BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF038K19

Length=531
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDP30269.1|  hypothetical protein JCGZ_17051                         212   3e-63   Jatropha curcas
ref|XP_009600865.1|  PREDICTED: uncharacterized protein LOC104096230    213   6e-63   
ref|XP_002527188.1|  conserved hypothetical protein                     209   1e-62   Ricinus communis
ref|XP_009765496.1|  PREDICTED: uncharacterized protein LOC104217040    211   1e-62   Nicotiana sylvestris
ref|XP_010533148.1|  PREDICTED: uncharacterized protein LOC104808974    208   5e-62   Tarenaya hassleriana [spider flower]
ref|XP_004242773.1|  PREDICTED: uncharacterized protein LOC101245669    209   2e-61   Solanum lycopersicum
ref|XP_006358289.1|  PREDICTED: uncharacterized protein LOC102581466    207   6e-61   Solanum tuberosum [potatoes]
emb|CDP10433.1|  unnamed protein product                                206   6e-61   Coffea canephora [robusta coffee]
emb|CBI28217.3|  unnamed protein product                                202   1e-60   Vitis vinifera
ref|XP_002282244.1|  PREDICTED: uncharacterized protein LOC100250...    203   8e-60   
ref|XP_010050047.1|  PREDICTED: uncharacterized protein LOC104438569    202   1e-59   Eucalyptus grandis [rose gum]
ref|NP_189057.1|  uncharacterized protein                               199   3e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006418809.1|  hypothetical protein EUTSA_v10002599mg             198   7e-59   Eutrema salsugineum [saltwater cress]
ref|XP_004159421.1|  PREDICTED: uncharacterized protein LOC101231810    199   9e-59   
ref|XP_010513150.1|  PREDICTED: uncharacterized protein LOC104789100    198   1e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010466779.1|  PREDICTED: uncharacterized protein LOC104746927    198   1e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010488492.1|  PREDICTED: uncharacterized protein LOC104766324    198   1e-58   Camelina sativa [gold-of-pleasure]
ref|XP_004508476.1|  PREDICTED: uncharacterized protein LOC101503440    199   2e-58   Cicer arietinum [garbanzo]
gb|KFK30783.1|  hypothetical protein AALP_AA6G025400                    196   2e-58   Arabis alpina [alpine rockcress]
gb|ACU17650.1|  unknown                                                 199   2e-58   Glycine max [soybeans]
gb|KHN22114.1|  hypothetical protein glysoja_033428                     199   3e-58   Glycine soja [wild soybean]
ref|XP_006600747.1|  PREDICTED: uncharacterized protein LOC100806760    198   3e-58   
ref|XP_002324645.2|  hypothetical protein POPTR_0018s12880g             198   4e-58   
gb|KHN15074.1|  hypothetical protein glysoja_011692                     198   4e-58   Glycine soja [wild soybean]
ref|XP_004139410.1|  PREDICTED: uncharacterized protein LOC101205660    199   4e-58   Cucumis sativus [cucumbers]
ref|XP_011020154.1|  PREDICTED: uncharacterized protein LOC105122...    199   4e-58   Populus euphratica
gb|KJB64739.1|  hypothetical protein B456_010G062400                    198   6e-58   Gossypium raimondii
ref|XP_011017791.1|  PREDICTED: uncharacterized protein LOC105121...    199   6e-58   Populus euphratica
ref|XP_008352256.1|  PREDICTED: uncharacterized protein LOC103415739    198   6e-58   
gb|KJB64738.1|  hypothetical protein B456_010G062400                    198   7e-58   Gossypium raimondii
ref|XP_009364005.1|  PREDICTED: uncharacterized protein LOC103953...    199   7e-58   
ref|XP_010103724.1|  hypothetical protein L484_016640                   197   7e-58   Morus notabilis
ref|XP_009368876.1|  PREDICTED: uncharacterized protein LOC103958346    197   8e-58   Pyrus x bretschneideri [bai li]
ref|XP_011017792.1|  PREDICTED: uncharacterized protein LOC105121...    198   9e-58   Populus euphratica
gb|KDP33588.1|  hypothetical protein JCGZ_07159                         197   1e-57   Jatropha curcas
ref|XP_011017790.1|  PREDICTED: uncharacterized protein LOC105121...    198   1e-57   Populus euphratica
emb|CDX85164.1|  BnaC07g07420D                                          195   1e-57   
gb|KJB64735.1|  hypothetical protein B456_010G062400                    197   1e-57   Gossypium raimondii
ref|XP_002883480.1|  hypothetical protein ARALYDRAFT_479917             195   1e-57   
ref|XP_002324862.2|  hypothetical protein POPTR_0018s01770g             198   1e-57   
gb|KHG12959.1|  Deoxyguanosinetriphosphate triphosphohydrolase-li...    196   1e-57   Gossypium arboreum [tree cotton]
gb|ACJ85266.1|  unknown                                                 197   1e-57   Medicago truncatula
ref|XP_003609369.1|  hypothetical protein MTR_4g114900                  197   2e-57   Medicago truncatula
ref|XP_003527166.1|  PREDICTED: uncharacterized protein LOC100798900    194   3e-57   Glycine max [soybeans]
ref|XP_011081559.1|  PREDICTED: uncharacterized protein LOC105164...    194   3e-57   Sesamum indicum [beniseed]
gb|EPS60827.1|  hypothetical protein M569_13973                         187   3e-57   Genlisea aurea
ref|XP_009102549.1|  PREDICTED: uncharacterized protein LOC103828677    193   4e-57   Brassica rapa
ref|XP_010541912.1|  PREDICTED: uncharacterized protein LOC104815272    197   4e-57   Tarenaya hassleriana [spider flower]
ref|XP_007202061.1|  hypothetical protein PRUPE_ppa006809mg             195   4e-57   
ref|XP_002285150.2|  PREDICTED: uncharacterized protein LOC100266444    196   5e-57   Vitis vinifera
ref|XP_007013493.1|  Uncharacterized protein TCM_038116                 195   6e-57   
gb|AFK38384.1|  unknown                                                 195   6e-57   Medicago truncatula
ref|XP_008456897.1|  PREDICTED: uncharacterized protein LOC103496707    196   7e-57   Cucumis melo [Oriental melon]
ref|XP_008242797.1|  PREDICTED: uncharacterized protein LOC103341097    195   9e-57   Prunus mume [ume]
ref|XP_007155026.1|  hypothetical protein PHAVU_003G166900g             194   9e-57   Phaseolus vulgaris [French bean]
ref|XP_007155025.1|  hypothetical protein PHAVU_003G166900g             194   1e-56   Phaseolus vulgaris [French bean]
emb|CAN68624.1|  hypothetical protein VITISV_010682                     197   1e-56   Vitis vinifera
ref|XP_011084102.1|  PREDICTED: uncharacterized protein LOC105166449    194   1e-56   
emb|CBI21048.3|  unnamed protein product                                195   2e-56   Vitis vinifera
gb|EYU20259.1|  hypothetical protein MIMGU_mgv1a010337mg                191   3e-56   Erythranthe guttata [common monkey flower]
ref|XP_004288790.1|  PREDICTED: uncharacterized protein LOC101293823    193   4e-56   Fragaria vesca subsp. vesca
ref|XP_010090609.1|  hypothetical protein L484_004495                   192   5e-56   Morus notabilis
ref|XP_011036558.1|  PREDICTED: uncharacterized protein LOC105134027    192   5e-56   Populus euphratica
ref|XP_006483371.1|  PREDICTED: uncharacterized protein LOC102623950    191   1e-55   Citrus sinensis [apfelsine]
ref|XP_007011853.1|  Uncharacterized protein isoform 2                  191   1e-55   
ref|XP_011039682.1|  PREDICTED: uncharacterized protein LOC105136151    192   1e-55   Populus euphratica
gb|KDO61741.1|  hypothetical protein CISIN_1g017107mg                   191   1e-55   Citrus sinensis [apfelsine]
ref|XP_006450423.1|  hypothetical protein CICLE_v10008661mg             191   2e-55   Citrus clementina [clementine]
ref|XP_009106210.1|  PREDICTED: uncharacterized protein LOC103832004    189   2e-55   Brassica rapa
gb|KHG13215.1|  Histone acetyltransferase                               191   2e-55   Gossypium arboreum [tree cotton]
emb|CDP13523.1|  unnamed protein product                                191   2e-55   Coffea canephora [robusta coffee]
emb|CDY18077.1|  BnaA01g23380D                                          189   2e-55   Brassica napus [oilseed rape]
ref|XP_002515508.1|  conserved hypothetical protein                     190   4e-55   Ricinus communis
ref|XP_002309630.1|  hypothetical protein POPTR_0006s27080g             190   4e-55   Populus trichocarpa [western balsam poplar]
gb|KHN00068.1|  hypothetical protein glysoja_050053                     188   5e-55   Glycine soja [wild soybean]
ref|XP_008363007.1|  PREDICTED: uncharacterized protein LOC103426701    191   5e-55   
ref|XP_010656446.1|  PREDICTED: uncharacterized protein LOC100250...    190   5e-55   Vitis vinifera
ref|XP_006842047.1|  hypothetical protein AMTR_s00078p00021180          192   6e-55   Amborella trichopoda
ref|XP_007011852.1|  Uncharacterized protein isoform 1                  190   7e-55   
ref|XP_011081560.1|  PREDICTED: uncharacterized protein LOC105164...    181   8e-55   Sesamum indicum [beniseed]
gb|KJB55018.1|  hypothetical protein B456_009G058400                    189   1e-54   Gossypium raimondii
ref|XP_007011854.1|  Uncharacterized protein isoform 3                  190   1e-54   
ref|XP_006450882.1|  hypothetical protein CICLE_v10008357mg             189   2e-54   Citrus clementina [clementine]
ref|XP_002308071.1|  hypothetical protein POPTR_0006s06600g             180   2e-54   
ref|XP_009138075.1|  PREDICTED: uncharacterized protein LOC103862117    184   3e-54   Brassica rapa
ref|XP_008219505.1|  PREDICTED: uncharacterized protein LOC103319706    188   3e-54   Prunus mume [ume]
ref|XP_007222724.1|  hypothetical protein PRUPE_ppa006474mg             188   3e-54   Prunus persica
emb|CDX75234.1|  BnaA01g04680D                                          184   4e-54   
ref|XP_009126211.1|  PREDICTED: uncharacterized protein LOC103851128    184   5e-54   Brassica rapa
ref|XP_007138398.1|  hypothetical protein PHAVU_009G205400g             186   5e-54   Phaseolus vulgaris [French bean]
ref|XP_006412493.1|  hypothetical protein EUTSA_v10026043mg             183   7e-54   Eutrema salsugineum [saltwater cress]
ref|XP_010437926.1|  PREDICTED: uncharacterized protein LOC104721601    182   1e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010432739.1|  PREDICTED: uncharacterized protein LOC104716...    182   1e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010247601.1|  PREDICTED: uncharacterized protein LOC104590583    187   2e-53   Nelumbo nucifera [Indian lotus]
emb|CDX72353.1|  BnaC07g43750D                                          181   2e-53   
ref|XP_010250149.1|  PREDICTED: uncharacterized protein LOC104592463    187   2e-53   Nelumbo nucifera [Indian lotus]
ref|NP_680756.1|  uncharacterized protein                               181   3e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002869285.1|  hypothetical protein ARALYDRAFT_491499             181   4e-53   Arabidopsis lyrata subsp. lyrata
ref|XP_008394095.1|  PREDICTED: uncharacterized protein LOC103456208    185   4e-53   Malus domestica [apple tree]
ref|XP_009355751.1|  PREDICTED: uncharacterized protein LOC103946707    185   5e-53   Pyrus x bretschneideri [bai li]
ref|XP_006284395.1|  hypothetical protein CARUB_v10005566mg             180   8e-53   
ref|XP_010048959.1|  PREDICTED: uncharacterized protein LOC104437...    184   8e-53   
ref|XP_009364006.1|  PREDICTED: uncharacterized protein LOC103953...    183   4e-52   
ref|XP_008809840.1|  PREDICTED: uncharacterized protein LOC103721416    183   6e-52   Phoenix dactylifera
ref|XP_011459176.1|  PREDICTED: uncharacterized protein LOC101295200    181   7e-52   Fragaria vesca subsp. vesca
ref|XP_010525953.1|  PREDICTED: uncharacterized protein LOC104803655    180   8e-52   Tarenaya hassleriana [spider flower]
ref|XP_004138852.1|  PREDICTED: uncharacterized protein LOC101206923    181   9e-52   Cucumis sativus [cucumbers]
gb|KJB06292.1|  hypothetical protein B456_001G033800                    181   1e-51   Gossypium raimondii
ref|XP_003522611.1|  PREDICTED: uncharacterized protein LOC100803...    177   1e-51   Glycine max [soybeans]
gb|ACU23696.1|  unknown                                                 177   1e-51   Glycine max [soybeans]
ref|XP_010696141.1|  PREDICTED: uncharacterized protein LOC104908692    179   2e-51   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008389784.1|  PREDICTED: uncharacterized protein LOC103452076    181   2e-51   
ref|XP_009384142.1|  PREDICTED: uncharacterized protein LOC103971756    179   6e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008445225.1|  PREDICTED: uncharacterized protein LOC103488...    179   9e-51   Cucumis melo [Oriental melon]
ref|XP_003526402.1|  PREDICTED: uncharacterized protein LOC100791147    175   2e-50   Glycine max [soybeans]
gb|KHG05548.1|  Histone acetyltransferase                               177   2e-50   Gossypium arboreum [tree cotton]
ref|XP_009774219.1|  PREDICTED: uncharacterized protein LOC104224298    177   2e-50   Nicotiana sylvestris
ref|XP_010922409.1|  PREDICTED: uncharacterized protein LOC105045704    179   3e-50   Elaeis guineensis
ref|XP_009621783.1|  PREDICTED: uncharacterized protein LOC104113357    177   3e-50   Nicotiana tomentosiformis
ref|XP_008779015.1|  PREDICTED: uncharacterized protein LOC103698...    177   1e-49   Phoenix dactylifera
ref|XP_009405444.1|  PREDICTED: uncharacterized protein LOC103988586    175   1e-49   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK29838.1|  hypothetical protein AALP_AA7G185400                    170   9e-49   Arabis alpina [alpine rockcress]
ref|XP_004138854.1|  PREDICTED: uncharacterized protein LOC101207405    171   3e-48   
ref|XP_004160792.1|  PREDICTED: uncharacterized protein LOC101231818    170   1e-47   
ref|XP_008466415.1|  PREDICTED: uncharacterized protein LOC103503829    169   2e-47   Cucumis melo [Oriental melon]
gb|KGN60097.1|  hypothetical protein Csa_3G878170                       168   3e-47   Cucumis sativus [cucumbers]
ref|XP_006578142.1|  PREDICTED: uncharacterized protein LOC100803...    166   4e-47   Glycine max [soybeans]
emb|CDX68833.1|  BnaC01g06200D                                          165   9e-47   
ref|XP_010451087.1|  PREDICTED: uncharacterized protein LOC104733182    162   3e-46   Camelina sativa [gold-of-pleasure]
ref|XP_007137014.1|  hypothetical protein PHAVU_009G092700g             164   5e-46   Phaseolus vulgaris [French bean]
ref|XP_008445226.1|  PREDICTED: uncharacterized protein LOC103488...    163   7e-45   Cucumis melo [Oriental melon]
ref|XP_004245316.1|  PREDICTED: uncharacterized protein LOC101252800    156   1e-42   Solanum lycopersicum
ref|XP_006343528.1|  PREDICTED: uncharacterized protein LOC102603247    155   2e-42   Solanum tuberosum [potatoes]
ref|XP_002961523.1|  hypothetical protein SELMODRAFT_437855             150   2e-39   
ref|XP_002971290.1|  hypothetical protein SELMODRAFT_441416             150   2e-39   
gb|KGN62956.1|  hypothetical protein Csa_2G381810                       148   3e-39   Cucumis sativus [cucumbers]
ref|XP_004136479.1|  PREDICTED: uncharacterized protein LOC101219225    140   2e-36   
dbj|BAB01356.1|  unnamed protein product                                139   2e-35   Arabidopsis thaliana [mouse-ear cress]
gb|KJB65832.1|  hypothetical protein B456_010G115300                    136   8e-35   Gossypium raimondii
emb|CDY45344.1|  BnaC01g30480D                                          133   9e-35   Brassica napus [oilseed rape]
ref|XP_008779016.1|  PREDICTED: uncharacterized protein LOC103698...    123   9e-30   Phoenix dactylifera
gb|KJB83194.1|  hypothetical protein B456_013G234700                    109   4e-27   Gossypium raimondii
gb|EYU18251.1|  hypothetical protein MIMGU_mgv1a009013mg                110   2e-25   Erythranthe guttata [common monkey flower]
gb|KJB64737.1|  hypothetical protein B456_010G062400                    100   7e-22   Gossypium raimondii
gb|KGN62958.1|  hypothetical protein Csa_2G381830                     99.8    1e-21   Cucumis sativus [cucumbers]
ref|XP_008445231.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  98.2    4e-21   
ref|XP_008385411.1|  PREDICTED: uncharacterized protein LOC103447...  94.7    7e-20   
ref|NP_001078480.1|  uncharacterized protein                          84.7    5e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010048962.1|  PREDICTED: uncharacterized protein LOC104437...  84.3    2e-16   
ref|XP_008385417.1|  PREDICTED: uncharacterized protein LOC103447...  79.0    3e-14   
ref|XP_010656448.1|  PREDICTED: uncharacterized protein LOC100250...  75.9    3e-13   Vitis vinifera
ref|XP_008337391.1|  PREDICTED: uncharacterized protein LOC103400513  70.9    4e-12   
ref|XP_006298289.1|  hypothetical protein CARUB_v10014354mg           71.2    7e-12   
gb|KJB65833.1|  hypothetical protein B456_010G115300                  69.3    5e-11   Gossypium raimondii
ref|XP_010432738.1|  PREDICTED: uncharacterized protein LOC104716951  63.2    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010048961.1|  PREDICTED: uncharacterized protein LOC104437...  62.8    9e-09   Eucalyptus grandis [rose gum]
ref|XP_007511391.1|  histone acetyltransferase                        60.5    2e-07   Bathycoccus prasinos
ref|XP_008445227.1|  PREDICTED: uncharacterized protein LOC103488...  59.3    2e-07   Cucumis melo [Oriental melon]
ref|XP_003060719.1|  histone acetyltransferase                        55.1    9e-06   Micromonas pusilla CCMP1545
gb|AES80967.2|  F-box/RNI superfamily protein, putative               52.8    4e-05   Medicago truncatula
emb|CEF97646.1|  Zinc finger, PHD-finger                              52.8    4e-05   Ostreococcus tauri
ref|XP_003624749.1|  hypothetical protein MTR_7g087040                52.8    4e-05   
gb|ABK23198.1|  unknown                                               48.9    5e-04   Picea sitchensis



