BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF038N18

Length=585
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDP30256.1|  hypothetical protein JCGZ_17038                         121   4e-28   Jatropha curcas
ref|XP_007013520.1|  RabGAP/TBC domain-containing protein isoform 1     118   6e-27   
gb|KJB27075.1|  hypothetical protein B456_004G276400                    114   5e-26   Gossypium raimondii
emb|CDP10442.1|  unnamed protein product                                114   9e-26   Coffea canephora [robusta coffee]
gb|KJB27076.1|  hypothetical protein B456_004G276400                    114   9e-26   Gossypium raimondii
ref|XP_010656459.1|  PREDICTED: TBC1 domain family member 17 isof...    114   1e-25   Vitis vinifera
gb|KJB27077.1|  hypothetical protein B456_004G276400                    113   1e-25   Gossypium raimondii
gb|KJB27079.1|  hypothetical protein B456_004G276400                    114   2e-25   Gossypium raimondii
gb|KHG01737.1|  TBC1 domain family member 15                            113   3e-25   Gossypium arboreum [tree cotton]
ref|XP_010241555.1|  PREDICTED: TBC1 domain family member 17 isof...    113   3e-25   Nelumbo nucifera [Indian lotus]
ref|XP_010656458.1|  PREDICTED: GTPase-activating protein GYP7 is...    113   3e-25   Vitis vinifera
ref|XP_010241554.1|  PREDICTED: TBC1 domain family member 17 isof...    112   4e-25   Nelumbo nucifera [Indian lotus]
ref|XP_010112474.1|  TBC1 domain family member 15                       110   9e-25   
gb|KDO80156.1|  hypothetical protein CISIN_1g005652mg                   109   6e-24   Citrus sinensis [apfelsine]
ref|XP_009593351.1|  PREDICTED: TBC1 domain family member 15 isof...    106   4e-23   
ref|XP_009593350.1|  PREDICTED: TBC1 domain family member 17 isof...    106   4e-23   Nicotiana tomentosiformis
ref|XP_009789610.1|  PREDICTED: TBC1 domain family member 15-like...    106   5e-23   Nicotiana sylvestris
ref|XP_009789609.1|  PREDICTED: TBC1 domain family member 17-like...    106   5e-23   Nicotiana sylvestris
ref|XP_009593349.1|  PREDICTED: TBC1 domain family member 17 isof...    106   6e-23   Nicotiana tomentosiformis
ref|XP_009789608.1|  PREDICTED: TBC1 domain family member 17-like...    106   7e-23   Nicotiana sylvestris
ref|XP_010323291.1|  PREDICTED: GTPase-activating protein gyp7          103   5e-22   Solanum lycopersicum
gb|AIU48660.1|  RabGAP/TBC domain-containing protein                    102   1e-21   Chloranthus japonicus
ref|XP_006358298.1|  PREDICTED: GTPase-activating protein gyp7-like     101   3e-21   Solanum tuberosum [potatoes]
gb|AIU48649.1|  RabGAP/TBC domain-containing protein                  98.2    5e-21   Sarcandra glabra
gb|AIU48684.1|  RabGAP/TBC domain-containing protein                    100   5e-21   Cinnamomum camphora
gb|AIU48651.1|  RabGAP/TBC domain-containing protein                    100   6e-21   Gossypium raimondii
ref|XP_011084120.1|  PREDICTED: TBC1 domain family member 15            100   6e-21   Sesamum indicum [beniseed]
gb|AIU48685.1|  RabGAP/TBC domain-containing protein                  97.8    1e-20   Platanus x hispanica [London plane tree]
gb|KJB64720.1|  hypothetical protein B456_010G061900                  99.4    1e-20   Gossypium raimondii
gb|AIU48681.1|  RabGAP/TBC domain-containing protein                  99.8    1e-20   Vitis vinifera
ref|XP_002285365.1|  PREDICTED: TBC1 domain family member 17 isof...  99.8    1e-20   Vitis vinifera
gb|AIU48652.1|  RabGAP/TBC domain-containing protein                  99.4    1e-20   Carica papaya [mamon]
ref|XP_007155039.1|  hypothetical protein PHAVU_003G167800g           99.4    1e-20   Phaseolus vulgaris [French bean]
gb|KJB64721.1|  hypothetical protein B456_010G061900                  99.0    2e-20   Gossypium raimondii
gb|AIU48643.1|  RabGAP/TBC domain-containing protein                  99.0    2e-20   Magnolia denudata [haku-mokuren]
gb|KJB64719.1|  hypothetical protein B456_010G061900                  99.0    2e-20   Gossypium raimondii
ref|XP_010241556.1|  PREDICTED: TBC1 domain family member 15 isof...  98.6    3e-20   Nelumbo nucifera [Indian lotus]
gb|AIU48673.1|  RabGAP/TBC domain-containing protein                  98.2    3e-20   Phaseolus vulgaris [French bean]
ref|XP_007013521.1|  RabGAP/TBC domain-containing protein isoform 2   98.2    4e-20   
gb|AIU48656.1|  RabGAP/TBC domain-containing protein                  97.4    8e-20   Glycine max [soybeans]
gb|AIU48647.1|  RabGAP/TBC domain-containing protein                  96.7    1e-19   Theobroma cacao [chocolate]
gb|KJB27078.1|  hypothetical protein B456_004G276400                  96.3    2e-19   Gossypium raimondii
ref|XP_004159423.1|  PREDICTED: TBC1 domain family member 15-like     95.1    2e-19   
gb|EYU18249.1|  hypothetical protein MIMGU_mgv1a002604mg              96.3    2e-19   Erythranthe guttata [common monkey flower]
gb|AIU48669.1|  RabGAP/TBC domain-containing protein                  95.9    2e-19   Erythranthe guttata [common monkey flower]
ref|XP_004508469.1|  PREDICTED: TBC1 domain family member 17-like...  95.5    2e-19   
gb|AIU48668.1|  RabGAP/TBC domain-containing protein                  95.5    3e-19   Manihot esculenta [manioc]
gb|AIU48659.1|  RabGAP/TBC domain-containing protein                  95.1    4e-19   Iris japonica
gb|KHN22122.1|  TBC1 domain family member 15                          95.1    4e-19   Glycine soja [wild soybean]
ref|XP_003542634.1|  PREDICTED: TBC1 domain family member 15-like     95.1    4e-19   Glycine max [soybeans]
gb|AIU48687.1|  RabGAP/TBC domain-containing protein                  95.1    5e-19   Houttuynia cordata [chameleon-plant]
ref|XP_011020167.1|  PREDICTED: TBC1 domain family member 15          95.1    5e-19   Populus euphratica
gb|KDO80165.1|  hypothetical protein CISIN_1g005652mg                 92.4    5e-19   Citrus sinensis [apfelsine]
gb|AIU48658.1|  RabGAP/TBC domain-containing protein                  94.7    5e-19   Buxus sinica
ref|XP_008456989.1|  PREDICTED: TBC1 domain family member 15          95.1    5e-19   Cucumis melo [Oriental melon]
ref|XP_004139297.1|  PREDICTED: TBC1 domain family member 15-like     94.7    6e-19   Cucumis sativus [cucumbers]
ref|XP_004508468.1|  PREDICTED: TBC1 domain family member 17-like...  94.7    6e-19   Cicer arietinum [garbanzo]
gb|AIU48662.1|  RabGAP/TBC domain-containing protein                  94.4    9e-19   Chimonanthus praecox [wintersweet]
gb|KDO80163.1|  hypothetical protein CISIN_1g005652mg                 93.2    1e-18   Citrus sinensis [apfelsine]
gb|ACU19099.1|  unknown                                               91.3    1e-18   Glycine max [soybeans]
gb|AIU48639.1|  RabGAP/TBC domain-containing protein                  93.6    1e-18   Aquilegia coerulea [Rocky Mountain columbine]
ref|XP_009758337.1|  PREDICTED: TBC1 domain family member 15-like     93.6    1e-18   Nicotiana sylvestris
gb|KDO80162.1|  hypothetical protein CISIN_1g005652mg                 92.8    2e-18   Citrus sinensis [apfelsine]
ref|XP_006345222.1|  PREDICTED: TBC1 domain family member 15-like     93.6    2e-18   Solanum tuberosum [potatoes]
gb|KDO80164.1|  hypothetical protein CISIN_1g005652mg                 92.4    2e-18   Citrus sinensis [apfelsine]
ref|XP_007204093.1|  hypothetical protein PRUPE_ppa002904mg           93.2    2e-18   
gb|AIU48671.1|  RabGAP/TBC domain-containing protein                  92.8    2e-18   Prunus persica
gb|KDO80161.1|  hypothetical protein CISIN_1g005652mg                 92.8    2e-18   Citrus sinensis [apfelsine]
gb|KDO80160.1|  hypothetical protein CISIN_1g005652mg                 92.8    2e-18   Citrus sinensis [apfelsine]
ref|XP_008242808.1|  PREDICTED: TBC1 domain family member 17          93.2    2e-18   Prunus mume [ume]
gb|KJB54007.1|  hypothetical protein B456_009G016100                  92.8    3e-18   Gossypium raimondii
gb|AIU48675.1|  RabGAP/TBC domain-containing protein                  92.4    3e-18   Ricinus communis
ref|XP_006475896.1|  PREDICTED: TBC1 domain family member 17-like     92.8    3e-18   Citrus sinensis [apfelsine]
ref|XP_009127224.1|  PREDICTED: TBC1 domain family member 15          92.8    3e-18   Brassica rapa
gb|AIU48650.1|  RabGAP/TBC domain-containing protein                  92.4    3e-18   Citrus clementina [clementine]
ref|XP_006450870.1|  hypothetical protein CICLE_v10007683mg           92.8    3e-18   Citrus clementina [clementine]
gb|AIU48654.1|  RabGAP/TBC domain-containing protein                  92.4    3e-18   Citrus sinensis [apfelsine]
gb|KDO80159.1|  hypothetical protein CISIN_1g005652mg                 92.4    3e-18   Citrus sinensis [apfelsine]
ref|XP_002527173.1|  conserved hypothetical protein                   92.4    4e-18   
ref|XP_006855176.1|  hypothetical protein AMTR_s00051p00106780        92.4    4e-18   Amborella trichopoda
gb|AIU48674.1|  RabGAP/TBC domain-containing protein                  89.0    4e-18   Artemisia annua [sweet Annie]
emb|CDY27056.1|  BnaA02g10760D                                        92.4    5e-18   Brassica napus [oilseed rape]
ref|XP_003609386.1|  TBC1 domain family member                        92.0    5e-18   Medicago truncatula
gb|AIU48666.1|  RabGAP/TBC domain-containing protein                  92.0    5e-18   Medicago truncatula
ref|XP_003549744.1|  PREDICTED: TBC1 domain family member 15-like     92.0    6e-18   
ref|XP_009624893.1|  PREDICTED: TBC1 domain family member 15-like     91.7    7e-18   Nicotiana tomentosiformis
ref|XP_004251725.1|  PREDICTED: TBC1 domain family member 17-like     90.9    1e-17   Solanum lycopersicum
gb|AIU48682.1|  RabGAP/TBC domain-containing protein                  88.2    2e-17   Lactuca sativa [cultivated lettuce]
gb|KCW80045.1|  hypothetical protein EUGRSUZ_C01375                   89.7    2e-17   Eucalyptus grandis [rose gum]
gb|AIU48655.1|  RabGAP/TBC domain-containing protein                  90.1    2e-17   Eucalyptus grandis [rose gum]
ref|XP_010047970.1|  PREDICTED: TBC1 domain family member 15          90.1    2e-17   Eucalyptus grandis [rose gum]
gb|AIU48680.1|  RabGAP/TBC domain-containing protein                  90.1    2e-17   Schrenkiella parvula
ref|XP_006401805.1|  hypothetical protein EUTSA_v10012867mg           90.1    3e-17   Eutrema salsugineum [saltwater cress]
ref|XP_006401806.1|  hypothetical protein EUTSA_v10012867mg           90.1    3e-17   
ref|XP_008377303.1|  PREDICTED: TBC1 domain family member 17          90.1    3e-17   
gb|AIU48690.1|  RabGAP/TBC domain-containing protein                  89.4    4e-17   Trachycarpus fortunei
gb|AIU48665.1|  RabGAP/TBC domain-containing protein                  89.4    4e-17   Aristolochia tagala
gb|AIU48648.1|  RabGAP/TBC domain-containing protein                  89.0    4e-17   Acorus calamus [flagroot]
ref|XP_010557604.1|  PREDICTED: TBC1 domain family member 15          89.4    5e-17   Tarenaya hassleriana [spider flower]
gb|AIU48661.1|  RabGAP/TBC domain-containing protein                  89.0    5e-17   Ceratophyllum demersum [hornwort]
gb|AIU48663.1|  RabGAP/TBC domain-containing protein                  86.3    5e-17   Pandanus utilis
emb|CDY65323.1|  BnaC02g44880D                                        89.4    5e-17   Brassica napus [oilseed rape]
gb|AIU48676.1|  RabGAP/TBC domain-containing protein                  89.0    6e-17   Dioscorea oppositifolia
ref|XP_010687933.1|  PREDICTED: TBC1 domain family member 15 isof...  89.0    6e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010687932.1|  PREDICTED: TBC1 domain family member 15 isof...  89.0    6e-17   Beta vulgaris subsp. vulgaris [field beet]
gb|AIU48645.1|  RabGAP/TBC domain-containing protein                  88.6    8e-17   Pinellia ternata
ref|XP_008785780.1|  PREDICTED: TBC1 domain family member 15          88.6    9e-17   Phoenix dactylifera
gb|AIU48657.1|  RabGAP/TBC domain-containing protein                  88.2    1e-16   Illicium henryi
ref|XP_009363991.1|  PREDICTED: TBC1 domain family member 15          88.2    1e-16   Pyrus x bretschneideri [bai li]
gb|AIU48683.1|  RabGAP/TBC domain-containing protein                  88.2    1e-16   Ceratophyllum platyacanthum subsp. oryzetorum
ref|XP_011017820.1|  PREDICTED: TBC1 domain family member 17-like...  88.2    1e-16   Populus euphratica
gb|AIU48689.1|  RabGAP/TBC domain-containing protein                  88.2    1e-16   Alisma plantago-aquatica
ref|XP_011017816.1|  PREDICTED: TBC1 domain family member 15-like...  88.2    1e-16   Populus euphratica
ref|XP_011017818.1|  PREDICTED: TBC1 domain family member 15-like...  87.8    1e-16   Populus euphratica
ref|XP_004287286.1|  PREDICTED: TBC1 domain family member 15          87.8    1e-16   Fragaria vesca subsp. vesca
ref|XP_008354495.1|  PREDICTED: GTPase-activating protein gyp7-like   86.3    2e-16   
gb|AIU48686.1|  RabGAP/TBC domain-containing protein                  87.4    2e-16   Ginkgo biloba [ginkgo]
gb|AIU48640.1|  RabGAP/TBC domain-containing protein                  87.4    2e-16   Arabidopsis lyrata [lyrate rockcress]
ref|XP_006372159.1|  hypothetical protein POPTR_0018s12770g           87.4    2e-16   
gb|AIU48670.1|  RabGAP/TBC domain-containing protein                  87.4    2e-16   Populus trichocarpa [western balsam poplar]
ref|XP_002324638.2|  hypothetical protein POPTR_0018s12770g           87.4    2e-16   
gb|AIU48664.1|  RabGAP/TBC domain-containing protein                  87.0    2e-16   Asparagus officinalis
ref|XP_011469988.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  85.9    6e-16   Fragaria vesca subsp. vesca
gb|AIU48641.1|  RabGAP/TBC domain-containing protein                  85.9    7e-16   Arabidopsis thaliana [mouse-ear cress]
gb|KFK26862.1|  hypothetical protein AALP_AA8G303600                  85.9    7e-16   Arabis alpina [alpine rockcress]
ref|XP_008362894.1|  PREDICTED: TBC1 domain family member 17-like     85.5    9e-16   
ref|XP_002864184.1|  hypothetical protein ARALYDRAFT_495330           85.5    9e-16   Arabidopsis lyrata subsp. lyrata
gb|AIU48653.1|  RabGAP/TBC domain-containing protein                  85.5    1e-15   Capsella rubella
ref|NP_200071.2|  RabGAP/TBC domain-containing protein                85.1    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010911930.1|  PREDICTED: TBC1 domain family member 17 isof...  84.7    1e-15   Elaeis guineensis
ref|XP_006280129.1|  hypothetical protein CARUB_v10026023mg           85.1    1e-15   Capsella rubella
ref|XP_010482625.1|  PREDICTED: TBC1 domain family member 15-like...  84.7    2e-15   Camelina sativa [gold-of-pleasure]
gb|AIU48677.1|  RabGAP/TBC domain-containing protein                  84.7    2e-15   Yucca filamentosa [Adam's-needle]
ref|XP_010445069.1|  PREDICTED: TBC1 domain family member 15-like...  84.7    2e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010482627.1|  PREDICTED: TBC1 domain family member 15-like...  84.7    2e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010482626.1|  PREDICTED: TBC1 domain family member 15-like...  84.7    2e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010442797.1|  PREDICTED: TBC1 domain family member 15-like     84.7    2e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010445073.1|  PREDICTED: TBC1 domain family member 15-like...  84.7    2e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010911929.1|  PREDICTED: TBC1 domain family member 15 isof...  82.4    9e-15   Elaeis guineensis
ref|XP_001783529.1|  predicted protein                                80.9    2e-14   
gb|AIU48691.1|  RabGAP/TBC domain-containing protein                  79.0    6e-14   Cabomba caroliniana
gb|AIU48667.1|  RabGAP/TBC domain-containing protein                  77.8    3e-13   Canna indica [canna]
ref|XP_009420718.1|  PREDICTED: TBC1 domain family member 15          77.8    4e-13   
dbj|BAA98077.1|  unnamed protein product                              75.1    7e-13   Arabidopsis thaliana [mouse-ear cress]
gb|AIU48642.1|  RabGAP/TBC domain-containing protein                  76.6    9e-13   Lilium brownii [Hong Kong lily]
gb|AIU48688.1|  RabGAP/TBC domain-containing protein                  75.5    1e-12   Zea mays [maize]
ref|NP_001168835.1|  uncharacterized protein LOC100382640             75.5    2e-12   Zea mays [maize]
gb|EEC73873.1|  hypothetical protein OsI_08649                        75.1    3e-12   Oryza sativa Indica Group [Indian rice]
ref|NP_001047892.1|  Os02g0709800                                     75.1    3e-12   
gb|AIU48679.1|  RabGAP/TBC domain-containing protein                  74.7    3e-12   Sorghum bicolor [broomcorn]
ref|XP_002452666.1|  hypothetical protein SORBIDRAFT_04g030250        74.7    4e-12   
ref|NP_001190524.1|  RabGAP/TBC domain-containing protein             74.3    5e-12   Arabidopsis thaliana [mouse-ear cress]
gb|AIU48678.1|  RabGAP/TBC domain-containing protein                  74.3    5e-12   Setaria italica
ref|XP_004953647.1|  PREDICTED: TBC1 domain family member 15-like     74.3    6e-12   Setaria italica
gb|EMT03185.1|  TBC1 domain family member 15                          73.9    6e-12   
gb|AIU48672.1|  RabGAP/TBC domain-containing protein                  73.9    7e-12   Panicum virgatum
gb|AIU48646.1|  RabGAP/TBC domain-containing protein                  72.8    1e-11   Brachypodium distachyon [annual false brome]
ref|XP_003570212.1|  PREDICTED: TBC1 domain family member 15          72.4    2e-11   Brachypodium distachyon [annual false brome]
dbj|BAK05291.1|  predicted protein                                    71.2    6e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006647781.1|  PREDICTED: TBC1 domain family member 15-like     70.5    9e-11   Oryza brachyantha
gb|KDO80158.1|  hypothetical protein CISIN_1g005652mg                 65.1    5e-09   Citrus sinensis [apfelsine]
gb|AIU48644.1|  RabGAP/TBC domain-containing protein                  60.5    9e-08   Musa acuminata [banana]
dbj|BAA98076.1|  unnamed protein product                              60.5    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004338737.1|  TBC domain containing protein                    59.7    2e-07   Acanthamoeba castellanii str. Neff
gb|EPS58476.1|  hypothetical protein M569_16338                       59.3    3e-07   Genlisea aurea
gb|KHG10934.1|  TBC1 domain family member 17                          56.2    5e-07   Gossypium arboreum [tree cotton]
ref|XP_006381118.1|  hypothetical protein POPTR_0006s06510g           57.8    6e-07   
ref|XP_002673421.1|  rabGTPase-activating protein                     58.5    7e-07   Naegleria gruberi strain NEG-M
ref|XP_005649420.1|  RabGAP/TBC                                       58.5    7e-07   Coccomyxa subellipsoidea C-169
ref|XP_003742417.1|  PREDICTED: TBC1 domain family member 25-like     57.8    1e-06   Galendromus occidentalis
ref|XP_008101787.1|  PREDICTED: TBC1 domain family member 25 isof...  57.0    2e-06   Anolis carolinensis [Carolina anole]
gb|ETE68555.1|  TBC1 domain family member 17                          57.0    2e-06   Ophiophagus hannah
ref|XP_007435599.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  57.0    2e-06   
ref|XP_003216761.1|  PREDICTED: TBC1 domain family member 25 isof...  57.0    2e-06   Anolis carolinensis [Carolina anole]
gb|EHH60857.1|  TBC1 domain family member 25                          57.0    2e-06   Macaca fascicularis [crab eating macaque]
ref|NP_001253225.1|  TBC1 domain family member 25                     56.6    3e-06   Macaca mulatta [rhesus macaque]
gb|EPY76893.1|  hypothetical protein CB1_001358002                    56.6    3e-06   Camelus ferus
ref|XP_002943822.2|  PREDICTED: TBC1 domain family member 25-like     56.2    3e-06   Xenopus tropicalis [western clawed frog]
ref|XP_006822429.1|  PREDICTED: TBC1 domain family member 15-like     55.8    3e-06   Saccoglossus kowalevskii
gb|KFO22672.1|  TBC1 domain family member 25                          56.2    4e-06   Fukomys damarensis [Damara mole rat]
ref|XP_010604738.1|  PREDICTED: TBC1 domain family member 25          56.2    4e-06   Fukomys damarensis [Damara mole rat]
ref|XP_006190481.1|  PREDICTED: TBC1 domain family member 25          55.5    5e-06   
gb|ETE62550.1|  TBC1 domain family member 25                          55.8    5e-06   Ophiophagus hannah
ref|XP_004396835.1|  PREDICTED: TBC1 domain family member 25 isof...  55.5    6e-06   
ref|XP_002594452.1|  hypothetical protein BRAFLDRAFT_72152            55.8    6e-06   Branchiostoma floridae
ref|XP_005887741.1|  PREDICTED: TBC1 domain family member 25 isof...  55.5    6e-06   Bos mutus
ref|XP_004672875.1|  PREDICTED: TBC1 domain family member 25 isof...  55.5    6e-06   Jaculus jaculus
gb|ERE63732.1|  TBC1 domain family member 25-like protein             55.5    6e-06   Cricetulus griseus [Chinese hamsters]
ref|XP_007081700.1|  PREDICTED: TBC1 domain family member 25          55.5    6e-06   
ref|XP_006527642.1|  PREDICTED: TBC1 domain family member 25 isof...  55.5    6e-06   
ref|XP_007435441.1|  PREDICTED: TBC1 domain family member 25          55.5    6e-06   Python bivittatus
ref|XP_006165094.1|  PREDICTED: TBC1 domain family member 25          55.5    6e-06   
ref|XP_005957025.1|  PREDICTED: TBC1 domain family member 25          55.5    6e-06   Pantholops hodgsonii [Tibetan antelope]
ref|XP_005411319.1|  PREDICTED: TBC1 domain family member 25 isof...  55.5    6e-06   Chinchilla lanigera
ref|XP_003276927.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  55.5    6e-06   
ref|XP_006097228.1|  PREDICTED: TBC1 domain family member 25 isof...  55.5    7e-06   
ref|XP_005411320.1|  PREDICTED: TBC1 domain family member 25 isof...  55.5    7e-06   
gb|EDL33960.1|  ornithine aminotransferase-like 1, isoform CRA_b      55.5    7e-06   Mus musculus [mouse]
gb|ELV12326.1|  TBC1 domain family member 25                          55.5    7e-06   Tupaia chinensis
ref|XP_005338702.1|  PREDICTED: TBC1 domain family member 25 isof...  55.5    7e-06   Ictidomys tridecemlineatus
ref|XP_004690059.1|  PREDICTED: TBC1 domain family member 25          55.5    7e-06   Condylura cristata
ref|XP_008156425.1|  PREDICTED: TBC1 domain family member 25 isof...  55.5    7e-06   
ref|XP_005085193.1|  PREDICTED: TBC1 domain family member 25 isof...  55.1    7e-06   
ref|XP_006903157.1|  PREDICTED: TBC1 domain family member 25-like     55.5    8e-06   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_008840756.1|  PREDICTED: TBC1 domain family member 25 isof...  55.1    8e-06   Nannospalax galili
ref|XP_636536.1|  RabGAP/TBC domain-containing protein                55.5    8e-06   Dictyostelium discoideum AX4
ref|XP_005657862.1|  PREDICTED: TBC1 domain family member 25          55.1    9e-06   
ref|XP_003807262.1|  PREDICTED: TBC1 domain family member 25 isof...  55.1    9e-06   Pan paniscus [bonobo]
ref|XP_010995179.1|  PREDICTED: TBC1 domain family member 25          55.1    9e-06   Camelus dromedarius [camel]
