=Tubulin alpha chain              69.3    1e-10   
ref|XP_009614122.1|  PREDICTED: tubulin alpha-3 chain                 69.3    1e-10   
ref|XP_008949708.1|  PREDICTED: tubulin alpha-1A chain-like           67.0    1e-10   
gb|AAB08791.1|  alpha tubulin                                         69.3    1e-10   
ref|XP_010637165.1|  PREDICTED: tubulin alpha chain-like              64.7    1e-10   
ref|XP_007155784.1|  hypothetical protein PHAVU_003G231500g           69.3    1e-10   
ref|XP_007634877.1|  PREDICTED: tubulin alpha-1A chain isoform X3     67.8    1e-10   
ref|XP_008475351.1|  PREDICTED: tubulin alpha-1 chain-like            68.2    1e-10   
emb|CAA06619.1|  alpha-tubulin 1                                      69.3    1e-10   
ref|XP_004778983.1|  PREDICTED: tubulin alpha-1C chain                67.4    1e-10   
sp|Q40831.1|TBA1_PELFA  RecName: Full=Tubulin alpha-1 chain           69.3    2e-10   
gb|ABF98643.1|  Tubulin alpha-1 chain, putative, expressed            69.3    2e-10   
gb|KHN01709.1|  Tubulin alpha chain                                   69.3    2e-10   
gb|AHJ80816.1|  Tua1                                                  69.3    2e-10   
ref|XP_010500556.1|  PREDICTED: tubulin alpha-2 chain isoform X2      69.3    2e-10   
ref|NP_001275271.1|  alpha-tubulin-like protein                       69.3    2e-10   
gb|ESU44180.1|  Tubulin alpha chain                                   69.3    2e-10   
ref|XP_004470253.1|  PREDICTED: tubulin alpha-1B chain-like           68.9    2e-10   
ref|XP_006895063.1|  PREDICTED: tubulin alpha-1B chain-like           67.4    2e-10   
ref|XP_010557536.1|  PREDICTED: tubulin alpha-4 chain-like isofor...  69.3    2e-10   
gb|AGV54441.1|  tubulin alpha-2 chain-like protein                    69.3    2e-10   
ref|XP_007426287.1|  PREDICTED: tubulin alpha-1C chain                67.4    2e-10   
ref|XP_005701842.1|  PREDICTED: uncharacterized protein LOC102173837  67.0    2e-10   
ref|XP_005702138.1|  PREDICTED: tubulin alpha-1A chain-like           66.2    2e-10   
ref|XP_010213341.1|  PREDICTED: tubulin alpha-1A chain-like           67.4    2e-10   
ref|XP_005391932.1|  PREDICTED: tubulin alpha-3 chain-like            67.4    2e-10   
gb|ELK23510.1|  Tubulin alpha chain                                   65.5    2e-10   
ref|XP_006581475.1|  PREDICTED: tubulin alpha-4 chain-like isofor...  69.3    2e-10   
ref|XP_005365400.1|  PREDICTED: tubulin alpha-3 chain-like            67.0    2e-10   
ref|XP_005461213.1|  PREDICTED: tubulin alpha-1A chain-like           67.4    2e-10   
gb|AAW30624.1|  unknown                                               66.6    2e-10   
ref|XP_009388503.1|  PREDICTED: tubulin alpha chain isoform X2        68.9    2e-10   
ref|XP_011088040.1|  PREDICTED: tubulin alpha chain                   68.9    2e-10   
ref|XP_010123422.1|  PREDICTED: tubulin alpha-1A chain-like           67.4    2e-10   
dbj|BAA78598.1|  hypothetical protein                                 64.7    2e-10   
gb|AII97815.1|  BLTX443                                               67.4    2e-10   
ref|XP_007606261.1|  PREDICTED: tubulin alpha chain-like 3            68.9    2e-10   
ref|XP_009212162.1|  PREDICTED: tubulin alpha chain-like 3            64.7    2e-10   
gb|KHG18997.1|  Tubulin alpha chain                                   68.9    2e-10   
ref|XP_004778984.1|  PREDICTED: tubulin alpha-1A chain                66.6    2e-10   
gb|ABS57456.1|  alpha-tubulin                                         66.6    2e-10   
ref|XP_006466394.1|  PREDICTED: tubulin alpha-3 chain-like isofor...  68.9    2e-10   
ref|XP_006426173.1|  hypothetical protein CICLE_v10025588mg           68.9    2e-10   
emb|CDO97305.1|  unnamed protein product                              68.9    2e-10   
gb|ABO47736.1|  alpha-tubulin                                         68.9    2e-10   
gb|KDO81347.1|  hypothetical protein CISIN_1g013037mg                 68.9    2e-10   
ref|XP_006472372.1|  PREDICTED: tubulin alpha chain isoform X1        68.9    2e-10   
emb|CDP00974.1|  unnamed protein product                              68.9    2e-10   
ref|XP_002976230.1|  hypothetical protein SELMODRAFT_105136           68.9    2e-10   
ref|NP_001105440.1|  tubulin alpha-3 chain                            68.9    2e-10   
ref|XP_007501738.1|  PREDICTED: tubulin alpha-4A chain isoform X2     68.9    2e-10   
ref|XP_006109205.1|  PREDICTED: tubulin alpha-1D chain-like           66.6    2e-10   
ref|XP_005932717.1|  PREDICTED: tubulin alpha-1B chain-like           67.0    2e-10   
gb|ABO47740.1|  alpha-tubulin                                         68.9    2e-10   
ref|XP_008440459.1|  PREDICTED: tubulin alpha chain-like isoform X1   68.9    2e-10   
ref|XP_004143417.1|  PREDICTED: tubulin alpha chain-like              68.9    2e-10   
gb|AFC88824.1|  putative tubulin alpha-3 chain                        68.9    2e-10   
ref|XP_008317242.1|  PREDICTED: tubulin alpha-1C chain-like           67.8    2e-10   
dbj|BAJ07366.1|  alpha-tubulin                                        65.9    2e-10   
ref|XP_006472373.1|  PREDICTED: tubulin alpha chain isoform X2        68.9    2e-10   
ref|XP_010256937.1|  PREDICTED: tubulin alpha chain-like              68.9    2e-10   
ref|XP_010242419.1|  PREDICTED: tubulin alpha-1 chain                 68.9    2e-10   
gb|ABO47742.1|  alpha-tubulin                                         68.9    2e-10   
ref|XP_002466376.1|  hypothetical protein SORBIDRAFT_01g006650        68.9    2e-10   
gb|KJB58757.1|  hypothetical protein B456_009G224800                  68.6    2e-10   
ref|XP_004231960.1|  PREDICTED: tubulin alpha-3 chain-like            68.9    2e-10   
ref|XP_006357741.1|  PREDICTED: tubulin alpha-3 chain-like            68.9    2e-10   
gb|EMC84438.1|  Tubulin alpha chain                                   65.1    2e-10   
gb|ETN70155.1|  hypothetical protein NECAME_14944                     63.9    2e-10   
ref|XP_004569718.1|  PREDICTED: tubulin alpha-1D chain-like           63.5    2e-10   
ref|XP_008172101.1|  PREDICTED: tubulin alpha-1B chain                67.4    2e-10   
sp|Q06331.1|TBA_ENTDO  RecName: Full=Tubulin alpha chain              68.6    2e-10   
ref|XP_006466395.1|  PREDICTED: tubulin alpha-3 chain-like isofor...  68.6    2e-10   
ref|XP_004628221.1|  PREDICTED: tubulin alpha chain-like 3-like       65.9    2e-10   
ref|XP_005760058.1|  alpha-tubulin                                    63.5    2e-10   
ref|XP_009818747.1|  PREDICTED: tubulin alpha-2 chain-like            65.5    2e-10   
ref|XP_006579968.1|  PREDICTED: tubulin alpha-3 chain-like isofor...  68.6    2e-10   
ref|XP_003220514.1|  PREDICTED: tubulin alpha-8 chain                 68.6    2e-10   
ref|XP_011366648.1|  PREDICTED: tubulin alpha-1C chain-like           67.4    2e-10   
gb|KIY93466.1|  Tubulin alpha-1 chain                                 66.2    2e-10   
ref|XP_005817084.1|  PREDICTED: tubulin alpha chain-like              67.4    2e-10   
emb|CAD32468.1|  alpha-tubulin                                        66.2    2e-10   
ref|XP_005139691.1|  PREDICTED: tubulin alpha-1B chain-like           68.6    2e-10   
ref|XP_008575749.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...  67.4    2e-10   
ref|XP_004874971.1|  PREDICTED: tubulin alpha-3 chain-like            67.4    3e-10   
gb|EDL87015.1|  rCG50513, isoform CRA_a                               67.8    3e-10   
ref|XP_006884982.1|  PREDICTED: uncharacterized protein LOC102849576  68.9    3e-10   
tpg|DAA63281.1|  TPA: alpha tubulin6                                  64.7    3e-10   
gb|ELR50891.1|  Tubulin alpha-3 chain                                 63.5    3e-10   
dbj|BAN21521.1|  tubulin alpha chain                                  66.2    3e-10   
gb|ETE59910.1|  Tubulin alpha-1A chain                                67.4    3e-10   
gb|AFM80104.1|  alpha-tubulin                                         68.6    3e-10   
ref|XP_008372962.1|  PREDICTED: tubulin alpha chain isoform X2        68.6    3e-10   