>gb|KDP30269.1| hypothetical protein JCGZ_17051 [Jatropha curcas]
Length=430

 Score =   212 bits (539),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+PIRGSII +I R V E HS ATKKN+EWQ KLPIVVL+
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPIRGSIIQQIFRVVNETHSVATKKNKEWQEKLPIVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY +PDTLWDR+NDA++TIIR DE+SETG+HLPPC+EAALNLGC+
Sbjct  61   AEEIMYSKANSEAEYMNPDTLWDRLNDAVNTIIRRDENSETGEHLPPCIEAALNLGCI  118



>ref|XP_009600865.1| PREDICTED: uncharacterized protein LOC104096230 [Nicotiana tomentosiformis]
Length=473

 Score =   213 bits (541),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+PIRGSII +I R V ERHS  TKKNREWQ KLPIVV +
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPIRGSIIQQIFRVVQERHSVVTKKNREWQQKLPIVVFK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVAE  523
            +EEIMYSK+NSEAEY DP+TLWDR+NDAI TIIR DE++ETGQ LPPCVEAALNLGC AE
Sbjct  61   SEEIMYSKSNSEAEYMDPETLWDRLNDAIDTIIRRDETAETGQFLPPCVEAALNLGCTAE  120

Query  524  K  526
            +
Sbjct  121  R  121



>ref|XP_002527188.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35201.1| conserved hypothetical protein [Ricinus communis]
Length=373

 Score =   209 bits (532),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+P+RGS+IH+I R V E HS  TKKN+EWQ KLPIVVL+
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPMRGSVIHQIFRVVSETHSAITKKNKEWQEKLPIVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY +PDTLWDRVNDAI+TIIR DES+ETG+ LPPC+EAALNLGC+
Sbjct  61   AEEIMYSKANSEAEYMNPDTLWDRVNDAINTIIRRDESNETGELLPPCIEAALNLGCI  118



>ref|XP_009765496.1| PREDICTED: uncharacterized protein LOC104217040 [Nicotiana sylvestris]
Length=478

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+PIRGSII +I R V ERH   TKKNREWQ KLPIVV +
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPIRGSIIQQIFRVVQERHGVVTKKNREWQQKLPIVVFK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVAE  523
            AEEIMYSKANSEAEY DP+TLWDR+N+AI TIIR DE++ETGQ LPPCVEAALNLGC AE
Sbjct  61   AEEIMYSKANSEAEYMDPETLWDRLNEAIDTIIRRDETAETGQFLPPCVEAALNLGCTAE  120

Query  524  K  526
            +
Sbjct  121  R  121



>ref|XP_010533148.1| PREDICTED: uncharacterized protein LOC104808974 [Tarenaya hassleriana]
Length=396

 Score =   208 bits (529),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECV+RAWHSD+H+PIRGSIIH+I R V E HS  TKKN+EWQ KLP+VVL+
Sbjct  1    MPRPGPRPYECVKRAWHSDLHQPIRGSIIHKIFRLVMEAHSATTKKNKEWQEKLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVA  520
            AEEIMYSKANSE EY + +TLWDRVNDA+ TIIR DES+ETGQ LPPCVEAALNLGC+A
Sbjct  61   AEEIMYSKANSEEEYTNAETLWDRVNDAVDTIIRRDESTETGQLLPPCVEAALNLGCIA  119



>ref|XP_004242773.1| PREDICTED: uncharacterized protein LOC101245669 [Solanum lycopersicum]
Length=482

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+P+RGSI  +I R V ERHS  TKKNREWQ KLP+VVL+
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPMRGSITQQIFRVVIERHSVVTKKNREWQQKLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVAE  523
            AEEIMYSKANSEAEY DP+TLWDRVNDAI TIIR DE++E GQ LPPCVEAALNLGC+ E
Sbjct  61   AEEIMYSKANSEAEYMDPETLWDRVNDAIDTIIRRDETTEIGQLLPPCVEAALNLGCIPE  120

Query  524  K  526
            +
Sbjct  121  R  121



>ref|XP_006358289.1| PREDICTED: uncharacterized protein LOC102581466 [Solanum tuberosum]
Length=481

 Score =   207 bits (528),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 106/121 (88%), Gaps = 1/121 (1%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+P+RGSII +I R V ERHS  TKKNREWQ KLP+VVL+
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPMRGSIIQQIFRVVRERHSVVTKKNREWQQKLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVAE  523
            AEEIMYSKANSEAEY DP+TLWDRVNDAI TIIR DE +ETGQ LPPCVEAALNLGC+ E
Sbjct  61   AEEIMYSKANSEAEYMDPETLWDRVNDAIDTIIRRDE-TETGQLLPPCVEAALNLGCIPE  119

Query  524  K  526
            +
Sbjct  120  R  120



>emb|CDP10433.1| unnamed protein product [Coffea canephora]
Length=427

 Score =   206 bits (524),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+PIRGSII RI + VYERH   T+KN EWQ KLPIVVL+
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPIRGSIIQRIFKLVYERHGAVTRKNNEWQAKLPIVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVAE  523
            AEEIMYSKA+SEA+Y D +T+WDRVNDAI TIIR DES+ETG+ LPPCVEAALNLGCV E
Sbjct  61   AEEIMYSKADSEAQYMDLETVWDRVNDAIDTIIRRDESTETGELLPPCVEAALNLGCVPE  120

Query  524  K  526
            +
Sbjct  121  R  121



>emb|CBI28217.3| unnamed protein product [Vitis vinifera]
Length=302

 Score =   202 bits (513),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+P+RGSII +I R V + HS+ATKKNREWQ KLPIVVL+
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPMRGSIIQQIFRVVTDTHSSATKKNREWQEKLPIVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSE EY D  TLWDRVNDA++TIIR DES+ETG+ LPPC+EAALNLGCV
Sbjct  61   AEEIMYSKANSETEYMDLGTLWDRVNDAVNTIIRRDESTETGELLPPCIEAALNLGCV  118



>ref|XP_002282244.1| PREDICTED: uncharacterized protein LOC100250879 isoform X1 [Vitis 
vinifera]
 ref|XP_010656444.1| PREDICTED: uncharacterized protein LOC100250879 isoform X1 [Vitis 
vinifera]
 ref|XP_010656445.1| PREDICTED: uncharacterized protein LOC100250879 isoform X1 [Vitis 
vinifera]
Length=424

 Score =   203 bits (516),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+P+RGSII +I R V + HS+ATKKNREWQ KLPIVVL+
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPMRGSIIQQIFRVVTDTHSSATKKNREWQEKLPIVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSE EY D  TLWDRVNDA++TIIR DES+ETG+ LPPC+EAALNLGCV
Sbjct  61   AEEIMYSKANSETEYMDLGTLWDRVNDAVNTIIRRDESTETGELLPPCIEAALNLGCV  118



>ref|XP_010050047.1| PREDICTED: uncharacterized protein LOC104438569 [Eucalyptus grandis]
 gb|KCW82888.1| hypothetical protein EUGRSUZ_C04258 [Eucalyptus grandis]
Length=422

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHS+ H+P+RG+II +I R V E HS+ATKKNREWQ KLPIVV R
Sbjct  1    MPRPGPRPYECVRRAWHSERHQPMRGTIIQQIFRVVSEAHSSATKKNREWQEKLPIVVFR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY D DTLW+RVNDAI+TIIR DES+ETG  LPPCVEAALNLGCV
Sbjct  61   AEEIMYSKANSEAEYMDADTLWERVNDAINTIIRRDESTETGCLLPPCVEAALNLGCV  118



>ref|NP_189057.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAF00723.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE76863.1| uncharacterized protein AT3G24150 [Arabidopsis thaliana]
Length=343

 Score =   199 bits (507),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECV+RAWHSD H+PIRGSII +I R   E HS AT+KN+EWQ KLP+VVL+
Sbjct  1    MPRPGPRPYECVKRAWHSDRHQPIRGSIIRQIFRLAMEAHSAATRKNKEWQEKLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVA  520
            AEEIMYSKANSE EY D DT+W+RVNDAI TIIR DES+ETG  LPPCVEAALNLGC+A
Sbjct  61   AEEIMYSKANSEEEYTDADTMWNRVNDAIDTIIRRDESTETGPLLPPCVEAALNLGCIA  119



>ref|XP_006418809.1| hypothetical protein EUTSA_v10002599mg [Eutrema salsugineum]
 gb|ESQ37245.1| hypothetical protein EUTSA_v10002599mg [Eutrema salsugineum]
Length=342

 Score =   198 bits (504),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECV+RAWHSD H+PIRGSII +I R   E HS AT+KN+EWQ KLP+VVL+
Sbjct  1    MPRPGPRPYECVKRAWHSDRHQPIRGSIIRQIFRLAMEAHSGATRKNKEWQEKLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVA  520
            AEEIMYSKANSE EY D DT+W+RVNDAI TIIR DES+ETG  LPPCVEAALNLGC+A
Sbjct  61   AEEIMYSKANSEEEYTDADTMWNRVNDAIDTIIRRDESTETGPLLPPCVEAALNLGCIA  119



>ref|XP_004159421.1| PREDICTED: uncharacterized protein LOC101231810 [Cucumis sativus]
Length=394

 Score =   199 bits (507),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+P+RGSII +I R V E H+ ATKKN+EWQ KLPIVV R
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPMRGSIIQQIFRVVNENHTPATKKNKEWQEKLPIVVFR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSE EY + +TLWDR+NDA++TIIR DESSE+G+ LPPCVEAALNLGCV
Sbjct  61   AEEIMYSKANSEVEYMNLETLWDRLNDAVNTIIRRDESSESGELLPPCVEAALNLGCV  118



>ref|XP_010513150.1| PREDICTED: uncharacterized protein LOC104789100 [Camelina sativa]
Length=346

 Score =   198 bits (503),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECV+RAWHSD H+PIRGSII +I R   E HS AT+KN+EWQ KLP+VVL+
Sbjct  1    MPRPGPRPYECVKRAWHSDRHQPIRGSIIRQIFRLAMEAHSAATRKNKEWQEKLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVA  520
            AEEIMYSKANSE EY D DT+W+RVNDAI TIIR DES+ETG  LPPCVEAALNLGC+A
Sbjct  61   AEEIMYSKANSEEEYTDADTMWNRVNDAIDTIIRRDESTETGPLLPPCVEAALNLGCIA  119



>ref|XP_010466779.1| PREDICTED: uncharacterized protein LOC104746927 [Camelina sativa]
Length=350

 Score =   198 bits (504),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECV+RAWHSD H+PIRGSII +I R   E HS AT+KN+EWQ KLP+VVL+
Sbjct  1    MPRPGPRPYECVKRAWHSDRHQPIRGSIIRQIFRLAMEAHSAATRKNKEWQEKLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVA  520
            AEEIMYSKANSE EY D DT+W+RVNDAI TIIR DES+ETG  LPPCVEAALNLGC+A
Sbjct  61   AEEIMYSKANSEEEYTDADTMWNRVNDAIDTIIRRDESTETGPLLPPCVEAALNLGCIA  119



>ref|XP_010488492.1| PREDICTED: uncharacterized protein LOC104766324 [Camelina sativa]
Length=348

 Score =   198 bits (503),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECV+RAWHSD H+PIRGSII +I R   E HS AT+KN+EWQ KLP+VVL+
Sbjct  1    MPRPGPRPYECVKRAWHSDRHQPIRGSIIRQIFRLAMEAHSAATRKNKEWQEKLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVA  520
            AEEIMYSKANSE EY D DT+W+RVNDAI TIIR DES+ETG  LPPCVEAALNLGC+A
Sbjct  61   AEEIMYSKANSEEEYTDADTMWNRVNDAIDTIIRRDESTETGPLLPPCVEAALNLGCIA  119



>ref|XP_004508476.1| PREDICTED: uncharacterized protein LOC101503440 [Cicer arietinum]
Length=399

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHS+ H+P+RGSII  I R V + H+ ATKKN+EWQ KLP+VVL+
Sbjct  1    MPRPGPRPYECVRRAWHSERHQPLRGSIIQHIFRVVTDAHTPATKKNKEWQEKLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGC  514
            AEEIMYSKANSEAEY++PDTLWDR+NDA++TIIR DE++ETG  LPPCVEAALNLGC
Sbjct  61   AEEIMYSKANSEAEYSNPDTLWDRLNDAVNTIIRRDETTETGDLLPPCVEAALNLGC  117



>gb|KFK30783.1| hypothetical protein AALP_AA6G025400 [Arabis alpina]
Length=313

 Score =   196 bits (499),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECV+R WHSD H+PIRGSII +I R   E HSTAT+KN+EWQ KLPIVVL+
Sbjct  1    MPRPGPRPYECVKRVWHSDRHQPIRGSIIRQIFRLAMEAHSTATRKNKEWQEKLPIVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVAE  523
            AEEIMYSKANSE EY + DT+W+RVNDAI TIIR DES+ETG  LPPCVEAALNLGC+  
Sbjct  61   AEEIMYSKANSEEEYTNADTMWNRVNDAIDTIIRRDESTETGPLLPPCVEAALNLGCIVV  120

Query  524  K  526
            K
Sbjct  121  K  121



>gb|ACU17650.1| unknown [Glycine max]
Length=399

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHS+ H+P+RGSII +I R V + HS ATKKN+EWQ KLP+VVL+
Sbjct  1    MPRPGPRPYECVRRAWHSERHQPVRGSIIQQIFRVVNDAHSPATKKNKEWQEKLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGC  514
            AEEIMYSKANSEAEY +PDTLWDR+NDA++TIIR DE++ETG  LPPCVEAALNLGC
Sbjct  61   AEEIMYSKANSEAEYLNPDTLWDRLNDAVNTIIRRDETTETGDLLPPCVEAALNLGC  117



>gb|KHN22114.1| hypothetical protein glysoja_033428 [Glycine soja]
Length=403

 Score =   199 bits (505),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHS+ H+P+RGSII +I R V + HS ATKKN+EWQ KLP+VVL+
Sbjct  1    MPRPGPRPYECVRRAWHSERHQPVRGSIIQQIFRVVNDAHSPATKKNKEWQEKLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGC  514
            AEEIMYSKANSEAEY +PDTLWDR+NDA++TIIR DE++ETG  LPPCVEAALNLGC
Sbjct  61   AEEIMYSKANSEAEYLNPDTLWDRLNDAVNTIIRRDETTETGDLLPPCVEAALNLGC  117



>ref|XP_006600747.1| PREDICTED: uncharacterized protein LOC100806760 [Glycine max]
Length=405