ref|NP_001192742.1|  TBC1 domain family member 25                     55.1    9e-06   Bos taurus [bovine]
dbj|BAC30751.1|  unnamed protein product                              55.1    9e-06   Mus musculus [mouse]
ref|XP_005887738.1|  PREDICTED: TBC1 domain family member 25 isof...  55.1    9e-06   Bos mutus
ref|XP_004612983.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  55.1    9e-06   
ref|XP_008840757.1|  PREDICTED: TBC1 domain family member 25 isof...  55.1    9e-06   
ref|XP_005700869.1|  PREDICTED: TBC1 domain family member 25          55.1    9e-06   
ref|XP_006045738.1|  PREDICTED: TBC1 domain family member 25          55.1    9e-06   Bubalus bubalis [domestic water buffalo]
ref|XP_005887739.1|  PREDICTED: TBC1 domain family member 25 isof...  55.1    9e-06   Bos mutus
gb|EDL33959.1|  ornithine aminotransferase-like 1, isoform CRA_a      55.1    1e-05   Mus musculus [mouse]
ref|XP_004022163.1|  PREDICTED: TBC1 domain family member 25          55.1    1e-05   Ovis aries [domestic sheep]
gb|ELR62308.1|  TBC1 domain family member 25                          55.1    1e-05   Bos mutus
ref|XP_007450933.1|  PREDICTED: TBC1 domain family member 25 isof...  55.1    1e-05   Lipotes vexillifer [baiji]
gb|AAI13778.1|  Tbc1d25 protein                                       55.1    1e-05   Mus musculus [mouse]
dbj|BAG57904.1|  unnamed protein product                              55.1    1e-05   Homo sapiens [man]
ref|XP_004465025.1|  PREDICTED: TBC1 domain family member 25          55.1    1e-05   Dasypus novemcinctus
ref|XP_008156426.1|  PREDICTED: TBC1 domain family member 25 isof...  55.1    1e-05   Eptesicus fuscus
ref|XP_007989784.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  55.1    1e-05   Chlorocebus sabaeus
ref|XP_007450934.1|  PREDICTED: TBC1 domain family member 25 isof...  55.1    1e-05   Lipotes vexillifer [baiji]
ref|XP_007115776.1|  PREDICTED: TBC1 domain family member 25          55.1    1e-05   Physeter catodon
ref|XP_010966423.1|  PREDICTED: TBC1 domain family member 25          55.1    1e-05   Camelus bactrianus [camel]
ref|XP_006213507.1|  PREDICTED: TBC1 domain family member 25          55.1    1e-05   Vicugna pacos
ref|XP_008156424.1|  PREDICTED: TBC1 domain family member 25 isof...  55.1    1e-05   
gb|AAI28566.1|  Tbc1d25 protein                                       55.1    1e-05   Mus musculus [mouse]
ref|XP_005887740.1|  PREDICTED: TBC1 domain family member 25 isof...  54.7    1e-05   Bos mutus
ref|XP_006097227.1|  PREDICTED: TBC1 domain family member 25 isof...  54.7    1e-05   Myotis lucifugus
ref|XP_007663252.1|  PREDICTED: TBC1 domain family member 25          54.7    1e-05   
ref|XP_011384546.1|  PREDICTED: TBC1 domain family member 25 isof...  54.7    1e-05   Pteropus vampyrus
ref|XP_003917718.1|  PREDICTED: TBC1 domain family member 25          54.7    1e-05   Papio anubis [baboon]
gb|AAA59593.1|  located at OATL1                                      54.7    1e-05   Homo sapiens [man]
ref|XP_006758967.1|  PREDICTED: TBC1 domain family member 25          54.7    1e-05   Myotis davidii
ref|XP_011384545.1|  PREDICTED: TBC1 domain family member 25 isof...  54.7    1e-05   Pteropus vampyrus
ref|XP_004316042.1|  PREDICTED: TBC1 domain family member 25          54.7    1e-05   
ref|XP_004282018.1|  PREDICTED: TBC1 domain family member 25          54.7    1e-05   Orcinus orca [Orca]
ref|XP_011384543.1|  PREDICTED: TBC1 domain family member 25 isof...  54.7    1e-05   Pteropus vampyrus
ref|XP_006922822.1|  PREDICTED: TBC1 domain family member 25          54.7    1e-05   Pteropus alecto
ref|XP_003939585.1|  PREDICTED: TBC1 domain family member 25          54.7    1e-05   Saimiri boliviensis boliviensis
ref|XP_005352876.1|  PREDICTED: TBC1 domain family member 25          54.7    1e-05   Microtus ochrogaster [prairie voles]
gb|EGW06113.1|  TBC1 domain family member 25                          54.7    1e-05   Cricetulus griseus [Chinese hamsters]
gb|EFB29245.1|  hypothetical protein PANDA_006183                     54.7    1e-05   Ailuropoda melanoleuca
ref|NP_001159909.1|  TBC1 domain family member 25 isoform 2           54.7    1e-05   Mus musculus [mouse]
ref|XP_006738425.1|  PREDICTED: TBC1 domain family member 25 isof...  54.7    1e-05   Leptonychotes weddellii
ref|XP_004672874.1|  PREDICTED: TBC1 domain family member 25 isof...  54.7    1e-05   Jaculus jaculus
ref|XP_002762882.1|  PREDICTED: TBC1 domain family member 25          54.7    1e-05   Callithrix jacchus [common marmoset]
ref|XP_005338701.1|  PREDICTED: TBC1 domain family member 25 isof...  54.7    1e-05   Ictidomys tridecemlineatus
ref|XP_005085191.1|  PREDICTED: TBC1 domain family member 25 isof...  54.7    1e-05   
ref|XP_010359402.1|  PREDICTED: TBC1 domain family member 25          54.7    1e-05   Rhinopithecus roxellana
ref|XP_009437315.1|  PREDICTED: TBC1 domain family member 25          54.7    1e-05   
gb|AAI01820.1|  TBC1 domain family, member 25                         54.7    1e-05   Homo sapiens [man]
gb|AAI01818.1|  TBC1 domain family, member 25                         54.7    1e-05   Homo sapiens [man]
ref|XP_003807261.1|  PREDICTED: TBC1 domain family member 25 isof...  54.7    1e-05   Pan paniscus [bonobo]
ref|XP_001493731.1|  PREDICTED: TBC1 domain family member 25 isof...  54.7    1e-05   Equus caballus [domestic horse]
ref|NP_002527.1|  TBC1 domain family member 25                        54.7    1e-05   Homo sapiens [man]
ref|XP_004672873.1|  PREDICTED: TBC1 domain family member 25 isof...  54.7    1e-05   Jaculus jaculus
gb|EAW50771.1|  ornithine aminotransferase-like 1, isoform CRA_c      54.7    1e-05   Homo sapiens [man]
ref|XP_005085192.1|  PREDICTED: TBC1 domain family member 25 isof...  54.7    1e-05   Mesocricetus auratus [Syrian golden hamster]
ref|XP_004396833.1|  PREDICTED: TBC1 domain family member 25 isof...  54.7    1e-05   
ref|XP_002917835.1|  PREDICTED: TBC1 domain family member 25          54.7    1e-05   Ailuropoda melanoleuca
ref|XP_005411318.1|  PREDICTED: TBC1 domain family member 25 isof...  54.7    1e-05   Chinchilla lanigera
ref|NP_766066.2|  TBC1 domain family member 25 isoform 1              54.7    1e-05   
ref|XP_007180359.1|  PREDICTED: TBC1 domain family member 25          54.7    1e-05   Balaenoptera acutorostrata scammoni
ref|XP_006738424.1|  PREDICTED: TBC1 domain family member 25 isof...  54.7    1e-05   Leptonychotes weddellii
gb|EAW50769.1|  ornithine aminotransferase-like 1, isoform CRA_a      54.7    1e-05   Homo sapiens [man]
ref|XP_006097226.1|  PREDICTED: TBC1 domain family member 25 isof...  54.7    1e-05   Myotis lucifugus
dbj|BAC37146.1|  unnamed protein product                              54.7    1e-05   Mus musculus [mouse]
ref|XP_007643831.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  54.7    1e-05   
ref|XP_005085190.1|  PREDICTED: TBC1 domain family member 25 isof...  54.7    1e-05   
ref|NP_001100425.1|  TBC1 domain family member 25                     54.7    1e-05   Rattus norvegicus [brown rat]
ref|XP_004894861.1|  PREDICTED: TBC1 domain family member 25          54.7    1e-05   
gb|EMP26956.1|  TBC1 domain family member 25                          54.7    1e-05   Chelonia mydas [green seaturtle]
ref|XP_004755075.1|  PREDICTED: TBC1 domain family member 25          54.7    1e-05   
ref|XP_004435019.1|  PREDICTED: TBC1 domain family member 25          54.7    1e-05   
ref|XP_004000530.1|  PREDICTED: TBC1 domain family member 25          54.7    1e-05   
ref|XP_006995132.1|  PREDICTED: TBC1 domain family member 25          54.7    1e-05   
ref|XP_006256763.1|  PREDICTED: TBC1 domain family member 25 isof...  54.3    1e-05   
ref|XP_008695843.1|  PREDICTED: TBC1 domain family member 25          54.3    1e-05   
ref|XP_005614171.1|  PREDICTED: TBC1 domain family member 25 isof...  54.3    1e-05   
ref|XP_004396834.1|  PREDICTED: TBC1 domain family member 25 isof...  54.3    1e-05   
gb|EHB09434.1|  TBC1 domain family member 25                          54.3    1e-05   
ref|XP_007069261.1|  PREDICTED: TBC1 domain family member 25          54.3    1e-05   
ref|XP_008327394.1|  PREDICTED: TBC1 domain family member 17          54.3    1e-05   
ref|XP_002406773.1|  rabGAP domain-containing protein, putative       54.3    1e-05   
ref|XP_548985.3|  PREDICTED: TBC1 domain family member 25 isoform X2  54.3    2e-05   
ref|XP_003462631.2|  PREDICTED: TBC1 domain family member 25          54.3    2e-05   
ref|XP_005641377.1|  PREDICTED: TBC1 domain family member 25 isof...  54.3    2e-05   
ref|XP_004871993.1|  PREDICTED: TBC1 domain family member 25          54.3    2e-05   
ref|XP_008569674.1|  PREDICTED: TBC1 domain family member 25          54.3    2e-05   
ref|XP_007529450.1|  PREDICTED: TBC1 domain family member 25          54.3    2e-05   
ref|XP_002190300.1|  PREDICTED: TBC1 domain family member 15          53.9    2e-05   
ref|XP_008175620.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  53.9    2e-05   
ref|XP_005242171.1|  PREDICTED: TBC1 domain family member 15          53.9    2e-05   
ref|XP_010112473.1|  hypothetical protein L484_008961                 53.9    2e-05   
ref|XP_010596065.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  53.9    2e-05   
ref|XP_002972350.1|  hypothetical protein SELMODRAFT_97576            53.5    3e-05   
ref|XP_006130897.1|  PREDICTED: TBC1 domain family member 25          53.5    3e-05   
gb|KFZ49120.1|  TBC1 domain family member 15                          53.5    3e-05   
ref|XP_006014957.1|  PREDICTED: TBC1 domain family member 17 isof...  53.5    3e-05   
ref|XP_007507734.1|  PREDICTED: TBC1 domain family member 25 isof...  53.5    3e-05   
ref|XP_006014956.1|  PREDICTED: TBC1 domain family member 17 isof...  53.1    3e-05   
ref|XP_008270799.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  53.1    4e-05   
ref|XP_004587950.1|  PREDICTED: TBC1 domain family member 25          53.1    4e-05   
ref|XP_003775215.1|  PREDICTED: TBC1 domain family member 25          53.1    4e-05   
ref|XP_006006266.1|  PREDICTED: TBC1 domain family member 25-like     53.1    4e-05   
gb|KFZ52722.1|  TBC1 domain family member 15                          52.8    4e-05   
emb|CAX73256.1|  TBC1 domain family member 15                         52.8    4e-05   
ref|XP_010176692.1|  PREDICTED: TBC1 domain family member 15          52.8    4e-05   
ref|XP_006876713.1|  PREDICTED: TBC1 domain family member 25          53.1    4e-05   
ref|XP_002971826.1|  hypothetical protein SELMODRAFT_96534            52.4    5e-05   
ref|XP_003799689.1|  PREDICTED: TBC1 domain family member 25          52.8    5e-05   
ref|XP_009863167.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  52.8    5e-05   
ref|XP_001846506.1|  TBC1 domain family                               52.8    5e-05   
ref|XP_009461518.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  52.8    5e-05   
ref|XP_004376932.1|  PREDICTED: TBC1 domain family member 25          52.8    5e-05   
ref|XP_010123979.1|  PREDICTED: TBC1 domain family member 15          52.8    5e-05   
gb|KGL95544.1|  TBC1 domain family member 15                          52.8    6e-05   
ref|XP_008047317.1|  PREDICTED: TBC1 domain family member 25          52.8    6e-05   
ref|XP_003292326.1|  hypothetical protein DICPUDRAFT_89768            52.8    6e-05   
ref|XP_007956093.1|  PREDICTED: TBC1 domain family member 25 isof...  52.8    6e-05   
ref|XP_004713230.1|  PREDICTED: TBC1 domain family member 25-like...  52.8    6e-05   
ref|XP_004713231.1|  PREDICTED: TBC1 domain family member 25-like...  52.8    6e-05   
ref|XP_007956094.1|  PREDICTED: TBC1 domain family member 25 isof...  52.8    6e-05   
ref|XP_009946918.1|  PREDICTED: TBC1 domain family member 15          52.8    6e-05   
gb|KFP37050.1|  TBC1 domain family member 15                          52.4    6e-05   
ref|XP_005024460.1|  PREDICTED: TBC1 domain family member 15          52.4    6e-05   
ref|XP_005805829.1|  PREDICTED: TBC1 domain family member 25-like     52.8    6e-05   
ref|XP_009975733.1|  PREDICTED: TBC1 domain family member 15          52.4    7e-05   
gb|EOA97812.1|  TBC1 domain family member 15                          52.4    7e-05   
ref|XP_010560088.1|  PREDICTED: TBC1 domain family member 15 isof...  52.4    7e-05   
ref|XP_004633581.1|  PREDICTED: TBC1 domain family member 25-like...  52.4    7e-05   
ref|XP_004633580.1|  PREDICTED: TBC1 domain family member 25-like...  52.4    7e-05   
ref|XP_005081528.1|  PREDICTED: TBC1 domain family member 15 isof...  52.4    7e-05   
ref|XP_010078295.1|  PREDICTED: TBC1 domain family member 15          52.4    7e-05   
ref|XP_005081527.1|  PREDICTED: TBC1 domain family member 15 isof...  52.4    7e-05   
gb|KFV12457.1|  TBC1 domain family member 15                          52.4    8e-05   
gb|KFV88938.1|  TBC1 domain family member 15                          52.4    8e-05   
ref|XP_009504749.1|  PREDICTED: TBC1 domain family member 15          52.4    8e-05   
ref|XP_009584974.1|  PREDICTED: TBC1 domain family member 15          52.4    8e-05   
gb|KFM03402.1|  TBC1 domain family member 15                          52.4    8e-05   
ref|XP_009644606.1|  PREDICTED: TBC1 domain family member 15          52.4    8e-05   
ref|XP_009271513.1|  PREDICTED: TBC1 domain family member 15          52.0    8e-05   
ref|XP_008925123.1|  PREDICTED: TBC1 domain family member 15          52.0    9e-05   
ref|NP_001121708.1|  TBC1 domain family member 25                     52.4    9e-05   
gb|KFP22081.1|  TBC1 domain family member 15                          52.0    9e-05   
ref|XP_009886127.1|  PREDICTED: TBC1 domain family member 15          52.0    9e-05   
ref|XP_008938492.1|  PREDICTED: TBC1 domain family member 21          52.0    9e-05   
gb|KFQ18609.1|  TBC1 domain family member 15                          52.0    9e-05   
gb|KFW83412.1|  TBC1 domain family member 15                          52.0    1e-04   
ref|XP_003962955.1|  PREDICTED: TBC1 domain family member 25-like     52.0    1e-04   
gb|KFP24887.1|  TBC1 domain family member 15                          52.0    1e-04   
ref|XP_007231968.1|  PREDICTED: TBC1 domain family member 25-like...  52.0    1e-04   
gb|KFP53694.1|  TBC1 domain family member 15                          52.0    1e-04   
ref|XP_007231967.1|  PREDICTED: TBC1 domain family member 25-like...  52.0    1e-04   
ref|XP_010196615.1|  PREDICTED: TBC1 domain family member 15          51.6    1e-04   
ref|XP_009085252.1|  PREDICTED: TBC1 domain family member 15          51.6    1e-04   
ref|XP_005480662.1|  PREDICTED: TBC1 domain family member 15          51.6    1e-04   
ref|XP_006274452.1|  PREDICTED: TBC1 domain family member 17          51.6    1e-04   
ref|XP_005991037.1|  PREDICTED: TBC1 domain family member 17          51.6    1e-04   
ref|XP_001656551.2|  AAEL013250-PA                                    51.6    1e-04   
ref|XP_005143065.1|  PREDICTED: TBC1 domain family member 15          51.6    1e-04   
gb|ENN71042.1|  hypothetical protein YQE_12253                        51.6    1e-04   
gb|ERL84119.1|  hypothetical protein D910_01465                       51.2    1e-04   
ref|XP_011471287.1|  PREDICTED: TBC1 domain family member 25          51.2    2e-04   
emb|CAF91261.1|  unnamed protein product                              51.2    2e-04   
ref|XP_008292633.1|  PREDICTED: TBC1 domain family member 25          51.2    2e-04   
gb|ERE88321.1|  TBC1 domain family member 15-like protein             51.2    2e-04   
ref|XP_008316763.1|  PREDICTED: TBC1 domain family member 25 isof...  51.2    2e-04   
ref|XP_008480502.1|  PREDICTED: uncharacterized protein LOC103517258  51.2    2e-04   
ref|XP_008316762.1|  PREDICTED: TBC1 domain family member 25 isof...  51.2    2e-04   
ref|XP_007575527.1|  PREDICTED: TBC1 domain family member 25          51.2    2e-04   
ref|XP_005943530.1|  PREDICTED: TBC1 domain family member 25-like     51.2    2e-04   
ref|XP_006804369.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  51.2    2e-04   
ref|XP_008411223.1|  PREDICTED: TBC1 domain family member 25          51.2    2e-04   
ref|XP_004570967.1|  PREDICTED: TBC1 domain family member 25-like     51.2    2e-04   
ref|XP_007638185.1|  PREDICTED: TBC1 domain family member 15 isof...  51.2    2e-04   
ref|XP_345826.3|  PREDICTED: TBC1 domain family member 15 isoform X2  51.2    2e-04   
ref|XP_010412149.1|  PREDICTED: TBC1 domain family member 15          51.2    2e-04   
ref|XP_003454299.2|  PREDICTED: TBC1 domain family member 25-like     51.2    2e-04   
ref|XP_005039952.1|  PREDICTED: TBC1 domain family member 15          51.2    2e-04   
ref|XP_010223867.1|  PREDICTED: TBC1 domain family member 15          51.2    2e-04   
ref|XP_006226083.1|  PREDICTED: TBC1 domain family member 15 isof...  50.8    2e-04   
ref|XP_005358112.1|  PREDICTED: TBC1 domain family member 15 isof...  50.8    2e-04   
gb|EFA85722.1|  RabGAP/TBC domain-containing protein                  50.8    2e-04   
gb|KGL84754.1|  TBC1 domain family member 15                          50.8    2e-04   
gb|KFP76577.1|  TBC1 domain family member 15                          50.8    2e-04   
ref|XP_005358111.1|  PREDICTED: TBC1 domain family member 15 isof...  50.8    2e-04   
ref|XP_007441051.1|  PREDICTED: TBC1 domain family member 15          50.8    2e-04   
ref|XP_009962025.1|  PREDICTED: TBC1 domain family member 15          50.8    2e-04   
ref|XP_009069186.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  50.8    3e-04   
gb|KFV47134.1|  TBC1 domain family member 15                          50.4    3e-04   
ref|XP_010751023.1|  PREDICTED: TBC1 domain family member 25          50.4    3e-04   
gb|KFO58466.1|  TBC1 domain family member 15                          50.4    3e-04   
ref|XP_008631121.1|  PREDICTED: TBC1 domain family member 15          50.4    3e-04   
emb|CDQ77680.1|  unnamed protein product                              50.4    3e-04   
ref|XP_006607177.1|  PREDICTED: TBC1 domain family member 25-like     50.4    3e-04   
gb|KFO87733.1|  TBC1 domain family member 15                          50.4    3e-04   
ref|XP_003695526.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  50.4    3e-04   
ref|XP_003251750.1|  PREDICTED: TBC1 domain family member 25 isof...  50.4    3e-04   
ref|XP_006571559.1|  PREDICTED: TBC1 domain family member 25 isof...  50.4    3e-04   
ref|XP_010131193.1|  PREDICTED: TBC1 domain family member 15          50.4    3e-04   
ref|XP_009325940.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  50.4    3e-04   
ref|XP_003489838.1|  PREDICTED: TBC1 domain family member 25-like     50.4    3e-04   
ref|XP_004602734.1|  PREDICTED: TBC1 domain family member 15 isof...  50.4    4e-04   
ref|XP_010767247.1|  PREDICTED: TBC1 domain family member 25-like     50.1    4e-04   
ref|XP_003706422.1|  PREDICTED: TBC1 domain family member 25-like     50.4    4e-04   
gb|ETN60785.1|  TBC1 domain family                                    50.4    4e-04   
ref|XP_005431957.1|  PREDICTED: TBC1 domain family member 15          50.1    4e-04   
ref|XP_004602733.1|  PREDICTED: TBC1 domain family member 15 isof...  50.1    4e-04   
ref|XP_010873951.1|  PREDICTED: TBC1 domain family member 25          50.1    4e-04   
ref|XP_005305159.1|  PREDICTED: TBC1 domain family member 15 isof...  50.1    4e-04   
ref|XP_008294681.1|  PREDICTED: TBC1 domain family member 17 isof...  50.1    4e-04   
ref|XP_005305158.1|  PREDICTED: TBC1 domain family member 15 isof...  50.1    5e-04   
ref|XP_006989060.1|  PREDICTED: TBC1 domain family member 15          50.1    5e-04   
ref|XP_624756.3|  PREDICTED: TBC1 domain family member 15             49.7    5e-04   
ref|XP_003689942.1|  PREDICTED: TBC1 domain family member 15-like     49.7    5e-04   
ref|XP_010872405.1|  PREDICTED: TBC1 domain family member 17          49.7    5e-04   
ref|XP_007054875.1|  PREDICTED: TBC1 domain family member 15          50.1    5e-04   
ref|XP_011333751.1|  PREDICTED: TBC1 domain family member 25          49.7    5e-04   
ref|XP_010159724.1|  PREDICTED: TBC1 domain family member 15-like     49.7    6e-04   
gb|KFV99684.1|  TBC1 domain family member 15                          49.7    6e-04   
ref|XP_004071273.1|  PREDICTED: TBC1 domain family member 17          49.7    6e-04   
ref|XP_009484857.1|  PREDICTED: TBC1 domain family member 15          49.7    6e-04   
ref|XP_008153766.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  49.7    6e-04   
ref|XP_004930958.1|  PREDICTED: uncharacterized protein LOC101737598  49.7    6e-04   
ref|XP_008498865.1|  PREDICTED: TBC1 domain family member 15          49.3    6e-04   
ref|NP_001072902.1|  TBC1 domain family, member 17                    49.7    7e-04   
ref|XP_005305160.1|  PREDICTED: TBC1 domain family member 15 isof...  49.3    7e-04   
gb|KFP06138.1|  TBC1 domain family member 15                          49.3    7e-04   
ref|XP_005469062.1|  PREDICTED: TBC1 domain family member 17          49.3    7e-04   
gb|KFQ85381.1|  TBC1 domain family member 15                          49.3    7e-04   
ref|XP_004361055.1|  RabGAP/TBC domain-containing protein             49.3    8e-04   
ref|XP_010753848.1|  PREDICTED: TBC1 domain family member 17          49.3    8e-04   
ref|XP_008294680.1|  PREDICTED: TBC1 domain family member 17 isof...  49.3    8e-04   
ref|XP_007950655.1|  PREDICTED: TBC1 domain family member 15 isof...  49.3    8e-04   
ref|XP_005519422.1|  PREDICTED: TBC1 domain family member 15          49.3    8e-04   
gb|EPQ18866.1|  TBC1 domain family member 15                          49.3    8e-04   
ref|XP_007950654.1|  PREDICTED: TBC1 domain family member 15 isof...  49.3    9e-04   
ref|XP_785291.3|  PREDICTED: TBC1 domain family member 25-like        49.3    9e-04   
emb|CDQ86691.1|  unnamed protein product                              49.3    9e-04   
ref|XP_005884185.1|  PREDICTED: TBC1 domain family member 15 isof...  49.3    9e-04   
ref|XP_005884184.1|  PREDICTED: TBC1 domain family member 15 isof...  49.3    0.001   
ref|XP_004632275.1|  PREDICTED: TBC1 domain family member 15          48.9    0.001   
gb|KFR06581.1|  TBC1 domain family member 15                          48.9    0.001   
ref|XP_009929915.1|  PREDICTED: TBC1 domain family member 15          48.9    0.001   
ref|XP_010706484.1|  PREDICTED: TBC1 domain family member 15          48.9    0.001   
ref|XP_003798993.1|  PREDICTED: TBC1 domain family member 15 isof...  48.9    0.001   
ref|XP_006095517.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  48.9    0.001   
ref|XP_006146258.1|  PREDICTED: TBC1 domain family member 15 isof...  48.9    0.001   
ref|XP_006759815.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  48.9    0.001   
ref|XP_001627200.1|  predicted protein                                48.5    0.001   