sp|Q9FT36.1|TBA_DAUCA  RecName: Full=Tubulin alpha chain              68.6    3e-10   
emb|CDQ56615.1|  unnamed protein product                              68.2    3e-10   
gb|AAI53472.1|  Unknown (protein for MGC:173992)                      66.2    3e-10   
ref|XP_010995722.1|  PREDICTED: tubulin alpha-1B chain                67.8    3e-10   
ref|XP_005107363.1|  PREDICTED: tubulin alpha-3 chain-like            65.1    3e-10   
ref|XP_010114853.1|  PREDICTED: tubulin alpha-2 chain                 67.8    3e-10   
ref|XP_008139124.1|  PREDICTED: tubulin alpha chain, testis-speci...  66.6    3e-10   
gb|AFM80108.1|  alpha-tubulin                                         68.2    3e-10   
ref|XP_006264719.1|  PREDICTED: tubulin alpha-1A chain                67.8    3e-10   
ref|XP_006629378.1|  PREDICTED: tubulin alpha-1B chain-like           67.8    3e-10   
gb|KFK32793.1|  hypothetical protein AALP_AA6G289100                  68.2    3e-10   
gb|EYC35727.1|  hypothetical protein Y032_0992g3330                   63.9    3e-10   
ref|XP_004560331.1|  PREDICTED: tubulin alpha-1A chain-like           67.0    3e-10   
ref|XP_002924843.1|  PREDICTED: tubulin alpha-4A chain-like           65.5    3e-10   
ref|XP_005745106.1|  PREDICTED: tubulin alpha-1B chain-like           68.2    3e-10   
gb|ABO33166.1|  alpha tubulin a2                                      66.2    3e-10   
ref|XP_005093900.1|  PREDICTED: tubulin alpha-1D chain-like           66.2    3e-10   
ref|XP_003394986.1|  PREDICTED: tubulin alpha-1C chain-like           68.2    3e-10   
gb|AAT68202.1|  alpha 1 tubulin                                       65.1    3e-10   
gb|ELK33566.1|  Tubulin alpha-3 chain                                 63.9    3e-10   
ref|XP_006612224.1|  PREDICTED: tubulin alpha-2/alpha-4 chain-lik...  68.2    3e-10   
emb|CAD32380.1|  tubulin                                              63.9    3e-10   
ref|NP_001029051.2|  tubulin alpha chain-like 3                       68.2    3e-10   
dbj|BAE22753.1|  unnamed protein product                              68.2    3e-10   
gb|ELU12889.1|  hypothetical protein CAPTEDRAFT_39468                 64.7    4e-10   
gb|EHB00536.1|  Tubulin alpha-1C chain                                68.2    4e-10   
ref|XP_008372961.1|  PREDICTED: tubulin alpha chain isoform X1        68.2    4e-10   
ref|XP_003770912.1|  PREDICTED: tubulin alpha-1C chain                67.4    4e-10   
ref|XP_008412910.1|  PREDICTED: tubulin alpha-1B chain-like           67.8    4e-10   
ref|XP_007936041.1|  PREDICTED: tubulin alpha-1A chain isoform X2     68.2    4e-10   
ref|XP_007456478.1|  PREDICTED: tubulin alpha-1B chain-like           68.2    4e-10   
ref|XP_004817225.1|  PREDICTED: tubulin alpha-3 chain-like            67.8    4e-10   
ref|XP_010695478.1|  PREDICTED: tubulin alpha-2 chain-like            68.2    4e-10   
ref|XP_007606030.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...  67.8    4e-10   
gb|EPS65641.1|  hypothetical protein M569_09137                       64.3    4e-10   
gb|AIX10966.1|  tubulin                                               68.2    4e-10   
emb|CAB66336.1|  alpha-tubulin                                        68.2    4e-10   
ref|XP_006038485.1|  PREDICTED: tubulin alpha-1 chain-like            68.2    4e-10   
ref|XP_002441132.1|  hypothetical protein SORBIDRAFT_09g021020        67.8    4e-10   
ref|XP_007560574.1|  PREDICTED: tubulin alpha-1B chain-like           68.2    4e-10   
gb|EGW14703.1|  Tubulin alpha chain, nucleomorph                      67.8    4e-10   
gb|EWC76929.1|  tubulin alpha chain                                   63.2    4e-10   
ref|XP_009809252.1|  PREDICTED: tubulin alpha-1D chain-like           67.8    4e-10   
ref|XP_006278043.1|  PREDICTED: tubulin alpha chain, testis-speci...  67.8    4e-10   
ref|XP_002970006.1|  hypothetical protein SELMODRAFT_231415           67.8    4e-10   
gb|EKC22339.1|  Tubulin alpha chain                                   66.6    4e-10   
gb|AAH21564.1|  TUBA1B protein                                        67.4    4e-10   
ref|XP_007560643.1|  PREDICTED: tubulin alpha-1C chain-like           67.8    4e-10   
ref|XP_009246735.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...  67.0    4e-10   
gb|EDM02020.1|  similar to Tubulin alpha-8 chain (Alpha-tubulin 8)    65.9    4e-10   
ref|XP_005324966.1|  PREDICTED: tubulin alpha-1B chain                66.6    4e-10   
gb|AFM80097.1|  alpha-tubulin                                         67.8    4e-10   
ref|XP_010146202.1|  PREDICTED: tubulin alpha-3 chain-like            64.7    4e-10   
ref|XP_007663362.1|  PREDICTED: tubulin alpha chain-like              64.7    4e-10   
emb|CBJ28184.1|  alpha tubulin                                        67.8    4e-10   
ref|XP_009508102.1|  PREDICTED: tubulin alpha-1C chain-like           67.8    4e-10   
ref|XP_007248487.1|  PREDICTED: tubulin alpha-1B chain-like           67.4    4e-10   
gb|KFO33466.1|  Tubulin alpha-1C chain                                67.4    4e-10   
ref|XP_010995781.1|  PREDICTED: tubulin alpha-1A chain-like           67.8    4e-10   
gb|AAM73790.1|  alpha-tubulin                                         64.7    4e-10   
ref|XP_010751704.1|  PREDICTED: tubulin alpha chain                   67.4    4e-10   
gb|EFX83326.1|  hypothetical protein DAPPUDRAFT_315805                67.8    4e-10   
ref|XP_009074537.1|  PREDICTED: tubulin alpha chain-like              64.3    4e-10   
emb|CBN77373.1|  alpha tubulin                                        67.8    4e-10   
ref|XP_007073037.1|  PREDICTED: tubulin alpha-1C chain                67.0    4e-10   
ref|XP_003784680.1|  PREDICTED: tubulin alpha-1B chain-like           68.2    4e-10   
ref|XP_002599490.1|  hypothetical protein BRAFLDRAFT_81006            67.4    4e-10   
gb|EYU37544.1|  hypothetical protein MIMGU_mgv1a007145mg              67.8    4e-10   
ref|XP_008236966.1|  PREDICTED: tubulin alpha chain-like isoform X2   67.8    5e-10   
gb|AAM73791.1|  alpha-tubulin                                         64.7    5e-10   
sp|Q40832.1|TBA2_PELFA  RecName: Full=Tubulin alpha-2 chain           67.8    5e-10   
ref|XP_010281096.1|  PREDICTED: tubulin alpha-3 chain-like            64.3    5e-10   
ref|XP_003138435.1|  hypothetical protein LOAG_02850                  63.2    5e-10   
ref|XP_002599759.1|  hypothetical protein BRAFLDRAFT_57605            67.8    5e-10   
ref|XP_002434310.1|  alpha tubulin, putative                          67.8    5e-10   
ref|XP_010852034.1|  PREDICTED: tubulin alpha-1C chain                67.8    5e-10   
gb|EAW66874.1|  hCG19802, isoform CRA_c                               64.3    5e-10   
ref|XP_010194381.1|  PREDICTED: tubulin alpha-3 chain-like            64.3    5e-10   
ref|XP_010164605.1|  PREDICTED: tubulin alpha-3 chain-like            64.3    5e-10   
ref|XP_001101935.1|  PREDICTED: tubulin alpha-3C/D chain-like iso...  67.8    5e-10   
ref|XP_011475942.1|  PREDICTED: tubulin alpha chain-like              67.0    5e-10   
ref|XP_006916969.1|  PREDICTED: tubulin alpha-1B chain                67.8    5e-10   
ref|XP_004232226.1|  PREDICTED: tubulin alpha chain-like              67.8    5e-10   
ref|XP_009809305.1|  PREDICTED: tubulin alpha-8 chain-like            64.7    5e-10   
ref|XP_004032593.1|  PREDICTED: tubulin alpha-3 chain-like            67.4    5e-10   
gb|AAX29832.1|  tubulin alpha 2                                       67.8    5e-10   
ref|XP_005495757.1|  PREDICTED: tubulin alpha-3 chain-like            67.8    5e-10   
emb|CAO79602.1|  alpha-tubulin                                        67.8    5e-10   
ref|XP_009626810.1|  PREDICTED: tubulin alpha chain-like              67.8    5e-10   
gb|AAH33064.1|  TUBA1C protein                                        67.0    5e-10   
gb|ERL84231.1|  hypothetical protein D910_01608                       67.4    5e-10   
dbj|BAE87851.1|  unnamed protein product                              67.4    5e-10   