 Score =   198 bits (504),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHS+ H+P+RGSII +I R V + HS ATKKN+EWQ KLP+VVL+
Sbjct  1    MPRPGPRPYECVRRAWHSERHQPVRGSIIQQIFRVVNDAHSPATKKNKEWQEKLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVA  520
            AEEIMYSKANSEAEY +PDTLWDR+NDA++TIIR DE++ETG  LPPCVEAALNLGC A
Sbjct  61   AEEIMYSKANSEAEYLNPDTLWDRLNDAVNTIIRRDETTETGGLLPPCVEAALNLGCKA  119



>ref|XP_002324645.2| hypothetical protein POPTR_0018s12880g [Populus trichocarpa]
 gb|EEF03210.2| hypothetical protein POPTR_0018s12880g [Populus trichocarpa]
Length=395

 Score =   198 bits (503),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD HKPIRGS+I +ILR  Y+ HS ATK NREWQ KL +VV R
Sbjct  1    MPRPGPRPYECVRRAWHSDRHKPIRGSMIGQILRMAYDTHSAATKGNREWQDKLLLVVYR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVAE  523
            AEEIMYSKANSEAEY   DTLWDRVNDA++TIIR DES+ETG  LPPC+EAALNLGC  E
Sbjct  61   AEEIMYSKANSEAEYVSQDTLWDRVNDAVNTIIRRDESTETGDLLPPCIEAALNLGCKVE  120

Query  524  K  526
            +
Sbjct  121  R  121



>gb|KHN15074.1| hypothetical protein glysoja_011692 [Glycine soja]
Length=405

 Score =   198 bits (504),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHS+ H+P+RGSII +I R V + HS ATKKN+EWQ KLP+VVL+
Sbjct  1    MPRPGPRPYECVRRAWHSERHQPVRGSIIQQIFRVVNDAHSPATKKNKEWQEKLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVA  520
            AEEIMYSKANSEAEY +PDTLWDR+NDA++TIIR DE++ETG  LPPCVEAALNLGC A
Sbjct  61   AEEIMYSKANSEAEYLNPDTLWDRLNDAVNTIIRRDETTETGGLLPPCVEAALNLGCKA  119



>ref|XP_004139410.1| PREDICTED: uncharacterized protein LOC101205660 [Cucumis sativus]
 gb|KGN60695.1| hypothetical protein Csa_2G007390 [Cucumis sativus]
Length=423

 Score =   199 bits (505),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+P+RGSII +I R V E H+ ATKKN+EWQ KLPIVV R
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPMRGSIIQQIFRVVNENHTPATKKNKEWQEKLPIVVFR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSE EY + +TLWDR+NDA++TIIR DESSE+G+ LPPCVEAALNLGCV
Sbjct  61   AEEIMYSKANSEVEYMNLETLWDRLNDAVNTIIRRDESSESGELLPPCVEAALNLGCV  118



>ref|XP_011020154.1| PREDICTED: uncharacterized protein LOC105122627 isoform X1 [Populus 
euphratica]
Length=424

 Score =   199 bits (505),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD HKPIRGS+I +ILR  Y+ HS ATK NREWQ KL +VV +
Sbjct  1    MPRPGPRPYECVRRAWHSDRHKPIRGSMIRQILRMAYDTHSAATKGNREWQDKLLLVVYK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVAE  523
            AEEIMYSKANSE+EY + DTLWDRVNDAI+TIIR DES+ETG  LPPC+EAALNLGC  E
Sbjct  61   AEEIMYSKANSESEYMNQDTLWDRVNDAINTIIRRDESAETGDLLPPCIEAALNLGCKVE  120

Query  524  K  526
            +
Sbjct  121  R  121



>gb|KJB64739.1| hypothetical protein B456_010G062400 [Gossypium raimondii]
Length=417

 Score =   198 bits (503),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHS+ H+P+RGSII +ILR   E HSTATKKN+EWQ K+  V+++
Sbjct  1    MPRPGPRPYECVRRAWHSERHQPMRGSIIQQILRLAIETHSTATKKNKEWQDKIITVIVK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGC  514
            AEEIMYSKANSEAEY +P+TLWDRVNDAI+TIIR DES+ETG+ LPPCVEAALNLGC
Sbjct  61   AEEIMYSKANSEAEYTNPETLWDRVNDAINTIIRRDESTETGELLPPCVEAALNLGC  117



>ref|XP_011017791.1| PREDICTED: uncharacterized protein LOC105121021 isoform X2 [Populus 
euphratica]
Length=443

 Score =   199 bits (505),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD HKPIRGS+I +ILR  Y+ HS ATK NREWQ KL +VV R
Sbjct  1    MPRPGPRPYECVRRAWHSDRHKPIRGSMIGQILRMAYDTHSAATKGNREWQDKLLLVVYR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVAE  523
            AEEIMYSKANSEAEY   DTLWDRVNDA++TIIR DES+ETG  LPPC+EAALNLGC  E
Sbjct  61   AEEIMYSKANSEAEYVSQDTLWDRVNDAVNTIIRRDESTETGDLLPPCIEAALNLGCKVE  120

Query  524  K  526
            +
Sbjct  121  R  121



>ref|XP_008352256.1| PREDICTED: uncharacterized protein LOC103415739 [Malus domestica]
Length=420

 Score =   198 bits (503),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+P+RGSII +I R V E HS+ TKKN+EWQ KLP+VV R
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPMRGSIIQQIFRVVNEVHSSVTKKNKEWQEKLPLVVFR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY + DTLWDR NDA++TIIR DE +ETG+ LPPCVEAALNLGC 
Sbjct  61   AEEIMYSKANSEAEYMNLDTLWDRANDAVNTIIRRDEGTETGELLPPCVEAALNLGCT  118



>gb|KJB64738.1| hypothetical protein B456_010G062400 [Gossypium raimondii]
Length=414

 Score =   198 bits (503),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHS+ H+P+RGSII +ILR   E HSTATKKN+EWQ K+  V+++
Sbjct  1    MPRPGPRPYECVRRAWHSERHQPMRGSIIQQILRLAIETHSTATKKNKEWQDKIITVIVK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGC  514
            AEEIMYSKANSEAEY +P+TLWDRVNDAI+TIIR DES+ETG+ LPPCVEAALNLGC
Sbjct  61   AEEIMYSKANSEAEYTNPETLWDRVNDAINTIIRRDESTETGELLPPCVEAALNLGC  117



>ref|XP_009364005.1| PREDICTED: uncharacterized protein LOC103953923 isoform X1 [Pyrus 
x bretschneideri]
Length=453

 Score =   199 bits (505),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+P+RGSII +I R V E HS+ TKKN+EWQ KLP+VVLR
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPMRGSIIQQIFRVVNEVHSSVTKKNKEWQEKLPLVVLR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY + DTLWDR NDA++TIIR DE SETG+ LPPCVEAALNLGC 
Sbjct  61   AEEIMYSKANSEAEYMNLDTLWDRANDAVNTIIRRDEGSETGELLPPCVEAALNLGCT  118



>ref|XP_010103724.1| hypothetical protein L484_016640 [Morus notabilis]
 gb|EXB96866.1| hypothetical protein L484_016640 [Morus notabilis]
Length=409

 Score =   197 bits (502),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+P+RGS+I +I R   E HS  TKKN+EWQ KLPIVVL+
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPMRGSVIQQIFRVANEAHSATTKKNKEWQEKLPIVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY + DTLWDRVNDAI+TIIR +E++ETG  LPPCVEAALNLGC+
Sbjct  61   AEEIMYSKANSEAEYTNLDTLWDRVNDAINTIIRREETTETGDLLPPCVEAALNLGCI  118



>ref|XP_009368876.1| PREDICTED: uncharacterized protein LOC103958346 [Pyrus x bretschneideri]
Length=417

 Score =   197 bits (502),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+P+RGSII +I R V E HS+ TKKN+EWQ KLP+VV R
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPMRGSIIQQIFRVVNEVHSSVTKKNKEWQEKLPLVVFR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY + DTLWDR NDA++TIIR DE +ETG+ LPPCVEAALNLGC 
Sbjct  61   AEEIMYSKANSEAEYMNLDTLWDRANDAVNTIIRRDEGTETGELLPPCVEAALNLGCT  118



>ref|XP_011017792.1| PREDICTED: uncharacterized protein LOC105121021 isoform X3 [Populus 
euphratica]
Length=437

 Score =   198 bits (503),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD HKPIRGS+I +ILR  Y+ HS ATK NREWQ KL +VV R
Sbjct  1    MPRPGPRPYECVRRAWHSDRHKPIRGSMIGQILRMAYDTHSAATKGNREWQDKLLLVVYR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVAE  523
            AEEIMYSKANSEAEY   DTLWDRVNDA++TIIR DES+ETG  LPPC+EAALNLGC  E
Sbjct  61   AEEIMYSKANSEAEYVSQDTLWDRVNDAVNTIIRRDESTETGDLLPPCIEAALNLGCKVE  120

Query  524  K  526
            +
Sbjct  121  R  121



>gb|KDP33588.1| hypothetical protein JCGZ_07159 [Jatropha curcas]
Length=408

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+PIRGS+I  I R V E HS+ATKKN+EWQ KLP+VVLR
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPIRGSLIQEIFRVVNEVHSSATKKNKEWQEKLPVVVLR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY D  TLWDR NDAI+TIIR DES+ETG+ L PC+EAALNLGC 
Sbjct  61   AEEIMYSKANSEAEYMDLKTLWDRTNDAINTIIRRDESTETGELLQPCIEAALNLGCT  118



>ref|XP_011017790.1| PREDICTED: uncharacterized protein LOC105121021 isoform X1 [Populus 
euphratica]
Length=462

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD HKPIRGS+I +ILR  Y+ HS ATK NREWQ KL +VV R
Sbjct  1    MPRPGPRPYECVRRAWHSDRHKPIRGSMIGQILRMAYDTHSAATKGNREWQDKLLLVVYR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVAE  523
            AEEIMYSKANSEAEY   DTLWDRVNDA++TIIR DES+ETG  LPPC+EAALNLGC  E
Sbjct  61   AEEIMYSKANSEAEYVSQDTLWDRVNDAVNTIIRRDESTETGDLLPPCIEAALNLGCKVE  120

Query  524  K  526
            +
Sbjct  121  R  121



>emb|CDX85164.1| BnaC07g07420D [Brassica napus]
Length=323

 Score =   195 bits (495),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPG RPYECV+RAWHSD H+PIRGSII +I R   E HS  T+KN+EWQ KLP+VVL+
Sbjct  1    MPRPGARPYECVKRAWHSDRHQPIRGSIIRQIFRLAMEAHSAGTRKNKEWQEKLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVAE  523
            AEEIMYSKANSE EY D DTLW+RVNDAI TIIR DE++ETG  LPPCVEAALNLGC+A 
Sbjct  61   AEEIMYSKANSEEEYTDADTLWNRVNDAIDTIIRRDETTETGPLLPPCVEAALNLGCIAV  120

Query  524  K  526
            K
Sbjct  121  K  121



>gb|KJB64735.1| hypothetical protein B456_010G062400 [Gossypium raimondii]
 gb|KJB64736.1| hypothetical protein B456_010G062400 [Gossypium raimondii]
Length=429

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHS+ H+P+RGSII +ILR   E HSTATKKN+EWQ K+  V+++
Sbjct  1    MPRPGPRPYECVRRAWHSERHQPMRGSIIQQILRLAIETHSTATKKNKEWQDKIITVIVK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGC  514
            AEEIMYSKANSEAEY +P+TLWDRVNDAI+TIIR DES+ETG+ LPPCVEAALNLGC
Sbjct  61   AEEIMYSKANSEAEYTNPETLWDRVNDAINTIIRRDESTETGELLPPCVEAALNLGC  117



>ref|XP_002883480.1| hypothetical protein ARALYDRAFT_479917 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59739.1| hypothetical protein ARALYDRAFT_479917 [Arabidopsis lyrata subsp. 
lyrata]
Length=347

 Score =   195 bits (496),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECV+RAWHSD H+PIRGSII +I R   E H  AT+KN+EWQ KLP+VVL+
Sbjct  1    MPRPGPRPYECVKRAWHSDRHQPIRGSIIRQIFRLAMEAHRAATRKNKEWQEKLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVA  520
            AEEIMYSKANSE EY D DT+W+RVNDAI T+I+ DES+ETG  LPPCVEAALNLGC+A
Sbjct  61   AEEIMYSKANSEEEYTDADTMWNRVNDAIDTVIKRDESTETGPLLPPCVEAALNLGCIA  119



>ref|XP_002324862.2| hypothetical protein POPTR_0018s01770g [Populus trichocarpa]
 gb|EEF03427.2| hypothetical protein POPTR_0018s01770g [Populus trichocarpa]
Length=448

 Score =   198 bits (503),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +2

Query  149  LRKKKMTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLP  328
            L KKKM RPGPRPYECVRRAWHSD H+PIRGS+I  I R V E H  ATKKN+EWQ KLP
Sbjct  37   LAKKKMPRPGPRPYECVRRAWHSDRHQPIRGSLIQEIFRLVNEAHCPATKKNKEWQEKLP  96

Query  329  IVVLRAEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNL  508
            +VVL+AEEIMYSKANSEAEY D  TLWDR NDAI+TIIR DES ETG+ L PC+EAALNL
Sbjct  97   VVVLKAEEIMYSKANSEAEYMDLKTLWDRANDAINTIIRRDESLETGELLQPCIEAALNL  156

Query  509  GCV  517
            GC 
Sbjct  157  GCT  159



>gb|KHG12959.1| Deoxyguanosinetriphosphate triphosphohydrolase-like protein [Gossypium 
arboreum]
Length=372

 Score =   196 bits (498),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHS+ H+P+RGSII +ILR   E HSTATKKN+EWQ K+  V+++
Sbjct  1    MPRPGPRPYECVRRAWHSERHQPMRGSIIQQILRLAIETHSTATKKNKEWQDKIITVIVK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGC  514
            AEEIMYSKANSEAEY +P+TLWDRVNDAI+TIIR DES+ETG+ LPPCVEAALNLGC
Sbjct  61   AEEIMYSKANSEAEYTNPETLWDRVNDAINTIIRRDESTETGELLPPCVEAALNLGC  117



>gb|ACJ85266.1| unknown [Medicago truncatula]
Length=406

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHS+ H+P+RGSII +I R V E H+ ATKKN+EWQ KLP+VVL+
Sbjct  1    MPRPGPRPYECVRRAWHSERHQPLRGSIIQQIFRVVTEAHTPATKKNKEWQEKLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGC  514
            AEEIMYSKANSEAEY + DTLWDR+NDA++TIIR DE++ETG  LPPCVEAALNLGC
Sbjct  61   AEEIMYSKANSEAEYLNSDTLWDRLNDAVNTIIRRDETTETGDLLPPCVEAALNLGC  117



>ref|XP_003609369.1| hypothetical protein MTR_4g114900 [Medicago truncatula]
 gb|AES91566.1| hypothetical protein MTR_4g114900 [Medicago truncatula]
Length=406

 Score =   197 bits (500),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHS+ H+P+RGSII +I R V E H+ ATKKN+EWQ KLP+VVL+
Sbjct  1    MPRPGPRPYECVRRAWHSERHQPLRGSIIQQIFRVVTEAHTPATKKNKEWQEKLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGC  514
            AEEIMYSKANSEAEY + DTLWDR+NDA++TIIR DE++ETG  LPPCVEAALNLGC
Sbjct  61   AEEIMYSKANSEAEYLNSDTLWDRLNDAVNTIIRRDETTETGDLLPPCVEAALNLGC  117



>ref|XP_003527166.1| PREDICTED: uncharacterized protein LOC100798900 [Glycine max]
Length=337

 Score =   194 bits (493),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYEC+RRAWHS+ H+P+RGSII +I R V E HS ATK N+EWQ KLPIVVLR
Sbjct  1    MPRPGPRPYECMRRAWHSERHQPMRGSIIRQIFRVVAEAHSAATKSNKEWQEKLPIVVLR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGC  514
            AEEI+YSKANSEAEY +PDTL DR+NDAI+TIIR DE++ETGQ LPPCVEAALN+GC
Sbjct  61   AEEIIYSKANSEAEYLNPDTLLDRLNDAINTIIRRDETTETGQLLPPCVEAALNIGC  117



>ref|XP_011081559.1| PREDICTED: uncharacterized protein LOC105164576 isoform X1 [Sesamum 
indicum]
Length=341

 Score =   194 bits (493),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H P+RGS+I  I R V E H +AT+KNREWQ KLPIVVLR
Sbjct  1    MPRPGPRPYECVRRAWHSDRHHPVRGSLIQEIFRIVNEVHCSATRKNREWQEKLPIVVLR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY+D  TLWDRVNDAI+TIIR DESSETG+ L PC+EAAL+LGC 
Sbjct  61   AEEIMYSKANSEAEYSDLKTLWDRVNDAINTIIRRDESSETGELLQPCIEAALHLGCT  118



>gb|EPS60827.1| hypothetical protein M569_13973, partial [Genlisea aurea]
Length=136