>gb|KDP30256.1| hypothetical protein JCGZ_17038 [Jatropha curcas]
Length=687

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 66/78 (85%), Gaps = 2/78 (3%)
 Frame = +3

Query  354  RKHDHDEEPATKVQP--LINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQAL  527
            RKH+H EE AT V P  LIN+ +FD ++LVWGKPRQP +G +EWATFLDSEGRVM+ +AL
Sbjct  319  RKHEHGEEAATNVGPFQLINFKEFDKLTLVWGKPRQPPLGSEEWATFLDSEGRVMDSKAL  378

Query  528  RKRIFYGGLENSLRKXVW  581
            RKRIFYGG+E++LR+ VW
Sbjct  379  RKRIFYGGVEHTLRREVW  396



>ref|XP_007013520.1| RabGAP/TBC domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY31139.1| RabGAP/TBC domain-containing protein isoform 1 [Theobroma cacao]
Length=743

 Score =   118 bits (295),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 68/82 (83%), Gaps = 2/82 (2%)
 Frame = +3

Query  342  KSSFRKHDHDEEPATKVQP--LINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMN  515
            K+ +RKH+HD+E AT V    LI++ +FD +SLVWGKPRQP +G +EWATFLDSEGRV++
Sbjct  334  KAPYRKHNHDDEAATNVGTFELIDFKEFDKLSLVWGKPRQPPLGLEEWATFLDSEGRVVD  393

Query  516  PQALRKRIFYGGLENSLRKXVW  581
             +ALRKRIFYGG+E+ LR+ VW
Sbjct  394  SKALRKRIFYGGIEHKLRREVW  415


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAAS QQGSASM R +  K S+S++ +   I  L D V ++P Q+AS+ I
Sbjct  5    ELHDLSDDADYAASQQQGSASMMRCDRGKRSSSSEPEGAEIVYLKDNVTIHPTQFASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +L+ I QG  + 
Sbjct  65   SGRLKLIKQGSSLF  78



>gb|KJB27075.1| hypothetical protein B456_004G276400 [Gossypium raimondii]
Length=544

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 65/84 (77%), Gaps = 2/84 (2%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQP--LINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRV  509
            + K  +R+H+ D E AT V    LINY +FD +SLVWGKPRQP +G +EW TFLDSEGRV
Sbjct  311  VEKVPYREHNRDGEAATNVGTFELINYKEFDKLSLVWGKPRQPPLGLEEWVTFLDSEGRV  370

Query  510  MNPQALRKRIFYGGLENSLRKXVW  581
            ++ +ALRKRIFYGG+E+ LRK VW
Sbjct  371  VDSKALRKRIFYGGIEHKLRKEVW  394


 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            ML  E+ D SD+  YAAS Q+GSASM R    K STS++++   I  L D VA++P QYA
Sbjct  1    MLEAELHDLSDDADYAASQQEGSASMMRCYSSKLSTSSETEGAEIVYLKDNVAIHPTQYA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  + 
Sbjct  61   SERISGRLKLIKQGSTLF  78



>emb|CDP10442.1| unnamed protein product [Coffea canephora]
Length=692

 Score =   114 bits (286),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 66/84 (79%), Gaps = 2/84 (2%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQ--PLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRV  509
            L K+S R  + DEE AT V    L+N  + D +SLVWGKPRQP +GP+EWATFLDSEGRV
Sbjct  313  LEKTSHRNENRDEEAATNVGVFELVNCKELDKLSLVWGKPRQPPLGPEEWATFLDSEGRV  372

Query  510  MNPQALRKRIFYGGLENSLRKXVW  581
            M+ +AL+KRIFYGG+E+SLRK +W
Sbjct  373  MDEKALKKRIFYGGVEHSLRKELW  396


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   E+ D SD+  YAAS+QQGS+S  RS+  + S+S ++D   I  L D V ++P Q+A
Sbjct  1    MHETEVNDLSDDADYAASMQQGSSSFARSDSGRRSSSGETDGAEIVYLKDNVTIHPTQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I  +L+ I QG  + 
Sbjct  61   SERIRGRLKLIKQGTALF  78



>gb|KJB27076.1| hypothetical protein B456_004G276400 [Gossypium raimondii]
Length=626

 Score =   114 bits (285),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 65/84 (77%), Gaps = 2/84 (2%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQP--LINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRV  509
            + K  +R+H+ D E AT V    LINY +FD +SLVWGKPRQP +G +EW TFLDSEGRV
Sbjct  311  VEKVPYREHNRDGEAATNVGTFELINYKEFDKLSLVWGKPRQPPLGLEEWVTFLDSEGRV  370

Query  510  MNPQALRKRIFYGGLENSLRKXVW  581
            ++ +ALRKRIFYGG+E+ LRK VW
Sbjct  371  VDSKALRKRIFYGGIEHKLRKEVW  394


 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            ML  E+ D SD+  YAAS Q+GSASM R    K STS++++   I  L D VA++P QYA
Sbjct  1    MLEAELHDLSDDADYAASQQEGSASMMRCYSSKLSTSSETEGAEIVYLKDNVAIHPTQYA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  + 
Sbjct  61   SERISGRLKLIKQGSTLF  78



>ref|XP_010656459.1| PREDICTED: TBC1 domain family member 17 isoform X2 [Vitis vinifera]
 emb|CBI28236.3| unnamed protein product [Vitis vinifera]
Length=684

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 65/84 (77%), Gaps = 2/84 (2%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQP--LINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRV  509
            L K+  RK  HDEE  T V    LI+  +FD ++LVWGKPRQP +G +EWATFLDSEGR+
Sbjct  312  LEKTRCRKQYHDEEAVTNVGTFELIDCKEFDKLALVWGKPRQPPLGSEEWATFLDSEGRI  371

Query  510  MNPQALRKRIFYGGLENSLRKXVW  581
            M+ +ALRKRIFYGG+E+SLRK VW
Sbjct  372  MDSKALRKRIFYGGIEHSLRKEVW  395



>gb|KJB27077.1| hypothetical protein B456_004G276400 [Gossypium raimondii]
Length=639

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 65/84 (77%), Gaps = 2/84 (2%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQP--LINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRV  509
            + K  +R+H+ D E AT V    LINY +FD +SLVWGKPRQP +G +EW TFLDSEGRV
Sbjct  267  VEKVPYREHNRDGEAATNVGTFELINYKEFDKLSLVWGKPRQPPLGLEEWVTFLDSEGRV  326

Query  510  MNPQALRKRIFYGGLENSLRKXVW  581
            ++ +ALRKRIFYGG+E+ LRK VW
Sbjct  327  VDSKALRKRIFYGGIEHKLRKEVW  350


 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            ML  E+ D SD+  YAAS Q+GSASM R    K STS++++   I  L D VA++P QYA
Sbjct  1    MLEAELHDLSDDADYAASQQEGSASMMRCYSSKLSTSSETEGAEIVYLKDNVAIHPTQYA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  + 
Sbjct  61   SERISGRLKLIKQGSTLF  78



>gb|KJB27079.1| hypothetical protein B456_004G276400 [Gossypium raimondii]
Length=683

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 65/84 (77%), Gaps = 2/84 (2%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQP--LINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRV  509
            + K  +R+H+ D E AT V    LINY +FD +SLVWGKPRQP +G +EW TFLDSEGRV
Sbjct  311  VEKVPYREHNRDGEAATNVGTFELINYKEFDKLSLVWGKPRQPPLGLEEWVTFLDSEGRV  370

Query  510  MNPQALRKRIFYGGLENSLRKXVW  581
            ++ +ALRKRIFYGG+E+ LRK VW
Sbjct  371  VDSKALRKRIFYGGIEHKLRKEVW  394


 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            ML  E+ D SD+  YAAS Q+GSASM R    K STS++++   I  L D VA++P QYA
Sbjct  1    MLEAELHDLSDDADYAASQQEGSASMMRCYSSKLSTSSETEGAEIVYLKDNVAIHPTQYA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  + 
Sbjct  61   SERISGRLKLIKQGSTLF  78



>gb|KHG01737.1| TBC1 domain family member 15 [Gossypium arboreum]
Length=683

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 66/84 (79%), Gaps = 2/84 (2%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQP--LINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRV  509
            + K  +R+H+ D E AT V    LI+Y +FD +SLVWGKPRQP +G +EWATFLDSEGRV
Sbjct  311  VEKVPYREHNRDGEAATNVGTFELISYKEFDKLSLVWGKPRQPPLGLEEWATFLDSEGRV  370

Query  510  MNPQALRKRIFYGGLENSLRKXVW  581
            ++ +ALRKRIFYGG+E+ LRK VW
Sbjct  371  VDSKALRKRIFYGGIEHKLRKEVW  394


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   E+ D SD+  YAAS Q+GSASM R +  K STS++++   I  L D VA++P QYA
Sbjct  1    MQEAELHDLSDDADYAASQQEGSASMMRCDSSKLSTSSETEGAEIVYLKDNVAIHPTQYA  60

Query  285  SDWINNQLRQINQGKPIL  338
             + I+ +L+ I QG  + 
Sbjct  61   FERISGRLKLIKQGSALF  78



>ref|XP_010241555.1| PREDICTED: TBC1 domain family member 17 isoform X2 [Nelumbo nucifera]
Length=700

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 65/85 (76%), Gaps = 2/85 (2%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQP--LINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRV  509
            L K   +K +H EE ATKV    L+N  +FD ++LVWGKPRQP +GP+EW TFLDSEGRV
Sbjct  328  LEKIPCKKQNHGEEAATKVGTFELVNCKEFDKLALVWGKPRQPPLGPEEWTTFLDSEGRV  387

Query  510  MNPQALRKRIFYGGLENSLRKXVWK  584
            M+ +AL+KRIFYGG+E+ LR  +WK
Sbjct  388  MDSKALKKRIFYGGIEHELRNEIWK  412


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 46/83 (55%), Gaps = 0/83 (0%)
 Frame = +3

Query  90   ADPEAMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVN  269
            ++   M   E  D SD+  YAAS QQGS S++++     +  N++D   +    D V ++
Sbjct  2    SESSTMQEGESHDLSDDADYAASQQQGSTSISQNGSGGRTVMNEADRAQVVYQKDNVTIH  61

Query  270  PMQYASDWINNQLRQINQGKPIL  338
            P QYAS+ I+ +LR I QG  + 
Sbjct  62   PTQYASERISGRLRLIKQGSSLF  84



>ref|XP_010656458.1| PREDICTED: GTPase-activating protein GYP7 isoform X1 [Vitis vinifera]
Length=696

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 64/82 (78%), Gaps = 2/82 (2%)
 Frame = +3

Query  342  KSSFRKHDHDEEPATKVQP--LINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMN  515
            K+  RK  HDEE  T V    LI+  +FD ++LVWGKPRQP +G +EWATFLDSEGR+M+
Sbjct  326  KTRCRKQYHDEEAVTNVGTFELIDCKEFDKLALVWGKPRQPPLGSEEWATFLDSEGRIMD  385

Query  516  PQALRKRIFYGGLENSLRKXVW  581
             +ALRKRIFYGG+E+SLRK VW
Sbjct  386  SKALRKRIFYGGIEHSLRKEVW  407



>ref|XP_010241554.1| PREDICTED: TBC1 domain family member 17 isoform X1 [Nelumbo nucifera]
Length=707

 Score =   112 bits (281),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 63/79 (80%), Gaps = 2/79 (3%)
 Frame = +3

Query  354  RKHDHDEEPATKVQP--LINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQAL  527
            +K +H EE ATKV    L+N  +FD ++LVWGKPRQP +GP+EW TFLDSEGRVM+ +AL
Sbjct  341  KKQNHGEEAATKVGTFELVNCKEFDKLALVWGKPRQPPLGPEEWTTFLDSEGRVMDSKAL  400

Query  528  RKRIFYGGLENSLRKXVWK  584
            +KRIFYGG+E+ LR  +WK
Sbjct  401  KKRIFYGGIEHELRNEIWK  419


 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 46/83 (55%), Gaps = 0/83 (0%)
 Frame = +3

Query  90   ADPEAMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVN  269
            ++   M   E  D SD+  YAAS QQGS S++++     +  N++D   +    D V ++
Sbjct  2    SESSTMQEGESHDLSDDADYAASQQQGSTSISQNGSGGRTVMNEADRAQVVYQKDNVTIH  61

Query  270  PMQYASDWINNQLRQINQGKPIL  338
            P QYAS+ I+ +LR I QG  + 
Sbjct  62   PTQYASERISGRLRLIKQGSSLF  84



>ref|XP_010112474.1| TBC1 domain family member 15 [Morus notabilis]
 gb|EXC33718.1| TBC1 domain family member 15 [Morus notabilis]
Length=517

 Score =   110 bits (275),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 67/99 (68%), Gaps = 2/99 (2%)
 Frame = +3

Query  291  WINNQLRQINQGKPILTKSSFRKHDHDEEPATKVQ--PLINYNKFDNVSLVWGKPRQPSM  464
            +   +L+        L K S  KH+  EE AT V    LIN  +FD ++LVWGKPRQP +
Sbjct  55   YFRQELKHWELVSYTLPKFSCMKHNIGEEAATGVGNFELINLEEFDKLALVWGKPRQPPL  114

Query  465  GPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            GP+EW T LDSEGRV +P+ALRKRIFYGG+E+ LRK VW
Sbjct  115  GPEEWVTLLDSEGRVTDPEALRKRIFYGGVEHILRKEVW  153



>gb|KDO80156.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=685

 Score =   109 bits (272),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 63/84 (75%), Gaps = 2/84 (2%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQP--LINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRV  509
            + K S RKH HDEE  T V    LI+  +FD ++LVWGKPRQP +G +EW TFLD+EGRV
Sbjct  312  VEKISSRKHIHDEEAVTNVGTFELIDCKEFDKLTLVWGKPRQPPLGSEEWTTFLDNEGRV  371

Query  510  MNPQALRKRIFYGGLENSLRKXVW  581
            M+  ALRKRIFYGG+++ LR+ VW
Sbjct  372  MDSNALRKRIFYGGVDHKLRREVW  395



>ref|XP_009593351.1| PREDICTED: TBC1 domain family member 15 isoform X3 [Nicotiana 
tomentosiformis]
Length=563

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 62/83 (75%), Gaps = 4/83 (5%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMN  515
            L K S  KH H+EE A + +      ++D +SLVWGKPRQP +G +EW+TFLDSEGR+++
Sbjct  195  LEKRSSEKHSHNEEAALRDETF----EYDKLSLVWGKPRQPPLGSKEWSTFLDSEGRIID  250

Query  516  PQALRKRIFYGGLENSLRKXVWK  584
             QALRKRIFYGG+E  LRK VW+
Sbjct  251  SQALRKRIFYGGVEKGLRKEVWR  273



>ref|XP_009593350.1| PREDICTED: TBC1 domain family member 17 isoform X2 [Nicotiana 
tomentosiformis]
Length=626

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 62/83 (75%), Gaps = 4/83 (5%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMN  515
            L K S  KH H+EE A + +      ++D +SLVWGKPRQP +G +EW+TFLDSEGR+++
Sbjct  308  LEKRSSEKHSHNEEAALRDETF----EYDKLSLVWGKPRQPPLGSKEWSTFLDSEGRIID  363

Query  516  PQALRKRIFYGGLENSLRKXVWK  584
             QALRKRIFYGG+E  LRK VW+
Sbjct  364  SQALRKRIFYGGVEKGLRKEVWR  386



>ref|XP_009789610.1| PREDICTED: TBC1 domain family member 15-like isoform X3 [Nicotiana 
sylvestris]
Length=563

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 62/83 (75%), Gaps = 4/83 (5%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMN  515
            L K S  KH H+EE A + +      ++D +SLVWGKPRQP +G +EW+TFLDSEGR+++
Sbjct  195  LEKRSNEKHSHNEEAALRDETF----EYDKLSLVWGKPRQPPLGSKEWSTFLDSEGRIID  250

Query  516  PQALRKRIFYGGLENSLRKXVWK  584
             QALRKRIFYGG+E  LRK VW+
Sbjct  251  SQALRKRIFYGGVEKGLRKEVWR  273



>ref|XP_009789609.1| PREDICTED: TBC1 domain family member 17-like isoform X2 [Nicotiana 
sylvestris]
Length=626

 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 62/83 (75%), Gaps = 4/83 (5%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMN  515
            L K S  KH H+EE A + +      ++D +SLVWGKPRQP +G +EW+TFLDSEGR+++
Sbjct  308  LEKRSNEKHSHNEEAALRDETF----EYDKLSLVWGKPRQPPLGSKEWSTFLDSEGRIID  363

Query  516  PQALRKRIFYGGLENSLRKXVWK  584
             QALRKRIFYGG+E  LRK VW+
Sbjct  364  SQALRKRIFYGGVEKGLRKEVWR  386


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            ++ D SD+  YAAS+ QGS SMT S   K S+S++   V I  L D VA++P Q+A + I
Sbjct  5    DLHDLSDDADYAASMHQGSTSMTTSGGSKPSSSSEQVGVEIVYLKDNVAIHPTQHAWERI  64

Query  297  NNQLRQINQGKPIL  338
              +L+ I QG  +L
Sbjct  65   RGRLKLIKQGSSLL  78



>ref|XP_009593349.1| PREDICTED: TBC1 domain family member 17 isoform X1 [Nicotiana 
tomentosiformis]
Length=676

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 62/83 (75%), Gaps = 4/83 (5%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMN  515
            L K S  KH H+EE A + +      ++D +SLVWGKPRQP +G +EW+TFLDSEGR+++
Sbjct  308  LEKRSSEKHSHNEEAALRDETF----EYDKLSLVWGKPRQPPLGSKEWSTFLDSEGRIID  363

Query  516  PQALRKRIFYGGLENSLRKXVWK  584
             QALRKRIFYGG+E  LRK VW+
Sbjct  364  SQALRKRIFYGGVEKGLRKEVWR  386



>ref|XP_009789608.1| PREDICTED: TBC1 domain family member 17-like isoform X1 [Nicotiana 
sylvestris]
Length=676

 Score =   106 bits (264),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 62/83 (75%), Gaps = 4/83 (5%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMN  515
            L K S  KH H+EE A + +      ++D +SLVWGKPRQP +G +EW+TFLDSEGR+++
Sbjct  308  LEKRSNEKHSHNEEAALRDETF----EYDKLSLVWGKPRQPPLGSKEWSTFLDSEGRIID  363

Query  516  PQALRKRIFYGGLENSLRKXVWK  584
             QALRKRIFYGG+E  LRK VW+
Sbjct  364  SQALRKRIFYGGVEKGLRKEVWR  386


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            ++ D SD+  YAAS+ QGS SMT S   K S+S++   V I  L D VA++P Q+A + I
Sbjct  5    DLHDLSDDADYAASMHQGSTSMTTSGGSKPSSSSEQVGVEIVYLKDNVAIHPTQHAWERI  64