>gb|EUB56387.1| Tubulin alpha-1C chain [Echinococcus granulosus]
Length=1453

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +2

Query  110   SSFAKMRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
             ++F+KMRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  999   AAFSKMRECISIHVGQAGVQMGNACWELYCLEHGIQ  1034



>gb|ABD94137.1| alpha tubulin [Cathaya argyrophylla]
 gb|ABD94138.1| alpha tubulin [Cathaya argyrophylla]
Length=59

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|EPS68934.1| alpha tubulin, partial [Genlisea aurea]
Length=57

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_002883197.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59456.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=237

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQVSTFLFFSCCG  250
            MRECISIHI QAGIQVGNACWELYCLEHGIQV    F +  G
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQVHDEHFETGAG  42



>ref|XP_010099392.1| Tubulin alpha chain [Morus notabilis]
 ref|XP_010105098.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB78237.1| Tubulin alpha chain [Morus notabilis]
 gb|EXC03883.1| Tubulin alpha chain [Morus notabilis]
Length=467

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQVST  226
            MRECISIHI QAGIQVGNACWELYCLEHGIQ+ T
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQIQT  34



>gb|AFW67745.1| alpha tubulin4 [Zea mays]
Length=111

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQVS  223
            MRECISIHI QAGIQVGNACWELYCLEHGIQ  
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQAD  33



>gb|AAT77078.1| alpha tubulin [Oryza sativa Japonica Group]
Length=195

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|AAV33983.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33984.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33985.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33986.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33987.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33988.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33989.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33990.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33991.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33992.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33993.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33994.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33995.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33996.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33997.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33998.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33999.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34000.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34001.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34002.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34003.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34004.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34005.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34006.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34007.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34008.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34009.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34010.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34011.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34012.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34013.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34014.1| alpha tubulin, partial [Pinus taeda]
 gb|AHY28653.1| alpha-tubulin, partial [Pinus echinata]
 gb|AHY28654.1| alpha-tubulin, partial [Pinus echinata]
 gb|AHY28655.1| alpha-tubulin, partial [Pinus elliottii]
 gb|AHY28656.1| alpha-tubulin, partial [Pinus elliottii]
 gb|AHY28657.1| alpha-tubulin, partial [Pinus palustris]
 gb|AHY28658.1| alpha-tubulin, partial [Pinus palustris]
 gb|AHY28659.1| alpha-tubulin, partial [Pinus taeda]
 gb|AHY28660.1| alpha-tubulin, partial [Pinus taeda]
Length=95

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|AAK51091.1| alpha tubulin [Coffea arabica]
Length=92

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|ETE56023.1| Tubulin alpha-1A chain, partial [Ophiophagus hannah]
Length=100

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  104  SNSSFAKMRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            + S F   RECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  9    NGSGFFPQRECISIHVGQAGVQIGNACWELYCLEHGIQ  46



>ref|XP_007047652.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX91809.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=501

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +2

Query  101  SSNSSFAKMRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            +  S+  KMRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  43   AGQSNHEKMRECISIHIGQAGIQVGNACWELYCLEHGIQ  81



>emb|CDJ03953.1| tubulin alpha chain [Echinococcus multilocularis]
 emb|CDS41235.1| tubulin alpha chain [Echinococcus multilocularis]
Length=510

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  110  SSFAKMRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
             SF KMRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  55   DSFFKMRECISIHVGQAGVQMGNACWELYCLEHGIQ  90



>ref|XP_001786415.1| predicted protein [Physcomitrella patens]
 gb|EDQ48774.1| predicted protein, partial [Physcomitrella patens]
Length=127

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>emb|CDS16437.1| tubulin alpha chain [Echinococcus granulosus]
Length=510

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  110  SSFAKMRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
             SF KMRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  55   DSFFKMRECISIHVGQAGVQMGNACWELYCLEHGIQ  90



>emb|CAA44864.1| alpha-tubulin #4 [Zea mays]
Length=46

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQVS  223
            MRECISIHI QAGIQVGNACWELYCLEHGIQ  
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQAD  33



>gb|ABF13307.1| alpha-tubulin [Phaseolus vulgaris]
Length=132

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>emb|CAD32379.1| tubulin alpha [Oryza sativa Indica Group]
Length=124

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|AFV46219.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=440

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  119  AKMRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            AKMRECISIHI +AGIQVGNACWELYCLEHGIQ
Sbjct  36   AKMRECISIHIGRAGIQVGNACWELYCLEHGIQ  68



>ref|WP_039310890.1| hypothetical protein, partial [Paenibacillus sp. IHB B 3415]
 gb|KHL91192.1| hypothetical protein QW71_36085, partial [Paenibacillus sp. IHB 
B 3415]
Length=453

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  119  AKMRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            +KMRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  3    SKMRECISIHIGQAGIQVGNACWELYCLEHGIQ  35



>sp|P33626.1|TBA4_MAIZE RecName: Full=Tubulin alpha-4 chain; AltName: Full=Alpha-4-tubulin, 
partial [Zea mays]
 gb|AFW67750.1| alpha tubulin4 [Zea mays]
 tpg|DAA51115.1| TPA: tubulin alpha-4 chain s [Zea mays]
Length=61

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQVS  223
            MRECISIHI QAGIQVGNACWELYCLEHGIQ  
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQAD  33



>gb|ACU18775.1| unknown [Glycine max]
Length=202

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_003979912.1| PREDICTED: tubulin alpha-1D chain-like, partial [Takifugu rubripes]
Length=121

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQVSTFL  232
            MRECISIHI QAG+Q+GNACWELYCLEHGIQ    +
Sbjct  1    MRECISIHIGQAGVQIGNACWELYCLEHGIQPDGLM  36