 Score =   187 bits (476),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYEC RRAWHSD H+PIRGS+I  I R V E H ++T+KN EWQ KLPIVVLR
Sbjct  1    MPRPGPRPYECFRRAWHSDRHQPIRGSLIQEIFRLVNEVHCSSTRKNMEWQEKLPIVVLR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY+D  TLW+RVNDAI TIIR DESSETG+ L PC+EAAL+LGC 
Sbjct  61   AEEIMYSKANSEAEYSDLSTLWNRVNDAIDTIIRRDESSETGELLRPCIEAALHLGCT  118



>ref|XP_009102549.1| PREDICTED: uncharacterized protein LOC103828677 [Brassica rapa]
 ref|XP_009102550.1| PREDICTED: uncharacterized protein LOC103828677 [Brassica rapa]
 emb|CDX77461.1| BnaA07g05990D [Brassica napus]
Length=323

 Score =   193 bits (491),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPG RPYECV+RAWHSD H+PIRGSII +I R   E HS  T+KN+EWQ KLP+VVL+
Sbjct  1    MPRPGARPYECVKRAWHSDRHQPIRGSIIRQIFRLAMEAHSAGTRKNKEWQEKLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVA  520
            AEEIMYSKANSE EY D DT+W+RVNDAI TIIR DE++ETG  LPPCVEAALNLGC+A
Sbjct  61   AEEIMYSKANSEEEYTDADTMWNRVNDAIDTIIRRDETTETGPLLPPCVEAALNLGCIA  119



>ref|XP_010541912.1| PREDICTED: uncharacterized protein LOC104815272 [Tarenaya hassleriana]
Length=460

 Score =   197 bits (500),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECV+RAWHSD H+PIRGS+I +I R V E HS  T+KN+EWQ KLP+VVL+
Sbjct  1    MPRPGPRPYECVKRAWHSDRHQPIRGSLIRQIFRLVREAHSATTRKNKEWQEKLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVA  520
            AEEIMYSKANSE EY + +TLW+RVNDA+ TIIR DES+ETGQ LPPCVEAALNLGCVA
Sbjct  61   AEEIMYSKANSEEEYTNAETLWNRVNDAVDTIIRRDESTETGQLLPPCVEAALNLGCVA  119



>ref|XP_007202061.1| hypothetical protein PRUPE_ppa006809mg [Prunus persica]
 gb|EMJ03260.1| hypothetical protein PRUPE_ppa006809mg [Prunus persica]
Length=394

 Score =   195 bits (496),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+P+RGSII +I R V E H + TKKN+EWQ KLP+VV +
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPMRGSIIQQIFRVVSEVHGSVTKKNKEWQEKLPMVVFK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY + +TLWDRVNDA++TIIR DE +ETG+ LPPCVEAALNLGC+
Sbjct  61   AEEIMYSKANSEAEYMNLETLWDRVNDAVNTIIRRDEGTETGELLPPCVEAALNLGCI  118



>ref|XP_002285150.2| PREDICTED: uncharacterized protein LOC100266444 [Vitis vinifera]
Length=414

 Score =   196 bits (497),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+PIRGS+I  I R V E HS+ATKKN+EWQ KLPIVVL+
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPIRGSLIQEIFRVVNEIHSSATKKNKEWQEKLPIVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGC  514
            AEEIMYSKANSEAEY D  TLWDR NDAI+TIIR DES+ETG+ L PC+EA+LNLGC
Sbjct  61   AEEIMYSKANSEAEYMDLKTLWDRANDAINTIIRRDESTETGEFLQPCIEASLNLGC  117



>ref|XP_007013493.1| Uncharacterized protein TCM_038116 [Theobroma cacao]
 gb|EOY31112.1| Uncharacterized protein TCM_038116 [Theobroma cacao]
Length=407

 Score =   195 bits (496),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHS+ H+PIRGSII +ILR   + HSTATKKN+EWQ K+  V+ +
Sbjct  1    MPRPGPRPYECVRRAWHSERHQPIRGSIIQQILRLAIDTHSTATKKNKEWQDKILTVIFK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGC  514
            AEEIMYSKANSE+EY +P+TLWDRVNDAI+TIIR DES+ETG+ LPPCVEAALNLGC
Sbjct  61   AEEIMYSKANSESEYMNPETLWDRVNDAINTIIRRDESTETGELLPPCVEAALNLGC  117



>gb|AFK38384.1| unknown [Medicago truncatula]
Length=406

 Score =   195 bits (495),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHS+ H+P+RGSII +I R V E H+ ATKKN+EWQ KLP+VVL+
Sbjct  1    MPRPGPRPYECVRRAWHSERHQPLRGSIIQQIFRVVTEAHTPATKKNKEWQEKLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGC  514
            AEEIMYSK NSEAEY + DTLWDR+NDA++TIIR DE++ETG  LPPCVEAALNLGC
Sbjct  61   AEEIMYSKTNSEAEYLNSDTLWDRLNDAVNTIIRRDETTETGDLLPPCVEAALNLGC  117



>ref|XP_008456897.1| PREDICTED: uncharacterized protein LOC103496707 [Cucumis melo]
Length=427

 Score =   196 bits (497),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD  +P+RGSII +I R V+E H+ ATKKN+EWQ KLPIVV R
Sbjct  1    MPRPGPRPYECVRRAWHSDRLQPMRGSIIQQIFRVVHENHTPATKKNKEWQEKLPIVVFR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSE EY + +TLWDR+NDA++TIIR DESSE+G+ LPPCVEAALNLGCV
Sbjct  61   AEEIMYSKANSEVEYMNLETLWDRLNDAVNTIIRRDESSESGELLPPCVEAALNLGCV  118



>ref|XP_008242797.1| PREDICTED: uncharacterized protein LOC103341097 [Prunus mume]
 ref|XP_008242798.1| PREDICTED: uncharacterized protein LOC103341097 [Prunus mume]
Length=420

 Score =   195 bits (495),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+P+RGSII +I R V E H + TKKN+EWQ KLP+VV +
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPMRGSIIQQIFRVVSEVHGSVTKKNKEWQEKLPMVVFK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY + +TLWDRVNDA++TIIR DE +ETG+ LPPCVEAALNLGC+
Sbjct  61   AEEIMYSKANSEAEYVNLETLWDRVNDAVNTIIRRDEGTETGELLPPCVEAALNLGCI  118



>ref|XP_007155026.1| hypothetical protein PHAVU_003G166900g [Phaseolus vulgaris]
 gb|ESW27020.1| hypothetical protein PHAVU_003G166900g [Phaseolus vulgaris]
Length=403

 Score =   194 bits (494),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHS+ H+P+RGSII +I R V + HS AT KN+E Q KLP+VVLR
Sbjct  1    MPRPGPRPYECVRRAWHSERHQPVRGSIIQQIFRVVVDAHSPATMKNKECQEKLPVVVLR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGC  514
            AEEIMYSKANSEAEY +PDTLWDR+NDAI+TIIR DE+SETG  LPPCVEAALNLGC
Sbjct  61   AEEIMYSKANSEAEYLNPDTLWDRLNDAINTIIRRDETSETGDLLPPCVEAALNLGC  117



>ref|XP_007155025.1| hypothetical protein PHAVU_003G166900g [Phaseolus vulgaris]
 gb|ESW27019.1| hypothetical protein PHAVU_003G166900g [Phaseolus vulgaris]
Length=419

 Score =   194 bits (494),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHS+ H+P+RGSII +I R V + HS AT KN+E Q KLP+VVLR
Sbjct  1    MPRPGPRPYECVRRAWHSERHQPVRGSIIQQIFRVVVDAHSPATMKNKECQEKLPVVVLR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGC  514
            AEEIMYSKANSEAEY +PDTLWDR+NDAI+TIIR DE+SETG  LPPCVEAALNLGC
Sbjct  61   AEEIMYSKANSEAEYLNPDTLWDRLNDAINTIIRRDETSETGDLLPPCVEAALNLGC  117



>emb|CAN68624.1| hypothetical protein VITISV_010682 [Vitis vinifera]
Length=526

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +2

Query  155  KKKMTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIV  334
             K+M RPGPRPYECVRRAWHSD H+PIRGS+I  I R V E HS+ATKKN+EWQ KLPIV
Sbjct  22   NKRMPRPGPRPYECVRRAWHSDRHQPIRGSLIQEIFRVVNEIHSSATKKNKEWQEKLPIV  81

Query  335  VLRAEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGC  514
            VL+AEEIMYSKANSEAEY D  TLWDR NDAI+TIIR DES+ETG+ L PC+EA+LNLGC
Sbjct  82   VLKAEEIMYSKANSEAEYMDLKTLWDRANDAINTIIRRDESTETGEFLQPCIEASLNLGC  141



>ref|XP_011084102.1| PREDICTED: uncharacterized protein LOC105166449 [Sesamum indicum]
 ref|XP_011084103.1| PREDICTED: uncharacterized protein LOC105166449 [Sesamum indicum]
Length=418

 Score =   194 bits (494),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHS+ H+P+RG II +I R V++ H +ATKKN+EWQ KLPIVVLR
Sbjct  1    MPRPGPRPYECVRRAWHSERHQPMRGLIIQQIFRLVHDNHPSATKKNKEWQEKLPIVVLR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY++ +TLWDRVN+A+ TIIR DE +E+G+ LPPCVEAALNLGCV
Sbjct  61   AEEIMYSKANSEAEYSNSETLWDRVNEAVDTIIRKDERTESGELLPPCVEAALNLGCV  118



>emb|CBI21048.3| unnamed protein product [Vitis vinifera]
Length=451

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+PIRGS+I  I R V E HS+ATKKN+EWQ KLPIVVL+
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPIRGSLIQEIFRVVNEIHSSATKKNKEWQEKLPIVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGC  514
            AEEIMYSKANSEAEY D  TLWDR NDAI+TIIR DES+ETG+ L PC+EA+LNLGC
Sbjct  61   AEEIMYSKANSEAEYMDLKTLWDRANDAINTIIRRDESTETGEFLQPCIEASLNLGC  117



>gb|EYU20259.1| hypothetical protein MIMGU_mgv1a010337mg [Erythranthe guttata]
Length=315

 Score =   191 bits (484),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H P+RGS+I  I R V E H  AT+KNREWQ KLPIVVL+
Sbjct  1    MPRPGPRPYECVRRAWHSDRHHPVRGSLIQEIFRIVNEVHCPATRKNREWQEKLPIVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY+D +TLWDRVNDAI+TIIR D+S+ETG+ L PC+EAAL+LGC 
Sbjct  61   AEEIMYSKANSEAEYSDLETLWDRVNDAINTIIRRDDSTETGELLQPCIEAALHLGCT  118



>ref|XP_004288790.1| PREDICTED: uncharacterized protein LOC101293823 [Fragaria vesca 
subsp. vesca]
Length=421

 Score =   193 bits (491),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+P+RGSII ++ R V E HS  TK N+EWQ KLP+VV +
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPMRGSIIQQMFRAVNEVHSAKTKNNKEWQEKLPMVVFK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVA  520
            AEEIMYSKANSEAEY + DTLWDR NDAI+TIIR +E +ETG  LPPCVEAALNLGCVA
Sbjct  61   AEEIMYSKANSEAEYINSDTLWDRANDAINTIIRREEGNETGDLLPPCVEAALNLGCVA  119



>ref|XP_010090609.1| hypothetical protein L484_004495 [Morus notabilis]
 gb|EXB40145.1| hypothetical protein L484_004495 [Morus notabilis]
Length=374

 Score =   192 bits (487),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+PIRGS+I  I R   E HS++TK+N+EWQ KLP+VVL+
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPIRGSLIKEIFRVANEIHSSSTKQNKEWQEKLPMVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY D  TLWDR NDAI+TIIR DES+ETG+ L PC+EAALNLGC 
Sbjct  61   AEEIMYSKANSEAEYMDLKTLWDRTNDAINTIIRRDESTETGEFLQPCIEAALNLGCT  118



>ref|XP_011036558.1| PREDICTED: uncharacterized protein LOC105134027 [Populus euphratica]
Length=407

 Score =   192 bits (489),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+PIRGS+I  I R V E H +ATKKN+EWQ KLP+VVL+
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPIRGSLIQEIFRLVNEAHCSATKKNKEWQEKLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY D  TLWDR NDAI+TIIR DES ETG+ L PC+EAALNLGC 
Sbjct  61   AEEIMYSKANSEAEYMDLKTLWDRANDAINTIIRRDESLETGELLQPCIEAALNLGCT  118



>ref|XP_006483371.1| PREDICTED: uncharacterized protein LOC102623950 [Citrus sinensis]
Length=377

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHS+ H+P+RGS+I  I R V E HS ATKKN+EWQ KLP+VVL+
Sbjct  1    MPRPGPRPYECVRRAWHSERHQPMRGSLIQEIFRVVNEIHSEATKKNKEWQEKLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            +EEIMYSKANSEAEY D  TL DR NDAI+TIIR DES+ETG+ LPPC+EAALNLGC+
Sbjct  61   SEEIMYSKANSEAEYMDLKTLLDRTNDAINTIIRLDESTETGELLPPCIEAALNLGCM  118



>ref|XP_007011853.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY29472.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=359

 Score =   191 bits (484),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 107/141 (76%), Gaps = 7/141 (5%)
 Frame = +2

Query  95   KFILSSPLCSASPHCVWELRKKKMTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVY  274
            K  LSSP    S       +  KM RPGPRPY C RRAWHSD H+P+RGS+I  I R V 
Sbjct  27   KAFLSSPFLLHS-------KSLKMPRPGPRPYVCERRAWHSDRHQPMRGSLIQEIFRVVN  79

Query  275  ERHSTATKKNREWQVKLPIVVLRAEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDE  454
            E HS+ATKKN+EWQ KLP+VVL+AEEIMYSKANSEAEY D  +LWDR NDAI+TII+ DE
Sbjct  80   EIHSSATKKNKEWQEKLPVVVLKAEEIMYSKANSEAEYMDLKSLWDRTNDAINTIIKRDE  139

Query  455  SSETGQHLPPCVEAALNLGCV  517
            S+ETG+ L PC+EAALNLGC 
Sbjct  140  STETGELLQPCIEAALNLGCT  160



>ref|XP_011039682.1| PREDICTED: uncharacterized protein LOC105136151 [Populus euphratica]
Length=407

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+PIRGS+I  I R V E HS+ TKKN+EWQ KLP+VVL+
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPIRGSLIQEIFRLVNEAHSSTTKKNKEWQEKLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY +  TLWDR NDAI+TIIR DES ETG+ L PC+EAALNLGC 
Sbjct  61   AEEIMYSKANSEAEYMELKTLWDRTNDAINTIIRRDESMETGELLQPCIEAALNLGCT  118



>gb|KDO61741.1| hypothetical protein CISIN_1g017107mg [Citrus sinensis]
Length=377

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHS+ H+P+RGS+I  I R V E HS ATKKN+EWQ KLP+VVL+
Sbjct  1    MPRPGPRPYECVRRAWHSERHQPMRGSLIQEIFRVVNEIHSEATKKNKEWQEKLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            +EEIMYSKANSEAEY D  TL DR NDAI+TIIR DES+ETG+ LPPC+EAALNLGC+
Sbjct  61   SEEIMYSKANSEAEYMDLKTLLDRTNDAINTIIRLDESTETGELLPPCIEAALNLGCM  118



>ref|XP_006450423.1| hypothetical protein CICLE_v10008661mg [Citrus clementina]
 gb|ESR63663.1| hypothetical protein CICLE_v10008661mg [Citrus clementina]
Length=377

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHS+ H+P+RGS+I  I R V E HS ATKKN+EWQ KLP+VVL+
Sbjct  1    MPRPGPRPYECVRRAWHSERHQPMRGSLIQEIFRVVNEIHSEATKKNKEWQEKLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            +EEIMYSKANSEAEY D  TL DR NDAI+TIIR DES+ETG+ LPPC+EAALNLGC+
Sbjct  61   SEEIMYSKANSEAEYMDLKTLLDRTNDAINTIIRLDESTETGELLPPCIEAALNLGCL  118



>ref|XP_009106210.1| PREDICTED: uncharacterized protein LOC103832004 [Brassica rapa]
Length=329

 Score =   189 bits (481),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 101/121 (83%), Gaps = 2/121 (2%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RP PRPYECV+RAWH D H+PIRGSII +I R   E HS ATKKN+EWQ KLP+VVL+
Sbjct  1    MPRPCPRPYECVKRAWHIDRHQPIRGSIIRQIFRLAMEAHSAATKKNKEWQEKLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVAE  523
            AEEIMYSKANSE EYA  DT+W+RVNDAI TIIR DES+ETG  LPPCVEAALNLGC+A 
Sbjct  61   AEEIMYSKANSEEEYA--DTIWNRVNDAIDTIIRRDESTETGPLLPPCVEAALNLGCIAV  118