Query  297  NNQLRQINQGKPIL  338
              +L+ I QG  +L
Sbjct  65   RGRLKLIKQGSSLL  78



>ref|XP_010323291.1| PREDICTED: GTPase-activating protein gyp7 [Solanum lycopersicum]
Length=678

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = +3

Query  342  KSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQ  521
            +SS  KH+ +EE A + + L  Y+ +D +SLVWGKPRQP +G +EW+TFLDSEGR+++ Q
Sbjct  310  ESSCEKHNKNEEAAMRDENL-EYD-YDKLSLVWGKPRQPPLGSEEWSTFLDSEGRIVDSQ  367

Query  522  ALRKRIFYGGLENSLRKXVWK  584
            ALRKRIFYGG+E  LRK VW+
Sbjct  368  ALRKRIFYGGVEKGLRKEVWR  388



>gb|AIU48660.1| RabGAP/TBC domain-containing protein, partial [Chloranthus japonicus]
Length=627

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 69/101 (68%), Gaps = 6/101 (6%)
 Frame = +3

Query  285  SDWINNQLRQINQGKPILTKSSFRKHD-HDEEPATKVQPLINYNKFDNVSLVWGKPRQPS  461
            SD+   Q +   Q  P+ T +S       DE PAT   P+    +FD ++LVWGKPRQP 
Sbjct  250  SDFSAYQGKHQIQSDPVCTGNSNDSQKVSDEIPATS-DPV----EFDKLTLVWGKPRQPP  304

Query  462  MGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            MG +EWATFLD+EGR+M+ + LRKRIFYGG+E+SLRK VWK
Sbjct  305  MGFEEWATFLDAEGRIMDSKGLRKRIFYGGVEHSLRKEVWK  345



>ref|XP_006358298.1| PREDICTED: GTPase-activating protein gyp7-like [Solanum tuberosum]
Length=678

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 63/81 (78%), Gaps = 2/81 (2%)
 Frame = +3

Query  342  KSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQ  521
            +SS   H+ +EE A + + L  Y+ +D +SLVWGKPRQP +G +EW+TFLDSEGRV++ Q
Sbjct  310  ESSCEIHNKNEEAAMRDESL-EYD-YDKLSLVWGKPRQPPLGSKEWSTFLDSEGRVIDSQ  367

Query  522  ALRKRIFYGGLENSLRKXVWK  584
            ALRKRIFYGG+E  LRK VW+
Sbjct  368  ALRKRIFYGGVEKGLRKEVWR  388



>gb|AIU48649.1| RabGAP/TBC domain-containing protein, partial [Sarcandra glabra]
Length=355

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 59/72 (82%), Gaps = 5/72 (7%)
 Frame = +3

Query  369  DEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYG  548
            DE PAT   P+    +FD ++LVWGKPRQP +G +EW+TFLD+EGR+M+ +ALRKRIFYG
Sbjct  7    DEIPATS-DPV----EFDKLTLVWGKPRQPPLGFEEWSTFLDAEGRIMDSKALRKRIFYG  61

Query  549  GLENSLRKXVWK  584
            G+E++LRK VWK
Sbjct  62   GVEHNLRKEVWK  73



>gb|AIU48684.1| RabGAP/TBC domain-containing protein, partial [Cinnamomum camphora]
Length=561

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            +FD +SLVWGKPRQP +G +EWATFLD+EGR+M+ +ALRKRIFYGG+E+SLRK VWK
Sbjct  223  EFDKLSLVWGKPRQPPLGFEEWATFLDAEGRIMDSKALRKRIFYGGVEHSLRKEVWK  279



>gb|AIU48651.1| RabGAP/TBC domain-containing protein, partial [Gossypium raimondii]
Length=624

 Score =   100 bits (249),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 62/91 (68%), Gaps = 4/91 (4%)
 Frame = +3

Query  309  RQINQGKPILTKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATF  488
            R  NQ     +KSS  K D   +      PL    +FD +SLVWGKPRQP +G +EWATF
Sbjct  255  RNSNQSALDYSKSSEYKEDVPVQSPVDPDPL----EFDKLSLVWGKPRQPPLGLEEWATF  310

Query  489  LDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            LDSEGRV++P+ALRKRIFYGG+E+  RK VW
Sbjct  311  LDSEGRVVDPKALRKRIFYGGVEHKFRKEVW  341



>ref|XP_011084120.1| PREDICTED: TBC1 domain family member 15 [Sesamum indicum]
Length=654

 Score =   100 bits (249),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD +SLVWGKPRQP +G +EWATF+D+EGRVM+P+ALRKRIFYGG+E++LRK VW
Sbjct  309  EFDKLSLVWGKPRQPPLGKEEWATFMDAEGRVMDPKALRKRIFYGGVEHNLRKEVW  364


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAASIQQGSASMTRS+ R+ S++++ +   +    + VA++P QYAS+ I
Sbjct  5    ELHDLSDDADYAASIQQGSASMTRSDSRRLSSTSEPEGAEVVYSKENVAIHPTQYASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +L+ I QG  + 
Sbjct  65   SGRLKLIKQGNSLF  78



>gb|AIU48685.1| RabGAP/TBC domain-containing protein, partial [Platanus x acerifolia]
Length=387

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 55/67 (82%), Gaps = 2/67 (3%)
 Frame = +3

Query  390  VQPLINYN--KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            V+PL+  +  +FD ++LVWGKPRQP +G +EWA FLDSEGR+M+ +ALRKRIFYGG+E+ 
Sbjct  147  VEPLVAADPPEFDKLTLVWGKPRQPPLGSEEWAAFLDSEGRIMDSKALRKRIFYGGVEHC  206

Query  564  LRKXVWK  584
            LR  VWK
Sbjct  207  LRNEVWK  213



>gb|KJB64720.1| hypothetical protein B456_010G061900 [Gossypium raimondii]
Length=527

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD +SLVWGKPRQP +G +EWATFLDSEGRV++P+ALRKRIFYGG+E+  RK VW
Sbjct  308  EFDKLSLVWGKPRQPPLGLEEWATFLDSEGRVVDPKALRKRIFYGGVEHKFRKEVW  363


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   E+ D SD+  YAAS QQGS S+ R +  K S+S++ +   I  L D V ++P Q+A
Sbjct  1    MQEAELHDLSDDADYAASQQQGSPSIMRCDSGKKSSSSEPEGAQIVYLKDNVTIHPTQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  + 
Sbjct  61   SERISGRLKLIKQGSSLF  78



>gb|AIU48681.1| RabGAP/TBC domain-containing protein, partial [Vitis vinifera]
Length=629

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD ++LVWGKPRQP +G +EWATFLDSEGR+M+ +ALRKRIFYGG+E+SLRK VW
Sbjct  291  EFDKLALVWGKPRQPPLGSEEWATFLDSEGRIMDSKALRKRIFYGGIEHSLRKEVW  346



>ref|XP_002285365.1| PREDICTED: TBC1 domain family member 17 isoform X3 [Vitis vinifera]
Length=657

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD ++LVWGKPRQP +G +EWATFLDSEGR+M+ +ALRKRIFYGG+E+SLRK VW
Sbjct  313  EFDKLALVWGKPRQPPLGSEEWATFLDSEGRIMDSKALRKRIFYGGIEHSLRKEVW  368



>gb|AIU48652.1| RabGAP/TBC domain-containing protein, partial [Carica papaya]
Length=628

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD ++LVWGKPRQP +GP+EW TFLDSEGRVM+ +ALRKRIFYGG+E+ LR+ VW
Sbjct  290  EFDKLTLVWGKPRQPPLGPEEWVTFLDSEGRVMDSKALRKRIFYGGIEHKLRREVW  345



>ref|XP_007155039.1| hypothetical protein PHAVU_003G167800g [Phaseolus vulgaris]
 gb|ESW27033.1| hypothetical protein PHAVU_003G167800g [Phaseolus vulgaris]
Length=652

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 85/149 (57%), Gaps = 10/149 (7%)
 Frame = +3

Query  159  IQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWINNQLR--QIN----  320
            +  GS+S+T  + R     + + D+ I  L     V   ++A +  +   R  QIN    
Sbjct  217  VNNGSSSVTHFHGRPRQKVDPARDISIQVLEKFSLVT--KFARETTSQLFRENQINGFSE  274

Query  321  QGKPILTKSSF-RKHDHDEEPATKVQPL-INYNKFDNVSLVWGKPRQPSMGPQEWATFLD  494
            +  PI T     R+  H EE  +    L ++  +FDN+SLVWGKPRQP +G +EW  FLD
Sbjct  275  RRTPIQTNIDHPRRSSHVEEKTSDESCLALDSQEFDNLSLVWGKPRQPPLGSEEWIIFLD  334

Query  495  SEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            SEGRV + +ALRKR+FYGGL++ LR  VW
Sbjct  335  SEGRVTDSEALRKRVFYGGLDHELRNEVW  363



>gb|KJB64721.1| hypothetical protein B456_010G061900 [Gossypium raimondii]
Length=550

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD +SLVWGKPRQP +G +EWATFLDSEGRV++P+ALRKRIFYGG+E+  RK VW
Sbjct  308  EFDKLSLVWGKPRQPPLGLEEWATFLDSEGRVVDPKALRKRIFYGGVEHKFRKEVW  363


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   E+ D SD+  YAAS QQGS S+ R +  K S+S++ +   I  L D V ++P Q+A
Sbjct  1    MQEAELHDLSDDADYAASQQQGSPSIMRCDSGKKSSSSEPEGAQIVYLKDNVTIHPTQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  + 
Sbjct  61   SERISGRLKLIKQGSSLF  78



>gb|AIU48643.1| RabGAP/TBC domain-containing protein, partial [Magnolia denudata]
Length=622

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            +FD +SLVWGKPRQP +G +EWATF DSEGR+M+ +ALRKRIFYGG+E+ LRK VWK
Sbjct  290  EFDKLSLVWGKPRQPPLGLEEWATFFDSEGRIMDSKALRKRIFYGGVEHCLRKEVWK  346



>gb|KJB64719.1| hypothetical protein B456_010G061900 [Gossypium raimondii]
Length=653

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD +SLVWGKPRQP +G +EWATFLDSEGRV++P+ALRKRIFYGG+E+  RK VW
Sbjct  308  EFDKLSLVWGKPRQPPLGLEEWATFLDSEGRVVDPKALRKRIFYGGVEHKFRKEVW  363


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   E+ D SD+  YAAS QQGS S+ R +  K S+S++ +   I  L D V ++P Q+A
Sbjct  1    MQEAELHDLSDDADYAASQQQGSPSIMRCDSGKKSSSSEPEGAQIVYLKDNVTIHPTQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  + 
Sbjct  61   SERISGRLKLIKQGSSLF  78



>ref|XP_010241556.1| PREDICTED: TBC1 domain family member 15 isoform X3 [Nelumbo nucifera]
Length=673

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            +FD ++LVWGKPRQP +GP+EW TFLDSEGRVM+ +AL+KRIFYGG+E+ LR  +WK
Sbjct  329  EFDKLALVWGKPRQPPLGPEEWTTFLDSEGRVMDSKALKKRIFYGGIEHELRNEIWK  385


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 46/83 (55%), Gaps = 0/83 (0%)
 Frame = +3

Query  90   ADPEAMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVN  269
            ++   M   E  D SD+  YAAS QQGS S++++     +  N++D   +    D V ++
Sbjct  2    SESSTMQEGESHDLSDDADYAASQQQGSTSISQNGSGGRTVMNEADRAQVVYQKDNVTIH  61

Query  270  PMQYASDWINNQLRQINQGKPIL  338
            P QYAS+ I+ +LR I QG  + 
Sbjct  62   PTQYASERISGRLRLIKQGSSLF  84



>gb|AIU48673.1| RabGAP/TBC domain-containing protein, partial [Phaseolus vulgaris]
Length=623

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 83/146 (57%), Gaps = 10/146 (7%)
 Frame = +3

Query  159  IQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWINNQLRQIN----QG  326
            +  GS+S+T  + R     + + D+ I  L     V   ++A +  +   R+ N    + 
Sbjct  200  VNNGSSSVTHFHGRPRQKVDPARDISIQVLEKFSLVT--KFARETTSQLFRENNGFSERR  257

Query  327  KPILTKSSFRKHDHDEEPATKVQPL-INYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEG  503
             PI T     +  H EE  +    L ++  +FDN+SLVWGKPRQP +G +EW  FLDSEG
Sbjct  258  TPIQTHP---RRSHVEEKTSDESCLALDSQEFDNLSLVWGKPRQPPLGSEEWIIFLDSEG  314

Query  504  RVMNPQALRKRIFYGGLENSLRKXVW  581
            RV + +ALRKR+FYGGL++ LR  VW
Sbjct  315  RVTDSEALRKRVFYGGLDHELRNEVW  340



>ref|XP_007013521.1| RabGAP/TBC domain-containing protein isoform 2 [Theobroma cacao]
 gb|EOY31140.1| RabGAP/TBC domain-containing protein isoform 2 [Theobroma cacao]
Length=656

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +3

Query  354  RKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRK  533
             K D DEE   K     +  +FD +SLVWGKPRQP +G +EWATFLDSEGRV++ +ALRK
Sbjct  292  HKVDEDEELPVKSPVAPDPLEFDKLSLVWGKPRQPPLGLEEWATFLDSEGRVVDSKALRK  351

Query  534  RIFYGGLENSLRKXVW  581
            RIFYGG+E+ LR+ VW
Sbjct  352  RIFYGGIEHKLRREVW  367


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAAS QQGSASM R +  K S+S++ +   I  L D V ++P Q+AS+ I
Sbjct  5    ELHDLSDDADYAASQQQGSASMMRCDRGKRSSSSEPEGAEIVYLKDNVTIHPTQFASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +L+ I QG  + 
Sbjct  65   SGRLKLIKQGSSLF  78



>gb|AIU48656.1| RabGAP/TBC domain-containing protein, partial [Glycine max]
Length=625

 Score = 97.4 bits (241),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 65/98 (66%), Gaps = 8/98 (8%)
 Frame = +3

Query  297  NNQLRQINQGKPILT---KSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMG  467
            NN    I++   I T   KS+  ++  DE P       ++  +FDN+SLVWGKPRQP +G
Sbjct  250  NNGFSPIDRRTHIQTHPKKSNVEENTSDESPVA-----LDSQEFDNLSLVWGKPRQPPLG  304

Query  468  PQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
             +EW TF+DSEGRV + +ALRKR+FYGGL++ LR  VW
Sbjct  305  SEEWITFMDSEGRVTDSEALRKRVFYGGLDHKLRNEVW  342



>gb|AIU48647.1| RabGAP/TBC domain-containing protein, partial [Theobroma cacao]
Length=603

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD +SLVWGKPRQP +G +EWATFLDSEGRV++ +ALRKRIFYGG+E+ LR+ VW
Sbjct  265  EFDKLSLVWGKPRQPPLGLEEWATFLDSEGRVVDSKALRKRIFYGGIEHKLRREVW  320



>gb|KJB27078.1| hypothetical protein B456_004G276400 [Gossypium raimondii]
Length=656

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 93/169 (55%), Gaps = 12/169 (7%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSN-IRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +LARE     +       +   SAS+ + N  R+    + + D+ I  L     V   ++
Sbjct  201  VLARESTSHENRERPDVGVSDVSASIPQYNGRRRQKFHDPARDISIQVLEKFSFVT--KF  258

Query  282  ASDWINNQLRQI--NQGKPILTKSSFRKHDHDEEPATKVQPLINYN-------KFDNVSL  434
            A +  +   R+   N  +P+  + S +  D+  +P+   + +   +       +FD +SL
Sbjct  259  ARETTSQLFRESHSNGFRPLERRKSNQSDDYSHKPSDDAEGVAVQSPVAPDPVEFDKLSL  318

Query  435  VWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            VWGKPRQP +G +EW TFLDSEGRV++ +ALRKRIFYGG+E+ LRK VW
Sbjct  319  VWGKPRQPPLGLEEWVTFLDSEGRVVDSKALRKRIFYGGIEHKLRKEVW  367


 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            ML  E+ D SD+  YAAS Q+GSASM R    K STS++++   I  L D VA++P QYA
Sbjct  1    MLEAELHDLSDDADYAASQQEGSASMMRCYSSKLSTSSETEGAEIVYLKDNVAIHPTQYA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  + 
Sbjct  61   SERISGRLKLIKQGSTLF  78



>ref|XP_004159423.1| PREDICTED: TBC1 domain family member 15-like [Cucumis sativus]
Length=485

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD ++LVWGKPRQP +G +EWATFLD+EGRV++  +LRKRIFYGG+E++LRK VW
Sbjct  314  QFDKLTLVWGKPRQPPLGSEEWATFLDAEGRVLDSTSLRKRIFYGGVEHNLRKEVW  369


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            ML  ++ D SD+  YAAS QQGS +M R++  + S+S++ +   +    + V ++P Q+A
Sbjct  1    MLETDLHDLSDDADYAASQQQGSTTMMRTDSGRGSSSSEHEGAEVVYSKENVTIHPTQFA  60

Query  285  SDWINNQLRQINQG  326
            S+ I+ +LR I QG
Sbjct  61   SERISGRLRLIKQG  74



>gb|EYU18249.1| hypothetical protein MIMGU_mgv1a002604mg [Erythranthe guttata]
Length=655

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD +SLVWGKPRQ  +G QEWATFLD+EGRVM+ +AL KRIFYGGLE++LRK VW
Sbjct  310  EFDKISLVWGKPRQSPLGQQEWATFLDAEGRVMDSKALIKRIFYGGLEHNLRKEVW  365


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAASIQQGSAS++++  R+ STSN+ D   I    D V ++P QYAS+ I
Sbjct  5    ELHDLSDDADYAASIQQGSASISQNESRRQSTSNEPDGAEIVYTKDNVTIHPTQYASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +L+ I QG  + 
Sbjct  65   SGRLKLIKQGNALF  78



>gb|AIU48669.1| RabGAP/TBC domain-containing protein, partial [Erythranthe guttata]
Length=624

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD +SLVWGKPRQ  +G QEWATFLD+EGRVM+ +AL KRIFYGGLE++LRK VW
Sbjct  286  EFDKISLVWGKPRQSPLGQQEWATFLDAEGRVMDSKALIKRIFYGGLEHNLRKEVW  341



>ref|XP_004508469.1| PREDICTED: TBC1 domain family member 17-like isoform X2 [Cicer 
arietinum]
Length=518

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD +SLVWGKPRQP +G +EW TFLDSEGRV N +ALRKRIFYGGL++ LR  VW
Sbjct  360  EFDELSLVWGKPRQPPLGSEEWITFLDSEGRVTNSEALRKRIFYGGLDHKLRNEVW  415



>gb|AIU48668.1| RabGAP/TBC domain-containing protein, partial [Manihot esculenta]
Length=627

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD ++LVWGKPRQP +G +EWATFLD EGRVM+ +ALRKRIFYGG+E++LR+ +W
Sbjct  289  EFDKLTLVWGKPRQPPLGSEEWATFLDPEGRVMDSKALRKRIFYGGVEHTLRREIW  344



>gb|AIU48659.1| RabGAP/TBC domain-containing protein, partial [Iris japonica]
Length=629

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +3

Query  411  NKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
             +FD +SLVWGKPRQP +  +EW TFLDSEGR+M+ +AL KRIFYGGLE+ LRK VWK
Sbjct  290  TEFDKLSLVWGKPRQPPLTHEEWVTFLDSEGRIMDSKALIKRIFYGGLEHKLRKEVWK  347



>gb|KHN22122.1| TBC1 domain family member 15 [Glycine soja]
Length=656

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 58/77 (75%), Gaps = 1/77 (1%)
 Frame = +3

Query  354  RKHDHDEEPATKVQPL-INYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALR  530
            +K  + EE  +   P+ ++  +FDN+SLVWGKPRQP +G +EW TF+DSEGRV + +ALR
Sbjct  289  KKSSNVEENTSDESPVALDSQEFDNLSLVWGKPRQPPLGSEEWITFMDSEGRVTDSEALR  348

Query  531  KRIFYGGLENSLRKXVW  581
            KR+FYGGL++ LR  VW
Sbjct  349  KRVFYGGLDHKLRNEVW  365


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 48/78 (62%), Gaps = 3/78 (4%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSAS-MTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            ML  E+ D SD+  YAAS QQGSAS M RS+  K S+  +  +  I  L D VA++P Q+
Sbjct  1    MLESELHDLSDDADYAASQQQGSASVMLRSDSAKQSSPREGAE--IVFLKDNVAIHPTQF  58

Query  282  ASDWINNQLRQINQGKPI  335
            AS+ I+ +L+ I Q   +
Sbjct  59   ASERISGRLKLIKQSSSL  76



>ref|XP_003542634.1| PREDICTED: TBC1 domain family member 15-like [Glycine max]
Length=656

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 58/77 (75%), Gaps = 1/77 (1%)
 Frame = +3

Query  354  RKHDHDEEPATKVQPL-INYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALR  530
            +K  + EE  +   P+ ++  +FDN+SLVWGKPRQP +G +EW TF+DSEGRV + +ALR
Sbjct  289  KKSSNVEENTSDESPVALDSQEFDNLSLVWGKPRQPPLGSEEWITFMDSEGRVTDSEALR  348

Query  531  KRIFYGGLENSLRKXVW  581
            KR+FYGGL++ LR  VW
Sbjct  349  KRVFYGGLDHKLRNEVW  365


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 48/78 (62%), Gaps = 3/78 (4%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSAS-MTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            ML  E+ D SD+  YAAS QQGSAS M RS+  K S+  +  +  I  L D VA++P Q+
Sbjct  1    MLESELHDLSDDADYAASQQQGSASVMLRSDSAKQSSPREGAE--IVFLKDNVAIHPTQF  58

Query  282  ASDWINNQLRQINQGKPI  335
            AS+ I+ +L+ I Q   +
Sbjct  59   ASERISGRLKLIKQSSSL  76



>gb|AIU48687.1| RabGAP/TBC domain-containing protein, partial [Houttuynia cordata]
Length=622

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 59/82 (72%), Gaps = 5/82 (6%)
 Frame = +3

Query  339  TKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNP  518
             KS+  + +  E  ATKV       + D +SLVWGKPRQPS+  +EW TFLDSEGR+ +P
Sbjct  264  VKSNEVQKNSTEVSATKVNM-----EVDKLSLVWGKPRQPSLSLEEWETFLDSEGRITDP  318

Query  519  QALRKRIFYGGLENSLRKXVWK  584
             ALRKR+FYGG+E++LRK +WK
Sbjct  319  SALRKRVFYGGVEHNLRKDIWK  340



>ref|XP_011020167.1| PREDICTED: TBC1 domain family member 15 [Populus euphratica]
Length=660

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD ++LVWGKPRQP +G +EWATFLDSEGRVM+ +AL+KRIFYGG+E++ R+ VW
Sbjct  314  EFDKMTLVWGKPRQPPLGSEEWATFLDSEGRVMDSKALKKRIFYGGVEHTTRREVW  369


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASM--TRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASD  290
            E+ D SD+  YAAS+QQGSASM  TRS+  + ++S+  +   I  L D V ++P QYAS+
Sbjct  5    ELHDLSDDADYAASLQQGSASMMITRSDSGRSTSSSVPEGAEIVYLKDNVTIHPTQYASE  64