>gb|EPQ14625.1| Peripherin [Myotis brandtii]
Length=591

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  104  SNSSFAKMRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            + SS A +RECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  63   TGSSPAFLRECISIHVGQAGVQIGNACWELYCLEHGIQ  100



>gb|ABE66388.1| alpha-tubulin [Striga asiatica]
Length=206

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|ACG47343.1| hypothetical protein [Zea mays]
Length=42

 Score = 65.9 bits (159),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 34/40 (85%), Gaps = 1/40 (3%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGI-QVSTFLFFS  241
            MRECISIHI QAGIQVGNACWELYCLEHGI + ST L+  
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIPETSTQLYHD  40



>gb|EYU34086.1| hypothetical protein MIMGU_mgv1a0196711mg, partial [Erythranthe 
guttata]
Length=199

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>tpg|DAA51110.1| TPA: alpha-tubulin, partial [Zea mays]
 tpg|DAA51116.1| TPA: alpha-tubulin, partial [Zea mays]
Length=240

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQVS  223
            MRECISIHI QAGIQVGNACWELYCLEHGIQ  
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQAD  33



>gb|ACU24494.1| unknown [Glycine max]
Length=173

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|AAT77076.1| alpha tubulin [Oryza sativa Japonica Group]
Length=128

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQVS  223
            MRECISIHI QAGIQVGNACWELYCLEHGIQ  
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQAD  33



>dbj|BAE88902.1| unnamed protein product [Macaca fascicularis]
Length=80

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>gb|EPY73087.1| hypothetical protein CB1_043508005, partial [Camelus ferus]
Length=75

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>gb|AHJ80818.1| Tua1, partial [Eragrostis tef]
Length=291

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_004400552.1| PREDICTED: tubulin alpha-3 chain-like [Odobenus rosmarus divergens]
Length=574

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  122  KMRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            K+RECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  124  KLRECISIHVGQAGVQIGNACWELYCLEHGIQ  155


 Score = 70.9 bits (172),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>ref|XP_010621916.1| PREDICTED: tubulin alpha-1B chain isoform X2 [Fukomys damarensis]
Length=575

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  122  KMRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            K+RECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  124  KLRECISIHVGQAGVQIGNACWELYCLEHGIQ  155


 Score = 70.9 bits (172),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>ref|XP_009423750.1| PREDICTED: tubulin alpha-1B chain isoform X2 [Pan troglodytes]
Length=575

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  122  KMRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            K+RECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  124  KLRECISIHVGQAGVQIGNACWELYCLEHGIQ  155


 Score = 70.9 bits (172),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>ref|XP_004805868.1| PREDICTED: LOW QUALITY PROTEIN: tubulin alpha-1A chain [Mustela 
putorius furo]
Length=575

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  122  KMRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            K+RECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  124  KLRECISIHVGQAGVQIGNACWELYCLEHGIQ  155


 Score = 70.9 bits (172),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>ref|XP_003793652.1| PREDICTED: tubulin alpha-1C chain isoform 1 [Otolemur garnettii]
Length=575

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  122  KMRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            K+RECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  124  KLRECISIHVGQAGVQIGNACWELYCLEHGIQ  155


 Score = 70.9 bits (172),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>ref|XP_010726225.1| PREDICTED: tubulin alpha chain-like, partial [Meleagris gallopavo]
Length=181

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  95   VCSSNSSFAKMRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            + S   S    RECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  3    ISSQTPSLTPQRECISIHVGQAGVQIGNACWELYCLEHGIQ  43



>ref|XP_006433709.1| hypothetical protein CICLE_v100015521mg, partial [Citrus clementina]
 gb|ESR46949.1| hypothetical protein CICLE_v100015521mg, partial [Citrus clementina]
Length=153

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/31 (94%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECIS+HI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQ  31



>dbj|BAC56489.1| similar to tubulin alpha 1 [Bos taurus]
Length=63

 Score = 65.9 bits (159),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>ref|NP_001275472.1| alpha-tubulin-like protein [Solanum tuberosum]
 gb|ABA46784.1| alpha-tubulin-like protein [Solanum tuberosum]
Length=237

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>emb|CBI29424.3| unnamed protein product [Vitis vinifera]
Length=287

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_008581337.1| PREDICTED: tubulin alpha chain-like, partial [Galeopterus variegatus]
Length=93

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>ref|XP_005391931.1| PREDICTED: tubulin alpha-3E chain [Chinchilla lanigera]
Length=123

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>gb|EPZ32931.1| Tubulin domain-containing protein [Rozella allomycis CSF55]
Length=144

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>gb|ACN40426.1| unknown [Picea sitchensis]
Length=319

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_002609253.1| hypothetical protein BRAFLDRAFT_86837 [Branchiostoma floridae]
 gb|EEN65263.1| hypothetical protein BRAFLDRAFT_86837, partial [Branchiostoma 
floridae]
Length=125

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>ref|XP_010751701.1| PREDICTED: tubulin alpha-1C chain-like isoform X3 [Larimichthys 
crocea]
Length=575

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31


 Score = 70.9 bits (172),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  122  KMRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            K+RECIS+H+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  124  KLRECISVHVGQAGVQIGNACWELYCLEHGIQ  155



>ref|XP_002263822.2| PREDICTED: tubulin alpha chain, partial [Vitis vinifera]
Length=322

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|KIH42923.1| hypothetical protein ANCDUO_27086 [Ancylostoma duodenale]
Length=83

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  128  RECISIHIVQAGIQVGNACWELYCLEHGIQVSTFL  232
            RECISIHI QAG Q+GNACWELYCLEHGI  S FL
Sbjct  25   RECISIHIGQAGAQIGNACWELYCLEHGIDQSGFL  59



>gb|AAI59362.1| Unknown (protein for MGC:185872) [Xenopus (Silurana) tropicalis]
Length=145

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>ref|XP_011302976.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Fopius arisanus]
Length=457

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  107  NSSFAKMRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            N   AK RECISIHI QAG+Q+GNACWELYCLEHGIQ
Sbjct  5    NERMAKKRECISIHIGQAGVQMGNACWELYCLEHGIQ  41



>emb|CDQ86411.1| unnamed protein product [Oncorhynchus mykiss]
Length=138

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  101  SSNSSFAKMRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            S+  S + MRECIS+H+ QAG+Q+GN CWELYCLEHGIQ
Sbjct  2    SATDSCSTMRECISVHVGQAGVQMGNTCWELYCLEHGIQ  40



>ref|XP_006264720.1| PREDICTED: tubulin alpha-1C chain [Alligator mississippiensis]
Length=159

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>gb|EGI67764.1| Tubulin alpha-1 chain [Acromyrmex echinatior]
Length=595

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  113  SFAKMRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            S   MRECIS+H+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  142  SIFNMRECISVHVGQAGVQIGNACWELYCLEHGIQ  176



>ref|XP_005896455.1| PREDICTED: tubulin alpha-1C chain-like [Bos mutus]
Length=470

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  101  SSNSSFAKMRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            S  + F+  RECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  10   SQQTPFSPTRECISIHVGQAGVQIGNACWELYCLEHGIQ  48



>ref|XP_004007465.1| PREDICTED: tubulin alpha-1C chain [Ovis aries]
Length=632

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31


 Score = 67.8 bits (164),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  128  RECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            RECIS+H+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  81   RECISVHVGQAGVQIGNACWELYCLEHGIQ  110



>gb|AAN33000.1| alpha-tubulin 4, partial [Gossypium hirsutum]
Length=311

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/31 (94%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECIS+HI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_001178141.2| PREDICTED: tubulin alpha-1C chain-like isoform 2 [Strongylocentrotus 
purpuratus]
Length=654

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>emb|CBI25125.3| unnamed protein product [Vitis vinifera]
Length=375

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|ELK08399.1| Protein LMBR1L [Pteropus alecto]
Length=948

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  101  SSNSSFAKMRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            +S  S +  RECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  83   TSTLSLSGTRECISIHVGQAGVQIGNACWELYCLEHGIQ  121



>ref|XP_005195212.2| PREDICTED: tubulin alpha-3 chain isoform X1 [Bos taurus]
Length=677