Query  524  K  526
            K
Sbjct  119  K  119



>gb|KHG13215.1| Histone acetyltransferase [Gossypium arboreum]
Length=396

 Score =   191 bits (485),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPY C RRAWHSD H+P+RGS+I  I R V E HS+ATKKN+EWQ KLP+VVL+
Sbjct  1    MPRPGPRPYVCERRAWHSDRHQPMRGSLIREIFRVVNEIHSSATKKNKEWQEKLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVAE  523
            AEEIMYSKANSEAEY D  TLWDR NDAI+TIIR DES+ETG+ L PC+EAALNLGC A 
Sbjct  61   AEEIMYSKANSEAEYMDIKTLWDRTNDAINTIIRRDESTETGELLQPCIEAALNLGCTAR  120

Query  524  K  526
            +
Sbjct  121  R  121



>emb|CDP13523.1| unnamed protein product [Coffea canephora]
Length=403

 Score =   191 bits (485),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+PIRGS+I  I R V E HS+ATKKN+EWQ KLPIVVL+
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPIRGSLIQEIFRIVNEIHSSATKKNKEWQEKLPIVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY D +TL DR NDAI+TIIR DES+ETG+ L PC+EAAL+LGC 
Sbjct  61   AEEIMYSKANSEAEYVDINTLRDRANDAINTIIRRDESTETGELLQPCIEAALHLGCT  118



>emb|CDY18077.1| BnaA01g23380D [Brassica napus]
Length=329

 Score =   189 bits (480),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 101/121 (83%), Gaps = 2/121 (2%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RP PRPYECV+RAWH D H+PIRGSII +I R   E HS ATKKN+EWQ KLP+VVL+
Sbjct  1    MPRPCPRPYECVKRAWHIDRHQPIRGSIIRQIFRLAMEAHSAATKKNKEWQEKLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVAE  523
            AEEIMYSKANSE EYA  DT+W+RVNDAI TIIR DES+ETG  LPPCVEAALNLGC+A 
Sbjct  61   AEEIMYSKANSEEEYA--DTIWNRVNDAIDTIIRRDESTETGPLLPPCVEAALNLGCIAV  118

Query  524  K  526
            K
Sbjct  119  K  119



>ref|XP_002515508.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46957.1| conserved hypothetical protein [Ricinus communis]
Length=391

 Score =   190 bits (483),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+P+RGS+I  I R V E HS ATKKN+EWQ KLP+VVL+
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPVRGSLIQEIFRVVNEVHSPATKKNKEWQEKLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY D  TLW+RVND I+TI+R DES+ETG  L PC+EAALNLGC 
Sbjct  61   AEEIMYSKANSEAEYMDLKTLWERVNDVINTIVRRDESTETGDLLLPCIEAALNLGCT  118



>ref|XP_002309630.1| hypothetical protein POPTR_0006s27080g [Populus trichocarpa]
 gb|EEE93153.1| hypothetical protein POPTR_0006s27080g [Populus trichocarpa]
Length=407

 Score =   190 bits (483),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+PIRGS+I  I R V E HS+ TKKN+EWQ KLP+VVL+
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPIRGSLIQEIFRLVNEAHSSTTKKNKEWQEKLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY +  TLWDR NDAI+TIIR DES+E G+ L PC+EAALNLGC 
Sbjct  61   AEEIMYSKANSEAEYMELKTLWDRTNDAINTIIRRDESTEIGELLQPCIEAALNLGCT  118



>gb|KHN00068.1| hypothetical protein glysoja_050053 [Glycine soja]
Length=340

 Score =   188 bits (478),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 103/120 (86%), Gaps = 3/120 (3%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNR---EWQVKLPIV  334
            M RPGPRPYEC+RRAWHS+ H+P+RGSII +I R V E HS ATK N+   EWQ KLPI+
Sbjct  1    MPRPGPRPYECMRRAWHSERHQPMRGSIIRQIFRVVAEAHSAATKSNKDNKEWQEKLPII  60

Query  335  VLRAEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGC  514
            VLRAEEI+YSKANSEAEY +PDTL DR+NDAI+TIIR DE++ETGQ LPPCVEAALN+GC
Sbjct  61   VLRAEEIIYSKANSEAEYLNPDTLLDRLNDAINTIIRRDETTETGQLLPPCVEAALNIGC  120



>ref|XP_008363007.1| PREDICTED: uncharacterized protein LOC103426701 [Malus domestica]
Length=420

 Score =   191 bits (484),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+  RGSII +I R V E HS+ TK N+EWQ KLP VV R
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQXXRGSIIQQIFRVVXEVHSSVTKXNKEWQEKLPXVVFR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY + DTLWDR NDA++TIIR DE +ETG+ LPPCVEAALNLGC 
Sbjct  61   AEEIMYSKANSEAEYMNLDTLWDRANDAVNTIIRRDEGTETGELLPPCVEAALNLGCT  118



>ref|XP_010656446.1| PREDICTED: uncharacterized protein LOC100250879 isoform X2 [Vitis 
vinifera]
Length=417

 Score =   190 bits (483),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 100/118 (85%), Gaps = 7/118 (6%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+P+RGSII +I        S+ATKKNREWQ KLPIVVL+
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPMRGSIIQQIF-------SSATKKNREWQEKLPIVVLK  53

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSE EY D  TLWDRVNDA++TIIR DES+ETG+ LPPC+EAALNLGCV
Sbjct  54   AEEIMYSKANSETEYMDLGTLWDRVNDAVNTIIRRDESTETGELLPPCIEAALNLGCV  111



>ref|XP_006842047.1| hypothetical protein AMTR_s00078p00021180 [Amborella trichopoda]
 gb|ERN03722.1| hypothetical protein AMTR_s00078p00021180 [Amborella trichopoda]
Length=486

 Score =   192 bits (487),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+P+RGS+I  I R V E HS++T+KN+EWQ KLP+VVL+
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPMRGSLIQEIFRVVNECHSSSTRKNKEWQEKLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY DP TLW+R+NDA++T+IR DES+ETG  L PC+EAALNLGC 
Sbjct  61   AEEIMYSKANSEAEYMDPKTLWERMNDAVNTMIRRDESTETGNLLQPCIEAALNLGCT  118



>ref|XP_007011852.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY29471.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=417

 Score =   190 bits (482),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 107/141 (76%), Gaps = 7/141 (5%)
 Frame = +2

Query  95   KFILSSPLCSASPHCVWELRKKKMTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVY  274
            K  LSSP    S       +  KM RPGPRPY C RRAWHSD H+P+RGS+I  I R V 
Sbjct  27   KAFLSSPFLLHS-------KSLKMPRPGPRPYVCERRAWHSDRHQPMRGSLIQEIFRVVN  79

Query  275  ERHSTATKKNREWQVKLPIVVLRAEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDE  454
            E HS+ATKKN+EWQ KLP+VVL+AEEIMYSKANSEAEY D  +LWDR NDAI+TII+ DE
Sbjct  80   EIHSSATKKNKEWQEKLPVVVLKAEEIMYSKANSEAEYMDLKSLWDRTNDAINTIIKRDE  139

Query  455  SSETGQHLPPCVEAALNLGCV  517
            S+ETG+ L PC+EAALNLGC 
Sbjct  140  STETGELLQPCIEAALNLGCT  160



>ref|XP_011081560.1| PREDICTED: uncharacterized protein LOC105164576 isoform X2 [Sesamum 
indicum]
Length=138

 Score =   181 bits (460),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H P+RGS+I  I R V E H +AT+KNREWQ KLPIVVLR
Sbjct  1    MPRPGPRPYECVRRAWHSDRHHPVRGSLIQEIFRIVNEVHCSATRKNREWQEKLPIVVLR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEA  496
            AEEIMYSKANSEAEY+D  TLWDRVNDAI+TIIR DESSETG+ L PC+E 
Sbjct  61   AEEIMYSKANSEAEYSDLKTLWDRVNDAINTIIRRDESSETGELLQPCIEG  111



>gb|KJB55018.1| hypothetical protein B456_009G058400 [Gossypium raimondii]
Length=399

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPY C RRAWHSD H+P+RGS+I  I R V E HS+ATKKN+EWQ KLP VVL+
Sbjct  1    MPRPGPRPYVCERRAWHSDRHQPMRGSLIQEIFRVVNEIHSSATKKNKEWQEKLPDVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVAE  523
            AEEIMYSKANSEAEY D  TLWDR NDAI+TIIR DES+ETG+ L PC+EAALNLGC A 
Sbjct  61   AEEIMYSKANSEAEYMDIKTLWDRTNDAINTIIRRDESTETGELLQPCIEAALNLGCTAR  120

Query  524  K  526
            +
Sbjct  121  R  121



>ref|XP_007011854.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY29473.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=447

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 107/141 (76%), Gaps = 7/141 (5%)
 Frame = +2

Query  95   KFILSSPLCSASPHCVWELRKKKMTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVY  274
            K  LSSP    S       +  KM RPGPRPY C RRAWHSD H+P+RGS+I  I R V 
Sbjct  27   KAFLSSPFLLHS-------KSLKMPRPGPRPYVCERRAWHSDRHQPMRGSLIQEIFRVVN  79

Query  275  ERHSTATKKNREWQVKLPIVVLRAEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDE  454
            E HS+ATKKN+EWQ KLP+VVL+AEEIMYSKANSEAEY D  +LWDR NDAI+TII+ DE
Sbjct  80   EIHSSATKKNKEWQEKLPVVVLKAEEIMYSKANSEAEYMDLKSLWDRTNDAINTIIKRDE  139

Query  455  SSETGQHLPPCVEAALNLGCV  517
            S+ETG+ L PC+EAALNLGC 
Sbjct  140  STETGELLQPCIEAALNLGCT  160



>ref|XP_006450882.1| hypothetical protein CICLE_v10008357mg [Citrus clementina]
 ref|XP_006475881.1| PREDICTED: uncharacterized protein LOC102614540 [Citrus sinensis]
 gb|ESR64122.1| hypothetical protein CICLE_v10008357mg [Citrus clementina]
 gb|KDO80187.1| hypothetical protein CISIN_1g014103mg [Citrus sinensis]
Length=430

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHS+ H+P+RGS I +I R   E HST TKKN+EWQ KLPIVVL+
Sbjct  1    MPRPGPRPYECVRRAWHSERHQPMRGSTIQQIFRVADEFHSTQTKKNKEWQEKLPIVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEI+YSKANSE EY + DTL DRVNDA++TIIR DES+ETG+ LPPCVEAALNLGC+
Sbjct  61   AEEILYSKANSEDEYMNLDTLRDRVNDAVNTIIRRDESTETGELLPPCVEAALNLGCI  118



>ref|XP_002308071.1| hypothetical protein POPTR_0006s06600g [Populus trichocarpa]
 gb|EEE91594.1| hypothetical protein POPTR_0006s06600g [Populus trichocarpa]
Length=137

 Score =   180 bits (457),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD HKPIRGS+I +ILR  Y+ HS ATK NREWQ KL +VV +
Sbjct  1    MPRPGPRPYECVRRAWHSDRHKPIRGSMIGQILRMAYDTHSAATKGNREWQDKLLLVVYK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAAL  502
            AEEIMYSKANSEAEY + DT WDRVNDAI+TIIR DES+ETG  LPPC+E + 
Sbjct  61   AEEIMYSKANSEAEYMNQDTFWDRVNDAINTIIRRDESTETGDLLPPCIEESF  113



>ref|XP_009138075.1| PREDICTED: uncharacterized protein LOC103862117 [Brassica rapa]
 emb|CDY13480.1| BnaA03g51980D [Brassica napus]
Length=260

 Score =   184 bits (467),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPY+C+RRAWHSD H+P+RG +I  I R V E HS +TKKN EWQ KLP+VVLR
Sbjct  1    MPRPGPRPYDCIRRAWHSDTHQPMRGLLIQEIFRIVCEIHSQSTKKNTEWQEKLPVVVLR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVAE  523
            AEEIMYSKANSEAEY D  TL DR NDAI+TIIR DE++ETG +L PC+EAAL+LGC   
Sbjct  61   AEEIMYSKANSEAEYMDLTTLLDRANDAINTIIRLDETTETGDYLQPCIEAALHLGCTPR  120

Query  524  K  526
            K
Sbjct  121  K  121



>ref|XP_008219505.1| PREDICTED: uncharacterized protein LOC103319706 [Prunus mume]
Length=410

 Score =   188 bits (478),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M R GPRPYECVRRAWHS+ H+P+RGS+I  I R V E HS+AT+KN+EWQ KLPIVVL+
Sbjct  1    MPRSGPRPYECVRRAWHSERHQPMRGSLIKEIFRVVNEIHSSATRKNKEWQDKLPIVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY D  TLWDR NDAI+TIIR DE +ETG  L PC+EAALNLGC+
Sbjct  61   AEEIMYSKANSEAEYMDLKTLWDRTNDAINTIIRRDEGTETGDFLQPCIEAALNLGCI  118



>ref|XP_007222724.1| hypothetical protein PRUPE_ppa006474mg [Prunus persica]
 gb|EMJ23923.1| hypothetical protein PRUPE_ppa006474mg [Prunus persica]
Length=410

 Score =   188 bits (478),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M R GPRPYECVRRAWHS+ H+P+RGS+I  I R V E HS+AT+KN+EWQ KLPIVVL+
Sbjct  1    MPRSGPRPYECVRRAWHSERHQPMRGSLIKEIFRVVNEIHSSATRKNKEWQDKLPIVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY D  TLWDR NDAI+TIIR DE +ETG  L PC+EAALNLGC+
Sbjct  61   AEEIMYSKANSEAEYMDLKTLWDRTNDAINTIIRRDEGTETGDFLQPCIEAALNLGCI  118



>emb|CDX75234.1| BnaA01g04680D [Brassica napus]
Length=255

 Score =   184 bits (466),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYEC+RR WHSD H+P+RG +I  I R V E HS +TKKN EWQ KLP+VVLR
Sbjct  1    MPRPGPRPYECIRRVWHSDRHQPMRGLLIQEIFRIVCEIHSQSTKKNTEWQEKLPVVVLR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY D +TL DR NDAI+TIIR DE++ETG+ L PC+EAAL+LGC 
Sbjct  61   AEEIMYSKANSEAEYMDMNTLLDRTNDAINTIIRLDETTETGEFLQPCIEAALHLGCT  118



>ref|XP_009126211.1| PREDICTED: uncharacterized protein LOC103851128 [Brassica rapa]
Length=265

 Score =   184 bits (466),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYEC+RR WHSD H+P+RG +I  I R V E HS +TKKN EWQ KLP+VVLR
Sbjct  1    MPRPGPRPYECIRRVWHSDRHQPMRGLLIQEIFRIVCEIHSQSTKKNTEWQEKLPVVVLR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY D +TL DR NDAI+TIIR DE++ETG+ L PC+EAAL+LGC 
Sbjct  61   AEEIMYSKANSEAEYMDMNTLLDRTNDAINTIIRLDETTETGEFLQPCIEAALHLGCT  118



>ref|XP_007138398.1| hypothetical protein PHAVU_009G205400g [Phaseolus vulgaris]
 gb|ESW10392.1| hypothetical protein PHAVU_009G205400g [Phaseolus vulgaris]
Length=338

 Score =   186 bits (471),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYEC+RRAWHSD H+PIRGS+I +I R   + HS +TK N+EWQ KLP+VVLR
Sbjct  1    MPRPGPRPYECMRRAWHSDRHQPIRGSVIGQIFRVATQFHSPSTKSNKEWQEKLPVVVLR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGC  514
            AEEI+YSKANSEAEY +P TL DR+NDAI TIIR +++ ETGQ LPPC+EAALNLGC
Sbjct  61   AEEIIYSKANSEAEYLNPATLLDRLNDAIDTIIRREQTKETGQLLPPCIEAALNLGC  117



>ref|XP_006412493.1| hypothetical protein EUTSA_v10026043mg [Eutrema salsugineum]
 gb|ESQ53946.1| hypothetical protein EUTSA_v10026043mg [Eutrema salsugineum]
Length=256

 Score =   183 bits (464),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPY+C+RRAWHSD H+P+RG +I  I R V E HS +TKKN EWQ KLP+VVLR
Sbjct  1    MPRPGPRPYDCIRRAWHSDRHQPMRGLLIQEIFRIVCEIHSQSTKKNTEWQEKLPVVVLR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY D +TL DR NDAI+TIIR DE++ETG+ L PC+EAAL+LGC 
Sbjct  61   AEEIMYSKANSEAEYMDLNTLLDRTNDAINTIIRLDETTETGEFLQPCIEAALHLGCT  118



>ref|XP_010437926.1| PREDICTED: uncharacterized protein LOC104721601 [Camelina sativa]
Length=241