Query  291  WINNQLRQINQGKPIL  338
             I+ +L+ I QG  + 
Sbjct  65   RISGRLKLIKQGSSLF  80



>gb|KDO80165.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=356

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  402  INYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +++ +FD ++LVWGKPRQP +G +EW TFLD+EGRVM+  ALRKRIFYGG+++ LR+ VW
Sbjct  7    VSFWQFDKLTLVWGKPRQPPLGSEEWTTFLDNEGRVMDSNALRKRIFYGGVDHKLRREVW  66



>gb|AIU48658.1| RabGAP/TBC domain-containing protein, partial [Buxus sinica]
Length=629

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 54/71 (76%), Gaps = 4/71 (6%)
 Frame = +3

Query  372  EEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGG  551
            EE      PL    +FD ++LVWGKPRQP +G +EWATFLDSEGR+++ +AL+KR+FYGG
Sbjct  281  EEIQVAADPL----EFDKLALVWGKPRQPPLGSEEWATFLDSEGRIVDSKALKKRVFYGG  336

Query  552  LENSLRKXVWK  584
            +E  LRK +WK
Sbjct  337  VEYGLRKELWK  347



>ref|XP_008456989.1| PREDICTED: TBC1 domain family member 15 [Cucumis melo]
Length=655

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD ++LVWGKPRQP +G +EWATFLD+EGRV++  +LRKRIFYGG+E++LRK VW
Sbjct  311  QFDKLTLVWGKPRQPPLGSEEWATFLDAEGRVLDSTSLRKRIFYGGVEHNLRKEVW  366


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            ML  ++ D SD+  YAAS QQGS +M R++  + STS++ +   +    + V ++P Q+A
Sbjct  1    MLETDLHDLSDDADYAASQQQGSTTMMRTDSGRGSTSSELEGAEVVYSKENVTIHPTQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +LR I QG  + 
Sbjct  61   SERISGRLRLIKQGSCLF  78



>ref|XP_004139297.1| PREDICTED: TBC1 domain family member 15-like [Cucumis sativus]
 gb|KGN60701.1| hypothetical protein Csa_2G007450 [Cucumis sativus]
Length=655

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD ++LVWGKPRQP +G +EWATFLD+EGRV++  +LRKRIFYGG+E++LRK VW
Sbjct  311  QFDKLTLVWGKPRQPPLGSEEWATFLDAEGRVLDSTSLRKRIFYGGVEHNLRKEVW  366


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            ML  ++ D SD+  YAAS QQGS +M R++  + S+S++ +   +    + V ++P Q+A
Sbjct  1    MLETDLHDLSDDADYAASQQQGSTTMMRTDSGRGSSSSEHEGAEVVYSKENVTIHPTQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +LR I QG  + 
Sbjct  61   SERISGRLRLIKQGSCLF  78



>ref|XP_004508468.1| PREDICTED: TBC1 domain family member 17-like isoform X1 [Cicer 
arietinum]
Length=705

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD +SLVWGKPRQP +G +EW TFLDSEGRV N +ALRKRIFYGGL++ LR  VW
Sbjct  360  EFDELSLVWGKPRQPPLGSEEWITFLDSEGRVTNSEALRKRIFYGGLDHKLRNEVW  415



>gb|AIU48662.1| RabGAP/TBC domain-containing protein, partial [Chimonanthus praecox]
Length=627

 Score = 94.4 bits (233),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +3

Query  405  NYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            N ++FD +SLVWGKPRQP +G +EWATFLD EGR+ +  AL+KRIFYGG+E+ LRK VWK
Sbjct  286  NPSEFDQLSLVWGKPRQPPLGLEEWATFLDVEGRITDSNALKKRIFYGGVEHDLRKEVWK  345



>gb|KDO80163.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=473

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD ++LVWGKPRQP +G +EW TFLD+EGRVM+  ALRKRIFYGG+++ LR+ VW
Sbjct  313  EFDKLTLVWGKPRQPPLGSEEWTTFLDNEGRVMDSNALRKRIFYGGVDHKLRREVW  368



>gb|ACU19099.1| unknown [Glycine max]
Length=311

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 62/95 (65%), Gaps = 1/95 (1%)
 Frame = +3

Query  300  NQLRQINQGKPILTKSSFRKHDHDEEPATKVQPLI-NYNKFDNVSLVWGKPRQPSMGPQE  476
            N    I++   I T     K  + EE  +   P++ +  +FDN+SLVWGKPRQP +G +E
Sbjct  85   NGFSPIDRRTHIQTNLDHPKSSNVEENTSVESPVVLDSQEFDNLSLVWGKPRQPPLGSEE  144

Query  477  WATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            W  FLDSEGRV + +ALRKR+FYGGL++ L+  VW
Sbjct  145  WNAFLDSEGRVTDSEALRKRVFYGGLDHELQNEVW  179



>gb|AIU48639.1| RabGAP/TBC domain-containing protein, partial [Aquilegia coerulea]
Length=625

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            +FD ++LVWG+PRQP +G +EWATFLD+EGR+++ ++LRKRIFYGGLE+ +R  VWK
Sbjct  287  EFDKLTLVWGQPRQPPLGSEEWATFLDAEGRILDSKSLRKRIFYGGLEHQIRNEVWK  343



>ref|XP_009758337.1| PREDICTED: TBC1 domain family member 15-like [Nicotiana sylvestris]
Length=649

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            +FD +SLVWGKPRQP +G +EW+TFLD EGRV + +A+RKRIFYGG+E  LRK VW+
Sbjct  303  EFDKLSLVWGKPRQPPLGTEEWSTFLDCEGRVTDSEAVRKRIFYGGVEQGLRKEVWR  359


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            +I D SD+  YAASIQQGS+SM RS+  K S+S + +   I  L D VA++P QYAS+ I
Sbjct  5    DIHDLSDDADYAASIQQGSSSMNRSDSSKQSSSGEQEGAEIVYLKDNVAIHPTQYASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +L+ I QG  + 
Sbjct  65   SGRLKLIKQGGSLF  78



>gb|KDO80162.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=522

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD ++LVWGKPRQP +G +EW TFLD+EGRVM+  ALRKRIFYGG+++ LR+ VW
Sbjct  313  EFDKLTLVWGKPRQPPLGSEEWTTFLDNEGRVMDSNALRKRIFYGGVDHKLRREVW  368



>ref|XP_006345222.1| PREDICTED: TBC1 domain family member 15-like [Solanum tuberosum]
Length=656

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            +FD +SLVWGKPRQP +G +EW+ FLDSEGRV + +ALRKRIFYGG+E  LRK VW+
Sbjct  310  EFDKLSLVWGKPRQPPLGTEEWSAFLDSEGRVTDSEALRKRIFYGGVEPDLRKEVWR  366


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            ++ D SD+  YAAS+Q GSASM RSN  K  +S + +   I  + D VA++P QYAS+ I
Sbjct  5    DVHDLSDDADYAASVQHGSASMNRSNSSKQGSSGEQEGAEIVYVKDNVAIHPTQYASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +L+ I QG  + 
Sbjct  65   SGRLKLIKQGGSLF  78



>gb|KDO80164.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=496

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD ++LVWGKPRQP +G +EW TFLD+EGRVM+  ALRKRIFYGG+++ LR+ VW
Sbjct  151  EFDKLTLVWGKPRQPPLGSEEWTTFLDNEGRVMDSNALRKRIFYGGVDHKLRREVW  206



>ref|XP_007204093.1| hypothetical protein PRUPE_ppa002904mg [Prunus persica]
 gb|EMJ05292.1| hypothetical protein PRUPE_ppa002904mg [Prunus persica]
Length=622

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD VSLVWGKPRQ  +G  EW TFLD EGR+M+ +ALRKRIFYGG+E+ LRK VW
Sbjct  313  EFDKVSLVWGKPRQAPLGSDEWKTFLDYEGRIMDSEALRKRIFYGGVEHELRKEVW  368


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAAS Q GSASM RS+  K S+S++ D   +  L D V ++P Q+AS+ I
Sbjct  5    ELHDLSDDADYAASQQHGSASMMRSDSGKHSSSSEHDGAEVVYLKDNVTIHPTQFASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +LR I QG  + 
Sbjct  65   SGRLRLIKQGSSLF  78



>gb|AIU48671.1| RabGAP/TBC domain-containing protein, partial [Prunus persica]
Length=589

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD VSLVWGKPRQ  +G  EW TFLD EGR+M+ +ALRKRIFYGG+E+ LRK VW
Sbjct  290  EFDKVSLVWGKPRQAPLGSDEWKTFLDYEGRIMDSEALRKRIFYGGVEHELRKEVW  345



>gb|KDO80161.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=553

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD ++LVWGKPRQP +G +EW TFLD+EGRVM+  ALRKRIFYGG+++ LR+ VW
Sbjct  313  EFDKLTLVWGKPRQPPLGSEEWTTFLDNEGRVMDSNALRKRIFYGGVDHKLRREVW  368



>gb|KDO80160.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=553

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD ++LVWGKPRQP +G +EW TFLD+EGRVM+  ALRKRIFYGG+++ LR+ VW
Sbjct  313  EFDKLTLVWGKPRQPPLGSEEWTTFLDNEGRVMDSNALRKRIFYGGVDHKLRREVW  368



>ref|XP_008242808.1| PREDICTED: TBC1 domain family member 17 [Prunus mume]
Length=661

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD VSLVWGKPRQ  +G  EW TFLD EGR+M+ +ALRKRIFYGG+E+ LRK VW
Sbjct  313  EFDKVSLVWGKPRQAPLGSDEWKTFLDYEGRIMDSEALRKRIFYGGVEHELRKEVW  368


 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAAS Q GSASM RS+  K S+S++ D   +  L D V ++P Q+AS+ I
Sbjct  5    ELHDLSDDADYAASQQHGSASMMRSDSGKHSSSSEHDGAEVVYLKDNVTIHPTQFASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +LR I QG  + 
Sbjct  65   SGRLRLIKQGSSLF  78



>gb|KJB54007.1| hypothetical protein B456_009G016100 [Gossypium raimondii]
Length=657

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +3

Query  417  FDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
             D +SL WGKPRQP +G +EWATFLDSEGRV++ +ALRKRIFYGG+E+ LRK VW+
Sbjct  312  LDKLSLAWGKPRQPPLGLEEWATFLDSEGRVVDSKALRKRIFYGGVEHKLRKEVWE  367


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   EI D SD+  YAAS QQGSASM R    K S+SN+ +   +  + D V ++P Q+A
Sbjct  1    MQETEIHDLSDDADYAASQQQGSASMMRCESGKRSSSNEPEGAEVVYMKDNVTIHPTQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I Q   + 
Sbjct  61   SERISGRLKLIKQSSSLF  78



>gb|AIU48675.1| RabGAP/TBC domain-containing protein, partial [Ricinus communis]
Length=610

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/152 (37%), Positives = 88/152 (58%), Gaps = 12/152 (8%)
 Frame = +3

Query  153  ASIQQGSASMTRSNIRKWSTSNK-SDDVGIACLNDKVAVNPMQYASDWINNQLRQINQGK  329
             +I +GS+S+ + + R+    N  + D+ I  L     V   ++A +   +QL   N G 
Sbjct  179  GNIHRGSSSIPQHDGRQRHKGNDPARDLSIQVLEKFSLVT--KFARE-TTSQLFWENNGF  235

Query  330  PILTKSSFRKHDHD------EEPATKVQPLINYN--KFDNVSLVWGKPRQPSMGPQEWAT  485
              + + S+ +   D      +     +Q  +  +  +FD ++LVWGKPRQP +G +EWAT
Sbjct  236  DAIERKSYNQSSLDCPKTPKDTEEVSIQSAVPSDPLEFDKLTLVWGKPRQPPLGFEEWAT  295

Query  486  FLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            FLDSEGRV + +ALRKRIFYGG+ ++LR+ VW
Sbjct  296  FLDSEGRVTDSKALRKRIFYGGVGHTLRREVW  327



>ref|XP_006475896.1| PREDICTED: TBC1 domain family member 17-like [Citrus sinensis]
 gb|KDO80157.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=658

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD ++LVWGKPRQP +G +EW TFLD+EGRVM+  ALRKRIFYGG+++ LR+ VW
Sbjct  313  EFDKLTLVWGKPRQPPLGSEEWTTFLDNEGRVMDSNALRKRIFYGGVDHKLRREVW  368



>ref|XP_009127224.1| PREDICTED: TBC1 domain family member 15 [Brassica rapa]
Length=672

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +3

Query  354  RKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRK  533
            ++H +DEE    +    +  +F+ +SLVWGKPRQP MG QE+  FLDSEGRV+  +ALR+
Sbjct  308  KEHLNDEETYNDIDVPADPLEFNKLSLVWGKPRQPPMGSQEFTAFLDSEGRVVESKALRE  367

Query  534  RIFYGGLENSLRKXVW  581
            R+FYGG+E+ LRK VW
Sbjct  368  RVFYGGIEHHLRKEVW  383


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M A E+ D SD+  YAAS  QGSASM R +  K S S+  D   +  L D VA++P Q+A
Sbjct  1    MEASELHDLSDDADYAASQLQGSASMMRCDSDKRSRSSDPDAAELIYLKDNVAIHPTQFA  60

Query  285  SDWINNQLRQINQ  323
            S+ I+ +L+   Q
Sbjct  61   SERISGRLKLTKQ  73



>gb|AIU48650.1| RabGAP/TBC domain-containing protein, partial [Citrus clementina]
Length=629

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD ++LVWGKPRQP +G +EW TFLD+EGRVM+  ALRKRIFYGG+++ LR+ VW
Sbjct  291  EFDKLTLVWGKPRQPPLGSEEWTTFLDNEGRVMDSNALRKRIFYGGVDHKLRREVW  346



>ref|XP_006450870.1| hypothetical protein CICLE_v10007683mg [Citrus clementina]
 gb|ESR64110.1| hypothetical protein CICLE_v10007683mg [Citrus clementina]
Length=658

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD ++LVWGKPRQP +G +EW TFLD+EGRVM+  ALRKRIFYGG+++ LR+ VW
Sbjct  313  EFDKLTLVWGKPRQPPLGSEEWTTFLDNEGRVMDSNALRKRIFYGGVDHKLRREVW  368



>gb|AIU48654.1| RabGAP/TBC domain-containing protein, partial [Citrus sinensis]
Length=629

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD ++LVWGKPRQP +G +EW TFLD+EGRVM+  ALRKRIFYGG+++ LR+ VW
Sbjct  291  EFDKLTLVWGKPRQPPLGSEEWTTFLDNEGRVMDSNALRKRIFYGGVDHKLRREVW  346



>gb|KDO80159.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=630

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD ++LVWGKPRQP +G +EW TFLD+EGRVM+  ALRKRIFYGG+++ LR+ VW
Sbjct  285  EFDKLTLVWGKPRQPPLGSEEWTTFLDNEGRVMDSNALRKRIFYGGVDHKLRREVW  340



>ref|XP_002527173.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35186.1| conserved hypothetical protein [Ricinus communis]
Length=645

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD ++LVWGKPRQP +G +EWATFLDSEGRV + +ALRKRIFYGG+ ++LR+ VW
Sbjct  299  EFDKLTLVWGKPRQPPLGFEEWATFLDSEGRVTDSKALRKRIFYGGVGHTLRREVW  354



>ref|XP_006855176.1| hypothetical protein AMTR_s00051p00106780 [Amborella trichopoda]
 gb|ERN16643.1| hypothetical protein AMTR_s00051p00106780 [Amborella trichopoda]
Length=688

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 77/126 (61%), Gaps = 7/126 (6%)
 Frame = +3

Query  225  DDVGIACLNDKVAVNPM--QYASDWINNQLRQINQ--GKPILTKSSFRKHDHDEEPATKV  392
            D++G      +V  +P+  Q   D ++ +L+  NQ    P L K + R     E  AT V
Sbjct  283  DNIGGYEKQQQVHSSPVKNQVGGDPVSQELQDKNQIISDP-LEKIACRNGKLCEAAATLV  341

Query  393  QP--LINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSL  566
                LI+  + +  SLVWGKPR P +G +EWATFLD EGR+++ +ALRKRIFYGG+E+ L
Sbjct  342  GTFELIDSKEAEQQSLVWGKPRLPPLGHEEWATFLDEEGRIVDSKALRKRIFYGGVEHGL  401

Query  567  RKXVWK  584
            RK VWK
Sbjct  402  RKEVWK  407



>gb|AIU48674.1| RabGAP/TBC domain-containing protein, partial [Artemisia annua]
Length=233

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            + D ++LVWGKPRQP +GP+EW TF DSEGRV +  AL++RIFYGG+E+SLRK +W
Sbjct  16   ELDKLALVWGKPRQPPLGPEEWGTFYDSEGRVEDLNALKERIFYGGVEHSLRKEIW  71



>emb|CDY27056.1| BnaA02g10760D [Brassica napus]
Length=672

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +3

Query  354  RKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRK  533
            ++H +DEE    +    +  +F+ +SLVWGKPRQP MG QE+  FLDSEGRV+  +ALR+
Sbjct  308  KEHLNDEEIYNDIDVPADPLEFNKLSLVWGKPRQPPMGSQEFTAFLDSEGRVVESKALRE  367

Query  534  RIFYGGLENSLRKXVW  581
            R+FYGG+E+ LRK VW
Sbjct  368  RVFYGGIEHHLRKEVW  383


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M A E+ D SD+  YAAS  QGSASM R    K S S+  D   +  L D VA++P Q+A
Sbjct  1    MEASELHDLSDDADYAASQLQGSASMMRCESDKRSRSSDPDAAELIYLKDNVAIHPTQFA  60

Query  285  SDWINNQLRQINQ  323
            S+ I+ +L+   Q
Sbjct  61   SERISGRLKLTKQ  73



>ref|XP_003609386.1| TBC1 domain family member [Medicago truncatula]
 gb|AES91583.1| RabGAP/TBC domain protein [Medicago truncatula]
Length=666

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FDN+SLVWGKPRQ  +G +EW TF+DSEGRV++ +ALRKRIFYGGL++ LR  VW
Sbjct  321  EFDNLSLVWGKPRQSPLGSKEWITFVDSEGRVIDSEALRKRIFYGGLDHELRNEVW  376



>gb|AIU48666.1| RabGAP/TBC domain-containing protein, partial [Medicago truncatula]
Length=626

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FDN+SLVWGKPRQ  +G +EW TF+DSEGRV++ +ALRKRIFYGGL++ LR  VW
Sbjct  288  EFDNLSLVWGKPRQSPLGSKEWITFVDSEGRVIDSEALRKRIFYGGLDHELRNEVW  343



>ref|XP_003549744.1| PREDICTED: TBC1 domain family member 15-like [Glycine max]
 gb|KHN15067.1| TBC1 domain family member 15 [Glycine soja]
Length=655

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +3

Query  297  NNQLRQINQGKPILTKSSFRKHDHDEEPATKVQPLI-NYNKFDNVSLVWGKPRQPSMGPQ  473
            +N    I++   I T     K  + EE  +   P++ +  +FDN+SLVWGKPRQP +G +
Sbjct  269  SNGFSPIDRRTHIQTNLDHPKSSNVEENTSVESPVVLDSQEFDNLSLVWGKPRQPPLGSE  328

Query  474  EWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            EW  FLDSEGRV + +ALRKR+FYGGL++ L+  VW
Sbjct  329  EWNAFLDSEGRVTDSEALRKRVFYGGLDHELQNEVW  364


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 47/79 (59%), Gaps = 3/79 (4%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSAS-MTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            ML  E+ D SD+  YAAS QQGSAS M RS+  K S+     ++  +   D VA++P Q+
Sbjct  1    MLESELHDLSDDADYAASQQQGSASVMLRSDSAKQSSPRNGAEIVFS--KDNVAIHPTQF  58

Query  282  ASDWINNQLRQINQGKPIL  338
            AS+ I+ +L+ I Q   + 
Sbjct  59   ASERISGRLKLIKQSSSLF  77



>ref|XP_009624893.1| PREDICTED: TBC1 domain family member 15-like [Nicotiana tomentosiformis]
Length=649

 Score = 91.7 bits (226),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            +FD +SLVWGKPRQP +G +EW+ FLD EGRV + +A+RKRIFYGG+E  LRK VW+
Sbjct  303  EFDKLSLVWGKPRQPPLGTEEWSAFLDCEGRVTDSEAVRKRIFYGGVEQGLRKEVWR  359


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            +I D SD+  YAASIQQGSASM RS+  K S+S + +   I  L D VA++P QYAS+ I
Sbjct  5    DIHDLSDDADYAASIQQGSASMNRSDSSKQSSSGEQEGAEIVYLKDNVAIHPTQYASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +L+ I QG  + 
Sbjct  65   SGRLKLIKQGGSLF  78



>ref|XP_004251725.1| PREDICTED: TBC1 domain family member 17-like [Solanum lycopersicum]
Length=656

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            +FD +SLVWGKPRQP +G +EW+ FLD+EGRV + +A+RKRIFYGG+E  LRK VW+
Sbjct  309  EFDKLSLVWGKPRQPPLGTEEWSAFLDTEGRVTDSEAVRKRIFYGGVEPDLRKEVWQ  365


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            ++ D SD+  YAAS+QQGSASM RSN  K  +S + +   I  + D VA++P QYAS+ I
Sbjct  5    DVHDLSDDADYAASVQQGSASMNRSNSSKQGSSGEQEGAEIVYVKDNVAIHPTQYASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +L+ I QG  + 
Sbjct  65   SGRLKLIKQGGSLF  78



>gb|AIU48682.1| RabGAP/TBC domain-containing protein, partial [Lactuca sativa]
Length=351

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD +SLVWGKPRQ  +  +EW++FLD EGR+M+P AL+KRIFYGG+E++LRK VW
Sbjct  13   EFDKLSLVWGKPRQHPLEVEEWSSFLDYEGRIMDPDALKKRIFYGGVEHNLRKEVW  68



>gb|KCW80045.1| hypothetical protein EUGRSUZ_C01375 [Eucalyptus grandis]
Length=527

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD +S+VWGKPRQ  +G  EWATFLDSEGRV++ +AL+KRIFYGG+E+ LR+ VW
Sbjct  183  EFDKLSMVWGKPRQSPLGSGEWATFLDSEGRVIDSKALKKRIFYGGVEHRLRREVW  238



>gb|AIU48655.1| RabGAP/TBC domain-containing protein, partial [Eucalyptus grandis]
Length=624

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD +S+VWGKPRQ  +G  EWATFLDSEGRV++ +AL+KRIFYGG+E+ LR+ VW
Sbjct  287  EFDKLSMVWGKPRQSPLGSGEWATFLDSEGRVIDSKALKKRIFYGGVEHRLRREVW  342



>ref|XP_010047970.1| PREDICTED: TBC1 domain family member 15 [Eucalyptus grandis]
 gb|KCW80044.1| hypothetical protein EUGRSUZ_C01375 [Eucalyptus grandis]
Length=654

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD +S+VWGKPRQ  +G  EWATFLDSEGRV++ +AL+KRIFYGG+E+ LR+ VW
Sbjct  310  EFDKLSMVWGKPRQSPLGSGEWATFLDSEGRVIDSKALKKRIFYGGVEHRLRREVW  365