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  228  MRECISIHVGQAGVQIGNACWELYCLEHGIQ  258


 Score = 68.6 bits (166),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  95   VCSSNSSFAKMRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            V   +S     RECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  9    VARPHSLLCFQRECISIHVGQAGVQIGNACWELYCLEHGIQ  49



>ref|XP_004854965.1| PREDICTED: klotho-like [Heterocephalus glaber]
Length=1349

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  119  AKMRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            A MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  299  AIMRECISIHVGQAGVQIGNACWELYCLEHGIQ  331



>ref|XP_005932718.1| PREDICTED: tubulin alpha chain-like [Haplochromis burtoni]
Length=142

 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>ref|XP_003793694.1| PREDICTED: tubulin alpha chain-like [Otolemur garnettii]
Length=142

 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>ref|XP_004019820.1| PREDICTED: tubulin alpha chain-like [Ovis aries]
Length=129

 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>emb|CBI22190.3| unnamed protein product [Vitis vinifera]
Length=393

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>emb|CAD32381.1| tubulin alpha [Oryza sativa Indica Group]
 gb|AFR41941.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR41942.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR41943.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR41944.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR41945.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR41946.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR41947.1| alpha-tubulin, partial [Populus alba]
 gb|AFR41948.1| alpha-tubulin, partial [Populus alba]
 gb|AFR41949.1| alpha-tubulin, partial [Populus alba]
 gb|AFR41950.1| alpha-tubulin, partial [Populus alba]
 gb|AFR41951.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR41952.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR41953.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR41954.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR41955.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR41956.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR41957.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR41958.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR41959.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR41960.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR41961.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR41962.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR41963.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR41964.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR41965.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR41966.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR41967.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR41968.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR41969.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR41970.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR41971.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42072.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42073.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42074.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42075.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42076.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42077.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42078.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42079.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42080.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42081.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42082.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42083.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42084.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42085.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42086.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42087.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42088.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42089.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42090.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42091.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42092.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42093.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42094.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42095.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42096.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42097.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42098.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42099.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42100.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42101.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42102.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42103.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42104.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42105.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42106.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42107.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42108.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42109.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42110.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42111.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42112.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42113.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42114.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42115.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42116.1| alpha-tubulin, partial [Populus nigra]
Length=31

 Score = 64.7 bits (156),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|EPY86205.1| protein LMBR1L isoform 1 [Camelus ferus]
Length=781

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>emb|CBI19330.3| unnamed protein product [Vitis vinifera]
Length=395

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_793102.3| PREDICTED: tubulin alpha-1C chain-like [Strongylocentrotus purpuratus]
Length=578

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  122  KMRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            K+RECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  126  KLRECISIHVGQAGVQMGNACWELYCLEHGIQ  157


 Score = 67.8 bits (164),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  128  RECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            RECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  4    RECISIHVGQAGVQMGNACWELYCLEHGIQ  33



>ref|XP_006264718.1| PREDICTED: tubulin alpha chain-like [Alligator mississippiensis]
Length=158

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>ref|XP_005059562.1| PREDICTED: tubulin alpha-2 chain-like [Ficedula albicollis]
Length=56

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECIS+H+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISVHVGQAGVQIGNACWELYCLEHGIQ  31



>gb|EPY78320.1| hypothetical protein CB1_001108068 [Camelus ferus]
Length=861

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>dbj|GAA50791.1| tubulin alpha [Clonorchis sinensis]
Length=616

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 1/41 (2%)
 Frame = +2

Query  98   CSSNSSFA-KMRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            CSS+S      RECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  156  CSSHSDANWNYRECISIHVGQAGVQIGNACWELYCLEHGIQ  196



>ref|XP_005466520.1| PREDICTED: tubulin alpha chain-like [Oreochromis niloticus]
Length=142

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>ref|XP_008236253.1| PREDICTED: tubulin alpha chain isoform X2 [Prunus mume]
Length=427

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|EGW08964.1| Tubulin alpha-3 chain [Cricetulus griseus]
Length=76

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>gb|KIH67265.1| hypothetical protein ANCDUO_02401 [Ancylostoma duodenale]
Length=64

 Score = 65.1 bits (157),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  128  RECISIHIVQAGIQVGNACWELYCLEHGIQVSTFL  232
            RECISIHI QAG Q+GNACWELYCLEHGI  S FL
Sbjct  6    RECISIHIGQAGAQIGNACWELYCLEHGIDQSGFL  40



>ref|XP_003392163.2| PREDICTED: tubulin alpha chain, testis-specific-like, partial 
[Amphimedon queenslandica]
Length=163

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>ref|XP_004704287.1| PREDICTED: tubulin alpha chain-like [Echinops telfairi]
Length=120

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>ref|XP_007107598.1| PREDICTED: tubulin alpha-1A chain [Physeter catodon]
Length=148

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>gb|ERE85967.1| tubulin alpha-1C chain-like protein [Cricetulus griseus]
Length=100

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>ref|XP_004085980.2| PREDICTED: tubulin alpha-1D chain-like [Oryzias latipes]
Length=130

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECIS+H+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISVHVGQAGVQIGNACWELYCLEHGIQ  31



>ref|XP_003976815.1| PREDICTED: tubulin alpha-1 chain-like, partial [Takifugu rubripes]
Length=180

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>gb|EHJ68371.1| Moesin [Danaus plexippus]
Length=1068

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECIS+HI QAG+Q+GNACWELYCLEHGIQ
Sbjct  7    MRECISVHIGQAGVQIGNACWELYCLEHGIQ  37



>gb|AFW67749.1| alpha tubulin4 [Zea mays]
Length=321

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQVS  223
            MRECISIHI QAGIQVGNACWELYCLEHGIQ  
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQAD  33



>emb|CDQ84911.1| unnamed protein product, partial [Oncorhynchus mykiss]
Length=1153

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  735  MRECISIHVGQAGVQIGNACWELYCLEHGIQ  765



>ref|XP_008216843.1| PREDICTED: tubulin alpha-1C chain-like, partial [Nasonia vitripennis]
Length=196

 Score = 67.4 bits (163),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQVS  223
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ  
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQAD  33



>emb|CAJ26346.1| alpha-tubulin [Platynereis dumerilii]
Length=190

 Score = 67.4 bits (163),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>gb|ADN07531.1| tubulin, alpha-like 3, 5 prime, partial [Microtus ochrogaster]
Length=81

 Score = 65.5 bits (158),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  128  RECISIHIVQAGIQVGNACWELYCLEHGIQVSTFLFFS  241
            REC+S+HI QAG+Q+G+ACWELYCLEHGIQ   F+  S
Sbjct  1    RECLSVHIGQAGVQIGDACWELYCLEHGIQPDGFILDS  38



>ref|XP_009916549.1| PREDICTED: tubulin alpha-1C chain-like, partial [Haliaeetus albicilla]
Length=199

 Score = 67.4 bits (163),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGVQMGNACWELYCLEHGIQ  31



>gb|EPQ18458.1| Tubulin alpha-1D chain [Myotis brandtii]
Length=568

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECIS+H+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  117  MRECISVHVGQAGVQIGNACWELYCLEHGIQ  147



>ref|XP_008455056.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Cucumis melo]
Length=406

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_005906298.1| PREDICTED: LOW QUALITY PROTEIN: tubulin alpha-1 chain-like [Bos 
mutus]
Length=202

 Score = 67.4 bits (163),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>gb|ERE81184.1| tubulin alpha-1C chain [Cricetulus griseus]
Length=197

 Score = 67.4 bits (163),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  36   MRECISIHVGQAGVQIGNACWELYCLEHGIQ  66



>ref|XP_008969760.1| PREDICTED: tubulin alpha chain-like [Pan paniscus]
Length=194

 Score = 67.4 bits (163),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>ref|XP_009124557.1| PREDICTED: tubulin alpha-6 chain-like isoform X2 [Brassica rapa]
Length=431

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|AAC97930.1| alpha tubulin, partial [Notothenia coriiceps]
Length=168

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>gb|EFO61055.1| Alpha-tubulin [Giardia lamblia P15]
Length=181

 Score = 67.4 bits (163),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECIS+HI QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISVHIGQAGVQIGNACWELYCLEHGIQ  31