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPY+C+RRAWHSD H+P+RG +I  I R V E HS +TKKN EWQ KLP+VVLR
Sbjct  1    MPRPGPRPYDCIRRAWHSDRHQPMRGLLIQEIFRIVCEIHSQSTKKNTEWQEKLPVVVLR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVAE  523
            AEEIMYSKANSEAEY D  TL DR N+AI+TIIR DE++ETG++L PC+EAAL+LGC   
Sbjct  61   AEEIMYSKANSEAEYMDLKTLLDRTNEAINTIIRLDETTETGEYLQPCIEAALHLGCTPR  120

Query  524  K  526
            K
Sbjct  121  K  121



>ref|XP_010432739.1| PREDICTED: uncharacterized protein LOC104716952 isoform X1 [Camelina 
sativa]
 ref|XP_010432740.1| PREDICTED: uncharacterized protein LOC104716952 isoform X2 [Camelina 
sativa]
 ref|XP_010432741.1| PREDICTED: uncharacterized protein LOC104716954 [Camelina sativa]
Length=244

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPY+C+RRAWHSD H+P+RG +I  I R V E HS +TKKN EWQ KLP+VVLR
Sbjct  1    MPRPGPRPYDCIRRAWHSDRHQPMRGLLIQEIFRIVCEIHSQSTKKNTEWQEKLPVVVLR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVAE  523
            AEEIMYSKANSEAEY D  TL DR N+AI+TIIR DE++ETG++L PC+EAAL+LGC   
Sbjct  61   AEEIMYSKANSEAEYMDLKTLLDRTNEAINTIIRLDETTETGEYLQPCIEAALHLGCTPR  120

Query  524  K  526
            K
Sbjct  121  K  121



>ref|XP_010247601.1| PREDICTED: uncharacterized protein LOC104590583 [Nelumbo nucifera]
Length=439

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+P+RGS+I  I R V E HS  T+KN+EWQ KLP+VVL+
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPMRGSLIQEIFRVVNEIHSAETRKNKEWQEKLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY D  TLW+RVNDAI+TIIR DES+ETG+ L PC+EAAL LGC+
Sbjct  61   AEEIMYSKANSEAEYMDLKTLWERVNDAINTIIRIDESTETGELLQPCIEAALLLGCI  118



>emb|CDX72353.1| BnaC07g43750D [Brassica napus]
Length=242

 Score =   181 bits (460),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPY+C+RRAWHSD H+P+RG +I  I R V E HS +TKKN EWQ KLP+VVLR
Sbjct  1    MPRPGPRPYDCIRRAWHSDTHQPMRGLLIQEIFRIVCEIHSQSTKKNTEWQEKLPVVVLR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEI+YSKANSEAEY D +TL +R NDAI+TIIR DE++ETG++L PC+EAAL+LGC 
Sbjct  61   AEEIIYSKANSEAEYMDMNTLLNRANDAINTIIRLDETTETGEYLQPCIEAALHLGCT  118



>ref|XP_010250149.1| PREDICTED: uncharacterized protein LOC104592463 [Nelumbo nucifera]
Length=448

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 102/120 (85%), Gaps = 2/120 (2%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+P+RGS+I  I R V E H+ ATKKN+EWQ KLPIVVLR
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPMRGSLIQEIFRVVNEIHNAATKKNKEWQEKLPIVVLR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQH--LPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY D  TLW+R+NDAI+TIIR DES+ETG+   L PC+EAAL+LGC+
Sbjct  61   AEEIMYSKANSEAEYMDLKTLWERLNDAINTIIRRDESTETGEGNLLQPCIEAALHLGCI  120



>ref|NP_680756.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAO41883.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50719.1| unknown protein [Arabidopsis thaliana]
 gb|AEE86036.1| uncharacterized protein AT4G32295 [Arabidopsis thaliana]
Length=238

 Score =   181 bits (459),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPY+C+RRAWHSD H+P+RG +I  I R V E HS +T+KN EWQ KLP+VVLR
Sbjct  1    MPRPGPRPYDCIRRAWHSDRHQPMRGLLIQEIFRIVCEIHSQSTRKNTEWQEKLPVVVLR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY D  TL DR NDAI+TIIR DE++ETG+ L PC+EAAL+LGC 
Sbjct  61   AEEIMYSKANSEAEYMDMKTLLDRTNDAINTIIRLDETTETGEFLQPCIEAALHLGCT  118



>ref|XP_002869285.1| hypothetical protein ARALYDRAFT_491499 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45544.1| hypothetical protein ARALYDRAFT_491499 [Arabidopsis lyrata subsp. 
lyrata]
Length=242

 Score =   181 bits (458),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPY+C+RRAWHSD H+P+RG +I  I R V E HS +T+KN EWQ KLP+VVLR
Sbjct  1    MPRPGPRPYDCIRRAWHSDRHQPMRGLLIQEIFRIVCEIHSQSTRKNTEWQEKLPVVVLR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY D  TL DR NDAI+TIIR DE++ETG+ L PC+EAAL+LGC 
Sbjct  61   AEEIMYSKANSEAEYMDMKTLLDRTNDAINTIIRLDETTETGEFLQPCIEAALHLGCT  118



>ref|XP_008394095.1| PREDICTED: uncharacterized protein LOC103456208 [Malus domestica]
Length=409

 Score =   185 bits (470),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M R G RPYECVRRAWHS+ H+P+RGS+I  I R V E HS ATKKN+EWQ KLPIVVL+
Sbjct  1    MPRSGLRPYECVRRAWHSERHQPMRGSLIKEIFRVVNEIHSLATKKNKEWQEKLPIVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY D  TLWDR NDAI+TIIR DE++ETG+ L PC+EAALNLGC+
Sbjct  61   AEEIMYSKANSEAEYMDLKTLWDRTNDAINTIIRRDETTETGEFLQPCIEAALNLGCI  118



>ref|XP_009355751.1| PREDICTED: uncharacterized protein LOC103946707 [Pyrus x bretschneideri]
 ref|XP_009355752.1| PREDICTED: uncharacterized protein LOC103946707 [Pyrus x bretschneideri]
Length=409

 Score =   185 bits (469),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M R GPRPYECVRRAWH + H+P+RGS+I  I R V E HS+ATKKN+EWQ KLPIVVL+
Sbjct  1    MPRSGPRPYECVRRAWHRERHQPMRGSLIKEIFRVVNEIHSSATKKNKEWQEKLPIVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVAE  523
            AEEIMYSKANSEAEY D  TLWDR NDAI+TIIR DE++ETG+ L PC+EAAL LGC+A 
Sbjct  61   AEEIMYSKANSEAEYMDLKTLWDRTNDAINTIIRRDETTETGEFLRPCIEAALILGCIAR  120

Query  524  K  526
            +
Sbjct  121  R  121



>ref|XP_006284395.1| hypothetical protein CARUB_v10005566mg, partial [Capsella rubella]
 gb|EOA17293.1| hypothetical protein CARUB_v10005566mg, partial [Capsella rubella]
Length=253

 Score =   180 bits (457),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPY+C+RRAWHSD H+P+RG +I  I R V E HS +TKKN EWQ KLP+VVLR
Sbjct  12   MPRPGPRPYDCIRRAWHSDRHQPMRGLLIQEIFRIVCEIHSQSTKKNTEWQEKLPVVVLR  71

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVAE  523
            AEEIMYSKANSEAEY D  TL DR N+AI+TIIR DE++E+G+ L PC+EAAL+LGC   
Sbjct  72   AEEIMYSKANSEAEYMDMTTLLDRTNEAINTIIRLDETTESGEFLQPCIEAALHLGCTPR  131

Query  524  K  526
            K
Sbjct  132  K  132



>ref|XP_010048959.1| PREDICTED: uncharacterized protein LOC104437666 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010048960.1| PREDICTED: uncharacterized protein LOC104437666 isoform X1 [Eucalyptus 
grandis]
 gb|KCW81389.1| hypothetical protein EUGRSUZ_C02771 [Eucalyptus grandis]
 gb|KCW81390.1| hypothetical protein EUGRSUZ_C02771 [Eucalyptus grandis]
Length=379

 Score =   184 bits (466),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVR+AWHS+ H+PIRGS+I  I R V E HS++TKKN+EWQ KLP+VVL+
Sbjct  1    MPRPGPRPYECVRKAWHSERHQPIRGSLIQDIFRVVNEIHSSSTKKNKEWQEKLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY D +TL DR NDAI+TIIR DES+ETG  L PC+EAAL LGC 
Sbjct  61   AEEIMYSKANSEAEYMDLETLLDRTNDAINTIIRLDESTETGDLLQPCIEAALTLGCT  118



>ref|XP_009364006.1| PREDICTED: uncharacterized protein LOC103953923 isoform X2 [Pyrus 
x bretschneideri]
Length=444

 Score =   183 bits (465),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+P+RGSII +I R V E HS+ TKKN+EWQ KLP+VVLR
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPMRGSIIQQIFRVVNEVHSSVTKKNKEWQEKLPLVVLR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVE  493
            AEEIMYSKANSEAEY + DTLWDR NDA++TIIR DE SETG+ LPPCVE
Sbjct  61   AEEIMYSKANSEAEYMNLDTLWDRANDAVNTIIRRDEGSETGELLPPCVE  110



>ref|XP_008809840.1| PREDICTED: uncharacterized protein LOC103721416 [Phoenix dactylifera]
 ref|XP_008809848.1| PREDICTED: uncharacterized protein LOC103721416 [Phoenix dactylifera]
Length=465

 Score =   183 bits (465),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+PIRGS+I  I R   E HS AT+KN+EWQ KLP VVL+
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPIRGSLIQEIFRVANEVHSPATRKNKEWQEKLPFVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY D  TL DR NDAI TIIR DE++E+G  L PC+EAALNLGC+
Sbjct  61   AEEIMYSKANSEAEYMDLKTLRDRANDAIDTIIRKDETTESGDLLQPCIEAALNLGCI  118



>ref|XP_011459176.1| PREDICTED: uncharacterized protein LOC101295200 [Fragaria vesca 
subsp. vesca]
Length=387

 Score =   181 bits (460),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 101/122 (83%), Gaps = 1/122 (1%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M R GPRPY+C+RRAWHS+ H+P+RGS+I  I   V E HS+AT+KN+EWQ KLPIVVL+
Sbjct  1    MPRSGPRPYDCIRRAWHSERHQPMRGSLIKEIFSVVNEIHSSATRKNKEWQEKLPIVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQH-LPPCVEAALNLGCVA  520
            AEEIMYSKANSEAEY D  TLWDR NDAI+TIIR DES ETG+  L PC+EAALNLGCVA
Sbjct  61   AEEIMYSKANSEAEYTDLKTLWDRANDAINTIIRRDESIETGEEFLQPCIEAALNLGCVA  120

Query  521  EK  526
             +
Sbjct  121  RR  122



>ref|XP_010525953.1| PREDICTED: uncharacterized protein LOC104803655 [Tarenaya hassleriana]
Length=331

 Score =   180 bits (456),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYEC+RR WHSD H+P+RG +I  I R V E HS ATKKN+EWQ KLP+VVL+
Sbjct  1    MPRPGPRPYECIRRVWHSDRHQPMRGLLIQEIFRIVCEIHSPATKKNKEWQEKLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSE EY D +TL DR  DAI+TIIR DE++ETG++L PC+EAAL+LGC 
Sbjct  61   AEEIMYSKANSETEYIDMNTLLDRTTDAINTIIRLDETTETGEYLQPCIEAALHLGCT  118



>ref|XP_004138852.1| PREDICTED: uncharacterized protein LOC101206923 [Cucumis sativus]
 ref|XP_004160790.1| PREDICTED: uncharacterized protein LOC101231392 [Cucumis sativus]
Length=395

 Score =   181 bits (460),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+PIRGS+I +I R V++ H+T TKKN+EWQ  LP+VV +
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPIRGSLIQQIFRVVHKIHNTFTKKNKEWQEMLPVVVFK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVAE  523
            AEEI+YSKANSEAEY D  TL +R+ DAI+TIIR DES+ETG  L PC+EAALNLGC   
Sbjct  61   AEEILYSKANSEAEYMDFSTLQNRLLDAINTIIRLDESTETGDFLQPCIEAALNLGCTPR  120

Query  524  K  526
            K
Sbjct  121  K  121



>gb|KJB06292.1| hypothetical protein B456_001G033800 [Gossypium raimondii]
Length=376

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPY   +++WHSD H+PIRGS++  I R V E HS+ATKKN+EWQ KLP+VVL+
Sbjct  1    MPRPGPRPYVFEKKSWHSDRHQPIRGSLVQEIFRVVNEIHSSATKKNKEWQEKLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVAE  523
            AEEIMYSKANSEAEY D  TLWDR NDAI+TIIR +ES+ETG+ L PC+EAALNLGC A 
Sbjct  61   AEEIMYSKANSEAEYMDLKTLWDRTNDAINTIIRRNESTETGKVLQPCIEAALNLGCTAR  120

Query  524  K  526
            +
Sbjct  121  R  121



>ref|XP_003522611.1| PREDICTED: uncharacterized protein LOC100803816 isoform X1 [Glycine 
max]
 gb|KHN08136.1| hypothetical protein glysoja_032320 [Glycine soja]
Length=275

 Score =   177 bits (450),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGP+PY+CV+RAWHS+IH+PIRG++I  I R V E H ++TKKN+E+Q KLP+VVLR
Sbjct  1    MPRPGPKPYDCVKRAWHSEIHQPIRGTLIQEIFRVVNEIHGSSTKKNKEYQEKLPVVVLR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVAE  523
            AEEI+YSKANSEAEY D  TL +R NDAI TIIR DE +ETG++L PC+EAAL+LGC   
Sbjct  61   AEEIIYSKANSEAEYMDLTTLLERTNDAIDTIIRRDEHTETGEYLRPCIEAALSLGCSLT  120

Query  524  K  526
            K
Sbjct  121  K  121



>gb|ACU23696.1| unknown [Glycine max]
Length=275

 Score =   177 bits (450),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGP+PY+CV+RAWHS+IH+PIRG++I  I R V E H ++TKKN+E+Q KLP+VVLR
Sbjct  1    MPRPGPKPYDCVKRAWHSEIHQPIRGTLIQEIFRVVNEIHGSSTKKNKEYQEKLPVVVLR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVAE  523
            AEEI+YSKANSEAEY D  TL +R NDAI TIIR DE +ETG++L PC+EAAL+LGC   
Sbjct  61   AEEIIYSKANSEAEYMDLTTLLERTNDAIDTIIRRDEHTETGEYLRPCIEAALSLGCSLT  120

Query  524  K  526
            K
Sbjct  121  K  121



>ref|XP_010696141.1| PREDICTED: uncharacterized protein LOC104908692 [Beta vulgaris 
subsp. vulgaris]
Length=361

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 96/119 (81%), Gaps = 1/119 (1%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHS+ H+PIRGS+I  I R   E HS ATKK +EWQ KLPIVVL+
Sbjct  1    MPRPGPRPYECVRRAWHSERHQPIRGSLIQEIFRIANEIHSPATKKKKEWQEKLPIVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSE-TGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSE EY D  TLWDR NDAI+TIIR +E SE TG+ L PC+EAAL+LGC 
Sbjct  61   AEEIMYSKANSEVEYMDLKTLWDRANDAINTIIRREEGSEDTGEFLQPCIEAALHLGCF  119



>ref|XP_008389784.1| PREDICTED: uncharacterized protein LOC103452076 [Malus domestica]
Length=444

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  188  YECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLRAEEIMYSK  367
            YECVRRAWHSD H+P+RGSII +I R V E HS+ TKKN+EWQ KLP VV RAEEIMYSK
Sbjct  33   YECVRRAWHSDRHQPMRGSIIQQIFRVVNEVHSSVTKKNKEWQEKLPXVVFRAEEIMYSK  92

Query  368  ANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            ANSEAEY + DTLWDR NDA++TIIR DE +ETG+ LPPCVEAALNLGC 
Sbjct  93   ANSEAEYMNLDTLWDRANDAVNTIIRRDEGTETGELLPPCVEAALNLGCT  142



>ref|XP_009384142.1| PREDICTED: uncharacterized protein LOC103971756 [Musa acuminata 
subsp. malaccensis]
Length=382

 Score =   179 bits (453),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+PIRGSII  I R   + HS AT+KN+E+Q KLP VVL+
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPIRGSIIQEIFRVANDVHSPATRKNKEFQEKLPFVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY D  TL DRVNDAI TIIR ++ +E+G  L PC+EAALNLGC+
Sbjct  61   AEEIMYSKANSEAEYVDLKTLRDRVNDAIDTIIRKEDGTESGDLLQPCIEAALNLGCI  118



>ref|XP_008445225.1| PREDICTED: uncharacterized protein LOC103488315 isoform X1 [Cucumis 
melo]
Length=393