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   E+ D SD+  YAAS +QGS SM RS+  K S+S + +   +  + D V ++P Q+A
Sbjct  1    MHETELHDLSDDADYAASQRQGSVSMQRSDSAKTSSSAEPEGAELVYVKDNVTIHPSQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            ++ I  +L  I QG  +L
Sbjct  61   AERIGGRLMLIKQGACLL  78



>gb|AIU48680.1| RabGAP/TBC domain-containing protein, partial [Schrenkiella parvula]
Length=628

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            KH +DEE    V    +  +F+ +SLVWGKPRQP MG +E+  FLDSEGRV+  +ALR+R
Sbjct  271  KHLNDEEIPITVDVPADPLEFNKLSLVWGKPRQPPMGSKEFTAFLDSEGRVVESKALRER  330

Query  537  IFYGGLENSLRKXVW  581
            +FYGG+E+ LR+ VW
Sbjct  331  VFYGGIEHQLRREVW  345



>ref|XP_006401805.1| hypothetical protein EUTSA_v10012867mg [Eutrema salsugineum]
 gb|ESQ43258.1| hypothetical protein EUTSA_v10012867mg [Eutrema salsugineum]
Length=675

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 79/137 (58%), Gaps = 6/137 (4%)
 Frame = +3

Query  177  SMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWINNQLRQINQGKPILTKSSFR  356
            S+     R+ +T   S++ G   ++ +    P+    + ++N   + +   P     S+ 
Sbjct  254  SLVTKFARETTTQLFSENNGFGSVDKRWNNQPVHNYDEKLSNIAEEKDHEGP----HSYP  309

Query  357  KHDH--DEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALR  530
            + DH  DEE    V    +  +F+ +SLVWGKPRQP MG +E+  FLDSEGRV+  +ALR
Sbjct  310  EKDHLNDEEIPITVDVPADPLEFNKLSLVWGKPRQPPMGSKEFTAFLDSEGRVVESKALR  369

Query  531  KRIFYGGLENSLRKXVW  581
            +R+FYGG+E+ LR+ VW
Sbjct  370  ERVFYGGIEHQLRREVW  386


 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS  QGSASM R +  K S S++ +   +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQLQGSASMMRCDSEKRSLSSEHEGAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQ  323
            AS+ I+ +L+   Q
Sbjct  62   ASERISGRLKLTKQ  75



>ref|XP_006401806.1| hypothetical protein EUTSA_v10012867mg [Eutrema salsugineum]
 gb|ESQ43259.1| hypothetical protein EUTSA_v10012867mg [Eutrema salsugineum]
Length=681

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 79/137 (58%), Gaps = 6/137 (4%)
 Frame = +3

Query  177  SMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWINNQLRQINQGKPILTKSSFR  356
            S+     R+ +T   S++ G   ++ +    P+    + ++N   + +   P     S+ 
Sbjct  260  SLVTKFARETTTQLFSENNGFGSVDKRWNNQPVHNYDEKLSNIAEEKDHEGP----HSYP  315

Query  357  KHDH--DEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALR  530
            + DH  DEE    V    +  +F+ +SLVWGKPRQP MG +E+  FLDSEGRV+  +ALR
Sbjct  316  EKDHLNDEEIPITVDVPADPLEFNKLSLVWGKPRQPPMGSKEFTAFLDSEGRVVESKALR  375

Query  531  KRIFYGGLENSLRKXVW  581
            +R+FYGG+E+ LR+ VW
Sbjct  376  ERVFYGGIEHQLRREVW  392


 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS  QGSASM R +  K S S++ +   +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQLQGSASMMRCDSEKRSLSSEHEGAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQ  323
            AS+ I+ +L+   Q
Sbjct  62   ASERISGRLKLTKQ  75



>ref|XP_008377303.1| PREDICTED: TBC1 domain family member 17 [Malus domestica]
Length=660

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD VS+ WG PRQP +G  EW TF+DSEGR++N +A RKRIFYGG+E+ LRK VW
Sbjct  314  EFDKVSMEWGNPRQPPLGSDEWETFMDSEGRIVNSEAFRKRIFYGGVEHKLRKEVW  369


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAAS+Q GSASM RS+  K S+S++ D   +  L D V ++P Q+AS+ I
Sbjct  5    ELHDLSDDADYAASLQHGSASMMRSDSGKHSSSSEHDGAEVVFLKDNVTIHPTQFASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +LR I  G  + 
Sbjct  65   SGRLRLIKHGSSLF  78



>gb|AIU48690.1| RabGAP/TBC domain-containing protein, partial [Trachycarpus fortunei]
Length=627

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            +FD + LVWGK R+P +  +EWA FLDSEGRVM+ +ALRKRIFYGG+E++LRK VWK
Sbjct  289  EFDKLPLVWGKQREPPLCLEEWAAFLDSEGRVMDSKALRKRIFYGGVEHNLRKEVWK  345



>gb|AIU48665.1| RabGAP/TBC domain-containing protein, partial [Aristolochia tagala]
Length=616

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            D +SLVWGKPRQP +G  EW  FLDSEGR+ +  +LRKRIFYGG+E+ LRK VWK
Sbjct  280  DKISLVWGKPRQPPLGFDEWTIFLDSEGRITDSDSLRKRIFYGGVEHGLRKEVWK  334



>gb|AIU48648.1| RabGAP/TBC domain-containing protein, partial [Acorus calamus]
Length=550

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            D +SLVWGKPRQ  +   EWATFLDSEGRV + +ALRKRIFYGG+EN+LRK VW+
Sbjct  214  DKLSLVWGKPRQSPLNYVEWATFLDSEGRVKDSEALRKRIFYGGVENNLRKEVWR  268



>ref|XP_010557604.1| PREDICTED: TBC1 domain family member 15 [Tarenaya hassleriana]
Length=669

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +3

Query  372  EEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGG  551
            EE  T V+   +  +F+ +SLVWGKPRQ  +G +EWA FLDSEGRVM+ +ALR R+FYGG
Sbjct  311  EEIPTDVEVPADPLEFNKMSLVWGKPRQSPLGRREWAAFLDSEGRVMDSKALRDRVFYGG  370

Query  552  LENSLRKXVW  581
            +E++LR+ VW
Sbjct  371  IEDALRREVW  380


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   E  D SD+  YAAS QQGSASM R +  K S+ ++ +   I  L D VA++P Q+A
Sbjct  1    MEESEFQDLSDDADYAASQQQGSASMMRCDSGKRSSPSEQEGGEIVYLKDNVAIHPTQFA  60

Query  285  SDWINNQLR  311
            S+ I+ +L+
Sbjct  61   SERISGRLK  69



>gb|AIU48661.1| RabGAP/TBC domain-containing protein, partial [Ceratophyllum 
demersum]
Length=615

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 62/88 (70%), Gaps = 0/88 (0%)
 Frame = +3

Query  321  QGKPILTKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSE  500
            Q  P++T +        ++ A +V  ++++ +FD + LVWGKPRQPS+  QEW  F+DSE
Sbjct  253  QENPLVTSAPEYGQLDTKKVADEVPVVLDHLEFDKLPLVWGKPRQPSLSLQEWEKFMDSE  312

Query  501  GRVMNPQALRKRIFYGGLENSLRKXVWK  584
            GR+ + ++LR+ +FYGG+++SLRK VWK
Sbjct  313  GRINDSKSLRRHVFYGGVDHSLRKEVWK  340



>gb|AIU48663.1| RabGAP/TBC domain-containing protein, partial [Pandanus utilis]
Length=264

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +3

Query  426  VSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            ++LVWGK RQP +  +EW+ FLDSEGR+M+ +ALRKRIFYGG+E++LRK VWK
Sbjct  92   LNLVWGKSRQPPLCLEEWSAFLDSEGRIMDSKALRKRIFYGGVEHNLRKEVWK  144



>emb|CDY65323.1| BnaC02g44880D [Brassica napus]
Length=672

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  354  RKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRK  533
            ++H +DEE    +    +  +F+ +SLVWGKPRQ  MG QE+  FLDSEGRV+  +ALR+
Sbjct  308  KEHLNDEEIYNDIDVPADPLEFNKLSLVWGKPRQSPMGSQEFTAFLDSEGRVVESKALRE  367

Query  534  RIFYGGLENSLRKXVW  581
            R+FYGG+E+ LRK VW
Sbjct  368  RVFYGGIEHHLRKEVW  383


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M A E+ D SD+  YAAS  QGSASM R +  K S S+  D   +  L D VA++P Q+A
Sbjct  1    MEASELHDLSDDADYAASQLQGSASMMRCDSDKRSRSSDPDAAELIYLKDNVAIHPTQFA  60

Query  285  SDWINNQLRQINQ  323
            S+ I+ +L+   Q
Sbjct  61   SERISGRLKLTKQ  73



>gb|AIU48676.1| RabGAP/TBC domain-containing protein, partial [Dioscorea oppositifolia]
Length=625

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            D+++LVWGKPRQP +  +EWA FLDSEGRV + +ALRKRIFYGG+E++LRK VWK
Sbjct  289  DSLNLVWGKPRQPPLKIEEWAAFLDSEGRVNDSKALRKRIFYGGVEHNLRKEVWK  343



>ref|XP_010687933.1| PREDICTED: TBC1 domain family member 15 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=622

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD ++LVWGKPRQP +  +EW TFLDSEGRV++ +ALRKRIFYGG+ + LRK +W
Sbjct  277  EFDKLALVWGKPRQPPLTKEEWITFLDSEGRVVDSKALRKRIFYGGVSHELRKEIW  332


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 47/78 (60%), Gaps = 3/78 (4%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M+  E+ D SD+  YAAS QQGS S+ RS+  + S    ++   +  + D V+++P QY 
Sbjct  1    MIETELHDLSDDADYAASQQQGSQSIMRSDSGRRSEPEGAE---VVYVKDNVSIHPTQYM  57

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  ++
Sbjct  58   SERISGRLKLIKQGDSLI  75



>ref|XP_010687932.1| PREDICTED: TBC1 domain family member 15 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=656

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD ++LVWGKPRQP +  +EW TFLDSEGRV++ +ALRKRIFYGG+ + LRK +W
Sbjct  311  EFDKLALVWGKPRQPPLTKEEWITFLDSEGRVVDSKALRKRIFYGGVSHELRKEIW  366


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 47/78 (60%), Gaps = 3/78 (4%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M+  E+ D SD+  YAAS QQGS S+ RS+  + S    ++   +  + D V+++P QY 
Sbjct  1    MIETELHDLSDDADYAASQQQGSQSIMRSDSGRRSEPEGAE---VVYVKDNVSIHPTQYM  57

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  ++
Sbjct  58   SERISGRLKLIKQGDSLI  75



>gb|AIU48645.1| RabGAP/TBC domain-containing protein, partial [Pinellia ternata]
Length=624

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            +F+ + L+WGKPRQ  +  +EW+ FLDSEGR+M+P ALRKRIFYGG+E+ LRK VWK
Sbjct  286  EFERLPLIWGKPRQGPLDFKEWSAFLDSEGRIMDPDALRKRIFYGGVEHDLRKEVWK  342



>ref|XP_008785780.1| PREDICTED: TBC1 domain family member 15 [Phoenix dactylifera]
Length=666

 Score = 88.6 bits (218),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            +FD + LVWGK R+P +  +EWA FLDSEGRVM+ +A RKRIFYGG+E++LRK VWK
Sbjct  321  EFDKLPLVWGKQREPPLCLEEWAAFLDSEGRVMDSKAFRKRIFYGGVEHNLRKEVWK  377



>gb|AIU48657.1| RabGAP/TBC domain-containing protein, partial [Illicium henryi]
Length=619

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  429  SLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            +LVWGK R P +G +EWATFLDSEGR+++ +ALRKRIFYGG+E+SLRK VWK
Sbjct  292  NLVWGKKRLPPLGSEEWATFLDSEGRILDSKALRKRIFYGGVEHSLRKEVWK  343



>ref|XP_009363991.1| PREDICTED: TBC1 domain family member 15 [Pyrus x bretschneideri]
Length=658

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD  S+VWGKPRQP +G  EW  F DSEGR+++ +A RKRIFYGG+E+ LRK VW
Sbjct  312  EFDKESMVWGKPRQPPLGSDEWEAFFDSEGRIIDSEAFRKRIFYGGVEHKLRKEVW  367


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAAS++ GSASM RS+  K S+S++ D   +  L D V ++P Q+ S+ I
Sbjct  5    ELHDLSDDADYAASLRHGSASMMRSDSGKHSSSSEHDGAEVVFLKDNVTIHPTQFTSERI  64

Query  297  NNQLRQINQGKPIL  338
            + +LR I  G  + 
Sbjct  65   SGRLRLIKHGSSLF  78



>gb|AIU48683.1| RabGAP/TBC domain-containing protein, partial [Ceratophyllum 
platyacanthum subsp. oryzetorum]
Length=615

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 62/88 (70%), Gaps = 0/88 (0%)
 Frame = +3

Query  321  QGKPILTKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSE  500
            Q  P++T +        ++ A +V  ++++ +FD + LVWGKPRQP++  QEW  F+DSE
Sbjct  253  QENPLVTSAPEYGQLDTKKVADEVPVVLDHLEFDKLPLVWGKPRQPALSLQEWEKFMDSE  312

Query  501  GRVMNPQALRKRIFYGGLENSLRKXVWK  584
            GR+ + ++LR+ +FYGG+++SLRK VWK
Sbjct  313  GRINDSKSLRRHVFYGGVDHSLRKEVWK  340



>ref|XP_011017820.1| PREDICTED: TBC1 domain family member 17-like isoform X3 [Populus 
euphratica]
Length=637

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD ++LVWGKPRQP +G +EW  FLDSEGRV++ +AL+KRIFYGG+E+S  K VW
Sbjct  329  EFDKMTLVWGKPRQPPLGSEEWEIFLDSEGRVIDSKALKKRIFYGGVEHSTCKEVW  384


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASM--TRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASD  290
            ++ D SD+  YAAS+QQG ASM  TRS++ K ++S+  +   +  L D V ++P QYAS+
Sbjct  5    DLHDLSDDGDYAASLQQGPASMMMTRSDVGKSTSSSVPEGAEVVYLKDNVTIHPTQYASE  64

Query  291  WINNQLRQINQGKPIL  338
             I+ +L+ I QG  + 
Sbjct  65   RISGRLKLIKQGSYLF  80



>gb|AIU48689.1| RabGAP/TBC domain-containing protein, partial [Alisma plantago-aquatica]
Length=628

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            +F+ +SLVWGKPRQ  MG  EWA FLDSEGR+M+P+AL+++IFYGGL+  LRK  WK
Sbjct  290  EFEKMSLVWGKPRQQPMGFDEWANFLDSEGRIMDPEALKRQIFYGGLKPGLRKEAWK  346



>ref|XP_011017816.1| PREDICTED: TBC1 domain family member 15-like isoform X1 [Populus 
euphratica]
 ref|XP_011017817.1| PREDICTED: TBC1 domain family member 15-like isoform X1 [Populus 
euphratica]
Length=676

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD ++LVWGKPRQP +G +EW  FLDSEGRV++ +AL+KRIFYGG+E+S  K VW
Sbjct  329  EFDKMTLVWGKPRQPPLGSEEWEIFLDSEGRVIDSKALKKRIFYGGVEHSTCKEVW  384


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASM--TRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASD  290
            ++ D SD+  YAAS+QQG ASM  TRS++ K ++S+  +   +  L D V ++P QYAS+
Sbjct  5    DLHDLSDDGDYAASLQQGPASMMMTRSDVGKSTSSSVPEGAEVVYLKDNVTIHPTQYASE  64

Query  291  WINNQLRQINQGKPIL  338
             I+ +L+ I QG  + 
Sbjct  65   RISGRLKLIKQGSYLF  80



>ref|XP_011017818.1| PREDICTED: TBC1 domain family member 15-like isoform X2 [Populus 
euphratica]
Length=661

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD ++LVWGKPRQP +G +EW  FLDSEGRV++ +AL+KRIFYGG+E+S  K VW
Sbjct  314  EFDKMTLVWGKPRQPPLGSEEWEIFLDSEGRVIDSKALKKRIFYGGVEHSTCKEVW  369


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASM--TRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASD  290
            ++ D SD+  YAAS+QQG ASM  TRS++ K ++S+  +   +  L D V ++P QYAS+
Sbjct  5    DLHDLSDDGDYAASLQQGPASMMMTRSDVGKSTSSSVPEGAEVVYLKDNVTIHPTQYASE  64

Query  291  WINNQLRQINQGKPIL  338
             I+ +L+ I QG  + 
Sbjct  65   RISGRLKLIKQGSYLF  80



>ref|XP_004287286.1| PREDICTED: TBC1 domain family member 15 [Fragaria vesca subsp. 
vesca]
Length=659

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD  SLVWGKPRQP +   EW TFLDSEGR+ + +ALRKRIFYGG+E+ LRK VW
Sbjct  313  EFDKNSLVWGKPRQPPLEFDEWRTFLDSEGRITDSEALRKRIFYGGVEHKLRKEVW  368



>ref|XP_008354495.1| PREDICTED: GTPase-activating protein gyp7-like [Malus domestica]
Length=398

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 55/77 (71%), Gaps = 1/77 (1%)
 Frame = +3

Query  354  RKHDHDEEPATKVQPLI-NYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALR  530
            +K  HD   A +  P+  +  +FD  S+VWGKPRQP +G  EW  F DSEGR+++ +A+R
Sbjct  292  QKXSHDSNRAPEKSPVPPDSLEFDKESMVWGKPRQPPLGSDEWEAFFDSEGRIIDSEAIR  351

Query  531  KRIFYGGLENSLRKXVW  581
            KRIFYGG+E++LRK V+
Sbjct  352  KRIFYGGVEHNLRKEVF  368


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAAS+Q GSASM RS+  K S+S++ D   +  L D VA++P Q+ S+ I
Sbjct  5    ELHDLSDDADYAASLQXGSASMMRSDSGKHSSSSEHDGAEVVFLKDNVAIHPTQFVSERI  64

Query  297  NNQLRQINQGKPIL  338
            + +LR I QG  + 
Sbjct  65   SGRLRLIKQGSSLF  78



>gb|AIU48686.1| RabGAP/TBC domain-containing protein, partial [Ginkgo biloba]
Length=617

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  429  SLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            +LVWGKPR P +G +EWATF+DSEGRV++ +ALRKRIFYGG+E++LR+ VWK
Sbjct  291  TLVWGKPRLPPLGIEEWATFVDSEGRVVDSKALRKRIFYGGIEHNLRQEVWK  342



>gb|AIU48640.1| RabGAP/TBC domain-containing protein, partial [Arabidopsis lyrata]
Length=627

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 83/152 (55%), Gaps = 11/152 (7%)
 Frame = +3

Query  150  AASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWINNQLRQINQGK  329
            +A I    +S+ +S +RK  + + + D+ I  L     V   ++A D    QL   N G 
Sbjct  196  SADIGNRVSSVIQSGLRKHKSHDPTRDLSIHLLEKFSLVT--KFARD-TTTQLFSENNGF  252

Query  330  PILTKS----SFRKHDH----DEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWAT  485
              + K       R +      DEE +  +    +  +F+ +SLVWGKPRQP MG +E+  
Sbjct  253  GSVDKRWNNLPIRHYSENLLKDEEISNDIDVPADPLEFNKLSLVWGKPRQPPMGHKEFTA  312

Query  486  FLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
             LDSEGRV+  +ALR+R+FYGG+E+ LR+ VW
Sbjct  313  LLDSEGRVVESKALRERVFYGGIEHQLRREVW  344



>ref|XP_006372159.1| hypothetical protein POPTR_0018s12770g [Populus trichocarpa]
 gb|ERP49956.1| hypothetical protein POPTR_0018s12770g [Populus trichocarpa]
Length=630

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD ++LVWGKPRQP +G +EW  FLDSEGR+++ +AL+KRIFYGG+E+S  K VW
Sbjct  283  EFDKMTLVWGKPRQPPLGSEEWEIFLDSEGRIIDSKALKKRIFYGGVEHSTCKEVW  338



>gb|AIU48670.1| RabGAP/TBC domain-containing protein, partial [Populus trichocarpa]
Length=627

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD ++LVWGKPRQP +G +EW  FLDSEGR+++ +AL+KRIFYGG+E+S  K VW
Sbjct  289  EFDKMTLVWGKPRQPPLGSEEWEIFLDSEGRIIDSKALKKRIFYGGVEHSTCKEVW  344



>ref|XP_002324638.2| hypothetical protein POPTR_0018s12770g [Populus trichocarpa]
 gb|EEF03203.2| hypothetical protein POPTR_0018s12770g [Populus trichocarpa]
Length=661

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD ++LVWGKPRQP +G +EW  FLDSEGR+++ +AL+KRIFYGG+E+S  K VW
Sbjct  314  EFDKMTLVWGKPRQPPLGSEEWEIFLDSEGRIIDSKALKKRIFYGGVEHSTCKEVW  369


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASM--TRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASD  290
            ++ D SD+  YAAS+QQGSASM  TRS+  K ++S+  +   +  L D V ++P QYAS+
Sbjct  5    DLHDLSDDADYAASLQQGSASMMMTRSDSGKSTSSSVPEGAEVVYLKDNVTIHPTQYASE  64

Query  291  WINNQLRQINQGKPIL  338
             I+ +L+ I QG  + 
Sbjct  65   RISGRLKLIKQGSSLF  80



>gb|AIU48664.1| RabGAP/TBC domain-containing protein, partial [Asparagus officinalis]
Length=625

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            K D ++LVWGKPRQ  +G +EW  FLDSEGR+++ +ALRKRIFYGG+E+ LRK +WK
Sbjct  289  KSDELNLVWGKPRQRPLGVEEWEAFLDSEGRIVDSKALRKRIFYGGVEHGLRKEIWK  345



>ref|XP_011469988.1| PREDICTED: LOW QUALITY PROTEIN: TBC1 domain family member 15-like 
[Fragaria vesca subsp. vesca]
Length=634

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXV  578
            +FD  SLVWGKPR P +   EW TFLDSEGR+M+ +ALRKRIFYGG+E+ LRK V
Sbjct  288  EFDKNSLVWGKPRHPPLETDEWHTFLDSEGRIMDSEALRKRIFYGGVEHKLRKEV  342



>gb|AIU48641.1| RabGAP/TBC domain-containing protein, partial [Arabidopsis thaliana]
Length=626

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 79/147 (54%), Gaps = 18/147 (12%)
 Frame = +3

Query  174  ASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWINNQLRQINQG---------  326
            +S+++S  RK  + + + D+ I  L     V   ++A D    QL   N G         
Sbjct  204  SSVSQSGFRKQKSHDPTRDLSIHLLEKFSLVT--KFARD-TTTQLFSENNGFGSIDKRWN  260

Query  327  -KPILTKS-SFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSE  500
             +PI   S +  K D          PL    +FD +SL+WGKPRQP MG +E+   LDSE
Sbjct  261  NQPIRHYSENLLKDDEISYIDVPADPL----EFDKLSLMWGKPRQPPMGHKEFTALLDSE  316

Query  501  GRVMNPQALRKRIFYGGLENSLRKXVW  581
            GRV+  +ALR+R+FYGG+E+ LR+ VW
Sbjct  317  GRVVESKALRERVFYGGIEHQLRREVW  343