>ref|XP_004644630.1| PREDICTED: tubulin alpha-3 chain-like [Octodon degus]
Length=182

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>ref|XP_006056311.1| PREDICTED: tubulin alpha-1B chain-like, partial [Bubalus bubalis]
Length=233

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>gb|AAX21196.1| putative alpha-tubulin [Solanum betaceum]
Length=204

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/31 (94%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGI+
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIK  31



>gb|KHG14074.1| Tubulin alpha-2 chain [Gossypium arboreum]
Length=393

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_010466127.1| PREDICTED: tubulin alpha-2 chain-like isoform X2 [Camelina sativa]
Length=423

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|EDM01432.1| rCG30111, isoform CRA_b [Rattus norvegicus]
Length=108

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>gb|AAW30622.1| unknown, partial [Sus scrofa]
Length=189

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>ref|XP_008294350.1| PREDICTED: tubulin alpha chain [Stegastes partitus]
Length=202

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>ref|XP_009702189.1| PREDICTED: tubulin alpha-1C chain-like, partial [Cariama cristata]
Length=195

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGVQMGNACWELYCLEHGIQ  31



>ref|XP_006482577.1| PREDICTED: tubulin alpha-2 chain-like isoform X2 [Citrus sinensis]
Length=425

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|AAW30623.1| unknown [Sus scrofa]
Length=201

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>gb|ABQ59634.1| alpha-tubulin 5 [Populus tremuloides]
Length=451

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_003804211.2| PREDICTED: tubulin alpha-3E chain [Pan paniscus]
Length=145

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>ref|XP_005350997.1| PREDICTED: tubulin alpha chain-like [Microtus ochrogaster]
Length=142

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>ref|XP_002587654.1| hypothetical protein BRAFLDRAFT_96496 [Branchiostoma floridae]
 gb|EEN43665.1| hypothetical protein BRAFLDRAFT_96496 [Branchiostoma floridae]
Length=127

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MREC+S+HI QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECVSLHIGQAGVQIGNACWELYCLEHGIQ  31



>ref|XP_002962630.1| hypothetical protein SELMODRAFT_230143 [Selaginella moellendorffii]
 ref|XP_002980460.1| hypothetical protein SELMODRAFT_233518 [Selaginella moellendorffii]
 gb|EFJ18720.1| hypothetical protein SELMODRAFT_233518 [Selaginella moellendorffii]
 gb|EFJ36093.1| hypothetical protein SELMODRAFT_230143 [Selaginella moellendorffii]
Length=452

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>dbj|BAG60120.1| unnamed protein product [Homo sapiens]
Length=182

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>ref|NP_849388.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 dbj|BAH19475.1| AT4G14960 [Arabidopsis thaliana]
 gb|AEE83529.1| tubulin alpha-6 chain [Arabidopsis thaliana]
Length=427

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_002401565.1| alpha tubulin, putative [Ixodes scapularis]
 gb|EEC02794.1| alpha tubulin, putative [Ixodes scapularis]
Length=634

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECIS+HI QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISVHIGQAGVQIGNACWELYCLEHGIQ  31



>ref|XP_002275973.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
Length=450

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_010291103.1| PREDICTED: tubulin alpha-8 chain [Phaethon lepturus]
Length=132

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 34/37 (92%), Gaps = 1/37 (3%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQVS-TFL  232
            MRECIS+HI QAG+Q+GNACWEL+CLEHGIQ + TF+
Sbjct  1    MRECISVHIGQAGVQIGNACWELFCLEHGIQPNGTFI  37



>ref|XP_006578253.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Glycine max]
Length=432

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_008294349.1| PREDICTED: tubulin alpha chain-like [Stegastes partitus]
Length=166

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>gb|AGG37287.1| alpha-tubulin 5 [Salix arbutifolia]
Length=451

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>sp|Q6VAG1.1|TBA1_GOSHI RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Gossypium hirsutum]
 gb|AAQ92661.1| alpha-tubulin 1 [Gossypium hirsutum]
Length=451

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_002989731.1| hypothetical protein SELMODRAFT_130285 [Selaginella moellendorffii]
 ref|XP_002991763.1| hypothetical protein SELMODRAFT_236391 [Selaginella moellendorffii]
 gb|EFJ07167.1| hypothetical protein SELMODRAFT_236391 [Selaginella moellendorffii]
 gb|EFJ09208.1| hypothetical protein SELMODRAFT_130285 [Selaginella moellendorffii]
Length=451

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_002989721.1| hypothetical protein SELMODRAFT_235864 [Selaginella moellendorffii]
 ref|XP_002993678.1| hypothetical protein SELMODRAFT_236787 [Selaginella moellendorffii]
 gb|EFJ05267.1| hypothetical protein SELMODRAFT_236787 [Selaginella moellendorffii]
 gb|EFJ09198.1| hypothetical protein SELMODRAFT_235864 [Selaginella moellendorffii]
Length=451

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|AEM36066.1| alpha tubulin [Mytilus edulis]
Length=99

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHG Q
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGTQ  31



>ref|XP_007541192.1| PREDICTED: tubulin alpha chain-like [Poecilia formosa]
Length=168

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQVSTFL  232
            MRECIS HI QAG+Q+GNACWELYCLEHGIQ    +
Sbjct  1    MRECISFHIGQAGVQIGNACWELYCLEHGIQPDGLM  36



>ref|XP_002981542.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
 gb|EFJ17357.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
Length=449

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|KHG20487.1| Tubulin alpha chain [Gossypium arboreum]
Length=451

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|ABK92552.1| unknown [Populus trichocarpa]
Length=451

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_005801996.1| PREDICTED: tubulin alpha-1B chain-like, partial [Xiphophorus 
maculatus]
Length=255

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>ref|XP_005466564.1| PREDICTED: tubulin alpha chain-like [Oreochromis niloticus]
Length=142

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECIS+H+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISVHVGQAGVQIGNACWELYCLEHGIQ  31



>gb|ABQ59633.1| alpha-tubulin 3 [Populus tremuloides]
Length=451

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_007199840.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
 ref|XP_008236252.1| PREDICTED: tubulin alpha chain isoform X1 [Prunus mume]
 gb|EMJ01039.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
Length=450

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_010664458.1| PREDICTED: tubulin alpha-4 chain [Vitis vinifera]
 emb|CAN77412.1| hypothetical protein VITISV_000470 [Vitis vinifera]
Length=451

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_006422747.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 ref|XP_006486878.1| PREDICTED: tubulin alpha chain-like isoform X1 [Citrus sinensis]
 gb|ESR35987.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 gb|KDO49534.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=450

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>emb|CAN62392.1| hypothetical protein VITISV_016172 [Vitis vinifera]
Length=435

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|KJB29387.1| hypothetical protein B456_005G097800 [Gossypium raimondii]
Length=451

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_010104543.1| Tubulin alpha chain [Morus notabilis]
 gb|EXC01144.1| Tubulin alpha chain [Morus notabilis]
Length=448

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_008341563.1| PREDICTED: tubulin alpha-2 chain-like [Malus domestica]
Length=450

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_002510010.1| tubulin alpha chain, putative [Ricinus communis]
 ref|XP_006852746.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
 gb|EEF52197.1| tubulin alpha chain, putative [Ricinus communis]
 gb|ERN14213.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
Length=451

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|ABX57816.1| alpha tubulin [Picea wilsonii]
Length=451

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|AAV92352.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92353.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92354.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92355.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92356.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92357.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92358.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92359.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92360.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92361.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92362.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92363.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92364.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92365.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92366.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92367.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92368.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92369.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92370.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92371.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92372.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92373.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92374.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92375.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92376.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92377.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92378.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92379.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|ACN40661.1| unknown [Picea sitchensis]
 gb|ACN40854.1| unknown [Picea sitchensis]
 gb|ACN40972.1| unknown [Picea sitchensis]
 gb|ACN41102.1| unknown [Picea sitchensis]
 gb|AIZ74331.1| alpha-tubulin [Pinus massoniana]
Length=451