 Score =   179 bits (453),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+PIRGS+I +I R V+E H+++TKKN+EWQ  LP+VVL+
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPIRGSLIQQIFRVVHEIHNSSTKKNKEWQEVLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVAE  523
            AEEI+YSKA+SEAEY D  TL  R+ DAI+TIIR DES+ETG  L PC+EAALNLGC   
Sbjct  61   AEEILYSKASSEAEYMDFGTLRYRLLDAINTIIRLDESTETGDFLQPCIEAALNLGCTPR  120

Query  524  K  526
            K
Sbjct  121  K  121



>ref|XP_003526402.1| PREDICTED: uncharacterized protein LOC100791147 [Glycine max]
 gb|KHN07073.1| hypothetical protein glysoja_023256 [Glycine soja]
Length=277

 Score =   175 bits (443),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPG +PY+CV+RAWHS+IH+PIRG++I  I R V E H ++TKKN+E+Q KLP+VVLR
Sbjct  1    MPRPGSKPYDCVKRAWHSEIHQPIRGTLIQEIFRVVNEIHGSSTKKNKEYQEKLPVVVLR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVAE  523
            AEEI+YSKANSEAEY D  TL +R NDAI TIIR DE +ETG++L PC+EAAL+LGC   
Sbjct  61   AEEIIYSKANSEAEYMDLKTLLERTNDAIDTIIRRDEHTETGEYLCPCIEAALSLGCSLT  120

Query  524  K  526
            K
Sbjct  121  K  121



>gb|KHG05548.1| Histone acetyltransferase [Gossypium arboreum]
Length=345

 Score =   177 bits (448),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPY   +++WHSD H+PIRGS++  I R V E HS+ATKKN+EWQ KLP+VVL+
Sbjct  1    MPRPGPRPYVFEKKSWHSDGHQPIRGSLVQEIFRVVNEIHSSATKKNKEWQEKLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVAE  523
            AEEIMYSKANSEAEY D  TL DR NDAI+TIIR +ES+ETG+ L PC+EAALNLGC A 
Sbjct  61   AEEIMYSKANSEAEYMDLKTLRDRTNDAINTIIRRNESTETGKVLQPCIEAALNLGCTAR  120

Query  524  K  526
            +
Sbjct  121  R  121



>ref|XP_009774219.1| PREDICTED: uncharacterized protein LOC104224298 [Nicotiana sylvestris]
Length=381

 Score =   177 bits (449),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 98/119 (82%), Gaps = 2/119 (2%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M +PGPRPYECVR+AWHSD H+PIRGS+I  I R V E H +ATKKN+EWQ KLPIVVLR
Sbjct  1    MPKPGPRPYECVRKAWHSDRHQPIRGSLIQEIFRIVNEIHGSATKKNKEWQEKLPIVVLR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDES--SETGQHLPPCVEAALNLGC  514
            AEEI+YSKANSEAEY D  TLWDR++DAI T+IR D+S  SE+   L PC+EAAL+LGC
Sbjct  61   AEEILYSKANSEAEYMDLKTLWDRLSDAIDTVIRRDDSTESESRDLLQPCIEAALHLGC  119



>ref|XP_010922409.1| PREDICTED: uncharacterized protein LOC105045704 [Elaeis guineensis]
Length=457

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHS+ H+PIRGS+I  I R   E HS AT++N+EWQ KLP VVL+
Sbjct  1    MPRPGPRPYECVRRAWHSERHQPIRGSLIQEIFRVANEIHSPATRRNKEWQEKLPFVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY D  TL DR NDAI TIIR DE++E+G  L PC+EAALNLGC+
Sbjct  61   AEEIMYSKANSEAEYMDLKTLRDRANDAIDTIIRKDETTESGDLLQPCIEAALNLGCI  118



>ref|XP_009621783.1| PREDICTED: uncharacterized protein LOC104113357 [Nicotiana tomentosiformis]
Length=381

 Score =   177 bits (449),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 97/119 (82%), Gaps = 2/119 (2%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M +PGPRPYECVR+AWHSD H+PIRGS+I  I R V E H +ATKKN+EWQ KLPIVVLR
Sbjct  1    MPKPGPRPYECVRKAWHSDRHQPIRGSLIQEIFRIVNEIHGSATKKNKEWQEKLPIVVLR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDES--SETGQHLPPCVEAALNLGC  514
            AEEI+YSKANSEAEY D  TLWDR+ DAI TIIR D+S  SE+   L PC+EAAL+LGC
Sbjct  61   AEEILYSKANSEAEYMDLKTLWDRLRDAIDTIIRRDDSTESESRDLLQPCIEAALHLGC  119



>ref|XP_008779015.1| PREDICTED: uncharacterized protein LOC103698748 isoform X1 [Phoenix 
dactylifera]
Length=471

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHS+ H+P+RGS+I  I R   E HS  T+KN+EWQ KLP VVL+
Sbjct  1    MPRPGPRPYECVRRAWHSERHQPMRGSLIQEIFRVANEVHSPFTRKNKEWQEKLPFVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY D  TL DR NDAI TIIR DE++E+G  L PC+EAALNLGC+
Sbjct  61   AEEIMYSKANSEAEYMDLKTLRDRANDAIDTIIRKDETTESGDLLQPCIEAALNLGCI  118



>ref|XP_009405444.1| PREDICTED: uncharacterized protein LOC103988586 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405445.1| PREDICTED: uncharacterized protein LOC103988586 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405446.1| PREDICTED: uncharacterized protein LOC103988586 [Musa acuminata 
subsp. malaccensis]
Length=378

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+ IRGSII  I R   + HS AT+KN+E+Q KLP VVL+
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQTIRGSIIQEIFRVANDVHSPATRKNKEFQEKLPFVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            AEEIMYSKANSEAEY D  TL DRVNDAI TIIR +++ E+G  L PC+EAALNLGCV
Sbjct  61   AEEIMYSKANSEAEYVDSKTLQDRVNDAIDTIIRKEDALESGDLLQPCIEAALNLGCV  118



>gb|KFK29838.1| hypothetical protein AALP_AA7G185400 [Arabis alpina]
Length=265

 Score =   170 bits (430),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = +2

Query  188  YECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLRAEEIMYSK  367
            Y+C+RRAWHSDIH+P+RG +I  I R V E HS +TKKN EWQ KLP+VVLRAEEIMYSK
Sbjct  11   YDCIRRAWHSDIHQPMRGLLIQEIFRIVCEIHSQSTKKNTEWQEKLPVVVLRAEEIMYSK  70

Query  368  ANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            ANSEAEY D +TL DR NDAI+TIIR DE++ETG+ + PC+EAAL+LGC 
Sbjct  71   ANSEAEYMDMNTLLDRTNDAINTIIRLDETTETGEFIQPCIEAALHLGCT  120



>ref|XP_004138854.1| PREDICTED: uncharacterized protein LOC101207405 [Cucumis sativus]
Length=346

 Score =   171 bits (433),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M R G RPYECVRRAWHSD H+PIRGS+I +I R V+E H+++TKKN+EWQ  LP+VVL+
Sbjct  1    MPRRGSRPYECVRRAWHSDRHQPIRGSLIQQIFRVVHEIHNSSTKKNKEWQEVLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVAE  523
            AEEI+YSKA+SE EY D  TL  R+ DAI+TIIR DES+ETG  L PC+EAALNLGC   
Sbjct  61   AEEILYSKASSEVEYMDFGTLRYRLLDAINTIIRLDESTETGDFLQPCIEAALNLGCTPR  120

Query  524  K  526
            K
Sbjct  121  K  121



>ref|XP_004160792.1| PREDICTED: uncharacterized protein LOC101231818 [Cucumis sativus]
Length=393

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M R G RPYECVRRAWHSD H+PIRGS+I +I R V+E H+++TKKN+EWQ  LP+VVL+
Sbjct  1    MPRRGSRPYECVRRAWHSDRHQPIRGSLIQQIFRVVHEIHNSSTKKNKEWQEVLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVAE  523
            AEEI+YSKA+SE EY D  TL  R+ DAI+TIIR DES+ETG  L PC+EAALNLGC   
Sbjct  61   AEEILYSKASSEVEYMDFGTLRYRLLDAINTIIRLDESTETGDFLQPCIEAALNLGCTPR  120

Query  524  K  526
            K
Sbjct  121  K  121



>ref|XP_008466415.1| PREDICTED: uncharacterized protein LOC103503829 [Cucumis melo]
Length=353

 Score =   169 bits (428),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +2

Query  170  RPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLRAE  349
            R G RP+ECVRRAWHS+ H+PIRGS+I  I R V E H  ATKKN+EWQ KLPIVVL+AE
Sbjct  4    RTGCRPFECVRRAWHSERHQPIRGSLIQEIFRVVSEVHCCATKKNKEWQEKLPIVVLKAE  63

Query  350  EIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            EI+YSKA+SEAEY D  TLW R+N+AI+TIIR D+ +ETG+ L PC+EAAL LGC 
Sbjct  64   EILYSKADSEAEYMDVTTLWTRINEAINTIIRLDKDAETGEFLHPCIEAALYLGCT  119



>gb|KGN60097.1| hypothetical protein Csa_3G878170 [Cucumis sativus]
Length=355

 Score =   168 bits (426),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +2

Query  170  RPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLRAE  349
            R G RP+ECVRRAWHS+ H+PIRGS+I  I R V E H  ATKKN+EWQ KLPIVVL+AE
Sbjct  4    RTGCRPFECVRRAWHSERHQPIRGSLIQEIFRVVSEVHCCATKKNKEWQEKLPIVVLKAE  63

Query  350  EIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            EI+YSKA+SEAEY D  TLW R+N+AI+TIIR D+ +ETG+ L PC+EAAL LGC 
Sbjct  64   EILYSKADSEAEYMDVTTLWTRINEAINTIIRLDKDAETGEFLHPCIEAALYLGCT  119



>ref|XP_006578142.1| PREDICTED: uncharacterized protein LOC100803816 isoform X2 [Glycine 
max]
Length=264

 Score =   166 bits (420),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGP+PY+CV+RAWHS+IH+PIRG++I  I R V E H ++TKKN+E+Q KLP+VVLR
Sbjct  1    MPRPGPKPYDCVKRAWHSEIHQPIRGTLIQEIFRVVNEIHGSSTKKNKEYQEKLPVVVLR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAA  499
            AEEI+YSKANSEAEY D  TL +R NDAI TIIR DE +ETG++L PC+EA 
Sbjct  61   AEEIIYSKANSEAEYMDLTTLLERTNDAIDTIIRRDEHTETGEYLRPCIEAT  112



>emb|CDX68833.1| BnaC01g06200D [Brassica napus]
Length=258

 Score =   165 bits (417),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +2

Query  188  YECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLRAEEIMYSK  367
            YEC+RR WHSD H+PIRG +I  I R V E HS +TKKN EWQ KLP+VVLRAEEIMYSK
Sbjct  13   YECIRRVWHSDRHQPIRGLLIQEIFRIVCEIHSQSTKKNTEWQEKLPVVVLRAEEIMYSK  72

Query  368  ANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            ANSEAEY D +TL DR N+AI+TIIR DE++E G+ L PC+EAAL+LGC 
Sbjct  73   ANSEAEYMDMNTLLDRTNEAINTIIRLDETTEKGEFLQPCIEAALHLGCT  122



>ref|XP_010451087.1| PREDICTED: uncharacterized protein LOC104733182 [Camelina sativa]
Length=200

 Score =   162 bits (409),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPY+C+RRAWHSD H+P+RG +I  I R V E HS +TKKN EWQ KLP+VVLR
Sbjct  1    MPRPGPRPYDCIRRAWHSDRHQPMRGLLIQEIFRIVCEIHSQSTKKNTEWQEKLPVVVLR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPP  484
            AEEIMYSKANSEAEY D  TL DR N+AI+TIIR DE++ETG++L P
Sbjct  61   AEEIMYSKANSEAEYMDLKTLLDRTNEAINTIIRLDETTETGEYLQP  107



>ref|XP_007137014.1| hypothetical protein PHAVU_009G092700g [Phaseolus vulgaris]
 gb|ESW09008.1| hypothetical protein PHAVU_009G092700g [Phaseolus vulgaris]
Length=297

 Score =   164 bits (414),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M R  P+PY+CVRRAWH+ IH+ IRG++I  I R V E HS++TKK +E+Q KLP+VVLR
Sbjct  1    MPRSAPKPYDCVRRAWHTHIHQSIRGTLIQEIFRVVNEIHSSSTKKKKEYQEKLPVVVLR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVAE  523
            AEEI+YSKANSE EY D  TL DR N AI TIIR DE ++TG++L PC+EAAL+LGC   
Sbjct  61   AEEIIYSKANSEVEYMDLATLLDRTNAAIDTIIRCDEHTQTGEYLRPCIEAALSLGCSLT  120

Query  524  K  526
            K
Sbjct  121  K  121



>ref|XP_008445226.1| PREDICTED: uncharacterized protein LOC103488315 isoform X2 [Cucumis 
melo]
Length=388

 Score =   163 bits (412),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 95/121 (79%), Gaps = 5/121 (4%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECVRRAWHSD H+PIRGS+I +I R V+E H+++TKKN+EWQ  LP+VVL+
Sbjct  1    MPRPGPRPYECVRRAWHSDRHQPIRGSLIQQIFRVVHEIHNSSTKKNKEWQEVLPVVVLK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVAE  523
            AEEI+YSKA+SEAEY D  TL  R+ DAI+TIIR DES+ETG  L PC+E     GC   
Sbjct  61   AEEILYSKASSEAEYMDFGTLRYRLLDAINTIIRLDESTETGDFLQPCIE-----GCTPR  115

Query  524  K  526
            K
Sbjct  116  K  116



>ref|XP_004245316.1| PREDICTED: uncharacterized protein LOC101252800 [Solanum lycopersicum]
Length=339

 Score =   156 bits (394),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 86/112 (77%), Gaps = 4/112 (4%)
 Frame = +2

Query  182  RPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLRAEEIMY  361
            R YECVR+AWHSD H+PIRGS I  I R V E H +ATKKN EWQ KLPIVV RAEEIMY
Sbjct  6    RAYECVRKAWHSDRHQPIRGSFIQEIFRIVNEVHGSATKKNMEWQEKLPIVVFRAEEIMY  65

Query  362  SKANSEAEYADPDTLWDRVNDAISTIIR---SDESSETGQHLPPCVEAALNL  508
            SKANSEAEY D  TLWDR+NDAI TIIR    DES+  G  L PC+EAAL+L
Sbjct  66   SKANSEAEYMDLKTLWDRLNDAIDTIIRREYKDESNSRGL-LQPCIEAALHL  116



>ref|XP_006343528.1| PREDICTED: uncharacterized protein LOC102603247 [Solanum tuberosum]
Length=355

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 85/112 (76%), Gaps = 4/112 (4%)
 Frame = +2

Query  182  RPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLRAEEIMY  361
            R YECV++AWHSD H+PIRGS I  I R V E H +ATKKN EWQ KLPIVV RAEEIMY
Sbjct  6    RAYECVKKAWHSDTHQPIRGSFIQEIFRIVNEVHGSATKKNMEWQEKLPIVVFRAEEIMY  65

Query  362  SKANSEAEYADPDTLWDRVNDAISTIIR---SDESSETGQHLPPCVEAALNL  508
            SKANSEAEY D  TLWDR+NDAI TIIR    DES   G  L PC+EAAL+L
Sbjct  66   SKANSEAEYMDLKTLWDRLNDAIDTIIRREYKDESKSRGL-LQPCIEAALHL  116



>ref|XP_002961523.1| hypothetical protein SELMODRAFT_437855 [Selaginella moellendorffii]
 gb|EFJ36783.1| hypothetical protein SELMODRAFT_437855 [Selaginella moellendorffii]
Length=522

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 90/124 (73%), Gaps = 6/124 (5%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYEC+RRAWHS+ H+ +RGS+   I R V E H   T+  +EWQ KLPIVVLR
Sbjct  1    MPRPGPRPYECIRRAWHSESHQALRGSLTQEIFRIVTEFHRPDTRGKKEWQEKLPIVVLR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTII------RSDESSETGQHLPPCVEAALN  505
            AEEI+YSKA +EAEYAD  TL +R++DA++T+I      R  E++  G  + PCVEAAL+
Sbjct  61   AEEILYSKARTEAEYADASTLKERLDDAVNTMIRRTDENRDQEAAGDGPFMEPCVEAALS  120

Query  506  LGCV  517
            LGC 
Sbjct  121  LGCA  124



>ref|XP_002971290.1| hypothetical protein SELMODRAFT_441416 [Selaginella moellendorffii]
 gb|EFJ27888.1| hypothetical protein SELMODRAFT_441416 [Selaginella moellendorffii]
Length=575