>gb|KFK26862.1| hypothetical protein AALP_AA8G303600 [Arabis alpina]
Length=675

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  369  DEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYG  548
            DEE +  +    +  +F  +SLVWGKPRQ  MG +E+  FLDSEGRV++P+ LR+R+FYG
Sbjct  316  DEEISNDIDVPADPLEFTKLSLVWGKPRQSPMGREEFTAFLDSEGRVVDPKGLRERVFYG  375

Query  549  GLENSLRKXVW  581
            G+E+ LR+ VW
Sbjct  376  GIEHQLRREVW  386


 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 47/75 (63%), Gaps = 1/75 (1%)
 Frame = +3

Query  102  AMLAREIIDPSDNI-YYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQ  278
            +M A E+ D SD+  Y AAS QQGSASM R +  K S+S++ +   +    D VA++P Q
Sbjct  2    SMEASELQDLSDDADYAAASQQQGSASMMRCDSEKRSSSSEHEGAELIYTKDNVAIHPTQ  61

Query  279  YASDWINNQLRQINQ  323
            +AS+ I+ +L+   Q
Sbjct  62   FASERISGRLKLTKQ  76



>ref|XP_008362894.1| PREDICTED: TBC1 domain family member 17-like [Malus domestica]
Length=659

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD  S+VWGKPRQP +G  EW  F DSEGR+++ +  RKRIFYGG+E++LRK VW
Sbjct  313  EFDKESMVWGKPRQPPLGSDEWEAFFDSEGRIIDSEXXRKRIFYGGVEHNLRKEVW  368


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAAS+Q GSASM RS+  K S+S++ D   +  L D VA++P Q+ S+ I
Sbjct  5    ELHDLSDDADYAASLQXGSASMMRSDSGKHSSSSEHDGAEVVFLKDNVAIHPTQFVSERI  64

Query  297  NNQLRQINQGKPIL  338
            + +LR I QG  + 
Sbjct  65   SGRLRLIKQGSSLF  78



>ref|XP_002864184.1| hypothetical protein ARALYDRAFT_495330 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40443.1| hypothetical protein ARALYDRAFT_495330 [Arabidopsis lyrata subsp. 
lyrata]
Length=674

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 63/95 (66%), Gaps = 2/95 (2%)
 Frame = +3

Query  303  QLRQINQGKPILTKSSFRKHD--HDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQE  476
            +L  I + K    + S+ ++D   DEE +  +    +  +F+ +SLVWGKPRQP MG +E
Sbjct  291  KLSNIAEEKHNEIRHSYSENDLLKDEEISNDIDVPADPLEFNKLSLVWGKPRQPPMGHKE  350

Query  477  WATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +   LDSEGRV+  +ALR+R+FYGG+E+ LR+ VW
Sbjct  351  FTALLDSEGRVVESKALRERVFYGGIEHQLRREVW  385


 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RS+  K S+ ++ DD  +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQQQGSASMMRSDSGKRSSPSEHDDAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQGKPIL  338
            AS+ I+ +L+   Q   + 
Sbjct  62   ASERISGRLKLTKQDSVLF  80



>gb|AIU48653.1| RabGAP/TBC domain-containing protein, partial [Capsella rubella]
Length=626

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 82/155 (53%), Gaps = 17/155 (11%)
 Frame = +3

Query  150  AASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI------NNQLR  311
            +A +    +S+ +  +RK  + + + D+ I  L     V   ++A D        NN   
Sbjct  195  SADVGNRVSSVNQYGLRKQKSHDPTRDLSIHLLEKFSLVT--KFARDTTTQLFSENNGFG  252

Query  312  QI-----NQGKPILTKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQE  476
             I     NQ  P    + F+    DEE A  V    +  + + +SLVWGKPRQP MG +E
Sbjct  253  SIDKRWNNQPSPHYLDNPFK----DEEIANNVDVPDDPLEVNKLSLVWGKPRQPPMGRKE  308

Query  477  WATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +  FLDSEGRV+  +ALR+R+FYGG+E+ LR  VW
Sbjct  309  FTAFLDSEGRVVESKALRERVFYGGIEHQLRSEVW  343



>ref|NP_200071.2| RabGAP/TBC domain-containing protein [Arabidopsis thaliana]
 gb|AED96237.1| RabGAP/TBC domain-containing protein [Arabidopsis thaliana]
Length=673

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +FD +SL+WGKPRQP MG +E+   LDSEGRV+  +ALR+R+FYGG+E+ LR+ VW
Sbjct  329  EFDKLSLMWGKPRQPPMGHKEFTALLDSEGRVVESKALRERVFYGGIEHQLRREVW  384


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RS+  K S  ++ +D  +  L D VA++P Q+
Sbjct  2    SMEATELQDLSDDADYAASQQQGSASMMRSDSGKRSLQSEHEDAVLIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQGKPIL  338
            AS+ I+ +L+   Q   + 
Sbjct  62   ASERISGRLKLTKQDSVLF  80



>ref|XP_010911930.1| PREDICTED: TBC1 domain family member 17 isoform X2 [Elaeis guineensis]
Length=532

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 65/116 (56%), Gaps = 7/116 (6%)
 Frame = +3

Query  237  IACLNDKVAVNPMQYASDWINNQLRQINQGKPILTKSSFRKHDHDEEPATKVQPLINYNK  416
            I  L+  +A  P+ + S  +   L  + Q   I+  +       D+     V    +  +
Sbjct  135  IVVLSSGLAFPPLYFYSGGVREFLGTLKQHIFIMRSA-------DDANVFLVNDFQDPLQ  187

Query  417  FDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            FD + LVWGK R+  +   EWA FLDSEGRV++ +ALRKRIFYGG E++LRK VWK
Sbjct  188  FDKLPLVWGKQRESPLCLAEWAAFLDSEGRVVDSKALRKRIFYGGAEHNLRKEVWK  243



>ref|XP_006280129.1| hypothetical protein CARUB_v10026023mg [Capsella rubella]
 gb|EOA13027.1| hypothetical protein CARUB_v10026023mg [Capsella rubella]
Length=672

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 76/137 (55%), Gaps = 6/137 (4%)
 Frame = +3

Query  177  SMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWINNQLRQINQGKP--ILTKSS  350
            S+     R  +T   S++ G   ++ +    P+    + ++N   + +Q  P   L    
Sbjct  251  SLVTKFARDTTTQLFSENNGFGSIDKRWNNQPVHSYPEKLSNIAEEKHQESPHSYLDNDP  310

Query  351  FRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALR  530
            F+    DEE A  V    +  + + +SLVWGKPRQP MG +E+  FLDSEGRV+  +ALR
Sbjct  311  FK----DEEIANNVDVPDDPLEVNKLSLVWGKPRQPPMGRKEFTAFLDSEGRVVESKALR  366

Query  531  KRIFYGGLENSLRKXVW  581
            +R+FYGG+E+ LR  VW
Sbjct  367  ERVFYGGIEHQLRSEVW  383


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM R +  K S+ ++ DD  +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQQQGSASMMRCDSGKRSSPSEHDDAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQGKPIL  338
            AS+ I+ +L+   Q   + 
Sbjct  62   ASERISGRLKLTKQDSVLF  80



>ref|XP_010482625.1| PREDICTED: TBC1 domain family member 15-like isoform X1 [Camelina 
sativa]
Length=678

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  369  DEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYG  548
            DEE +  V    +  +F+ +SLVWGKPRQ  MG +E+  FLDSEGRV+  +ALR+R+FYG
Sbjct  319  DEEISNDVDVPADPLEFNKLSLVWGKPRQSPMGHKEFTAFLDSEGRVVESKALRERVFYG  378

Query  549  GLENSLRKXVW  581
            G+E+ LR+ VW
Sbjct  379  GIEHQLRREVW  389


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RSN  K S  ++ DD  +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQQQGSASMMRSNSGKRSLPSEHDDAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQGKPIL  338
            AS+ I+ +L+   Q   + 
Sbjct  62   ASERISGRLKLTKQDSVLF  80



>gb|AIU48677.1| RabGAP/TBC domain-containing protein, partial [Yucca filamentosa]
Length=624

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            D ++LVWGKPRQ  +   EW  FLDSEGR+M+ +ALRKRIFYGG+E+++RK +WK
Sbjct  290  DGLNLVWGKPRQKPLSIDEWGDFLDSEGRIMDSKALRKRIFYGGVEHNMRKEIWK  344



>ref|XP_010445069.1| PREDICTED: TBC1 domain family member 15-like isoform X1 [Camelina 
sativa]
Length=678

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  369  DEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYG  548
            DEE +  V    +  +F+ +SLVWGKPRQ  MG +E+  FLDSEGRV+  +ALR+R+FYG
Sbjct  319  DEEISNDVDVPADPLEFNKLSLVWGKPRQSPMGHKEFTAFLDSEGRVVESKALRERVFYG  378

Query  549  GLENSLRKXVW  581
            G+E+ LR+ VW
Sbjct  379  GIEHQLRREVW  389


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RSN  K S  ++ DD  +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQQQGSASMMRSNSGKRSLPSEHDDAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQGKPIL  338
            AS+ I+ +L+   Q   + 
Sbjct  62   ASERISGRLKLTKQDSVLF  80



>ref|XP_010482627.1| PREDICTED: TBC1 domain family member 15-like isoform X3 [Camelina 
sativa]
Length=679

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  369  DEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYG  548
            DEE +  V    +  +F+ +SLVWGKPRQ  MG +E+  FLDSEGRV+  +ALR+R+FYG
Sbjct  320  DEEISNDVDVPADPLEFNKLSLVWGKPRQSPMGHKEFTAFLDSEGRVVESKALRERVFYG  379

Query  549  GLENSLRKXVW  581
            G+E+ LR+ VW
Sbjct  380  GIEHQLRREVW  390


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RSN  K S  ++ DD  +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQQQGSASMMRSNSGKRSLPSEHDDAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQGKPIL  338
            AS+ I+ +L+   Q   + 
Sbjct  62   ASERISGRLKLTKQDSVLF  80



>ref|XP_010482626.1| PREDICTED: TBC1 domain family member 15-like isoform X2 [Camelina 
sativa]
Length=672

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  369  DEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYG  548
            DEE +  V    +  +F+ +SLVWGKPRQ  MG +E+  FLDSEGRV+  +ALR+R+FYG
Sbjct  313  DEEISNDVDVPADPLEFNKLSLVWGKPRQSPMGHKEFTAFLDSEGRVVESKALRERVFYG  372

Query  549  GLENSLRKXVW  581
            G+E+ LR+ VW
Sbjct  373  GIEHQLRREVW  383


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RSN  K S  ++ DD  +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQQQGSASMMRSNSGKRSLPSEHDDAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQGKPIL  338
            AS+ I+ +L+   Q   + 
Sbjct  62   ASERISGRLKLTKQDSVLF  80



>ref|XP_010442797.1| PREDICTED: TBC1 domain family member 15-like [Camelina sativa]
Length=672

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  369  DEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYG  548
            DEE +  V    +  +F+ +SLVWGKPRQ  MG +E+  FLDSEGRV+  +ALR+R+FYG
Sbjct  313  DEEISNDVDVPADPLEFNKLSLVWGKPRQSPMGHKEFTAFLDSEGRVVESKALRERVFYG  372

Query  549  GLENSLRKXVW  581
            G+E+ LR+ VW
Sbjct  373  GIEHQLRREVW  383


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RSN  K S  ++ DD  +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQQQGSASMMRSNSGKRSLPSEHDDAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQGKPIL  338
            AS+ I+ +L+   Q   + 
Sbjct  62   ASERISGRLKLTKQDSVLF  80



>ref|XP_010445073.1| PREDICTED: TBC1 domain family member 15-like isoform X2 [Camelina 
sativa]
Length=672

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  369  DEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYG  548
            DEE +  V    +  +F+ +SLVWGKPRQ  MG +E+  FLDSEGRV+  +ALR+R+FYG
Sbjct  313  DEEISNDVDVPADPLEFNKLSLVWGKPRQSPMGHKEFTAFLDSEGRVVESKALRERVFYG  372

Query  549  GLENSLRKXVW  581
            G+E+ LR+ VW
Sbjct  373  GIEHQLRREVW  383


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RSN  K S  ++ DD  +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQQQGSASMMRSNSGKRSLPSEHDDAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQGKPIL  338
            AS+ I+ +L+   Q   + 
Sbjct  62   ASERISGRLKLTKQDSVLF  80



>ref|XP_010911929.1| PREDICTED: TBC1 domain family member 15 isoform X1 [Elaeis guineensis]
Length=667

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            +FD + LVWGK R+  +   EWA FLDSEGRV++ +ALRKRIFYGG E++LRK VWK
Sbjct  322  EFDKLPLVWGKQRESPLCLAEWAAFLDSEGRVVDSKALRKRIFYGGAEHNLRKEVWK  378



>ref|XP_001783529.1| predicted protein [Physcomitrella patens]
 gb|EDQ51665.1| predicted protein [Physcomitrella patens]
Length=485

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  399  LINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXV  578
            L++  + D+ +LVWG+ R P +G +EWATFLDSEGRV++P+AL+KR+F+GG+E +LR  +
Sbjct  139  LVDGTQNDSPALVWGRARPPPLGHEEWATFLDSEGRVVDPKALKKRVFHGGVEPNLRPEL  198

Query  579  WK  584
            WK
Sbjct  199  WK  200



>gb|AIU48691.1| RabGAP/TBC domain-containing protein, partial [Cabomba caroliniana]
Length=409

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            + D +SLVWGKPR   +G +EW+ FLD+EGR+ + +ALR++IFYGG++  LRK VWK
Sbjct  77   EIDKLSLVWGKPRLHHLGSEEWSKFLDAEGRITDSKALREQIFYGGVKPQLRKEVWK  133



>gb|AIU48667.1| RabGAP/TBC domain-containing protein, partial [Canna indica]
Length=628

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 59/101 (58%), Gaps = 5/101 (5%)
 Frame = +3

Query  285  SDWIN-NQLRQINQGKPILTKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPS  461
            SD +N  + +Q N    + T SS  K    +       PL    +F+ + L+WGK R   
Sbjct  250  SDGLNAYEKKQQNNYSSVHTSSSDEKEKTSDMSPVASDPL----EFEELRLIWGKQRMHP  305

Query  462  MGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            +  +EW +F DSEGR+ + +ALR+RIFYGG+E+ +RK VWK
Sbjct  306  LSFEEWTSFFDSEGRITDSKALRERIFYGGVEDDIRKKVWK  346



>ref|XP_009420718.1| PREDICTED: TBC1 domain family member 15 [Musa acuminata subsp. 
malaccensis]
Length=667

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            +F+ + LVWGK R   +  +EWA FLDSEGR+++ +ALR+RIFYGG++ ++RK VWK
Sbjct  322  EFEKLPLVWGKQRMHPLCLEEWAAFLDSEGRILDSKALRERIFYGGVDQNIRKEVWK  378



>dbj|BAA98077.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAC42472.1| unknown protein [Arabidopsis thaliana]
 gb|ABH11525.1| rabGAP [Arabidopsis thaliana]
Length=338

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +3

Query  435  VWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +WGKPRQP MG +E+   LDSEGRV+  +ALR+R+FYGG+E+ LR+ VW
Sbjct  1    MWGKPRQPPMGHKEFTALLDSEGRVVESKALRERVFYGGIEHQLRREVW  49



>gb|AIU48642.1| RabGAP/TBC domain-containing protein, partial [Lilium brownii]
Length=620

 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +3

Query  432  LVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            L+WGK RQ  +  +EWA F+D+EGR+++ ++L+KRIFYGG+E++LRK VWK
Sbjct  288  LIWGKQRQSPLCLEEWAAFIDTEGRIIDSESLKKRIFYGGVEHNLRKEVWK  338



>gb|AIU48688.1| RabGAP/TBC domain-containing protein, partial [Zea mays]
Length=450

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            D + LVWGK R   +  +EW +FLD EGR+M+ +ALRK++FYGG++++LRK VWK
Sbjct  114  DPLPLVWGKQRDHPLSVEEWTSFLDREGRIMDSKALRKKVFYGGVDHALRKEVWK  168



>ref|NP_001168835.1| uncharacterized protein LOC100382640 [Zea mays]
 gb|ACN30830.1| unknown [Zea mays]
 gb|AFW63576.2| hypothetical protein ZEAMMB73_375304 [Zea mays]
Length=671

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            D + LVWGK R   +  +EW +FLD EGR+M+ +ALRK++FYGG++++LRK VWK
Sbjct  328  DPLPLVWGKQRDHPLSVEEWTSFLDREGRIMDSKALRKKVFYGGVDHALRKEVWK  382



>gb|EEC73873.1| hypothetical protein OsI_08649 [Oryza sativa Indica Group]
Length=682

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  423  NVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            N  L WGKPR+  +   EW +FLD EGRVM+ +ALRK++FYGG+++ LRK VWK
Sbjct  335  NKILAWGKPREQPLSVDEWRSFLDPEGRVMDSKALRKKVFYGGIDHVLRKEVWK  388



>ref|NP_001047892.1| Os02g0709800 [Oryza sativa Japonica Group]
 dbj|BAD72476.1| GTPase activating protein-like [Oryza sativa Japonica Group]
 dbj|BAF09806.1| Os02g0709800 [Oryza sativa Japonica Group]
 dbj|BAG91061.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57667.1| hypothetical protein OsJ_08107 [Oryza sativa Japonica Group]
Length=679

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  423  NVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            N  L WGKPR+  +   EW +FLD EGRVM+ +ALRK++FYGG+++ LRK VWK
Sbjct  337  NKILAWGKPREQPLSVDEWRSFLDPEGRVMDSKALRKKVFYGGIDHVLRKEVWK  390



>gb|AIU48679.1| RabGAP/TBC domain-containing protein, partial [Sorghum bicolor]
Length=616

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            D + LVWGK R   +  +EW  FLD EGRVM+ +ALRK++FYGG++++LRK VWK
Sbjct  280  DPLPLVWGKQRDRPLSVEEWTAFLDPEGRVMDSKALRKKVFYGGVDHALRKEVWK  334



>ref|XP_002452666.1| hypothetical protein SORBIDRAFT_04g030250 [Sorghum bicolor]
 gb|EES05642.1| hypothetical protein SORBIDRAFT_04g030250 [Sorghum bicolor]
Length=661

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            D + LVWGK R   +  +EW  FLD EGRVM+ +ALRK++FYGG++++LRK VWK
Sbjct  318  DPLPLVWGKQRDRPLSVEEWTAFLDPEGRVMDSKALRKKVFYGGVDHALRKEVWK  372



>ref|NP_001190524.1| RabGAP/TBC domain-containing protein [Arabidopsis thaliana]
 gb|AED96238.1| RabGAP/TBC domain-containing protein [Arabidopsis thaliana]
Length=690

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 17/73 (23%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQE-----------------WATFLDSEGRVMNPQALRKRIF  542
            +FD +SL+WGKPRQP MG +E                 +   LDSEGRV+  +ALR+R+F
Sbjct  329  EFDKLSLMWGKPRQPPMGHKERRNDISPSIKCRISTEYFTALLDSEGRVVESKALRERVF  388

Query  543  YGGLENSLRKXVW  581
            YGG+E+ LR+ VW
Sbjct  389  YGGIEHQLRREVW  401


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RS+  K S  ++ +D  +  L D VA++P Q+
Sbjct  2    SMEATELQDLSDDADYAASQQQGSASMMRSDSGKRSLQSEHEDAVLIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQGKPIL  338
            AS+ I+ +L+   Q   + 
Sbjct  62   ASERISGRLKLTKQDSVLF  80



>gb|AIU48678.1| RabGAP/TBC domain-containing protein, partial [Setaria italica]
Length=628

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            D + LVWGK R   +  +EWA FLD EGRVM+ +ALRK++FYGG+++ LR+ VWK
Sbjct  292  DPLPLVWGKQRDRPLSAEEWAAFLDPEGRVMDSKALRKKVFYGGVDHVLREKVWK  346



>ref|XP_004953647.1| PREDICTED: TBC1 domain family member 15-like [Setaria italica]
Length=672

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            D + LVWGK R   +  +EWA FLD EGRVM+ +ALRK++FYGG+++ LR+ VWK
Sbjct  329  DPLPLVWGKQRDRPLSAEEWAAFLDPEGRVMDSKALRKKVFYGGVDHVLREKVWK  383



>gb|EMT03185.1| TBC1 domain family member 15 [Aegilops tauschii]
Length=591

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            D + LVWGK R   +  +EW  FLD EGR+M+ +ALRK+IFYGG+++ LRK VWK
Sbjct  289  DELLLVWGKKRGNPLSVEEWRAFLDPEGRIMDSKALRKKIFYGGVDHVLRKEVWK  343



>gb|AIU48672.1| RabGAP/TBC domain-containing protein, partial [Panicum virgatum]
Length=628

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            D + LVWGK R   +   EW  FLD EGRVM+ +ALRK++FYGG+E+ LRK VWK
Sbjct  292  DPLPLVWGKQRDCPLSVAEWTAFLDPEGRVMDSKALRKKVFYGGVEHVLRKEVWK  346



>gb|AIU48646.1| RabGAP/TBC domain-containing protein, partial [Brachypodium distachyon]
Length=628

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            D + LVWGK R   +   EW  FLD EGR+M+ +ALRK++FYGG+++ LRK VWK
Sbjct  292  DELLLVWGKKRGSPLTVDEWRAFLDPEGRIMDSKALRKKVFYGGVDHVLRKEVWK  346



>ref|XP_003570212.1| PREDICTED: TBC1 domain family member 15 [Brachypodium distachyon]
Length=677

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            D + LVWGK R   +   EW  FLD EGR+M+ +ALRK++FYGG+++ LRK VWK
Sbjct  334  DELLLVWGKKRGSPLTVDEWRAFLDPEGRIMDSKALRKKVFYGGVDHVLRKEVWK  388



>dbj|BAK05291.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=680

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            D + LVW K R   +  +EW  FLD EGR+M+ +ALRK+IFYGG+++ LRK VWK
Sbjct  337  DELLLVWEKKRGSPLSVEEWRAFLDPEGRIMDSKALRKKIFYGGVDHVLRKEVWK  391



>ref|XP_006647781.1| PREDICTED: TBC1 domain family member 15-like [Oryza brachyantha]
Length=635

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +3

Query  429  SLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            SL WGK R+  +  +EW +FLD EGRV++ +ALR +IFYGG+++ LRK VWK
Sbjct  295  SLAWGKQREQPLSVEEWRSFLDPEGRVVDSKALRNKIFYGGVDHVLRKEVWK  346



>gb|KDO80158.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=638

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 39/55 (71%), Gaps = 2/55 (4%)
 Frame = +3

Query  417  FDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVW  581
            +D  ++V   P  P   P EW TFLD+EGRVM+  ALRKRIFYGG+++ LR+ VW
Sbjct  296  YDTETIVNEIPVAPD--PVEWTTFLDNEGRVMDSNALRKRIFYGGVDHKLRREVW  348



>gb|AIU48644.1| RabGAP/TBC domain-containing protein, partial [Musa acuminata]
Length=319

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +3

Query  474  EWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            +WA FLDSEGR+++ +ALR+RIFYGG++ ++RK VWK
Sbjct  1    QWAAFLDSEGRILDSKALRERIFYGGVDQNIRKEVWK  37