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_002466535.1| hypothetical protein SORBIDRAFT_01g009570 [Sorghum bicolor]
 gb|EER93533.1| hypothetical protein SORBIDRAFT_01g009570 [Sorghum bicolor]
 gb|ACX70682.1| tubulin alpha-2-like protein [Sorghum bicolor]
Length=452

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|EJD75589.1| hypothetical protein LOAG_17302 [Loa loa]
Length=49

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  128  RECISIHIVQAGIQVGNACWELYCLEHGIQVSTFLF  235
            RE ISIHI QAG+Q+GNACWELYCLEHGIQV    F
Sbjct  6    REVISIHIGQAGVQIGNACWELYCLEHGIQVGKVFF  41



>gb|KDP32140.1| hypothetical protein JCGZ_12601 [Jatropha curcas]
Length=450

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_002522104.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF40304.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_003635553.2| PREDICTED: tubulin alpha chain-like [Vitis vinifera]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>dbj|BAP59012.1| alpha tubulin [Taxus cuspidata]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>dbj|BAJ06364.1| alpha-tubulin [Alopecurus aequalis]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_007018369.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY15594.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|AGG37285.1| alpha-tubulin 3 [Salix arbutifolia]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|ABO47737.1| alpha-tubulin [Gossypium hirsutum]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|NP_001289660.1| tubulin alpha chain-like [Eucalyptus grandis]
 gb|ABS50670.1| alpha-tubulin [Eucalyptus grandis]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_003558668.1| PREDICTED: tubulin alpha-2 chain-like [Brachypodium distachyon]
 emb|CAM58977.1| alpha-tubulin 4 [Hordeum vulgare subsp. vulgare]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_006486879.1| PREDICTED: tubulin alpha chain-like isoform X2 [Citrus sinensis]
Length=433

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_003522731.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Glycine max]
Length=452

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_011457777.1| PREDICTED: tubulin alpha chain [Fragaria vesca subsp. vesca]
Length=450

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_009335354.1| PREDICTED: tubulin alpha chain [Pyrus x bretschneideri]
Length=450

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_008379344.1| PREDICTED: tubulin alpha-2 chain [Malus domestica]
Length=450

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|ACN40181.1| unknown [Picea sitchensis]
 gb|ACN40840.1| unknown [Picea sitchensis]
Length=450

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|AAO73546.1| alpha-tubulin [Ceratopteris richardii]
 gb|AAW57307.1| alpha-tubulin [Ceratopteris richardii]
Length=450

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>sp|Q6VAG0.1|TBA2_GOSHI RecName: Full=Tubulin alpha-2 chain; AltName: Full=Alpha-2-tubulin 
[Gossypium hirsutum]
 gb|AAQ92662.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|ACM89776.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|KJB77616.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
 gb|KJB77617.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
Length=450

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_002283198.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
 ref|XP_006827169.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
 ref|XP_010939541.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
 gb|ERM94406.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
Length=450

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|AGE09583.1| TUA1-like protein [Eucalyptus cladocalyx]
 gb|KCW68570.1| hypothetical protein EUGRSUZ_F02183 [Eucalyptus grandis]
Length=420

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>emb|CDY25017.1| BnaC02g39910D [Brassica napus]
Length=410

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_011002356.1| PREDICTED: tubulin alpha chain-like [Populus euphratica]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_009402887.1| PREDICTED: tubulin alpha chain [Musa acuminata subsp. malaccensis]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_002313194.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
 gb|EEE87149.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_002298794.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
 gb|EEE83599.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_003608582.1| Tubulin alpha-5 chain [Medicago truncatula]
 gb|AES90779.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_001764722.1| predicted protein [Physcomitrella patens]
 gb|EDQ70421.1| predicted protein [Physcomitrella patens]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_006581474.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
Length=452

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|KDP44552.1| hypothetical protein JCGZ_16385 [Jatropha curcas]
Length=450

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|ACJ60905.1| alpha tubulin [Betula pendula]
Length=450

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>sp|P33629.1|TBA_PRUDU RecName: Full=Tubulin alpha chain [Prunus dulcis]
 emb|CAA47635.1| alpha-tubulin [Prunus dulcis]
Length=450

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|ABO47739.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG18532.1| Tubulin alpha-2 chain [Gossypium arboreum]
Length=450

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_010245599.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_010266793.1| PREDICTED: tubulin alpha chain [Nelumbo nucifera]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_006404742.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
 gb|ESQ46195.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|KDO49533.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=431

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_010774362.1| PREDICTED: tubulin alpha-1D chain-like, partial [Notothenia coriiceps]
Length=99

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECIS+HI QAG Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISVHIGQAGAQIGNACWELYCLEHGIQ  31



>ref|XP_004136930.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 ref|XP_004155416.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 gb|KGN43837.1| Tubulin alpha chain [Cucumis sativus]
Length=450

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_010300646.1| PREDICTED: tubulin alpha-2 chain-like, partial [Balearica regulorum 
gibbericeps]
Length=131

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 34/37 (92%), Gaps = 1/37 (3%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQVS-TFL  232
            MRECIS+HI QAG+Q+GNACWEL+CLEHGIQ + TF+
Sbjct  1    MRECISVHIGQAGVQIGNACWELFCLEHGIQPNGTFI  37



>emb|CDY66630.1| BnaCnng51680D [Brassica napus]
Length=435

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_009388502.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|KDP41548.1| hypothetical protein JCGZ_15955 [Jatropha curcas]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_002301128.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
 ref|XP_011017025.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017026.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017027.1| PREDICTED: tubulin alpha chain-like isoform X2 [Populus euphratica]
 gb|AAO63781.1| alpha-tubulin 1 [Populus tremuloides]
 gb|ABK96001.1| unknown [Populus trichocarpa]
 gb|EEE80401.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_007137281.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
 gb|ESW09275.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|ABV55999.1| alpha-tubulin 7 [Populus tremuloides]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|ABD92937.1| alpha tubulin-4A [Triticum aestivum]
 gb|ABD92938.1| alpha tubulin-4B [Triticum aestivum]
 gb|EMS53764.1| Tubulin alpha chain [Triticum urartu]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|ABD92936.1| alpha tubulin-4D [Triticum aestivum]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_004299843.1| PREDICTED: tubulin alpha chain-like [Fragaria vesca subsp. vesca]
 gb|AAK81858.1|AF394915_1 alpha tubulin subunit [Rosa hybrid cultivar]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>tpg|DAA51109.1| TPA: alpha tubulin [Zea mays]
Length=452

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|KHN08201.1| Tubulin alpha chain [Glycine soja]
Length=457

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_004599399.1| PREDICTED: tubulin alpha-1B chain, partial [Ochotona princeps]
Length=231

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>ref|XP_011030289.1| PREDICTED: tubulin alpha-4 chain [Populus euphratica]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_010943272.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_009779180.1| PREDICTED: tubulin alpha-3 chain-like [Nicotiana sylvestris]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|AAB84298.1| tubulin [Oryza sativa Indica Group]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_010093625.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB54386.1| Tubulin alpha chain [Morus notabilis]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|AGG37283.1| alpha-tubulin 1 [Salix arbutifolia]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>dbj|BAC24800.1| alpha tubulin [Physcomitrella patens]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_009407690.1| PREDICTED: tubulin alpha chain-like [Musa acuminata subsp. malaccensis]
Length=452

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|AIJ27191.1| alpha-tubulin 1a, partial [Mytilus galloprovincialis]
Length=271

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>ref|XP_008804464.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=450

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_006431130.1| hypothetical protein CICLE_v10011709mg [Citrus clementina]
 ref|XP_006482576.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Citrus sinensis]
 gb|ESR44370.1| hypothetical protein CICLE_v10011709mg [Citrus clementina]
 gb|KDO72550.1| hypothetical protein CISIN_1g013066mg [Citrus sinensis]
Length=450

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_004304311.1| PREDICTED: tubulin alpha-2 chain-like [Fragaria vesca subsp. 
vesca]
Length=450

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_004150268.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_004156870.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_008454421.1| PREDICTED: tubulin alpha chain [Cucumis melo]
 gb|ADN33817.1| tubulin alpha chain [Cucumis melo subsp. melo]
 gb|KGN52737.1| Tubulin alpha chain [Cucumis sativus]
Length=450