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 90/124 (73%), Gaps = 6/124 (5%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYEC+RRAWHS+ H+ +RGS+   I R V E H   T+  +EWQ KLPIVVLR
Sbjct  1    MPRPGPRPYECIRRAWHSESHQALRGSLTQEIFRIVTEFHRPDTRGKKEWQEKLPIVVLR  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTII------RSDESSETGQHLPPCVEAALN  505
            AEEI+YSKA +EAEYAD  TL +R++DA++T+I      R  E++  G  + PCVEAAL+
Sbjct  61   AEEILYSKARTEAEYADASTLKERLDDAVNTMIRRTDENRDQEAAGDGPFMEPCVEAALS  120

Query  506  LGCV  517
            LGC 
Sbjct  121  LGCA  124



>gb|KGN62956.1| hypothetical protein Csa_2G381810 [Cucumis sativus]
Length=385

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +2

Query  206  AWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLRAEEIMYSKANSEAE  385
            AWHSD H+PIRGS+I +I R V+E H+++TKKN+EWQ  LP+VVL+AEEI+YSKA+SE E
Sbjct  7    AWHSDRHQPIRGSLIQQIFRVVHEIHNSSTKKNKEWQEVLPVVVLKAEEILYSKASSEVE  66

Query  386  YADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVAEK  526
            Y D  TL  R+ DAI+TIIR DES+ETG  L PC+EAALNLGC   K
Sbjct  67   YMDFGTLRYRLLDAINTIIRLDESTETGDFLQPCIEAALNLGCTPSK  113



>ref|XP_004136479.1| PREDICTED: uncharacterized protein LOC101219225 [Cucumis sativus]
Length=363

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +2

Query  224  HKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLRAEEIMYSKANSEAEYADPDT  403
            H+PIRGS+I  I R V E H  ATKKN+EWQ KLPIVVL+AEEI+YSKA+SEAEY D  T
Sbjct  20   HQPIRGSLIQEIFRVVSEVHCCATKKNKEWQEKLPIVVLKAEEILYSKADSEAEYMDVTT  79

Query  404  LWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            LW R+N+AI+TIIR D+ +ETG+ L PC+EAAL LGC 
Sbjct  80   LWTRINEAINTIIRLDKDAETGEFLHPCIEAALYLGCT  117



>dbj|BAB01356.1| unnamed protein product [Arabidopsis thaliana]
Length=480

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  266  FVYERHSTATKKNREWQVKLPIVVLRAEEIMYSKANSEAEYADPDTLWDRVNDAISTIIR  445
               E HS AT+KN+EWQ KLP+VVL+AEEIMYSKANSE EY D DT+W+RVNDAI TIIR
Sbjct  135  LAMEAHSAATRKNKEWQEKLPVVVLKAEEIMYSKANSEEEYTDADTMWNRVNDAIDTIIR  194

Query  446  SDESSETGQHLPPCVEAALNLGCVA  520
             DES+ETG  LPPCVEAALNLGC+A
Sbjct  195  RDESTETGPLLPPCVEAALNLGCIA  219



>gb|KJB65832.1| hypothetical protein B456_010G115300, partial [Gossypium raimondii]
Length=360

 Score =   136 bits (342),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +2

Query  257  ILRFVYERHSTATKKNREWQVKLPIVVLRAEEIMYSKANSEAEYADPDTLWDRVNDAIST  436
              R V E H +ATKKN+EWQ KLPIVVL+AEEIMYSKANSEAEY D  TLWDR NDAI+T
Sbjct  4    FFRVVNEIHCSATKKNKEWQEKLPIVVLKAEEIMYSKANSEAEYMDLKTLWDRTNDAINT  63

Query  437  IIRSDESSETGQHLPPCVEAALNLGCV  517
            IIR DES+ETG+ L PC+EAALNLGC 
Sbjct  64   IIRRDESNETGELLQPCIEAALNLGCT  90



>emb|CDY45344.1| BnaC01g30480D [Brassica napus]
Length=239

 Score =   133 bits (334),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 80/119 (67%), Gaps = 1/119 (1%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M R GPRPYECV+RAWH D H+PIRG II +I R   E HS ATKKN+EWQ KL +VV +
Sbjct  1    MPRLGPRPYECVKRAWHIDRHQPIRGFIIRQIFRLSMEAHSAATKKNKEWQEKLSVVVFK  60

Query  344  AEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVA  520
            A+EIMYSK+NSE        L   V   ++       ++ETG  LPPCVEAALNLGC A
Sbjct  61   ADEIMYSKSNSEVLILT-LVLCVFVYQNLADFGGLTLTTETGPLLPPCVEAALNLGCTA  118



>ref|XP_008779016.1| PREDICTED: uncharacterized protein LOC103698748 isoform X2 [Phoenix 
dactylifera]
Length=455

 Score =   123 bits (308),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = +2

Query  257  ILRFVYERHSTATKKNREWQVKLPIVVLRAEEIMYSKANSEAEYADPDTLWDRVNDAIST  436
            ++R   E HS  T+KN+EWQ KLP VVL+AEEIMYSKANSEAEY D  TL DR NDAI T
Sbjct  16   MVRVANEVHSPFTRKNKEWQEKLPFVVLKAEEIMYSKANSEAEYMDLKTLRDRANDAIDT  75

Query  437  IIRSDESSETGQHLPPCVEAALNLGCV  517
            IIR DE++E+G  L PC+EAALNLGC+
Sbjct  76   IIRKDETTESGDLLQPCIEAALNLGCI  102



>gb|KJB83194.1| hypothetical protein B456_013G234700 [Gossypium raimondii]
Length=113

 Score =   109 bits (273),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = +2

Query  164  MTRPGPRPYECVRRAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLR  343
            M RPGPRPYECV+RAWHS+ H+ IRGS++ +ILR   + HS+ATKKN EW+ K+ IV+++
Sbjct  1    MPRPGPRPYECVKRAWHSETHQLIRGSMVQQILRLAIQTHSSATKKNMEWRDKILIVIVK  60

Query  344  AEEIMYSKANSEAEYA  391
            AEEIMYSKANSE  ++
Sbjct  61   AEEIMYSKANSEIRFS  76



>gb|EYU18251.1| hypothetical protein MIMGU_mgv1a009013mg [Erythranthe guttata]
Length=355

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = +2

Query  296  KKNREWQVKLPIVVLRAEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQH  475
            +K +  +  LPIVVL+AEEIMYSKANSEAEY++ +TLW RVNDA+ TIIR DES+ETG  
Sbjct  9    RKIKNGKRSLPIVVLKAEEIMYSKANSEAEYSNVETLWIRVNDAVDTIIRKDESTETGDL  68

Query  476  LPPCVEAALNLGCV  517
            LPPCVEAALNL CV
Sbjct  69   LPPCVEAALNLACV  82



>gb|KJB64737.1| hypothetical protein B456_010G062400 [Gossypium raimondii]
Length=350

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  356  MYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGC  514
            MYSKANSEAEY +P+TLWDRVNDAI+TIIR DES+ETG+ LPPCVEAALNLGC
Sbjct  1    MYSKANSEAEYTNPETLWDRVNDAINTIIRRDESTETGELLPPCVEAALNLGC  53



>gb|KGN62958.1| hypothetical protein Csa_2G381830 [Cucumis sativus]
Length=343

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +2

Query  323  LPIVVLRAEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAAL  502
            LP+VV +AEEI+YSKANSEAEY D  TL +R+ DAI+TIIR DES+ETG  L PC+EAAL
Sbjct  2    LPVVVFKAEEILYSKANSEAEYMDFSTLQNRLLDAINTIIRLDESTETGDFLQPCIEAAL  61

Query  503  NLGCVAEK  526
            NLGC   K
Sbjct  62   NLGCTPRK  69



>ref|XP_008445231.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103488318 
[Cucumis melo]
Length=343

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +2

Query  323  LPIVVLRAEEIMYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAAL  502
            LP+VVL+AEEI+YSKANSEAEY D  TL +R+ DAI+TIIR DESSETG  L PC+EAAL
Sbjct  2    LPVVVLKAEEILYSKANSEAEYMDFSTLKNRLLDAINTIIRLDESSETGDFLQPCIEAAL  61

Query  503  NLGCVAEK  526
            NL C   K
Sbjct  62   NLXCTPRK  69



>ref|XP_008385411.1| PREDICTED: uncharacterized protein LOC103447962 isoform X1 [Malus 
domestica]
Length=356

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  356  MYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            MYSKANSEAEY + DTLWDR NDA++TIIR DE +ETG+ LPPCVEAALNLGC 
Sbjct  1    MYSKANSEAEYMNLDTLWDRANDAVNTIIRRDEGTETGELLPPCVEAALNLGCT  54



>ref|NP_001078480.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE86037.1| uncharacterized protein AT4G32295 [Arabidopsis thaliana]
Length=174

 Score = 84.7 bits (208),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  356  MYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            MYSKANSEAEY D  TL DR NDAI+TIIR DE++ETG+ L PC+EAAL+LGC 
Sbjct  1    MYSKANSEAEYMDMKTLLDRTNDAINTIIRLDETTETGEFLQPCIEAALHLGCT  54



>ref|XP_010048962.1| PREDICTED: uncharacterized protein LOC104437666 isoform X3 [Eucalyptus 
grandis]
 gb|KCW81391.1| hypothetical protein EUGRSUZ_C02771 [Eucalyptus grandis]
Length=315

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  356  MYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            MYSKANSEAEY D +TL DR NDAI+TIIR DES+ETG  L PC+EAAL LGC 
Sbjct  1    MYSKANSEAEYMDLETLLDRTNDAINTIIRLDESTETGDLLQPCIEAALTLGCT  54



>ref|XP_008385417.1| PREDICTED: uncharacterized protein LOC103447962 isoform X2 [Malus 
domestica]
Length=347

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  356  MYSKANSEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVE  493
            MYSKANSEAEY + DTLWDR NDA++TIIR DE +ETG+ LPPCVE
Sbjct  1    MYSKANSEAEYMNLDTLWDRANDAVNTIIRRDEGTETGELLPPCVE  46



>ref|XP_010656448.1| PREDICTED: uncharacterized protein LOC100250879 isoform X3 [Vitis 
vinifera]
 ref|XP_010656449.1| PREDICTED: uncharacterized protein LOC100250879 isoform X3 [Vitis 
vinifera]
Length=349

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  392  DPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            D  TLWDRVNDA++TIIR DES+ETG+ LPPC+EAALNLGCV
Sbjct  2    DLGTLWDRVNDAVNTIIRRDESTETGELLPPCIEAALNLGCV  43



>ref|XP_008337391.1| PREDICTED: uncharacterized protein LOC103400513, partial [Malus 
domestica]
Length=161

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +2

Query  263  RFVYERHSTATKKNREWQVKLPIVVLRAEEIMYSKANSEAEYADP  397
            R V E HS+ TKKN+EWQ KLP+VV RAEEIMYSKANSEAEY  P
Sbjct  16   RVVNEVHSSVTKKNKEWQEKLPLVVFRAEEIMYSKANSEAEYMLP  60



>ref|XP_006298289.1| hypothetical protein CARUB_v10014354mg [Capsella rubella]
 gb|EOA31187.1| hypothetical protein CARUB_v10014354mg [Capsella rubella]
Length=278

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  404  LWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVA  520
            +W+RVNDAI TIIR DES+ETG  LPPCVEAALNLGC+A
Sbjct  1    MWNRVNDAIDTIIRRDESTETGPLLPPCVEAALNLGCIA  39



>gb|KJB65833.1| hypothetical protein B456_010G115300 [Gossypium raimondii]
Length=313

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  392  DPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            D  TLWDR NDAI+TIIR DES+ETG+ L PC+EAALNLGC 
Sbjct  2    DLKTLWDRTNDAINTIIRRDESNETGELLQPCIEAALNLGCT  43



>ref|XP_010432738.1| PREDICTED: uncharacterized protein LOC104716951 [Camelina sativa]
Length=169

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +2

Query  392  DPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVAEK  526
            D  TL DR N+AI+TIIR DE++ETG++L PC+EAAL+LGC   K
Sbjct  2    DLKTLLDRTNEAINTIIRLDETTETGEYLQPCIEAALHLGCTPRK  46



>ref|XP_010048961.1| PREDICTED: uncharacterized protein LOC104437666 isoform X2 [Eucalyptus 
grandis]
Length=304

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  392  DPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCV  517
            D +TL DR NDAI+TIIR DES+ETG  L PC+EAAL LGC 
Sbjct  2    DLETLLDRTNDAINTIIRLDESTETGDLLQPCIEAALTLGCT  43



>ref|XP_007511391.1| histone acetyltransferase [Bathycoccus prasinos]
 emb|CCO17512.1| histone acetyltransferase [Bathycoccus prasinos]
Length=1263

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 45/80 (56%), Gaps = 4/80 (5%)
 Frame = +2

Query  203  RAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLRAEEIMYSKANSEA  382
            R W SD   P R  +I  ILR   +R  + TK   EWQ KLP  VLR EE +Y  A ++ 
Sbjct  16   RTWQSDEDIPQRKILIQHILRLFQQRKPSVTK---EWQQKLPDFVLRLEEAVYRGARTKE  72

Query  383  EYADPDTLWDRVNDAISTII  442
            EY D DTL  R+  A++ I+
Sbjct  73   EYCDKDTLEARLQ-AVARIM  91



>ref|XP_008445227.1| PREDICTED: uncharacterized protein LOC103488315 isoform X3 [Cucumis 
melo]
Length=318

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +2

Query  392  DPDTLWDRVNDAISTIIRSDESSETGQHLPPCVEAALNLGCVAEK  526
            D  TL  R+ DAI+TIIR DES+ETG  L PC+EAALNLGC   K
Sbjct  2    DFGTLRYRLLDAINTIIRLDESTETGDFLQPCIEAALNLGCTPRK  46



>ref|XP_003060719.1| histone acetyltransferase [Micromonas pusilla CCMP1545]
 gb|EEH55488.1| histone acetyltransferase [Micromonas pusilla CCMP1545]
Length=1272

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 44/80 (55%), Gaps = 4/80 (5%)
 Frame = +2

Query  203  RAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLRAEEIMYSKANSEA  382
            + W SD   P R  +I  IL+   +R  + T   REWQ KLP  VLR EE +Y  A S+ 
Sbjct  28   KTWQSDADIPQRKVLIQHILKLFRQRKPSET---REWQQKLPDFVLRLEEAVYRGARSKE  84

Query  383  EYADPDTLWDRVNDAISTII  442
            EY +  TL  R+  A++ I+
Sbjct  85   EYCNEATLEARLQ-AVARIM  103



>gb|AES80967.2| F-box/RNI superfamily protein, putative [Medicago truncatula]
Length=976

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  257  ILRFVYERHSTATKKNREWQVKLPIVVLRAEEIMYSK  367
            I+  V+E  + ATKKN+EWQ +LP VVL+AEEIM+SK
Sbjct  934  IILVVFEARTPATKKNKEWQEQLPTVVLKAEEIMHSK  970



>emb|CEF97646.1| Zinc finger, PHD-finger [Ostreococcus tauri]
Length=1182

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 45/89 (51%), Gaps = 4/89 (4%)
 Frame = +2

Query  203  RAWHSDIHKPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLRAEEIMYSKANSEA  382
            R W SD   P R  +I  ILR   +R    T    EW+ KLP  VLR EE +Y  A S+ 
Sbjct  23   RTWQSDEDIPQRKILIQHILRVFKQRKPELTN---EWKHKLPDFVLRLEEAVYRGARSKD  79

Query  383  EYADPDTLWDRVNDAISTIIRSDESSETG  469
            EY D  TL  R+  A++ I+   +  + G
Sbjct  80   EYCDKATLEARLQ-AVARIMIQRQGMQQG  107



>ref|XP_003624749.1| hypothetical protein MTR_7g087040 [Medicago truncatula]
Length=968

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  257  ILRFVYERHSTATKKNREWQVKLPIVVLRAEEIMYSK  367
            I+  V+E  + ATKKN+EWQ +LP VVL+AEEIM+SK
Sbjct  926  IILVVFEARTPATKKNKEWQEQLPTVVLKAEEIMHSK  962



>gb|ABK23198.1| unknown [Picea sitchensis]
Length=273

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 54/100 (54%), Gaps = 6/100 (6%)
 Frame = +2

Query  197  VRRAWHSDIH-KPIRGSIIHRILRFVYERHSTATKKNREWQVKLPIVVLRAEEIMYSKAN  373
            +RR+WH+D     +R  II +IL+ ++ RH  +     +WQ +LP  V R EE+++++A 
Sbjct  98   IRRSWHTDTELYAVRKYIIEKILQ-LFNRHPVSP----DWQQQLPNFVRRLEEVLFNEAA  152

Query  374  SEAEYADPDTLWDRVNDAISTIIRSDESSETGQHLPPCVE  493
            S+ EY + + L  R+   +  +  +  S  +    P  V+
Sbjct  153  SQEEYMNLNNLEQRLQSLMRRLTPNGNSVSSQTSNPGGVQ  192



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556507818200