>dbj|BAA98076.1| unnamed protein product [Arabidopsis thaliana]
Length=327

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 51/87 (59%), Gaps = 0/87 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RS+  K S  ++ +D  +  L D VA++P Q+
Sbjct  2    SMEATELQDLSDDADYAASQQQGSASMMRSDSGKRSLQSEHEDAVLIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQGKPILTKSSFRKH  362
            AS+ I+++        P     S R+H
Sbjct  62   ASERISDRSLYTITAVPFTEVRSIRRH  88



>ref|XP_004338737.1| TBC domain containing protein [Acanthamoeba castellanii str. 
Neff]
 gb|ELR16724.1| TBC domain containing protein [Acanthamoeba castellanii str. 
Neff]
Length=418

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +3

Query  450  RQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            R+  + PQEW +F D  GR+ N + LRK+IFYGG++ S+R+ VWK
Sbjct  76   RKAPLSPQEWRSFFDETGRITNERKLRKKIFYGGVDPSIRREVWK  120



>gb|EPS58476.1| hypothetical protein M569_16338, partial [Genlisea aurea]
Length=340

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   E+ D SD++ YAASIQQGSAS+ R++  K S +++ +      + D V ++P Q+A
Sbjct  1    MHETELSDLSDDVDYAASIQQGSASIYRTDSGKRSQTSEPEGAEAVYIKDNVTIHPTQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ + QG  + 
Sbjct  61   SERISGRLKLLKQGNALF  78



>gb|KHG10934.1| TBC1 domain family member 17 [Gossypium arboreum]
Length=142

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   EI D SD+  YAAS  QGSASM R    K S+SN+ +   +  + D V ++P Q+A
Sbjct  1    MQETEIHDLSDDADYAASQHQGSASMMRCESGKRSSSNEPEGAEVVYMEDNVTIHPTQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I Q     
Sbjct  61   SERISGRLKLIKQSSSFF  78



>ref|XP_006381118.1| hypothetical protein POPTR_0006s06510g, partial [Populus trichocarpa]
 gb|ERP58915.1| hypothetical protein POPTR_0006s06510g, partial [Populus trichocarpa]
Length=301

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASM--TRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASD  290
            E+ D SD+  YAAS+QQGSA+M  TR++  + ++S+  +   I  L D V ++P QYAS+
Sbjct  5    ELHDLSDDADYAASLQQGSANMMITRTDSGRSTSSSVPEGAEIVYLKDNVTIHPTQYASE  64

Query  291  WINNQLRQINQGKPIL  338
             I+ +L+ I QG  + 
Sbjct  65   RISGRLKLIKQGSSLF  80



>ref|XP_002673421.1| rabGTPase-activating protein [Naegleria gruberi]
 gb|EFC40677.1| rabGTPase-activating protein [Naegleria gruberi]
Length=717

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 35/47 (74%), Gaps = 1/47 (2%)
 Frame = +3

Query  447  PRQPS-MGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            PR  + +  + W T+ D EGR+ + QAL+++I+YGG+ENS+RK VWK
Sbjct  392  PRMDTPITAESWKTYFDEEGRIKDFQALKEKIYYGGVENSIRKEVWK  438



>ref|XP_005649420.1| RabGAP/TBC [Coccomyxa subellipsoidea C-169]
 gb|EIE24876.1| RabGAP/TBC [Coccomyxa subellipsoidea C-169]
Length=656

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = +3

Query  375  EPATKVQP--LINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYG  548
            E AT V    L++ +  ++ + V   PR P M  +E+ +FL S+GR+ N +A+R R+FY 
Sbjct  315  EAATAVGAFELLDRDLLESATSVRNAPRPPPMHHEEFCSFLGSDGRIANEKAMRARVFYS  374

Query  549  GLENSLRKXVWK  584
            G E  +R+ VWK
Sbjct  375  GCEPEVRREVWK  386



>ref|XP_003742417.1| PREDICTED: TBC1 domain family member 25-like [Metaseiulus occidentalis]
Length=776

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  453  QPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            +P M  +EW  FLD EGR++ PQ LR+ +F GG+E SLR  VWK
Sbjct  187  KPPMSRREWQNFLDCEGRLIQPQELRRSVFRGGIEPSLRNIVWK  230



>ref|XP_008101787.1| PREDICTED: TBC1 domain family member 25 isoform X2 [Anolis carolinensis]
Length=563

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 44/67 (66%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ  ++++  ++V     KP +P +   E+ TFL+ EG++  P  LR RIF+GG+E S
Sbjct  49   SKVQQALSWSYGEDV-----KPFKPPLSDSEFHTFLNHEGQLTKPAELRLRIFHGGVEPS  103

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  104  LRKVVWR  110



>gb|ETE68555.1| TBC1 domain family member 17 [Ophiophagus hannah]
Length=644

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +3

Query  450  RQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            R+  +  QEW   LD +GRV++P  LRKRIF GGL  SLRK VWK
Sbjct  269  RETPVTEQEWEQHLDPDGRVLDPIGLRKRIFAGGLSMSLRKEVWK  313



>ref|XP_007435599.1| PREDICTED: LOW QUALITY PROTEIN: TBC1 domain family member 17 
[Python bivittatus]
Length=641

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +3

Query  450  RQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            R+  +  QEW   LD +GRV++P  LRKRIF GGL  SLRK VWK
Sbjct  266  RESPITEQEWEQHLDPDGRVLDPIGLRKRIFAGGLSMSLRKEVWK  310



>ref|XP_003216761.1| PREDICTED: TBC1 domain family member 25 isoform X1 [Anolis carolinensis]
Length=694

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 44/67 (66%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ  ++++  ++V     KP +P +   E+ TFL+ EG++  P  LR RIF+GG+E S
Sbjct  180  SKVQQALSWSYGEDV-----KPFKPPLSDSEFHTFLNHEGQLTKPAELRLRIFHGGVEPS  234

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  235  LRKVVWR  241



>gb|EHH60857.1| TBC1 domain family member 25 [Macaca fascicularis]
Length=690

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/67 (40%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+LD EG++  P+ LR RI++GG+E S
Sbjct  180  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLDHEGQLSRPEELRLRIYHGGVEPS  234

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  235  LRKVVWR  241



>ref|NP_001253225.1| TBC1 domain family member 25 [Macaca mulatta]
 ref|XP_005593533.1| PREDICTED: TBC1 domain family member 25 isoform X1 [Macaca fascicularis]
Length=688

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 27/67 (40%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+LD EG++  P+ LR RI++GG+E S
Sbjct  178  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLDHEGQLSRPEELRLRIYHGGVEPS  232

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  233  LRKVVWR  239



>gb|EPY76893.1| hypothetical protein CB1_001358002 [Camelus ferus]
Length=761

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  344  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  398

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  399  LRKVVWR  405



>ref|XP_002943822.2| PREDICTED: TBC1 domain family member 25-like [Xenopus (Silurana) 
tropicalis]
Length=602

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 27/67 (40%), Positives = 43/67 (64%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            T+VQ  +++   D+V     KP +P +   E+ T+L  EG++  P+ LR RI++GG+E S
Sbjct  57   TRVQQALSWTYSDDV-----KPFKPPLSDSEFHTYLSHEGQLTRPEELRLRIYHGGVEPS  111

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  112  LRKVVWR  118



>ref|XP_006822429.1| PREDICTED: TBC1 domain family member 15-like, partial [Saccoglossus 
kowalevskii]
Length=291

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +3

Query  450  RQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENSLRKXVWK  584
            RQ  + P+EW T LDS+GRVM    L ++I++GGL +S+RK VWK
Sbjct  225  RQDPVIPEEWQTHLDSDGRVMRKDLLIEKIYHGGLYHSIRKDVWK  269



>gb|KFO22672.1| TBC1 domain family member 25 [Fukomys damarensis]
Length=668

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ ++N++  +++     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  157  SKVQQVLNWSYGEDI-----KPFKPPLSDAEFHTYLNHEGQLSRPEDLRLRIYHGGVEPS  211

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  212  LRKVVWR  218



>ref|XP_010604738.1| PREDICTED: TBC1 domain family member 25, partial [Fukomys damarensis]
Length=672

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ ++N++  +++     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  161  SKVQQVLNWSYGEDI-----KPFKPPLSDAEFHTYLNHEGQLSRPEDLRLRIYHGGVEPS  215

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  216  LRKVVWR  222



>ref|XP_006190481.1| PREDICTED: TBC1 domain family member 25 [Camelus ferus]
Length=557

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  153  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  207

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  208  LRKVVWR  214



>gb|ETE62550.1| TBC1 domain family member 25, partial [Ophiophagus hannah]
Length=711

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 44/67 (66%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ  ++++  ++V     KP +P +   E+ T+L+ EG++  P  LR RIF+GG+E S
Sbjct  200  SKVQQALSWSYGEDV-----KPFKPPLSDSEFHTYLNHEGQLTKPAELRLRIFHGGVEPS  254

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  255  LRKVVWR  261



>ref|XP_004396835.1| PREDICTED: TBC1 domain family member 25 isoform 3 [Odobenus rosmarus 
divergens]
Length=559

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  50   SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  104

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  105  LRKVVWR  111



>ref|XP_002594452.1| hypothetical protein BRAFLDRAFT_72152 [Branchiostoma floridae]
 gb|EEN50463.1| hypothetical protein BRAFLDRAFT_72152 [Branchiostoma floridae]
Length=765

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            TK+  ++++N  D       KP +P++   E+ +FLD  GR++ P+ LR RI++GG++ +
Sbjct  186  TKMTQVLSFN--DTKEEEDEKPMKPALSDTEFHSFLDESGRLIRPEDLRLRIYHGGVDPA  243

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  244  LRKVVWR  250



>ref|XP_005887741.1| PREDICTED: TBC1 domain family member 25 isoform X4 [Bos mutus]
 ref|XP_005887742.1| PREDICTED: TBC1 domain family member 25 isoform X5 [Bos mutus]
Length=560

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  50   SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  104

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  105  LRKVVWR  111



>ref|XP_004672875.1| PREDICTED: TBC1 domain family member 25 isoform X3 [Jaculus jaculus]
Length=560

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  50   SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  104

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  105  LRKVVWR  111



>gb|ERE63732.1| TBC1 domain family member 25-like protein, partial [Cricetulus 
griseus]
Length=558

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  48   SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  102

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  103  LRKVVWR  109



>ref|XP_007081700.1| PREDICTED: TBC1 domain family member 25 [Panthera tigris altaica]
Length=496

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  164  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  218

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  219  LRKVVWR  225



>ref|XP_006527642.1| PREDICTED: TBC1 domain family member 25 isoform X1 [Mus musculus]
Length=560

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  50   SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  104

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  105  LRKVVWR  111



>ref|XP_007435441.1| PREDICTED: TBC1 domain family member 25 [Python bivittatus]
Length=714

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 44/67 (66%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ  ++++  ++V     KP +P +   E+ T+L+ EG++  P  LR RIF+GG+E S
Sbjct  202  SKVQQALSWSYGEDV-----KPFKPPLSDSEFHTYLNHEGQLTRPAELRLRIFHGGVEPS  256

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  257  LRKVVWR  263



>ref|XP_006165094.1| PREDICTED: TBC1 domain family member 25 [Tupaia chinensis]
Length=695

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  187  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  241

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  242  LRKVVWR  248



>ref|XP_005957025.1| PREDICTED: TBC1 domain family member 25 [Pantholops hodgsonii]
Length=584

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  177  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  231

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  232  LRKVVWR  238



>ref|XP_005411319.1| PREDICTED: TBC1 domain family member 25 isoform X2 [Chinchilla 
lanigera]
Length=569

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  59   SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  113

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  114  LRKVVWR  120



>ref|XP_003276927.1| PREDICTED: LOW QUALITY PROTEIN: TBC1 domain family member 25 
[Nomascus leucogenys]
Length=576

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  161  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  215

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  216  LRKVVWR  222



>ref|XP_006097228.1| PREDICTED: TBC1 domain family member 25 isoform X3 [Myotis lucifugus]
Length=560

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  50   SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  104

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  105  LRKVVWR  111



>ref|XP_005411320.1| PREDICTED: TBC1 domain family member 25 isoform X3 [Chinchilla 
lanigera]
Length=560

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  50   SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  104

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  105  LRKVVWR  111



>gb|EDL33960.1| ornithine aminotransferase-like 1, isoform CRA_b [Mus musculus]
Length=524

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  14   SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  68

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  69   LRKVVWR  75



>gb|ELV12326.1| TBC1 domain family member 25 [Tupaia chinensis]
Length=843

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  335  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  389

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  390  LRKVVWR  396



>ref|XP_005338702.1| PREDICTED: TBC1 domain family member 25 isoform X2 [Ictidomys 
tridecemlineatus]
Length=559

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  50   SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  104

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  105  LRKVVWR  111



>ref|XP_004690059.1| PREDICTED: TBC1 domain family member 25 [Condylura cristata]
Length=687

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 27/67 (40%), Positives = 45/67 (67%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+LD EG++  P  LR RI++GG+E S
Sbjct  177  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLDHEGQLSRPDELRLRIYHGGVEPS  231

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  232  LRKVVWR  238



>ref|XP_008156425.1| PREDICTED: TBC1 domain family member 25 isoform X2 [Eptesicus 
fuscus]
Length=569

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  59   SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  113

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  114  LRKVVWR  120



>ref|XP_005085193.1| PREDICTED: TBC1 domain family member 25 isoform X4 [Mesocricetus 
auratus]
 ref|XP_005085194.1| PREDICTED: TBC1 domain family member 25 isoform X5 [Mesocricetus 
auratus]
Length=555

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  50   SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  104

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  105  LRKVVWR  111



>ref|XP_006903157.1| PREDICTED: TBC1 domain family member 25-like [Elephantulus edwardii]
Length=682

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 45/67 (67%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ ++N++  ++V     KP +P +   E+  +L+ EG++  P+ LR RI++GG+E S
Sbjct  177  SKVQQVLNWSYGEDV-----KPFKPPLSDAEFHMYLNHEGQLSRPEELRLRIYHGGVEPS  231

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  232  LRKVVWR  238



>ref|XP_008840756.1| PREDICTED: TBC1 domain family member 25 isoform X1 [Nannospalax 
galili]
Length=678

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  170  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  224

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  225  LRKVVWR  231



>ref|XP_636536.1| RabGAP/TBC domain-containing protein [Dictyostelium discoideum 
AX4]
 gb|EAL63027.1| RabGAP/TBC domain-containing protein [Dictyostelium discoideum 
AX4]
Length=829

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 35/57 (61%), Gaps = 4/57 (7%)
 Frame = +3

Query  423  NVSLVWGKPRQPS--MGPQEWATFLDSEGRV--MNPQALRKRIFYGGLENSLRKXVW  581
            N S+  G  R+    M P EW ++ D EGR+   N Q L K+IFYGG+E S+R+ VW
Sbjct  484  NFSIELGANRRECNPMSPSEWYSYFDDEGRICLANQQILLKKIFYGGIEESIRQEVW  540



>ref|XP_005657862.1| PREDICTED: TBC1 domain family member 25 [Sus scrofa]
Length=788

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  275  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  329

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  330  LRKVVWR  336



>ref|XP_003807262.1| PREDICTED: TBC1 domain family member 25 isoform X2 [Pan paniscus]
Length=630

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  120  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  174

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  175  LRKVVWR  181



>ref|XP_010995179.1| PREDICTED: TBC1 domain family member 25 [Camelus dromedarius]
Length=687

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  177  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  231

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  232  LRKVVWR  238



>ref|NP_001192742.1| TBC1 domain family member 25 [Bos taurus]
 tpg|DAA12867.1| TPA: TBC1 domain family member 25-like [Bos taurus]
Length=687

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  177  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  231

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  232  LRKVVWR  238



>dbj|BAC30751.1| unnamed protein product [Mus musculus]
Length=688

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  178  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  232

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  233  LRKVVWR  239



>ref|XP_005887738.1| PREDICTED: TBC1 domain family member 25 isoform X1 [Bos mutus]
Length=691

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  181  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  235

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  236  LRKVVWR  242



>ref|XP_004612983.1| PREDICTED: LOW QUALITY PROTEIN: TBC1 domain family member 25 
[Sorex araneus]
Length=695

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  178  SKVQQVLSWSYGEDV-----KPFKPPLNDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  232

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  233  LRKVVWR  239



>ref|XP_008840757.1| PREDICTED: TBC1 domain family member 25 isoform X2 [Nannospalax 
galili]
Length=615

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  107  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  161

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  162  LRKVVWR  168



>ref|XP_005700869.1| PREDICTED: TBC1 domain family member 25 [Capra hircus]
Length=656

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  146  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  200

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  201  LRKVVWR  207



>ref|XP_006045738.1| PREDICTED: TBC1 domain family member 25 [Bubalus bubalis]
Length=687

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  177  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  231

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  232  LRKVVWR  238



>ref|XP_005887739.1| PREDICTED: TBC1 domain family member 25 isoform X2 [Bos mutus]
Length=687

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  177  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  231

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  232  LRKVVWR  238



>gb|EDL33959.1| ornithine aminotransferase-like 1, isoform CRA_a [Mus musculus]
Length=688

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  178  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  232

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  233  LRKVVWR  239



>ref|XP_004022163.1| PREDICTED: TBC1 domain family member 25 [Ovis aries]
Length=687

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  177  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  231

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  232  LRKVVWR  238



>gb|ELR62308.1| TBC1 domain family member 25 [Bos mutus]
Length=688

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  177  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  231

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  232  LRKVVWR  238



>ref|XP_007450933.1| PREDICTED: TBC1 domain family member 25 isoform X1 [Lipotes vexillifer]
Length=690

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  180  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  234

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  235  LRKVVWR  241



>gb|AAI13778.1| Tbc1d25 protein, partial [Mus musculus]
Length=717

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  207  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  261

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  262  LRKVVWR  268



>dbj|BAG57904.1| unnamed protein product [Homo sapiens]
Length=630

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  120  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  174

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  175  LRKVVWR  181



>ref|XP_004465025.1| PREDICTED: TBC1 domain family member 25 [Dasypus novemcinctus]
Length=687

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 45/67 (67%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ ++N++  ++V     KP +P +   E+  +L+ EG++  P+ LR RI++GG+E S
Sbjct  177  SKVQQVLNWSYGEDV-----KPFKPPLSDAEFHMYLNHEGQLSRPEELRLRIYHGGVEPS  231

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  232  LRKVVWR  238



>ref|XP_008156426.1| PREDICTED: TBC1 domain family member 25 isoform X3 [Eptesicus 
fuscus]
Length=688

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  178  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  232

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  233  LRKVVWR  239



>ref|XP_007989784.1| PREDICTED: LOW QUALITY PROTEIN: TBC1 domain family member 25 
[Chlorocebus sabaeus]
Length=685

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  178  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  232

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  233  LRKVVWR  239



>ref|XP_007450934.1| PREDICTED: TBC1 domain family member 25 isoform X2 [Lipotes vexillifer]
Length=686

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  176  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  230

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  231  LRKVVWR  237



>ref|XP_007115776.1| PREDICTED: TBC1 domain family member 25 [Physeter catodon]
Length=686

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  176  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  230

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  231  LRKVVWR  237



>ref|XP_010966423.1| PREDICTED: TBC1 domain family member 25 [Camelus bactrianus]
Length=687

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  177  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  231

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  232  LRKVVWR  238



>ref|XP_006213507.1| PREDICTED: TBC1 domain family member 25 [Vicugna pacos]
Length=687

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  177  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  231

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  232  LRKVVWR  238



>ref|XP_008156424.1| PREDICTED: TBC1 domain family member 25 isoform X1 [Eptesicus 
fuscus]
Length=692

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  182  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  236

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  237  LRKVVWR  243



>gb|AAI28566.1| Tbc1d25 protein, partial [Mus musculus]
Length=718

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  208  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  262

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  263  LRKVVWR  269



>ref|XP_005887740.1| PREDICTED: TBC1 domain family member 25 isoform X3 [Bos mutus]
Length=597

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  87   SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  141

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  142  LRKVVWR  148



>ref|XP_006097227.1| PREDICTED: TBC1 domain family member 25 isoform X2 [Myotis lucifugus]
Length=687

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  177  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  231

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  232  LRKVVWR  238



>ref|XP_007663252.1| PREDICTED: TBC1 domain family member 25, partial [Ornithorhynchus 
anatinus]
Length=729

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 45/67 (67%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ  ++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  171  SKVQQALSWSYGEDV-----KPFKPPLTDTEFHTYLNHEGQLTRPEELRLRIYHGGVEPS  225

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  226  LRKVVWR  232



>ref|XP_011384546.1| PREDICTED: TBC1 domain family member 25 isoform X3 [Pteropus 
vampyrus]
Length=618

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  108  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  162

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  163  LRKVVWR  169



>ref|XP_003917718.1| PREDICTED: TBC1 domain family member 25 [Papio anubis]
Length=688

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  178  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  232

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  233  LRKVVWR  239



>gb|AAA59593.1| located at OATL1, partial [Homo sapiens]
Length=651

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  141  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  195

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  196  LRKVVWR  202



>ref|XP_006758967.1| PREDICTED: TBC1 domain family member 25, partial [Myotis davidii]
Length=669

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  173  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  227

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  228  LRKVVWR  234



>ref|XP_011384545.1| PREDICTED: TBC1 domain family member 25 isoform X2 [Pteropus 
vampyrus]
Length=683

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  173  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  227

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  228  LRKVVWR  234



>ref|XP_004316042.1| PREDICTED: TBC1 domain family member 25 [Tursiops truncatus]
Length=686

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  176  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  230

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  231  LRKVVWR  237



>ref|XP_004282018.1| PREDICTED: TBC1 domain family member 25 [Orcinus orca]
Length=686

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  176  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  230

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  231  LRKVVWR  237



>ref|XP_011384543.1| PREDICTED: TBC1 domain family member 25 isoform X1 [Pteropus 
vampyrus]
Length=687

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  177  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  231

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  232  LRKVVWR  238



>ref|XP_006922822.1| PREDICTED: TBC1 domain family member 25 [Pteropus alecto]
 gb|ELK03440.1| TBC1 domain family member 25 [Pteropus alecto]
Length=687

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  177  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  231

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  232  LRKVVWR  238



>ref|XP_003939585.1| PREDICTED: TBC1 domain family member 25 [Saimiri boliviensis 
boliviensis]
Length=687

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  178  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  232

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  233  LRKVVWR  239



>ref|XP_005352876.1| PREDICTED: TBC1 domain family member 25 [Microtus ochrogaster]
Length=688

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  178  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  232

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  233  LRKVVWR  239



>gb|EGW06113.1| TBC1 domain family member 25 [Cricetulus griseus]
Length=688

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  178  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  232

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  233  LRKVVWR  239



>gb|EFB29245.1| hypothetical protein PANDA_006183 [Ailuropoda melanoleuca]
Length=647

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  138  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  192

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  193  LRKVVWR  199



>ref|NP_001159909.1| TBC1 domain family member 25 isoform 2 [Mus musculus]
Length=723

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  213  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  267

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  268  LRKVVWR  274



>ref|XP_006738425.1| PREDICTED: TBC1 domain family member 25 isoform X2 [Leptonychotes 
weddellii]
Length=686

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = +3

Query  384  TKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGLENS  563
            +KVQ +++++  ++V     KP +P +   E+ T+L+ EG++  P+ LR RI++GG+E S
Sbjct  177  SKVQQVLSWSYGEDV-----KPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPS  231

Query  564  LRKXVWK  584
            LRK VW+
Sbjct  232  LRKVVWR  238



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 737611932690