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_011014531.1| PREDICTED: tubulin alpha-4 chain-like [Populus euphratica]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_011008936.1| PREDICTED: tubulin alpha chain [Populus euphratica]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_010507910.1| PREDICTED: tubulin alpha-2 chain-like [Camelina sativa]
 ref|XP_010466126.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Camelina sativa]
 ref|XP_010487911.1| PREDICTED: tubulin alpha-2 chain-like [Camelina sativa]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_007156677.1| hypothetical protein PHAVU_002G007900g [Phaseolus vulgaris]
 gb|ESW28671.1| hypothetical protein PHAVU_002G007900g [Phaseolus vulgaris]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_004501073.1| PREDICTED: tubulin alpha chain-like [Cicer arietinum]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_004288297.1| PREDICTED: tubulin alpha-3 chain [Fragaria vesca subsp. vesca]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_003603670.1| Tubulin alpha-7 chain [Medicago truncatula]
 gb|AES73921.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>emb|CAA62917.1| alfa-tubulin [Oryza sativa Japonica Group]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_010096739.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB65591.1| Tubulin alpha chain [Morus notabilis]
Length=449

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_010526692.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_010555432.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_010531321.1| PREDICTED: tubulin alpha chain isoform X1 [Tarenaya hassleriana]
Length=450

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_009335355.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
Length=450

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|AID52921.1| tubulin alpha chain [Carthamus tinctorius]
Length=450

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|AGG37289.1| alpha-tubulin 7 [Salix arbutifolia]
Length=450

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_007908291.1| PREDICTED: tubulin alpha chain-like [Callorhinchus milii]
Length=447

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQVSTFL  232
            MREC+S+HI QAG+Q+GNACWELYCLEHGIQ   F+
Sbjct  1    MRECVSVHIGQAGVQIGNACWELYCLEHGIQPDGFM  36



>ref|XP_008787760.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_008787237.1| PREDICTED: tubulin alpha chain [Phoenix dactylifera]
 ref|XP_010941981.1| PREDICTED: tubulin alpha chain [Elaeis guineensis]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_002964078.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
 ref|XP_002975442.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ23643.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ34411.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_001770881.1| predicted protein [Physcomitrella patens]
 gb|EDQ64211.1| predicted protein [Physcomitrella patens]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|ABK92520.1| unknown [Populus trichocarpa]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_010065856.1| PREDICTED: tubulin alpha chain [Eucalyptus grandis]
 gb|KCW63554.1| hypothetical protein EUGRSUZ_G01186 [Eucalyptus grandis]
Length=450

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|NP_171974.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 ref|NP_175423.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 ref|XP_002863595.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002891551.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006279139.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 ref|XP_006393188.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 ref|XP_006406473.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 ref|XP_009107244.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Brassica rapa]
 sp|B9DGT7.2|TBA2_ARATH RecName: Full=Tubulin alpha-2 chain [Arabidopsis thaliana]
 sp|Q0WV25.2|TBA4_ARATH RecName: Full=Tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AAF40454.1|AC004809_12 Identical to the alpha-4 tubulin (TUA4) gene from A. thaliana 
gb|M84697. ESTs gb|T46564. gb|T04381, gb|T76028, gb|T21602, 
gb|H37154 gb|H37663 and gb|T21719 come from this gene [Arabidopsis 
thaliana]
 gb|AAF76449.1|AC015445_16 Identical to Tubulin Alpha-6 Chain from Arabidopsis thaliana 
gi|267070 and contains a Tubulin PF|00091 domain. ESTs gb|N37387, 
gb|N37805, gb|R90497, gb|T44684, gb|H36144, gb|N38686, 
gb|AI994844, gb|R90689, gb|T04725, gb|H36928, gb|N96479, gb|H36922, 
gb|R90670, gb|Z17980, gb|T4428, gb|H36248, gb|N65408, 
gb|T46222 come from this gene [Arabidopsis thaliana]
 gb|AAK95316.1|AF410330_1 At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|AAA32889.1| apha-2 tubulin [Arabidopsis thaliana]
 gb|AAA32890.1| alpha-4 tubulin [Arabidopsis thaliana]
 gb|AAL25612.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAL38293.1| Tubulin Alpha-6 Chain [Arabidopsis thaliana]
 gb|AAM98269.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAN31076.1| At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|ABQ01730.1| TUA2 [Eutrema halophilum]
 gb|ABQ01731.1| TUA2-2 [Eutrema halophilum]
 gb|EFH39854.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67810.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|AEE27747.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AEE32507.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 gb|EOA12037.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 gb|ESQ30474.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 gb|ESQ47926.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 gb|KFK35954.1| hypothetical protein AALP_AA4G059800 [Arabis alpina]
 gb|KFK39296.1| alpha tubulin 1 [Arabis alpina]
 emb|CDY45043.1| BnaA08g02320D [Brassica napus]
 emb|CDY03583.1| BnaC03g68420D [Brassica napus]
Length=450

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_007042689.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX98520.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_007215369.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
 ref|XP_008230754.1| PREDICTED: tubulin alpha chain-like [Prunus mume]
 gb|EMJ16568.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
Length=450

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>sp|Q6VAF9.1|TBA4_GOSHI RecName: Full=Tubulin alpha-4 chain; AltName: Full=Alpha-4-tubulin 
[Gossypium hirsutum]
 gb|AAQ92663.1| alpha-tubulin 4 [Gossypium hirsutum]
Length=450

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|AAL16174.1|AF428406_1 AT4g14960/dl3520c [Arabidopsis thaliana]
Length=450

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|AHJ80822.1| Tua1 [Eragrostis tef]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQVS  223
            MRECISIHI QAGIQVGNACWELYCLEHGIQ  
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQAD  33



>ref|XP_002517492.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF45034.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>dbj|BAE99023.1| tubulin alpha-2/alpha-4 chain [Arabidopsis thaliana]
Length=450

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|EDL10694.1| mCG13302, isoform CRA_b [Mus musculus]
Length=108

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIH+ QAG+Q+GNACWELYCLEHGIQ
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQ  31



>gb|AFW67748.1| alpha tubulin4 [Zea mays]
Length=364

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQVS  223
            MRECISIHI QAGIQVGNACWELYCLEHGIQ  
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQAD  33



>ref|XP_010939312.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_010936237.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_009618479.1| PREDICTED: tubulin alpha-3 chain-like [Nicotiana tomentosiformis]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>gb|AAO23139.1| alpha tubulin [Populus tremuloides]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|NP_001067613.1| Os11g0247300 [Oryza sativa Japonica Group]
 sp|Q53M52.1|TBA2_ORYSJ RecName: Full=Tubulin alpha-2 chain [Oryza sativa Japonica Group]
 gb|AAX96762.1| Tubulin/FtsZ family, GTPase domain, putative [Oryza sativa Japonica 
Group]
 gb|AAX96764.1| Tubulin/FtsZ family, GTPase domain, putative [Oryza sativa Japonica 
Group]
 gb|ABA92352.1| Tubulin alpha-3 chain, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABA92353.1| Tubulin alpha-3 chain, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27976.1| Os11g0247300 [Oryza sativa Japonica Group]
 gb|EAY80511.1| hypothetical protein OsI_35689 [Oryza sativa Indica Group]
 gb|EAZ17981.1| hypothetical protein OsJ_33527 [Oryza sativa Japonica Group]
 dbj|BAG95614.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH85357.1| alpha-tubulin [Oryza sativa Japonica Group]
 gb|ADM86870.1| alpha-tubulin [Oryza sativa Japonica Group]
 gb|AFI71279.1| alpha-tubulin [Oryza sativa Japonica Group]
Length=451

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_007032501.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY03427.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



>ref|XP_006307493.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
 ref|XP_010418156.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 ref|XP_010430201.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Camelina sativa]
 ref|XP_010430202.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Camelina sativa]
 ref|XP_010473400.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 gb|EOA40391.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
Length=450

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  MRECISIHIVQAGIQVGNACWELYCLEHGIQ  217
            MRECISIHI QAGIQVGNACWELYCLEHGIQ
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQ  31



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 672416417960